1GSPA

Ribonuclease t1 complexed with 2',3'-cgps, 1 day
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endoribonuclease
molecule keywords RIBONUCLEASE T1
publication title Hydrolysis of a slow cyclic thiophosphate substrate of RNase T1 analyzed by time-resolved crystallography.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gspA00
1ZGXA 3GSPA 1AQZA 1IYYA 1TRPA 3AGNA 2BU4A 1I2EA 3Q3FA 1BIRA 1UCKA 7RNTA 1RGFA 2SARA 3AHSA 4BU4A 1X1XA 1BSEA 2AADA 1BNSA 2C4BA 1JBTA 1PY3A 1UCIA 1BSCA 3SYUA 1I3FA 1GOVA 1RGEA 1A2PA 3AHWA 1BSAA 1X1UA 1GOUA 2F5MA 1R4YA 1JBRA 2RNTA 3DH2A 1BGSA 1I0VA 4J5GA 1LOYA 6RNTA 4GSPA 2ZA4A 1I8VA 3A5EA 1FYSA 1RTUA 1LOVA 3WHOA 3AGOA 1TRQA 1LNIA 9RNTA 1BUJA 1RMSA 4HAAA 4J5KA 1FW7A 1GOYA 1RDSA 2KF6A 1T2HA 1AY7A 3D4AA 1HZ1A 1GMQA 1YVSA 4HOHA 3RNTA 1RGLA 1X1WA 1PYLA 1BRIA 1RN4A 1I0XA 1B20A 1GSPA 1DETA 1I70A 3D5GA 1I3IA 7GSPA 1UCLA 5HOHA 1RLSA 1RSNA 1Q9EA 1SARA 1BNRA 5BIRA 1BSDA 1FUSA 1UCJA 1LRAA 1RGKA 1RGCA 1BANA 1I2FA 3HOHA 1B2UA 1BRKA 1X1YA 2F56A 1I2GA 1B27A 5GSPA 1B2MA 2KF4A 1RNBA 1B2SA 3D5IA 3BIRA 4BIRA 1B2ZA 1BRGA 3BU4A 1BNEA 1C54A 1BNGA 1BRJA 4GHOA 6GSPA 1BOXA 1MGRA 2F5WA 3KCHA 1BVIA 1CH0A 1RN1A 1T2IA 1LOWA 1RGHA 1B2XA 1G02A 1JBSA 1FZUA 2BIRA 1RGAA 3WR2A 1HYFA 1BNFA 1DE3A 1BNJA 3URPA 1MGWA 2AAEA 1YGWA 1FUTA 1BAOA 1BU4A 8RNTA 1BNIA 5RNTA 1B21A 2RBIA 1BRHA 2KAAA 2KF3A 3DGYA 2F4YA 1RHLA 1TTOA 1RGGA 1RCKA 2GSPA 1RCLA 2KF5A 1BRSA 4RNTA 1BRNL 5BU4A 1RNTA 1GMPA 2HOHA 1B3SA 1BSBA 1YNVX 1GMRA
chains in the Genus database with same CATH superfamily
1ZGXA 3GSPA 5I97A 1AQZA 5FW5A 1WQLB 1G96A 4KFFA 3GZYB 3FCSB 1I2EA 4XM4A 4BTYA 1E97A 1EA2A 1OHSA 2A15A 2CFDA 2CKFB 1TJDA 1S5AA 4MEIA 4K61A 2SARA 5DREA 4BU4A 3CCE3 1NWWA 1K734 5FGOA 2D42A 3MKIA 1MWUA 5G2GA 3SXXA 3PXMA 1X1XA 1EUIC 1YGEA 3RGAA 3OV4A 3LZAA 1HU9A 4EXRA 3NX0A 4FCZA 3CPW2 3SYUA 3Q2PA 1I3FA 1J2BA 1A2PA 3GZRA 1BSAA 2XGLA 2XFSA 3BLZA 3HI7A 2O3OA 4NHFA 1GOUA 2F5MA 4OVMA 1R4YA 1NDOB 3CCQ3 3DH2A 1AR0A 4HYZA 1S723 2ZA4A 3WHOA 1D6ZA 4CJNA 1YJW3 3AGOA 2R4IA 3CU3A 1N8QA 1UUVB 9RNTA 1MWSA 2Z6BA 3LTDA 1V57A 1IVXA 1LNHA 1Q42A 2KF6A 1T2HA 5ELJA 1OGZA 3ECFA 3NM7A 3OWSA 1HZ1A 1WMPA 2QEX3 4STDA 1JZOA 5EEOA 4XBYA 4TX4A 1OF5A 1EQKA 1U8CB 2MC8A 2CFLA 1GSPA 3ALAA 3CCM3 1N9EA 4AKZA 4EYCA 4H3UA 3JVCA 4NPBA 4FMCA 3U1WA 2IUKA 3LOYA 4K90B 1UCLA 4GL6A 5HOHA 4RNZA 2UGIA 1QVF2 3E99A 1BNRA 1LVNA 2WO0A 4CCVA 5BIRA 3LTAA 3I553 1FGOA 1FUSA 1MWRA 3RGRA 1DVCA 3F7XA 1GD4A 1RGCA 1STDA 4LEHA 4ZM8A 3ER7A 4MMZB 3IPTA 1YJN3 5IENA 3KIIA 4N6OB 3WMDA 1W2B2 1X1YA 1CQSA 3SVAA 1VQ83 1B27A 1FGRA 3NXJA 2W9PA 4KT3B 2HMMB 2IUJA 3BIRA 1O7HB 4BIRA 1VQ53 2OTJ3 2P05A 1JJ22 3BU4A 1BNEA 4KVHA 1RRHA 1BNGA 3HIGA 1C54A 1IVWA 4GHOA 3UJMA 3SOYA 1D6YA 2ML5A 1UI8A 4N6UA 5IW9A 2PZVA 3KE7A 1RGHA 2B1XB 1G02A 3CNMA 4XDWA 1JBSA 1STFI 1NNVA 2IA7A 3WR2A 1HYFA 5AIIA 1BNFA 2QGUA 5LC7A 1DE3A 3CCL3 1M1K4 4K1UA 3LXUX 2CC3A 1A2VA 2WGOA 3G0KA 3EBTA 3FF2A 1RKYA 4AEQA 3S28A 5JBSA 2UX0A 5RNTA 3SX1A 1ROVA 1BRHA 2KAAA 2W03A 3D9RA 3V98A 2KF3A 3TDGA 3CNXA 1VQ93 3AMOB 5IEOA 2YFIB 1RGGA 1JKGA 1IT8A 1GY6A 2CHCA 3NBBA 1QAFA 1ASKA 3F8XA 1KC84 3FG4A 3EJVA 3MYTA 1M1XB 2KF5A 1BRSA 5D82A 2OTL3 1BRNL 2XRXB 4EC6A 2D1WA 1O7MB 2HMNB 2L1SA 4I5QA 2JQ5A 4HBRA 1KQS2 2RSXA 1N5HA 1YNVX 2J8XB 3K7CA 2K0MA 2P38A 2KRTA 2YX9A 1JNQA 3BNCA 6STDA 1OCVA 4R80A 2OOVA 3AGNA 2XR8B 2F99A 1FGTA 2FXTA 1GYBA 1R4CA 3Q1CA 3LT8A 1BIRA 1UCKA 1OHOA 2P09A 1JRQA 3MSOA 3OX9A 2GU1A 2OQEA 2C11A 4FCJA 4HM4B 5LC6A 2F98A 1Y4KA 4EV5A 2CWTA 3KN4A 5AYRB 1PFPA 4XDVA 1SIHA 2OWPA 1BSCA 1FGQA 5AEUB 3NM2A 4K1VA 3CCJ3 3EHCA 3FGYA 1Q7Y4 1JZDA 3AHWA 4ORLA 2ZHXB 4X2HA 4N6V0 3UNLA 1EKMA 4GB5A 1BUQA 4RZMA 2OOVC 3NQYA 3B4OA 1I0VA 2BMRB 1LOYA 6RNTA 2W56A 1G0TA 4GSPA 4H61A 5KP4A 1RTUA 3OXAA 1LOVA 3V92A 2E2UA 2CW9A 3ZFZA 2B24B 1ZX2A 1LNIA 1YIT3 1RMSA 2GEYA 4HM8B 1WMNA 2KXGA 4R9KA 3DGMA 3IMAB 4J8TA 1O7WB 3GAXA 2CX1A 4FCMA 1AY7A 1OPYA 1GD3A 1GMQA 1YVSA 3KFQC 4OUQA 1N8R4 1M904 3DY5A 3CC43 1RN4A 1B20A 1LQMB 1DETA 2BMQB 7GSPA 3NUVA 2WGQA 1UUGB 4Q53A 3Q90A 1RLSA 2Y73A 1NB5I 4HM7B 1BSDA 2V1LA 1LRAA 1FGMA 4N3VA 1RGKA 3F14A 3G713 1V58A 2CG0A 5AYSC 5CXOA 3O8YA 1JN5B 5IG5A 3MG3A 4KFDA 5GSPA 3UB1A 1KWIA 1AVKA 3KSED 4HM3B 3MG1A 1VQ43 1RNBA 4LGQA 1B2SA 2CIUA 3D5IA 3HX8A 1B2ZA 5M18A 1BRGA 1BRJA 1CEWI 2YFJB 4HM1B 5BXQA 1MGRA 2Z77A 3KCHA 2HMOB 5G1LA 1IQYA 1JV2B 1UUWB 1BVIA 1CH0A 1Q7HA 2GEXA 2RFRA 3PGBA 5IG3A 2YFLB 1MWTA 1U5OA 5CF1A 4N6NB 2RGQA 3STDA 3EBYA 1VZZA 1RN7A 3URPA 1MGWA 3GZBA 1BU4A 3ROBA 4WYKA 1JB5A 3JUNA 3K9MC 2XF3A 3LTBA 1B21A 2BO9B 2RBIA 4NREA 2E2VA 3MWZA 2CFGA 1GS3A 3WODG 1OACA 3X3XA 1DMNA 1RHLA 4R4KA 3S5CA 3J7Yd 3PYJA 4L7KA 3CMA3 2LYXA 3NV0A 1RCKA 3FSDA 1GY5A 1RCLA 5AIGA 2XEPA 4HZ9B 4RNTA 1K41A 7STDA 5BU4A 4KFEA 1O7PB 1GMPA 1B3SA 1IT7A 1W6CA 2BT3A 5IF6A 3ZG0A 3EN1B 1ULJB 5BVBA 3UL6A 4ILFA 5DRVA 3KKGA 1TRPA 3FZWA 2W2CA 1YI23 4XBTA 2R41A 3QK9A 1A67A 3FF0A 3X40A 1JB2A 2FGTA 5JPUA 3EE1A 4IIAA 1IVUA 1RGFA 3AHSA 1UDII 3CPOA 3F40A 4U13A 4WFOA 1KSIA 3WA2X 3WDGB 1UW1A 4EW5A 4HM6B 4WHAA 1E3VA 3DZLA 1W01A 1Q40A 3UL5A 4EV2A 1JBTA 1PY3A 3EF8A 3FG1A 1QVG2 1E3RA 2K3DA 2LQVA 3CCV3 1GOVA 1OF5B 1RGEA 2GBWB 2GU3A 1X1UA 3LMLA 4MMYB 3PCSA 1TUHA 3L0RA 5IEPA 1DMMA 2RNTA 3EX9A 3HZPA 1BGSA 3A76A 1NU3A 4J5GA 4DKIA 5M19A 2IY2A 2W9QA 2Y74A 3FH1A 1VQQA 1ISKA 4G1MB 5CF2A 1UGIA 4HKVB 3N9HA 1SPUA 4LYLB 2QA43 5A0OB 1Q864 1BUJA 3LT9A 3B8LA 4J5KA 1FW7A 2HMKB 4BTXA 1ZO2A 1GOYA 1IU7A 3D4AA 3G6E3 1IV7A 2ZDJA 3MPHA 5ELUA 2M7OA 1O7NB 3NQZA 1I70A 1PU4A 2W6JH 1I3IA 4JRFA 2QIYA 4X2OA 4N6LA 3EC9A 1OHPA 3PCRA 1FUWA 1TU5A 3WA3A 5G1KA 1Q9EA 5IERA 4HZBB 3G16A 1LOXA 4XB5A 1UCJA 1ULIB 3FKAA 2PNCA 2INXA 3G8ZA 3X3ZA 2F86B 1DYUA 3H3HA 3PS8A 3VF1A 1BANA 2OQEC 1B2UA 1BRKA 2Z76A 3SLUA 1W00A 2CWUA 1MNLA 2MF7A 5KP3A 1I2GA 3CXC2 2STDA 4EBGA 2SBLA 3FLJA 2K54A 3D79A 2W04A 3QRDA 3HK4A 1A2KA 2GBXB 1GY7A 1JKGB 2WOHA 2I9WA 2OCTA 1W2ZA 4IPBA 2F5WA 1NB3I 4J9AA 1AV4A 4HM5B 1T2IA 1EG9B 3DUKA 2BIRA 1FZUA 2XH9A 1L5GB 2W0QA 1VQN3 1QALA 2H0GA 3BB9A 3MHEA 2FNQA 5AEWB 1IVVA 2XSOB 1YGWA 1FUTA 4O2HA 4WWUC 1CYVA 4CPKA 1TFOA 3CCS3 1BNIA 3DMCA 3F8HA 5AIHA 3DM8A 3LYGA 4R9LA 3X41A 1IK3A 3CCR3 4KZ1A 3T0UA 3DGYA 4PEJA 3DXOA 1VQM3 3JUMA 4RBNA 4FMBA 3S29A 2ML6A 3JUOA 2BMOB 3IJEB 5CK6A 1YIJ3 3D3LA 4HJLB 3F9SA 1VQL3 3I563 3DGLA 1V74A 1HKXA 1BSBA 3CCU3 1GMRA 1NO3A 2P0XA 1K9M4 2XSHB 1IYYA 3JUQA 5M1AA 2O9UX 4HM0B 2BU4A 3S27A 2W56B 4BL3A 3EN8A 1QAKA 3Q3FA 1AVLA 1T5YA 1TFKA 7RNTA 2H0IA 4RNYA 1VQO3 3B4PA 2XGNA 1US1A 3EB8A 1WNHA 2UUGC 3EQQB 4I4KA 3AMOA 3KSPA 1BSEA 1SJWA 2AADA 1BNSA 1LQGC 1N9JA 2C4BA 2CX0A 2RCDA 2XFTA 3K0ZA 4MJDA 2Q07A 3F7SA 4N6TA 5AI1A 1SQWA 1MOLA 1UCIA 2Z7AA 1NJI4 1IV9A 3KZTA 3SOAA 5STDA 3H51A 3VGNA 3WOFB 1QMAA 1F8NA 1YVBI 4AKYA 1T3BA 2P0MA 1JB4A 1IQ8A 1W02A 1N5PA 3HIIA 2HMLB 1JBRA 2BHMA 4LSOA 1C7HA 4IT7A 1FA3A 3N54B 4XBXA 2IMJA 1I8VA 2CWVA 1WMOA 3A5EA 2CK3H 1FYSA 3ZG5A 3I0YA 2GXFA 1TP6A 4FMDA 1TRQA 5JPPA 3X42A 1CYUA 3OWYA 3X3YA 4HAAA 1RJOA 2HMJB 4JF8A 2CFKA 4FR9A 3OW22 1UI7A 3T8UA 1RDSA 1RRLA 3RDEA 4HOHA 3MG2A 3V99A 4O3VA 3RNTA 1DVDA 1RGLA 1X1WA 3NBJA 1PYLA 4O02B 1BRIA 1I0XA 3D5GA 3VSYA 1M9GA 3CD63 2CH9A 3GWRA 3GZXB 4BTWA 1IQXA 1VQ73 4BL2A 1RSNA 1SARA 3M8CA 4CDLA 4MMXB 5EQLA 3JUPA 1W6GA 3BNEA 1VQP3 2CFWA 1I2FA 3HOHA 4LMIA 4OK0A 1OUNA 4QWTA 2KCDA 1EEJA 2F56A 4WYKB 5EVHA 1B2MA 3BNBA 2KF4A 3NHXA 1KD14 1W6YA 1YHQ3 4L8PA 4N6MA 2E2TA 1ZS7A 1W5ZA 5D83A 1WTHA 1W7CA 3K5TA 2H0HA 2BNGA 3SEDA 1OGXA 5AIFA 3CME3 3NV0B 3NBRA 4L8OA 5CLKA 1BOXA 3U97A 3WOEB 3S67A 6GSPA 1Q824 8CHOA 3PZWA 1A90A 1RN1A 1LOWA 3OWUA 1B2XA 1O7GB 1LXEA 1D6UA 2WOFA 4HVNA 1ROAA 3GRDA 4O8SA 1QJGA 1RGAA 3DGOA 4R1KA 5IG4A 5KP1A 1W4NA 1Q814 3LTCA 1VQ63 1BNJA 1TIJA 1JN5A 3CC73 1K8A4 3K63A 2AAEA 1BAOA 5IG0A 1UGHI 1IDPA 8RNTA 3G4S3 5TGNA 2C10A 4WP5A 2JDIH 5HGRA 3FG3A 2F4YA 1Z1SA 2CG1A 1DMQA 3B7CA 3DGNA 1SIIA 3LH4A 1TTOA 1Q40B 1YJ93 3BNDA 1OH0A 5D81A 1VQK3 3T8NA 2GSPA 4LZIA 2L4VA 2ZL8A 3N8BA 1RNTA 3CC23 2HOHA 2IYJA 4HM2B 4FMAA 1K28A
chains in the Genus database with same CATH topology
1ZGXA 3GSPA 1AQZA 1IYYA 1TRPA 3AGNA 2BU4A 1I2EA 3Q3FA 1BIRA 1UCKA 7RNTA 1RGFA 2SARA 3AHSA 4BU4A 1X1XA 1BSEA 2AADA 1BNSA 2C4BA 1JBTA 1PY3A 1UCIA 1BSCA 3SYUA 1I3FA 1GOVA 1RGEA 1A2PA 3AHWA 1BSAA 1X1UA 1GOUA 2F5MA 1R4YA 1JBRA 2RNTA 3DH2A 1BGSA 1I0VA 4J5GA 1LOYA 6RNTA 4GSPA 2ZA4A 1I8VA 3A5EA 1FYSA 1RTUA 1LOVA 3WHOA 3AGOA 1TRQA 1LNIA 9RNTA 1BUJA 1RMSA 4HAAA 4J5KA 1FW7A 1GOYA 1RDSA 2KF6A 1T2HA 1AY7A 3D4AA 1HZ1A 1GMQA 1YVSA 4HOHA 3RNTA 1RGLA 1X1WA 1PYLA 1BRIA 1RN4A 1I0XA 1B20A 1GSPA 1DETA 1I70A 3D5GA 1I3IA 7GSPA 1UCLA 5HOHA 1RLSA 1RSNA 1Q9EA 1SARA 1BNRA 5BIRA 1BSDA 1FUSA 1UCJA 1LRAA 1RGKA 1RGCA 1BANA 1I2FA 3HOHA 1B2UA 1BRKA 1X1YA 2F56A 1I2GA 1B27A 5GSPA 1B2MA 2KF4A 1RNBA 1B2SA 3D5IA 3BIRA 4BIRA 1B2ZA 1BRGA 3BU4A 1BNEA 1C54A 1BNGA 1BRJA 4GHOA 6GSPA 1BOXA 1MGRA 2F5WA 3KCHA 1BVIA 1CH0A 1RN1A 1T2IA 1LOWA 1RGHA 1B2XA 1G02A 1JBSA 1FZUA 2BIRA 1RGAA 3WR2A 1HYFA 1BNFA 1DE3A 1BNJA 3URPA 1MGWA 2AAEA 1YGWA 1FUTA 1BAOA 1BU4A 8RNTA 1BNIA 5RNTA 1B21A 2RBIA 1BRHA 2KAAA 2KF3A 3DGYA 2F4YA 1RHLA 1TTOA 1RGGA 1RCKA 2GSPA 1RCLA 2KF5A 1BRSA 4RNTA 1BRNL 5BU4A 1RNTA 1GMPA 2HOHA 1B3SA 1BSBA 1YNVX 1GMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZGX A;  3GSP A;  1AQZ A;  1IYY A;  1TRP A;  3AGN A;  2BU4 A;  1I2E A;  3Q3F A;  1BIR A;  1UCK A;  7RNT A;  1RGF A;  2SAR A;  3AHS A;  4BU4 A;  1X1X A;  1BSE A;  2AAD A;  1BNS A;  2C4B A;  1JBT A;  1PY3 A;  1UCI A;  1BSC A;  3SYU A;  1I3F A;  1GOV A;  1RGE A;  1A2P A;  3AHW A;  1BSA A;  1X1U A;  1GOU A;  2F5M A;  1R4Y A;  1JBR A;  2RNT A;  3DH2 A;  1BGS A;  1I0V A;  4J5G A;  1LOY A;  6RNT A;  4GSP A;  2ZA4 A;  1I8V A;  3A5E A;  1FYS A;  1RTU A;  1LOV A;  3WHO A;  3AGO A;  1TRQ A;  1LNI A;  9RNT A;  1BUJ A;  1RMS A;  4HAA A;  4J5K A;  1FW7 A;  1GOY A;  1RDS A;  2KF6 A;  1T2H A;  1AY7 A;  3D4A A;  1HZ1 A;  1GMQ A;  1YVS A;  4HOH A;  3RNT A;  1RGL A;  1X1W A;  1PYL A;  1BRI A;  1RN4 A;  1I0X A;  1B20 A;  1GSP A;  1DET A;  1I70 A;  3D5G A;  1I3I A;  7GSP A;  1UCL A;  5HOH A;  1RLS A;  1RSN A;  1Q9E A;  1SAR A;  1BNR A;  5BIR A;  1BSD A;  1FUS A;  1UCJ A;  1LRA A;  1RGK A;  1RGC A;  1BAN A;  1I2F A;  3HOH A;  1B2U A;  1BRK A;  1X1Y A;  2F56 A;  1I2G A;  1B27 A;  5GSP A;  1B2M A;  2KF4 A;  1RNB A;  1B2S A;  3D5I A;  3BIR A;  4BIR A;  1B2Z A;  1BRG A;  3BU4 A;  1BNE A;  1C54 A;  1BNG A;  1BRJ A;  4GHO A;  6GSP A;  1BOX A;  1MGR A;  2F5W A;  3KCH A;  1BVI A;  1CH0 A;  1RN1 A;  1T2I A;  1LOW A;  1RGH A;  1B2X A;  1G02 A;  1JBS A;  1FZU A;  2BIR A;  1RGA A;  3WR2 A;  1HYF A;  1BNF A;  1DE3 A;  1BNJ A;  3URP A;  1MGW A;  2AAE A;  1YGW A;  1FUT A;  1BAO A;  1BU4 A;  8RNT A;  1BNI A;  5RNT A;  1B21 A;  2RBI A;  1BRH A;  2KAA A;  2KF3 A;  3DGY A;  2F4Y A;  1RHL A;  1TTO A;  1RGG A;  1RCK A;  2GSP A;  1RCL A;  2KF5 A;  1BRS A;  4RNT A;  1BRN L;  5BU4 A;  1RNT A;  1GMP A;  2HOH A;  1B3S A;  1BSB A;  1YNV X;  1GMR A; 
#chains in the Genus database with same CATH topology
 1ZGX A;  3GSP A;  5I97 A;  1AQZ A;  5FW5 A;  1WQL B;  1G96 A;  4KFF A;  3GZY B;  3FCS B;  1I2E A;  4XM4 A;  4BTY A;  1E97 A;  1EA2 A;  1OHS A;  2A15 A;  2CFD A;  2CKF B;  1TJD A;  1S5A A;  4MEI A;  4K61 A;  2SAR A;  5DRE A;  4BU4 A;  3CCE 3;  1NWW A;  1K73 4;  5FGO A;  2D42 A;  3MKI A;  1MWU A;  5G2G A;  3SXX A;  3PXM A;  1X1X A;  1EUI C;  1YGE A;  3RGA A;  3OV4 A;  3LZA A;  1HU9 A;  4EXR A;  3NX0 A;  4FCZ A;  3CPW 2;  3SYU A;  3Q2P A;  1I3F A;  1J2B A;  1A2P A;  3GZR A;  1BSA A;  2XGL A;  2XFS A;  3BLZ A;  3HI7 A;  2O3O A;  4NHF A;  1GOU A;  2F5M A;  4OVM A;  1R4Y A;  1NDO B;  3CCQ 3;  3DH2 A;  1AR0 A;  4HYZ A;  1S72 3;  2ZA4 A;  3WHO A;  1D6Z A;  4CJN A;  1YJW 3;  3AGO A;  2R4I A;  3CU3 A;  1N8Q A;  1UUV B;  9RNT A;  1MWS A;  2Z6B A;  3LTD A;  1V57 A;  1IVX A;  1LNH A;  1Q42 A;  2KF6 A;  1T2H A;  5ELJ A;  1OGZ A;  3ECF A;  3NM7 A;  3OWS A;  1HZ1 A;  1WMP A;  2QEX 3;  4STD A;  1JZO A;  5EEO A;  4XBY A;  4TX4 A;  1OF5 A;  1EQK A;  1U8C B;  2MC8 A;  2CFL A;  1GSP A;  3ALA A;  3CCM 3;  1N9E A;  4AKZ A;  4EYC A;  4H3U A;  3JVC A;  4NPB A;  4FMC A;  3U1W A;  2IUK A;  3LOY A;  4K90 B;  1UCL A;  4GL6 A;  5HOH A;  4RNZ A;  2UGI A;  1QVF 2;  3E99 A;  1BNR A;  1LVN A;  2WO0 A;  4CCV A;  5BIR A;  3LTA A;  3I55 3;  1FGO A;  1FUS A;  1MWR A;  3RGR A;  1DVC A;  3F7X A;  1GD4 A;  1RGC A;  1STD A;  4LEH A;  4ZM8 A;  3ER7 A;  4MMZ B;  3IPT A;  1YJN 3;  5IEN A;  3KII A;  4N6O B;  3WMD A;  1W2B 2;  1X1Y A;  1CQS A;  3SVA A;  1VQ8 3;  1B27 A;  1FGR A;  3NXJ A;  2W9P A;  4KT3 B;  2HMM B;  2IUJ A;  3BIR A;  1O7H B;  4BIR A;  1VQ5 3;  2OTJ 3;  2P05 A;  1JJ2 2;  3BU4 A;  1BNE A;  4KVH A;  1RRH A;  1BNG A;  3HIG A;  1C54 A;  1IVW A;  4GHO A;  3UJM A;  3SOY A;  1D6Y A;  2ML5 A;  1UI8 A;  4N6U A;  5IW9 A;  2PZV A;  3KE7 A;  1RGH A;  2B1X B;  1G02 A;  3CNM A;  4XDW A;  1JBS A;  1STF I;  1NNV A;  2IA7 A;  3WR2 A;  1HYF A;  5AII A;  1BNF A;  2QGU A;  5LC7 A;  1DE3 A;  3CCL 3;  1M1K 4;  4K1U A;  3LXU X;  2CC3 A;  1A2V A;  2WGO A;  3G0K A;  3EBT A;  3FF2 A;  1RKY A;  4AEQ A;  3S28 A;  5JBS A;  2UX0 A;  5RNT A;  3SX1 A;  1ROV A;  1BRH A;  2KAA A;  2W03 A;  3D9R A;  3V98 A;  2KF3 A;  3TDG A;  3CNX A;  1VQ9 3;  3AMO B;  5IEO A;  2YFI B;  1RGG A;  1JKG A;  1IT8 A;  1GY6 A;  2CHC A;  3NBB A;  1QAF A;  1ASK A;  3F8X A;  1KC8 4;  3FG4 A;  3EJV A;  3MYT A;  1M1X B;  2KF5 A;  1BRS A;  5D82 A;  2OTL 3;  1BRN L;  2XRX B;  4EC6 A;  2D1W A;  1O7M B;  2HMN B;  2L1S A;  4I5Q A;  2JQ5 A;  4HBR A;  1KQS 2;  2RSX A;  1N5H A;  1YNV X;  2J8X B;  3K7C A;  2K0M A;  2P38 A;  2KRT A;  2YX9 A;  1JNQ A;  3BNC A;  6STD A;  1OCV A;  4R80 A;  2OOV A;  3AGN A;  2XR8 B;  2F99 A;  1FGT A;  2FXT A;  1GYB A;  1R4C A;  3Q1C A;  3LT8 A;  1BIR A;  1UCK A;  1OHO A;  2P09 A;  1JRQ A;  3MSO A;  3OX9 A;  2GU1 A;  2OQE A;  2C11 A;  4FCJ A;  4HM4 B;  5LC6 A;  2F98 A;  1Y4K A;  4EV5 A;  2CWT A;  3KN4 A;  5AYR B;  1PFP A;  4XDV A;  1SIH A;  2OWP A;  1BSC A;  1FGQ A;  5AEU B;  3NM2 A;  4K1V A;  3CCJ 3;  3EHC A;  3FGY A;  1Q7Y 4;  1JZD A;  3AHW A;  4ORL A;  2ZHX B;  4X2H A;  4N6V 0;  3UNL A;  1EKM A;  4GB5 A;  1BUQ A;  4RZM A;  2OOV C;  3NQY A;  3B4O A;  1I0V A;  2BMR B;  1LOY A;  6RNT A;  2W56 A;  1G0T A;  4GSP A;  4H61 A;  5KP4 A;  1RTU A;  3OXA A;  1LOV A;  3V92 A;  2E2U A;  2CW9 A;  3ZFZ A;  2B24 B;  1ZX2 A;  1LNI A;  1YIT 3;  1RMS A;  2GEY A;  4HM8 B;  1WMN A;  2KXG A;  4R9K A;  3DGM A;  3IMA B;  4J8T A;  1O7W B;  3GAX A;  2CX1 A;  4FCM A;  1AY7 A;  1OPY A;  1GD3 A;  1GMQ A;  1YVS A;  3KFQ C;  4OUQ A;  1N8R 4;  1M90 4;  3DY5 A;  3CC4 3;  1RN4 A;  1B20 A;  1LQM B;  1DET A;  2BMQ B;  7GSP A;  3NUV A;  2WGQ A;  1UUG B;  4Q53 A;  3Q90 A;  1RLS A;  2Y73 A;  1NB5 I;  4HM7 B;  1BSD A;  2V1L A;  1LRA A;  1FGM A;  4N3V A;  1RGK A;  3F14 A;  3G71 3;  1V58 A;  2CG0 A;  5AYS C;  5CXO A;  3O8Y A;  1JN5 B;  5IG5 A;  3MG3 A;  4KFD A;  5GSP A;  3UB1 A;  1KWI A;  1AVK A;  3KSE D;  4HM3 B;  3MG1 A;  1VQ4 3;  1RNB A;  4LGQ A;  1B2S A;  2CIU A;  3D5I A;  3HX8 A;  1B2Z A;  5M18 A;  1BRG A;  1BRJ A;  1CEW I;  2YFJ B;  4HM1 B;  5BXQ A;  1MGR A;  2Z77 A;  3KCH A;  2HMO B;  5G1L A;  1IQY A;  1JV2 B;  1UUW B;  1BVI A;  1CH0 A;  1Q7H A;  2GEX A;  2RFR A;  3PGB A;  5IG3 A;  2YFL B;  1MWT A;  1U5O A;  5CF1 A;  4N6N B;  2RGQ A;  3STD A;  3EBY A;  1VZZ A;  1RN7 A;  3URP A;  1MGW A;  3GZB A;  1BU4 A;  3ROB A;  4WYK A;  1JB5 A;  3JUN A;  3K9M C;  2XF3 A;  3LTB A;  1B21 A;  2BO9 B;  2RBI A;  4NRE A;  2E2V A;  3MWZ A;  2CFG A;  1GS3 A;  3WOD G;  1OAC A;  3X3X A;  1DMN A;  1RHL A;  4R4K A;  3S5C A;  3J7Y d;  3PYJ A;  4L7K A;  3CMA 3;  2LYX A;  3NV0 A;  1RCK A;  3FSD A;  1GY5 A;  1RCL A;  5AIG A;  2XEP A;  4HZ9 B;  4RNT A;  1K41 A;  7STD A;  5BU4 A;  4KFE A;  1O7P B;  1GMP A;  1B3S A;  1IT7 A;  1W6C A;  2BT3 A;  5IF6 A;  3ZG0 A;  3EN1 B;  1ULJ B;  5BVB A;  3UL6 A;  4ILF A;  5DRV A;  3KKG A;  1TRP A;  3FZW A;  2W2C A;  1YI2 3;  4XBT A;  2R41 A;  3QK9 A;  1A67 A;  3FF0 A;  3X40 A;  1JB2 A;  2FGT A;  5JPU A;  3EE1 A;  4IIA A;  1IVU A;  1RGF A;  3AHS A;  1UDI I;  3CPO A;  3F40 A;  4U13 A;  4WFO A;  1KSI A;  3WA2 X;  3WDG B;  1UW1 A;  4EW5 A;  4HM6 B;  4WHA A;  1E3V A;  3DZL A;  1W01 A;  1Q40 A;  3UL5 A;  4EV2 A;  1JBT A;  1PY3 A;  3EF8 A;  3FG1 A;  1QVG 2;  1E3R A;  2K3D A;  2LQV A;  3CCV 3;  1GOV A;  1OF5 B;  1RGE A;  2GBW B;  2GU3 A;  1X1U A;  3LML A;  4MMY B;  3PCS A;  1TUH A;  3L0R A;  5IEP A;  1DMM A;  2RNT A;  3EX9 A;  3HZP A;  1BGS A;  3A76 A;  1NU3 A;  4J5G A;  4DKI A;  5M19 A;  2IY2 A;  2W9Q A;  2Y74 A;  3FH1 A;  1VQQ A;  1ISK A;  4G1M B;  5CF2 A;  1UGI A;  4HKV B;  3N9H A;  1SPU A;  4LYL B;  2QA4 3;  5A0O B;  1Q86 4;  1BUJ A;  3LT9 A;  3B8L A;  4J5K A;  1FW7 A;  2HMK B;  4BTX A;  1ZO2 A;  1GOY A;  1IU7 A;  3D4A A;  3G6E 3;  1IV7 A;  2ZDJ A;  3MPH A;  5ELU A;  2M7O A;  1O7N B;  3NQZ A;  1I70 A;  1PU4 A;  2W6J H;  1I3I A;  4JRF A;  2QIY A;  4X2O A;  4N6L A;  3EC9 A;  1OHP A;  3PCR A;  1FUW A;  1TU5 A;  3WA3 A;  5G1K A;  1Q9E A;  5IER A;  4HZB B;  3G16 A;  1LOX A;  4XB5 A;  1UCJ A;  1ULI B;  3FKA A;  2PNC A;  2INX A;  3G8Z A;  3X3Z A;  2F86 B;  1DYU A;  3H3H A;  3PS8 A;  3VF1 A;  1BAN A;  2OQE C;  1B2U A;  1BRK A;  2Z76 A;  3SLU A;  1W00 A;  2CWU A;  1MNL A;  2MF7 A;  5KP3 A;  1I2G A;  3CXC 2;  2STD A;  4EBG A;  2SBL A;  3FLJ A;  2K54 A;  3D79 A;  2W04 A;  3QRD A;  3HK4 A;  1A2K A;  2GBX B;  1GY7 A;  1JKG B;  2WOH A;  2I9W A;  2OCT A;  1W2Z A;  4IPB A;  2F5W A;  1NB3 I;  4J9A A;  1AV4 A;  4HM5 B;  1T2I A;  1EG9 B;  3DUK A;  2BIR A;  1FZU A;  2XH9 A;  1L5G B;  2W0Q A;  1VQN 3;  1QAL A;  2H0G A;  3BB9 A;  3MHE A;  2FNQ A;  5AEW B;  1IVV A;  2XSO B;  1YGW A;  1FUT A;  4O2H A;  4WWU C;  1CYV A;  4CPK A;  1TFO A;  3CCS 3;  1BNI A;  3DMC A;  3F8H A;  5AIH A;  3DM8 A;  3LYG A;  4R9L A;  3X41 A;  1IK3 A;  3CCR 3;  4KZ1 A;  3T0U A;  3DGY A;  4PEJ A;  3DXO A;  1VQM 3;  3JUM A;  4RBN A;  4FMB A;  3S29 A;  2ML6 A;  3JUO A;  2BMO B;  3IJE B;  5CK6 A;  1YIJ 3;  3D3L A;  4HJL B;  3F9S A;  1VQL 3;  3I56 3;  3DGL A;  1V74 A;  1HKX A;  1BSB A;  3CCU 3;  1GMR A;  1NO3 A;  2P0X A;  1K9M 4;  2XSH B;  1IYY A;  3JUQ A;  5M1A A;  2O9U X;  4HM0 B;  2BU4 A;  3S27 A;  2W56 B;  4BL3 A;  3EN8 A;  1QAK A;  3Q3F A;  1AVL A;  1T5Y A;  1TFK A;  7RNT A;  2H0I A;  4RNY A;  1VQO 3;  3B4P A;  2XGN A;  1US1 A;  3EB8 A;  1WNH A;  2UUG C;  3EQQ B;  4I4K A;  3AMO A;  3KSP A;  1BSE A;  1SJW A;  2AAD A;  1BNS A;  1LQG C;  1N9J A;  2C4B A;  2CX0 A;  2RCD A;  2XFT A;  3K0Z A;  4MJD A;  2Q07 A;  3F7S A;  4N6T A;  5AI1 A;  1SQW A;  1MOL A;  1UCI A;  2Z7A A;  1NJI 4;  1IV9 A;  3KZT A;  3SOA A;  5STD A;  3H51 A;  3VGN A;  3WOF B;  1QMA A;  1F8N A;  1YVB I;  4AKY A;  1T3B A;  2P0M A;  1JB4 A;  1IQ8 A;  1W02 A;  1N5P A;  3HII A;  2HML B;  1JBR A;  2BHM A;  4LSO A;  1C7H A;  4IT7 A;  1FA3 A;  3N54 B;  4XBX A;  2IMJ A;  1I8V A;  2CWV A;  1WMO A;  3A5E A;  2CK3 H;  1FYS A;  3ZG5 A;  3I0Y A;  2GXF A;  1TP6 A;  4FMD A;  1TRQ A;  5JPP A;  3X42 A;  1CYU A;  3OWY A;  3X3Y A;  4HAA A;  1RJO A;  2HMJ B;  4JF8 A;  2CFK A;  4FR9 A;  3OW2 2;  1UI7 A;  3T8U A;  1RDS A;  1RRL A;  3RDE A;  4HOH A;  3MG2 A;  3V99 A;  4O3V A;  3RNT A;  1DVD A;  1RGL A;  1X1W A;  3NBJ A;  1PYL A;  4O02 B;  1BRI A;  1I0X A;  3D5G A;  3VSY A;  1M9G A;  3CD6 3;  2CH9 A;  3GWR A;  3GZX B;  4BTW A;  1IQX A;  1VQ7 3;  4BL2 A;  1RSN A;  1SAR A;  3M8C A;  4CDL A;  4MMX B;  5EQL A;  3JUP A;  1W6G A;  3BNE A;  1VQP 3;  2CFW A;  1I2F A;  3HOH A;  4LMI A;  4OK0 A;  1OUN A;  4QWT A;  2KCD A;  1EEJ A;  2F56 A;  4WYK B;  5EVH A;  1B2M A;  3BNB A;  2KF4 A;  3NHX A;  1KD1 4;  1W6Y A;  1YHQ 3;  4L8P A;  4N6M A;  2E2T A;  1ZS7 A;  1W5Z A;  5D83 A;  1WTH A;  1W7C A;  3K5T A;  2H0H A;  2BNG A;  3SED A;  1OGX A;  5AIF A;  3CME 3;  3NV0 B;  3NBR A;  4L8O A;  5CLK A;  1BOX A;  3U97 A;  3WOE B;  3S67 A;  6GSP A;  1Q82 4;  8CHO A;  3PZW A;  1A90 A;  1RN1 A;  1LOW A;  3OWU A;  1B2X A;  1O7G B;  1LXE A;  1D6U A;  2WOF A;  4HVN A;  1ROA A;  3GRD A;  4O8S A;  1QJG A;  1RGA A;  3DGO A;  4R1K A;  5IG4 A;  5KP1 A;  1W4N A;  1Q81 4;  3LTC A;  1VQ6 3;  1BNJ A;  1TIJ A;  1JN5 A;  3CC7 3;  1K8A 4;  3K63 A;  2AAE A;  1BAO A;  5IG0 A;  1UGH I;  1IDP A;  8RNT A;  3G4S 3;  5TGN A;  2C10 A;  4WP5 A;  2JDI H;  5HGR A;  3FG3 A;  2F4Y A;  1Z1S A;  2CG1 A;  1DMQ A;  3B7C A;  3DGN A;  1SII A;  3LH4 A;  1TTO A;  1Q40 B;  1YJ9 3;  3BND A;  1OH0 A;  5D81 A;  1VQK 3;  3T8N A;  2GSP A;  4LZI A;  2L4V A;  2ZL8 A;  3N8B A;  1RNT A;  3CC2 3;  2HOH A;  2IYJ A;  4HM2 B;  4FMA A;  1K28 A; 
#chains in the Genus database with same CATH homology
 1ZGX A;  3GSP A;  1AQZ A;  1IYY A;  1TRP A;  3AGN A;  2BU4 A;  1I2E A;  3Q3F A;  1BIR A;  1UCK A;  7RNT A;  1RGF A;  2SAR A;  3AHS A;  4BU4 A;  1X1X A;  1BSE A;  2AAD A;  1BNS A;  2C4B A;  1JBT A;  1PY3 A;  1UCI A;  1BSC A;  3SYU A;  1I3F A;  1GOV A;  1RGE A;  1A2P A;  3AHW A;  1BSA A;  1X1U A;  1GOU A;  2F5M A;  1R4Y A;  1JBR A;  2RNT A;  3DH2 A;  1BGS A;  1I0V A;  4J5G A;  1LOY A;  6RNT A;  4GSP A;  2ZA4 A;  1I8V A;  3A5E A;  1FYS A;  1RTU A;  1LOV A;  3WHO A;  3AGO A;  1TRQ A;  1LNI A;  9RNT A;  1BUJ A;  1RMS A;  4HAA A;  4J5K A;  1FW7 A;  1GOY A;  1RDS A;  2KF6 A;  1T2H A;  1AY7 A;  3D4A A;  1HZ1 A;  1GMQ A;  1YVS A;  4HOH A;  3RNT A;  1RGL A;  1X1W A;  1PYL A;  1BRI A;  1RN4 A;  1I0X A;  1B20 A;  1GSP A;  1DET A;  1I70 A;  3D5G A;  1I3I A;  7GSP A;  1UCL A;  5HOH A;  1RLS A;  1RSN A;  1Q9E A;  1SAR A;  1BNR A;  5BIR A;  1BSD A;  1FUS A;  1UCJ A;  1LRA A;  1RGK A;  1RGC A;  1BAN A;  1I2F A;  3HOH A;  1B2U A;  1BRK A;  1X1Y A;  2F56 A;  1I2G A;  1B27 A;  5GSP A;  1B2M A;  2KF4 A;  1RNB A;  1B2S A;  3D5I A;  3BIR A;  4BIR A;  1B2Z A;  1BRG A;  3BU4 A;  1BNE A;  1C54 A;  1BNG A;  1BRJ A;  4GHO A;  6GSP A;  1BOX A;  1MGR A;  2F5W A;  3KCH A;  1BVI A;  1CH0 A;  1RN1 A;  1T2I A;  1LOW A;  1RGH A;  1B2X A;  1G02 A;  1JBS A;  1FZU A;  2BIR A;  1RGA A;  3WR2 A;  1HYF A;  1BNF A;  1DE3 A;  1BNJ A;  3URP A;  1MGW A;  2AAE A;  1YGW A;  1FUT A;  1BAO A;  1BU4 A;  8RNT A;  1BNI A;  5RNT A;  1B21 A;  2RBI A;  1BRH A;  2KAA A;  2KF3 A;  3DGY A;  2F4Y A;  1RHL A;  1TTO A;  1RGG A;  1RCK A;  2GSP A;  1RCL A;  2KF5 A;  1BRS A;  4RNT A;  1BRN L;  5BU4 A;  1RNT A;  1GMP A;  2HOH A;  1B3S A;  1BSB A;  1YNV X;  1GMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...