3F8HA

Crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
b'NLYFQGMNDTIARYFDAFNAGDTDGMLACLSEDVAHHVNEGNIRVGKEKFAAFCAHMSHCYKEELTDMVIFATPDATRAAAEYTVNGTYLATDEGLPEARQQSYKLPAGSFFDLRDGLITRVTTYYNLSDWIKQVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (YP_611791.1) from SILICIBACTER SP. TM1040 at 2.00 A resolution
rcsb
source organism Silicibacter sp. tm1040
molecule tags Unknown function
total genus 38
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f8hA00
1JN5A 1C7HA 5STDA 5IG5A 4HM4B 2HMMB 1ASKA 3EX9A 5BVBA 1EG9B 2BMRB 5D81A 5D83A 3T8UA 1O7MB 3JUQA 3KKGA 1JKGB 4HKVB 5AIIA 3ROBA 1O7PB 3K0ZA 3DUKA 4ORLA 3MKIA 3EBTA 4U13A 3GZBA 3EBYA 2JQ5A 3Q90A 5BXQA 2BMOB 1O7HB 1W01A 2B24B 2CKFB 5CF2A 4R1KA 1UUVB 1OGXA 3B4OA 1QMAA 4HZ9B 5IEOA 1JB5A 5D82A 3DMCA 5IG4A 3HZPA 2XR8B 3HK4A 3F7XA 3SOAA 1STDA 1W00A 3IPTA 2F98A 3B8LA 3ER7A 3STDA 1OGZA 1E3VA 1WQLB 1OF5B 1ULIB 3KZTA 2HMJB 4OUQA 2XSOB 3FF2A 5AEWB 4WYKA 4HM2B 8CHOA 1Q42A 1HKXA 3F8XA 2RFRA 5AI1A 1IDPA 1NDOB 1Q40A 1OHOA 3OXAA 3DZLA 1A2KA 1JB2A 3S5CA 4HM6B 4K1VA 1VZZA 4WWUC 3OWSA 4FCMA 5JPUA 1JN5B 3H51A 3KSPA 4H3UA 4N3VA 4HM8B 3NV0A 5IERA 3SOYA 2CHCA 1E3RA 2IMJA 3DXOA 3M8CA 4HZBB 1GY5A 1ULJB 2F99A 3NUVA 4J9AA 2GBWB 5HGRA 3F40A 3LYGA 3RGRA 5IF6A 5CXOA 3FGYA 3OWYA 5IG0A 3E99A 3G8ZA 3NXJA 3D9RA 5AEUB 4RZMA 3WMDA 2QIYA 3MYTA 3OV4A 2INXA 3CNMA 5FW5A 3FLJA 5KP4A 2QGUA 2Z76A 3EQQB 3F8HA 4L7KA 4L8PA 4Q53A 4WYKB 3NM2A 1EA2A 1DMNA 3F14A 4HJLB 1Q40B 3BB9A 4XDVA 3GZXB 3SEDA 3VSYA 4OVMA 4LGQA 4LEHA 1ZO2A 4CDLA 4L8OA 3MSOA 3NV0B 3OWUA 3GZYB 3ECFA 4GB5A 1CQSA 1JKGA 3CNXA 1W02A 4HM1B 3EJVA 4HM3B 1UUWB 3GRDA 1OH0A 4PEJA 3JUMA 3CU3A 2HMKB 5IENA 3FH1A 1DMMA 3K7CA 3DM8A 5AIFA 2HMNB 1K41A 1W6YA 1GY6A 1QJGA 4WP5A 4X2HA 3MHEA 5G2GA 3T8NA 1OF5A 2XSHB 5IG3A 3H3HA 3MG1A 1OCVA 2GXFA 3GZRA 5DRVA 3BLZA 1OHSA 1Z1SA 1O7NB 4HM5B 4XBXA 1S5AA 4XDWA 3B7CA 3FF0A 4LMIA 3FZWA 3LZAA 1BUQA 4R9KA 1NWWA 2GBXB 1O7GB 3MG3A 4XBTA 5TGNA 3B4PA 1JB4A 3KE7A 3JUPA 2R4IA 2HMOB 3G16A 1O7WB 1TUHA 3G0KA 1GY7A 5KP1A 2F86B 3EC9A 2I9WA 2GEXA 1OPYA 3UNLA 1NU3A 2OWPA 2B1XB 3EN8A 3F7SA 4IIAA 3JUOA 2RGQA 2YFLB 3UJMA 3EF8A 4XB5A 2YFIB 6STDA 1SJWA 7STDA 3EN1B 2Z7AA 5EVHA 1GYBA 2RCDA 3CPOA 2STDA 2GEYA 5DREA 4R9LA 4KVHA 4I4KA 1E97A 4HVNA 1AR0A 3I0YA 2K54A 3HX8A 2YFJB 3VGNA 2BNGA 5CF1A 5KP3A 4MJDA 3GWRA 1OUNA 3JUNA 2HMLB 4K1UA 1U5OA 4HM7B 2A15A 3A76A 4STDA 2XRXB 5CK6A 4XM4A 2BMQB 2W2CA 3FSDA 1GS3A 3MG2A 1OHPA 3RGAA 5IEPA 5JPPA 1DMQA 3OX9A 4FCJA 3F9SA 4X2OA 4J8TA 1ZX2A 1ISKA 2PZVA 3FKAA 3EHCA 4HM0B 3NBRA 1TP6A 4XBYA 2UX0A 3NHXA 2Z77A 5AIHA 5AIGA 5CLKA
chains in the Genus database with same CATH superfamily
1JN5A 1UUGB 1C7HA 1VQP3 5STDA 2KF4A 3Q2PA 3S29A 5IG5A 4HM4B 3LTAA 3AGNA 4N6V0 2HMMB 5M1AA 1ASKA 3EX9A 2KCDA 1R4CA 1EG9B 1X1WA 2BMRB 2F5MA 5BVBA 1I2FA 1TTOA 5D81A 1VQM3 5D83A 2OQEA 3SLUA 3T8UA 5RNTA 1O7MB 3NX0A 1GMPA 3IMAB 3JUQA 3UB1A 5I97A 1RN1A 1JKGB 3KKGA 2Y74A 4R4KA 5AYRB 3S27A 2C11A 1MGRA 2ZL8A 3ALAA 3IJEB 4HKVB 1DVDA 5AIIA 2XFTA 3KSED 5IW9A 1BNFA 3ROBA 4MEIA 3VF1A 1CEWI 1O7PB 3K0ZA 3DUKA 4ORLA 5GSPA 1G96A 3MKIA 3EBTA 4HOHA 3EB8A 4KFFA 4U13A 3GZBA 3EBYA 2E2TA 1IT7A 1AY7A 4O02B 2JQ5A 3Q90A 5BXQA 1NNVA 1V58A 2BMOB 2CFGA 1BANA 1O7HB 1W01A 2B24B 2CKFB 1RKYA 5CF2A 1QAFA 4R1KA 4RBNA 2OTL3 1UUVB 9RNTA 1W7CA 1OGXA 5LC6A 1BGSA 1EUIC 3B4OA 1QMAA 1JZDA 4HZ9B 1JB5A 5IEOA 1B3SA 5D82A 4EC6A 3KCHA 3DMCA 1VQK3 1RN4A 5IG4A 2XGNA 3HZPA 3CCL3 2CG0A 3G4S3 1K8A4 2XR8B 3LOYA 3LTDA 4BTYA 1RLSA 1IVUA 3HK4A 3NM7A 1Q7Y4 1FGOA 1RRLA 1X1UA 2H0IA 3CCQ3 1NB3I 1W6GA 3F7XA 1QVF2 3SOAA 1STDA 2XH9A 4FMDA 1W00A 3IPTA 2F98A 3U97A 3CMA3 3B8LA 3ER7A 3PGBA 3DGLA 1BRKA 3G713 2XEPA 3STDA 3UL5A 1OGZA 1E3VA 1WQLB 3AHWA 1BRHA 4MMYB 1J2BA 3BNDA 3WA2X 4JF8A 3DGOA 1RRHA 3D79A 1OF5B 1RGFA 1B2SA 3BIRA 3PYJA 1ULIB 4N6NB 1B21A 3KZTA 3O8YA 1M9GA 2QEX3 1S723 2CX0A 2LYXA 2HMJB 2UGIA 2XSOB 2ZA4A 3FF2A 4OUQA 4DKIA 4WYKA 5AEWB 5HOHA 1IVWA 1W6CA 4HM2B 8CHOA 1Q42A 2C10A 2FXTA 1HKXA 2V1LA 1G02A 3CC23 3F8XA 2RFRA 5AI1A 1N8QA 1IDPA 1NDOB 1LOVA 1B2ZA 1VQN3 1Q40A 1OHOA 3OXAA 2SBLA 2W56B 3DZLA 1TU5A 3CCS3 1K734 2SARA 2W04A 1A2KA 1MWSA 1JB2A 3D5GA 3S5CA 3LMLA 4HM6B 4GSPA 2KF5A 4RNZA 4K1VA 1VZZA 3DH2A 4WWUC 5ELUA 2E2VA 4CJNA 3DGYA 2E2UA 3LH4A 3MWZA 3KN4A 3OWSA 4FCMA 5M19A 3CCM3 1QAKA 2Z6BA 2CWTA 3CCR3 5JPUA 3LTCA 1JN5B 3H51A 3KSPA 2KF6A 4H3UA 3FG3A 4N3VA 1V74A 4HM8B 1X1XA 2IUKA 1A2PA 3NV0A 4EBGA 3SOYA 2CHCA 1R4YA 1BIRA 4BU4A 5IERA 3CXC2 1E3RA 3LT8A 1SIHA 2FGTA 2IMJA 1A90A 2KXGA 3CCE3 2RBIA 3DXOA 3M8CA 2Y73A 1T3BA 1HU9A 2QA43 5AIGA 1B2XA 4N6LA 4HZBB 1N9JA 1W5ZA 1NB5I 4EXRA 1UI8A 1RCKA 2C4BA 1EQKA 1KD14 1GY5A 1Y4KA 3LXUX 3S28A 1FUWA 1ULJB 2XF3A 2RNTA 3D5IA 2F99A 1JBRA 3T0UA 2BHMA 3NUVA 4J9AA 1PU4A 2XFSA 2GBWB 1RDSA 4WHAA 3X40A 1N5HA 5HGRA 3F40A 1N5PA 3LYGA 3I563 1RNBA 1IQ8A 3RGRA 5CXOA 5IF6A 1RGAA 3FG4A 3FGYA 3OWYA 5IG0A 3E99A 3G8ZA 7GSPA 1M1K4 3NXJA 4LYLB 1BU4A 3D9RA 5AEUB 4HBRA 5JBSA 2D1WA 4RZMA 3RNTA 1GMRA 3GAXA 3WMDA 1UCIA 1MWRA 2CW9A 2QIYA 3A5EA 2JDIH 1KC84 3MYTA 4FMCA 3OV4A 1I0VA 3DGMA 1RJOA 2O3OA 2INXA 1JNQA 3L0RA 1TFOA 3JVCA 3CNMA 1RTUA 1VQ53 1LQMB 4IT7A 1YGWA 1SQWA 5FW5A 2LQVA 3FLJA 4GHOA 4EYCA 1RN7A 4ZM8A 5KP4A 1DE3A 3CC73 2QGUA 2Z76A 1UI7A 1B27A 3GSPA 1BSBA 4BL3A 4BTWA 1BRGA 1WMOA 3EQQB 3F8HA 2ML6A 2P38A 2AADA 3D4AA 1JRQA 1FGMA 1W2ZA 4L7KA 1LOWA 1LOYA 3KIIA 4L8PA 3V98A 7RNTA 2F5WA 4Q53A 4WYKB 2P05A 1GD4A 1HZ1A 2W9PA 3NM2A 4ILFA 1YIJ3 2CFLA 1MWUA 2CK3H 1K9M4 1VQ73 1EA2A 4N6TA 3WOEB 1FUTA 3QK9A 2W03A 1DMNA 2R41A 3F14A 1LOXA 2OOVC 2OCTA 2CWUA 1YJN3 4HJLB 1I70A 2BIRA 3AMOA 4N6UA 4FCZA 3WR2A 1Q40B 4FMAA 1YHQ3 4GL6A 1VQ43 2F4YA 3BB9A 4AKYA 4XDVA 1VQO3 3GZXB 1PYLA 3SEDA 3WOFB 3VSYA 1MOLA 4MMXB 4OVMA 3SYUA 1WMPA 3N9HA 4LGQA 1IU7A 4QWTA 3SVAA 1LVNA 5G1LA 4LEHA 3AGOA 1KWIA 2P0XA 2BU4A 2W0QA 3WDGB 1ZO2A 1MWTA 1UGIA 5AYSC 2XGLA 3SXXA 4CDLA 4L8OA 1CYUA 1TIJA 2P0MA 3MSOA 3NV0B 4FR9A 3DY5A 3OWUA 5M18A 5FGOA 1IQXA 1MGWA 3GZYB 4CCVA 1BUJA 3ECFA 2MC8A 1SIIA 4GB5A 3CME3 1CQSA 1B20A 1LNIA 1JKGA 5A0OB 3CNXA 1AV4A 3AHSA 1L5GB 1W02A 1UCKA 2J8XB 1I8VA 3CPW2 1RGEA 1RHLA 4HM1B 5LC7A 1TRQA 3EJVA 4HM3B 3LTBA 3V99A 1UUWB 4NPBA 1FGRA 1CH0A 3GRDA 3K9MC 6GSPA 3BNEA 1A67A 1OH0A 4PEJA 3JUMA 2YX9A 1Q7HA 3CU3A 3S67A 1BRNL 3BNBA 1PFPA 2KRTA 2HMKB 2CWVA 5IENA 3FH1A 3PCSA 1BSDA 1DMMA 4G1MB 4RNYA 3K7CA 1T2HA 4BL2A 4OK0A 1QVG2 3DM8A 1IVVA 2GU3A 2PNCA 5AIFA 1JV2B 1JZOA 5ELJA 2HMNB 2P09A 1K41A 3DGNA 4KFEA 1W6YA 1WMNA 1GY6A 1QJGA 4WP5A 4X2HA 1NJI4 4BIRA 1VQ93 1IT8A 3CCV3 1DYUA 3MHEA 1GSPA 3LT9A 4K90B 1DETA 3FCSB 1F8NA 5G2GA 3T8NA 1MNLA 1M904 1OF5A 4NHFA 4HAAA 1YJ93 3EE1A 1HYFA 2XSHB 5IG3A 1JBTA 1UDII 1I2GA 3H3HA 4TX4A 1SARA 3ZG0A 3CD63 3PCRA 1ROAA 3MG1A 8RNTA 1TJDA 1OCVA 2GXFA 3GZRA 4O2HA 3NQZA 5DRVA 1STFI 3BLZA 4NREA 1OHSA 2H0HA 2WO0A 1Z1SA 3WODG 1O7NB 2L4VA 4HM5B 3RDEA 4XBXA 1S5AA 2HOHA 4XDWA 1GMQA 1YVBI 5G1KA 3URPA 2CFWA 2GSPA 3B7CA 1IV7A 3FF0A 4LMIA 3FZWA 3G6E3 3CC43 3LZAA 3NBJA 2L1SA 3AMOB 1BUQA 1RCLA 1NWWA 2GBXB 4FMBA 1O7GB 4R9KA 1IYYA 3MG3A 4XBTA 5TGNA 1N8R4 4BTXA 1W4NA 1CYVA 3B4PA 1JB4A 2BO9B 1BNIA 1WNHA 3JUPA 3KE7A 3TDGA 1IQYA 1FYSA 1JJ22 1VQL3 1UW1A 2BT3A 2R4IA 1VQQA 1BVIA 1DVCA 2F56A 2HMOB 2OOVA 1IV9A 3G16A 1O7WB 1RGKA 1TUHA 4CPKA 3NQYA 1ZGXA 1KSIA 1Q814 3G0KA 1GY7A 2IA7A 4R80A 5KP1A 2GU1A 4EV5A 4KT3B 2F86B 3EC9A 2I9WA 1BSEA 2GEXA 1BRJA 1OPYA 1GOVA 3UNLA 3HI7A 3HIGA 1YGEA 3N54B 3PXMA 1K28A 1Q864 3ZFZA 1D6ZA 1NU3A 3V92A 2M7OA 2MF7A 2OWPA 4KFDA 1UCJA 2B1XB 1RNTA 4N6OB 1BNRA 3X3XA 2CC3A 2WGOA 3PZWA 3EN8A 1BNJA 1VQ83 2Q07A 3F7SA 1LNHA 4IIAA 1VQ63 3JUOA 1V57A 1FGTA 2K3DA 1FUSA 2RGQA 2YFLB 3UJMA 2OQEC 1I0XA 3EF8A 4KZ1A 1FGQA 1WTHA 4XB5A 2YFIB 1W2B2 1ROVA 4H61A 1UCLA 1A2VA 1BSCA 3J7Yd 1NO3A 1GD3A 6STDA 1UGHI 1SJWA 1I3FA 4IPBA 7STDA 1B2MA 3EN1B 2Z7AA 3QRDA 1RGGA 3K63A 1BNEA 3FG1A 5EVHA 1GYBA 1BSAA 5EEOA 1KQS2 4K61A 2ML5A 4EW5A 2RCDA 3CPOA 4LSOA 1YI23 2IY2A 2UUGC 2STDA 2GEYA 1AQZA 2WOHA 2KF3A 5DREA 3K5TA 3MPHA 4J5GA 3Q3FA 4KVHA 1FZUA 4R9LA 3NBBA 4I4KA 1E97A 1Q9EA 3X3ZA 1I2EA 3WA3A 3I553 4MMZB 5EQLA 1G0TA 2D42A 4HVNA 1AR0A 3I0YA 2IYJA 4RNTA 3SX1A 2K54A 1QALA 1T2IA 3HX8A 1T5YA 5BU4A 1SPUA 1TFKA 1U8CB 1Q824 1AVLA 1C54A 2YFJB 2WOFA 1BRIA 3VGNA 2BNGA 1OACA 3PS8A 6RNTA 4I5QA 5CF1A 5KP3A 2W9QA 1LRAA 3D3LA 4WFOA 2AAEA 4MJDA 1ZS7A 3GWRA 3ZG5A 1RSNA 1X1YA 1RGCA 1FW7A 3CCU3 1OUNA 3JUNA 2HMLB 4HYZA 1FA3A 4K1UA 2CFDA 1U5OA 4HM7B 4O8SA 1LQGC 2A15A 1BOXA 1BRSA 3A76A 1GOUA 1PY3A 2FNQA 4STDA 2CIUA 2XRXB 1YIT3 4AKZA 5CK6A 4XM4A 1BNSA 2ZDJA 4J5KA 2BMQB 1LXEA 2W2CA 3FSDA 1GS3A 3MG2A 1RGHA 1OHPA 2H0GA 3Q1CA 3RGAA 5IEPA 3OW22 5JPPA 2WGQA 1DMQA 3HIIA 1YJW3 3OX9A 3UL6A 4FCJA 3U1WA 1M1XB 1TRPA 4AEQA 1EKMA 2CX1A 3HOHA 3WHOA 3X41A 3F9SA 1D6UA 4X2OA 3CCJ3 3N8BA 1US1A 1ZX2A 4J8TA 1EEJA 5BIRA 1ISKA 1GOYA 1IK3A 2ZHXB 4JRFA 1JBSA 2PZVA 1BAOA 1AVKA 1BNGA 1I3IA 1YVSA 3BU4A 3EHCA 3FKAA 3NBRA 1TP6A 1B2UA 4HM0B 2IUJA 3X42A 2OTJ3 4EV2A 1RGLA 2W56A 2CFKA 3BNCA 2K0MA 3KFQC 2CG1A 2W6JH 4LZIA 1RMSA 4XBYA 2UX0A 2CH9A 1IVXA 3NHXA 1YNVX 2KAAA 2Z77A 1D6YA 4N6MA 5AIHA 2RSXA 1N9EA 4O3VA 2O9UX 5CLKA 3X3YA
chains in the Genus database with same CATH topology
1JN5A 1C7HA 1VQP3 5STDA 3Q2PA 3S29A 5IG5A 4HM4B 3LTAA 4N6V0 2HMMB 1ASKA 3EX9A 2KCDA 1R4CA 1EG9B 5BVBA 2BMRB 1VQM3 5D81A 5D83A 2OQEA 3SLUA 3T8UA 1O7MB 3NX0A 3IMAB 3JUQA 3UB1A 5I97A 3KKGA 1JKGB 4R4KA 2Y74A 5AYRB 3S27A 2C11A 2ZL8A 3ALAA 3IJEB 4HKVB 1DVDA 5AIIA 2XFTA 3KSED 5IW9A 3ROBA 4MEIA 3VF1A 1CEWI 1O7PB 3K0ZA 3DUKA 4ORLA 1G96A 3MKIA 3EBTA 3EB8A 4KFFA 4U13A 3GZBA 3EBYA 2E2TA 1IT7A 4O02B 2JQ5A 3Q90A 5BXQA 2BMOB 2CFGA 1O7HB 1W01A 2B24B 2CKFB 1RKYA 5CF2A 1QAFA 4R1KA 4RBNA 2OTL3 1UUVB 1W7CA 1OGXA 5LC6A 3B4OA 1QMAA 4HZ9B 5IEOA 1JB5A 5D82A 4EC6A 3DMCA 1VQK3 5IG4A 2XGNA 3HZPA 3CCL3 2CG0A 3G4S3 1K8A4 2XR8B 3LOYA 3LTDA 4BTYA 3NM7A 1IVUA 3HK4A 1Q7Y4 1FGOA 1RRLA 3CCQ3 1NB3I 1W6GA 3F7XA 1QVF2 3SOAA 1STDA 2XH9A 4FMDA 1W00A 3IPTA 2F98A 3U97A 3CMA3 3B8LA 3ER7A 3PGBA 3DGLA 3G713 2XEPA 3STDA 3UL5A 1OGZA 1E3VA 1WQLB 4MMYB 1J2BA 3BNDA 3WA2X 4JF8A 3DGOA 1RRHA 1OF5B 2QEX3 3PYJA 1ULIB 4N6NB 3KZTA 1S723 3O8YA 1M9GA 2LYXA 2HMJB 4OUQA 2XSOB 3FF2A 5AEWB 4WYKA 1IVWA 1W6CA 4HM2B 8CHOA 1Q42A 2C10A 2FXTA 1HKXA 2V1LA 3CC23 3F8XA 2RFRA 5AI1A 1N8QA 1IDPA 1NDOB 1VQN3 1Q40A 1OHOA 3OXAA 2SBLA 2W56B 3DZLA 1TU5A 3CCS3 1K734 2W04A 1A2KA 1JB2A 3S5CA 3LMLA 4HM6B 4RNZA 4K1VA 1VZZA 4WWUC 5ELUA 2E2VA 2E2UA 3LH4A 3MWZA 3KN4A 3OWSA 4FCMA 3CCM3 1QAKA 2Z6BA 2CWTA 3CCR3 5JPUA 3LTCA 1JN5B 3H51A 3KSPA 4H3UA 3FG3A 4N3VA 1V74A 4HM8B 2IUKA 3NV0A 4EBGA 5IERA 3SOYA 2CHCA 3CXC2 1E3RA 3LT8A 1SIHA 2FGTA 2IMJA 1A90A 2KXGA 3CCE3 3DXOA 3M8CA 2Y73A 1HU9A 2QA43 5AIGA 4N6LA 4HZBB 1N9JA 1W5ZA 1NB5I 4EXRA 1UI8A 1EQKA 1KD14 1GY5A 1Y4KA 3LXUX 3S28A 1FUWA 1ULJB 2XF3A 2F99A 3T0UA 2BHMA 3NUVA 4J9AA 1PU4A 2XFSA 2GBWB 4WHAA 3X40A 1N5HA 5HGRA 3F40A 1N5PA 3LYGA 3I563 1IQ8A 3RGRA 5CXOA 5IF6A 3FG4A 3FGYA 3OWYA 5IG0A 3E99A 3G8ZA 1M1K4 3NXJA 3D9RA 5AEUB 4HBRA 5JBSA 2D1WA 4RZMA 3WMDA 3GAXA 1KC84 2CW9A 2QIYA 2JDIH 3MYTA 4FMCA 3OV4A 3DGMA 1RJOA 2O3OA 2INXA 1JNQA 3L0RA 1TFOA 3JVCA 3CNMA 1VQ53 4IT7A 1SQWA 5FW5A 2LQVA 3FLJA 4EYCA 1RN7A 4ZM8A 5KP4A 3CC73 2QGUA 2Z76A 1UI7A 4BTWA 1WMOA 3EQQB 3F8HA 2ML6A 2P38A 1JRQA 1FGMA 1W2ZA 4L7KA 3KIIA 4L8PA 3V98A 4Q53A 4WYKB 2P05A 1GD4A 3NM2A 2W9PA 1YIJ3 2CFLA 2CK3H 1K9M4 1VQ73 1EA2A 3WOEB 3QK9A 2W03A 1DMNA 3F14A 1LOXA 2OOVC 2OCTA 2CWUA 1YJN3 4HJLB 3AMOA 4N6UA 4FCZA 1Q40B 4FMAA 1YHQ3 4GL6A 1VQ43 3BB9A 4AKYA 4XDVA 1VQO3 3GZXB 3SEDA 3WOFB 3VSYA 1MOLA 4MMXB 4OVMA 1WMPA 3N9HA 4LGQA 1IU7A 4QWTA 3SVAA 1LVNA 4LEHA 1KWIA 2P0XA 2W0QA 3WDGB 1ZO2A 5AYSC 2XGLA 3SXXA 4CDLA 4L8OA 1CYUA 1TIJA 2P0MA 3MSOA 3NV0B 4FR9A 3DY5A 3OWUA 5FGOA 1IQXA 3GZYB 4CCVA 3ECFA 2MC8A 1SIIA 4GB5A 3CME3 1CQSA 1JKGA 5A0OB 3CNXA 1AV4A 1L5GB 1W02A 3CPW2 5LC7A 4HM1B 3EJVA 4HM3B 3LTBA 3V99A 1UUWB 1FGRA 3GRDA 3K9MC 3BNEA 1A67A 1OH0A 4PEJA 3JUMA 2YX9A 3CU3A 3S67A 3BNBA 1PFPA 2KRTA 2HMKB 2CWVA 5IENA 3FH1A 3PCSA 1DMMA 4G1MB 4RNYA 3K7CA 1QVG2 4OK0A 3DM8A 1IVVA 2GU3A 2PNCA 5AIFA 1JV2B 5ELJA 2HMNB 2P09A 1K41A 3DGNA 4KFEA 1W6YA 1WMNA 1GY6A 1QJGA 4WP5A 4X2HA 1NJI4 1VQ93 1IT8A 3CCV3 1DYUA 3MHEA 3LT9A 4K90B 3FCSB 1F8NA 5G2GA 3T8NA 1MNLA 1M904 1OF5A 4NHFA 1YJ93 3EE1A 2XSHB 5IG3A 4TX4A 3H3HA 3CD63 3PCRA 1ROAA 3MG1A 1OCVA 2GXFA 3GZRA 4O2HA 3NQZA 5DRVA 1STFI 3BLZA 4NREA 1OHSA 2WO0A 3WODG 1Z1SA 1O7NB 2L4VA 4HM5B 3RDEA 4XBXA 1S5AA 4XDWA 1YVBI 2CFWA 3B7CA 1IV7A 3FF0A 4LMIA 3FZWA 3G6E3 3CC43 3LZAA 3NBJA 3AMOB 1BUQA 4FMBA 1NWWA 2GBXB 4R9KA 1O7GB 3MG3A 4XBTA 5TGNA 1N8R4 4BTXA 1W4NA 1CYVA 3B4PA 1JB4A 2BO9B 1WNHA 3JUPA 3KE7A 3TDGA 1JJ22 1IQYA 1VQL3 1UW1A 2BT3A 2R4IA 1DVCA 2HMOB 2OOVA 1IV9A 3G16A 1O7WB 1TUHA 3NQYA 1KSIA 1Q814 3G0KA 1GY7A 2IA7A 4R80A 5KP1A 2GU1A 4EV5A 2F86B 3EC9A 2I9WA 2GEXA 1OPYA 3UNLA 3HI7A 3HIGA 1YGEA 3N54B 3PXMA 1K28A 1Q864 1D6ZA 1NU3A 3V92A 2M7OA 2MF7A 2OWPA 4KFDA 4N6OB 2B1XB 3X3XA 2CC3A 2WGOA 3PZWA 3EN8A 1VQ83 2Q07A 3F7SA 1LNHA 4IIAA 1VQ63 3JUOA 1FGTA 2RGQA 2YFLB 3UJMA 2OQEC 3EF8A 4KZ1A 1FGQA 1WTHA 4XB5A 2YFIB 1W2B2 1ROVA 4H61A 1A2VA 3J7Yd 1NO3A 1GD3A 6STDA 1SJWA 4IPBA 7STDA 3EN1B 2Z7AA 3QRDA 3K63A 3FG1A 5EVHA 1GYBA 5EEOA 1KQS2 4K61A 2ML5A 2RCDA 3CPOA 4LSOA 1YI23 2STDA 2GEYA 2WOHA 5DREA 3K5TA 3MPHA 4R9LA 4KVHA 3NBBA 4I4KA 1E97A 3X3ZA 3WA3A 3I553 4MMZB 5EQLA 2D42A 4HVNA 1AR0A 3I0YA 3SX1A 2K54A 1QALA 3HX8A 1T5YA 1SPUA 1TFKA 1U8CB 1Q824 1AVLA 2YFJB 2WOFA 3VGNA 2BNGA 1OACA 3PS8A 5CF1A 5KP3A 2W9QA 4WFOA 3D3LA 4MJDA 3GWRA 3CCU3 1OUNA 3JUNA 2HMLB 4HYZA 1FA3A 4K1UA 2CFDA 1U5OA 4HM7B 4O8SA 2A15A 3A76A 4STDA 2FNQA 2CIUA 2XRXB 1YIT3 4AKZA 5CK6A 4XM4A 2ZDJA 2BMQB 1LXEA 2W2CA 3FSDA 1GS3A 3MG2A 1OHPA 3Q1CA 3RGAA 5IEPA 3OW22 5JPPA 2WGQA 1DMQA 3HIIA 1YJW3 3OX9A 3UL6A 4FCJA 3U1WA 1M1XB 4AEQA 1EKMA 3X41A 3F9SA 1D6UA 4X2OA 3CCJ3 3N8BA 1US1A 1ZX2A 4J8TA 1ISKA 1IK3A 4JRFA 2PZVA 1AVKA 4N6TA 3FKAA 3EHCA 4HM0B 3NBRA 1TP6A 2IUJA 3X42A 2OTJ3 4EV2A 2W56A 2CFKA 3BNCA 2K0MA 3KFQC 2CG1A 2W6JH 4LZIA 4XBYA 2UX0A 2CH9A 1IVXA 3NHXA 2Z77A 1D6YA 4N6MA 5AIHA 2RSXA 1N9EA 4O3VA 2O9UX 5CLKA 3X3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JN5 A;  1C7H A;  5STD A;  5IG5 A;  4HM4 B;  2HMM B;  1ASK A;  3EX9 A;  5BVB A;  1EG9 B;  2BMR B;  5D81 A;  5D83 A;  3T8U A;  1O7M B;  3JUQ A;  3KKG A;  1JKG B;  4HKV B;  5AII A;  3ROB A;  1O7P B;  3K0Z A;  3DUK A;  4ORL A;  3MKI A;  3EBT A;  4U13 A;  3GZB A;  3EBY A;  2JQ5 A;  3Q90 A;  5BXQ A;  2BMO B;  1O7H B;  1W01 A;  2B24 B;  2CKF B;  5CF2 A;  4R1K A;  1UUV B;  1OGX A;  3B4O A;  1QMA A;  4HZ9 B;  5IEO A;  1JB5 A;  5D82 A;  3DMC A;  5IG4 A;  3HZP A;  2XR8 B;  3HK4 A;  3F7X A;  3SOA A;  1STD A;  1W00 A;  3IPT A;  2F98 A;  3B8L A;  3ER7 A;  3STD A;  1OGZ A;  1E3V A;  1WQL B;  1OF5 B;  1ULI B;  3KZT A;  2HMJ B;  4OUQ A;  2XSO B;  3FF2 A;  5AEW B;  4WYK A;  4HM2 B;  8CHO A;  1Q42 A;  1HKX A;  3F8X A;  2RFR A;  5AI1 A;  1IDP A;  1NDO B;  1Q40 A;  1OHO A;  3OXA A;  3DZL A;  1A2K A;  1JB2 A;  3S5C A;  4HM6 B;  4K1V A;  1VZZ A;  4WWU C;  3OWS A;  4FCM A;  5JPU A;  1JN5 B;  3H51 A;  3KSP A;  4H3U A;  4N3V A;  4HM8 B;  3NV0 A;  5IER A;  3SOY A;  2CHC A;  1E3R A;  2IMJ A;  3DXO A;  3M8C A;  4HZB B;  1GY5 A;  1ULJ B;  2F99 A;  3NUV A;  4J9A A;  2GBW B;  5HGR A;  3F40 A;  3LYG A;  3RGR A;  5IF6 A;  5CXO A;  3FGY A;  3OWY A;  5IG0 A;  3E99 A;  3G8Z A;  3NXJ A;  3D9R A;  5AEU B;  4RZM A;  3WMD A;  2QIY A;  3MYT A;  3OV4 A;  2INX A;  3CNM A;  5FW5 A;  3FLJ A;  5KP4 A;  2QGU A;  2Z76 A;  3EQQ B;  3F8H A;  4L7K A;  4L8P A;  4Q53 A;  4WYK B;  3NM2 A;  1EA2 A;  1DMN A;  3F14 A;  4HJL B;  1Q40 B;  3BB9 A;  4XDV A;  3GZX B;  3SED A;  3VSY A;  4OVM A;  4LGQ A;  4LEH A;  1ZO2 A;  4CDL A;  4L8O A;  3MSO A;  3NV0 B;  3OWU A;  3GZY B;  3ECF A;  4GB5 A;  1CQS A;  1JKG A;  3CNX A;  1W02 A;  4HM1 B;  3EJV A;  4HM3 B;  1UUW B;  3GRD A;  1OH0 A;  4PEJ A;  3JUM A;  3CU3 A;  2HMK B;  5IEN A;  3FH1 A;  1DMM A;  3K7C A;  3DM8 A;  5AIF A;  2HMN B;  1K41 A;  1W6Y A;  1GY6 A;  1QJG A;  4WP5 A;  4X2H A;  3MHE A;  5G2G A;  3T8N A;  1OF5 A;  2XSH B;  5IG3 A;  3H3H A;  3MG1 A;  1OCV A;  2GXF A;  3GZR A;  5DRV A;  3BLZ A;  1OHS A;  1Z1S A;  1O7N B;  4HM5 B;  4XBX A;  1S5A A;  4XDW A;  3B7C A;  3FF0 A;  4LMI A;  3FZW A;  3LZA A;  1BUQ A;  4R9K A;  1NWW A;  2GBX B;  1O7G B;  3MG3 A;  4XBT A;  5TGN A;  3B4P A;  1JB4 A;  3KE7 A;  3JUP A;  2R4I A;  2HMO B;  3G16 A;  1O7W B;  1TUH A;  3G0K A;  1GY7 A;  5KP1 A;  2F86 B;  3EC9 A;  2I9W A;  2GEX A;  1OPY A;  3UNL A;  1NU3 A;  2OWP A;  2B1X B;  3EN8 A;  3F7S A;  4IIA A;  3JUO A;  2RGQ A;  2YFL B;  3UJM A;  3EF8 A;  4XB5 A;  2YFI B;  6STD A;  1SJW A;  7STD A;  3EN1 B;  2Z7A A;  5EVH A;  1GYB A;  2RCD A;  3CPO A;  2STD A;  2GEY A;  5DRE A;  4R9L A;  4KVH A;  4I4K A;  1E97 A;  4HVN A;  1AR0 A;  3I0Y A;  2K54 A;  3HX8 A;  2YFJ B;  3VGN A;  2BNG A;  5CF1 A;  5KP3 A;  4MJD A;  3GWR A;  1OUN A;  3JUN A;  2HML B;  4K1U A;  1U5O A;  4HM7 B;  2A15 A;  3A76 A;  4STD A;  2XRX B;  5CK6 A;  4XM4 A;  2BMQ B;  2W2C A;  3FSD A;  1GS3 A;  3MG2 A;  1OHP A;  3RGA A;  5IEP A;  5JPP A;  1DMQ A;  3OX9 A;  4FCJ A;  3F9S A;  4X2O A;  4J8T A;  1ZX2 A;  1ISK A;  2PZV A;  3FKA A;  3EHC A;  4HM0 B;  3NBR A;  1TP6 A;  4XBY A;  2UX0 A;  3NHX A;  2Z77 A;  5AIH A;  5AIG A;  5CLK A; 
#chains in the Genus database with same CATH topology
 1JN5 A;  1UUG B;  1C7H A;  1VQP 3;  5STD A;  2KF4 A;  3Q2P A;  3S29 A;  5IG5 A;  4HM4 B;  3LTA A;  3AGN A;  4N6V 0;  2HMM B;  5M1A A;  1ASK A;  3EX9 A;  2KCD A;  1R4C A;  1EG9 B;  1X1W A;  2BMR B;  2F5M A;  5BVB A;  1I2F A;  1TTO A;  5D81 A;  1VQM 3;  5D83 A;  2OQE A;  3SLU A;  3T8U A;  5RNT A;  1O7M B;  3NX0 A;  1GMP A;  3IMA B;  3JUQ A;  3UB1 A;  5I97 A;  1RN1 A;  1JKG B;  3KKG A;  2Y74 A;  4R4K A;  5AYR B;  3S27 A;  2C11 A;  1MGR A;  2ZL8 A;  3ALA A;  3IJE B;  4HKV B;  1DVD A;  5AII A;  2XFT A;  3KSE D;  5IW9 A;  1BNF A;  3ROB A;  4MEI A;  3VF1 A;  1CEW I;  1O7P B;  3K0Z A;  3DUK A;  4ORL A;  5GSP A;  1G96 A;  3MKI A;  3EBT A;  4HOH A;  3EB8 A;  4KFF A;  4U13 A;  3GZB A;  3EBY A;  2E2T A;  1IT7 A;  1AY7 A;  4O02 B;  2JQ5 A;  3Q90 A;  5BXQ A;  1NNV A;  1V58 A;  2BMO B;  2CFG A;  1BAN A;  1O7H B;  1W01 A;  2B24 B;  2CKF B;  1RKY A;  5CF2 A;  1QAF A;  4R1K A;  4RBN A;  2OTL 3;  1UUV B;  9RNT A;  1W7C A;  1OGX A;  5LC6 A;  1BGS A;  1EUI C;  3B4O A;  1QMA A;  1JZD A;  4HZ9 B;  1JB5 A;  5IEO A;  1B3S A;  5D82 A;  4EC6 A;  3KCH A;  3DMC A;  1VQK 3;  1RN4 A;  5IG4 A;  2XGN A;  3HZP A;  3CCL 3;  2CG0 A;  3G4S 3;  1K8A 4;  2XR8 B;  3LOY A;  3LTD A;  4BTY A;  1RLS A;  1IVU A;  3HK4 A;  3NM7 A;  1Q7Y 4;  1FGO A;  1RRL A;  1X1U A;  2H0I A;  3CCQ 3;  1NB3 I;  1W6G A;  3F7X A;  1QVF 2;  3SOA A;  1STD A;  2XH9 A;  4FMD A;  1W00 A;  3IPT A;  2F98 A;  3U97 A;  3CMA 3;  3B8L A;  3ER7 A;  3PGB A;  3DGL A;  1BRK A;  3G71 3;  2XEP A;  3STD A;  3UL5 A;  1OGZ A;  1E3V A;  1WQL B;  3AHW A;  1BRH A;  4MMY B;  1J2B A;  3BND A;  3WA2 X;  4JF8 A;  3DGO A;  1RRH A;  3D79 A;  1OF5 B;  1RGF A;  1B2S A;  3BIR A;  3PYJ A;  1ULI B;  4N6N B;  1B21 A;  3KZT A;  3O8Y A;  1M9G A;  2QEX 3;  1S72 3;  2CX0 A;  2LYX A;  2HMJ B;  2UGI A;  2XSO B;  2ZA4 A;  3FF2 A;  4OUQ A;  4DKI A;  4WYK A;  5AEW B;  5HOH A;  1IVW A;  1W6C A;  4HM2 B;  8CHO A;  1Q42 A;  2C10 A;  2FXT A;  1HKX A;  2V1L A;  1G02 A;  3CC2 3;  3F8X A;  2RFR A;  5AI1 A;  1N8Q A;  1IDP A;  1NDO B;  1LOV A;  1B2Z A;  1VQN 3;  1Q40 A;  1OHO A;  3OXA A;  2SBL A;  2W56 B;  3DZL A;  1TU5 A;  3CCS 3;  1K73 4;  2SAR A;  2W04 A;  1A2K A;  1MWS A;  1JB2 A;  3D5G A;  3S5C A;  3LML A;  4HM6 B;  4GSP A;  2KF5 A;  4RNZ A;  4K1V A;  1VZZ A;  3DH2 A;  4WWU C;  5ELU A;  2E2V A;  4CJN A;  3DGY A;  2E2U A;  3LH4 A;  3MWZ A;  3KN4 A;  3OWS A;  4FCM A;  5M19 A;  3CCM 3;  1QAK A;  2Z6B A;  2CWT A;  3CCR 3;  5JPU A;  3LTC A;  1JN5 B;  3H51 A;  3KSP A;  2KF6 A;  4H3U A;  3FG3 A;  4N3V A;  1V74 A;  4HM8 B;  1X1X A;  2IUK A;  1A2P A;  3NV0 A;  4EBG A;  3SOY A;  2CHC A;  1R4Y A;  1BIR A;  4BU4 A;  5IER A;  3CXC 2;  1E3R A;  3LT8 A;  1SIH A;  2FGT A;  2IMJ A;  1A90 A;  2KXG A;  3CCE 3;  2RBI A;  3DXO A;  3M8C A;  2Y73 A;  1T3B A;  1HU9 A;  2QA4 3;  5AIG A;  1B2X A;  4N6L A;  4HZB B;  1N9J A;  1W5Z A;  1NB5 I;  4EXR A;  1UI8 A;  1RCK A;  2C4B A;  1EQK A;  1KD1 4;  1GY5 A;  1Y4K A;  3LXU X;  3S28 A;  1FUW A;  1ULJ B;  2XF3 A;  2RNT A;  3D5I A;  2F99 A;  1JBR A;  3T0U A;  2BHM A;  3NUV A;  4J9A A;  1PU4 A;  2XFS A;  2GBW B;  1RDS A;  4WHA A;  3X40 A;  1N5H A;  5HGR A;  3F40 A;  1N5P A;  3LYG A;  3I56 3;  1RNB A;  1IQ8 A;  3RGR A;  5CXO A;  5IF6 A;  1RGA A;  3FG4 A;  3FGY A;  3OWY A;  5IG0 A;  3E99 A;  3G8Z A;  7GSP A;  1M1K 4;  3NXJ A;  4LYL B;  1BU4 A;  3D9R A;  5AEU B;  4HBR A;  5JBS A;  2D1W A;  4RZM A;  3RNT A;  1GMR A;  3GAX A;  3WMD A;  1UCI A;  1MWR A;  2CW9 A;  2QIY A;  3A5E A;  2JDI H;  1KC8 4;  3MYT A;  4FMC A;  3OV4 A;  1I0V A;  3DGM A;  1RJO A;  2O3O A;  2INX A;  1JNQ A;  3L0R A;  1TFO A;  3JVC A;  3CNM A;  1RTU A;  1VQ5 3;  1LQM B;  4IT7 A;  1YGW A;  1SQW A;  5FW5 A;  2LQV A;  3FLJ A;  4GHO A;  4EYC A;  1RN7 A;  4ZM8 A;  5KP4 A;  1DE3 A;  3CC7 3;  2QGU A;  2Z76 A;  1UI7 A;  1B27 A;  3GSP A;  1BSB A;  4BL3 A;  4BTW A;  1BRG A;  1WMO A;  3EQQ B;  3F8H A;  2ML6 A;  2P38 A;  2AAD A;  3D4A A;  1JRQ A;  1FGM A;  1W2Z A;  4L7K A;  1LOW A;  1LOY A;  3KII A;  4L8P A;  3V98 A;  7RNT A;  2F5W A;  4Q53 A;  4WYK B;  2P05 A;  1GD4 A;  1HZ1 A;  2W9P A;  3NM2 A;  4ILF A;  1YIJ 3;  2CFL A;  1MWU A;  2CK3 H;  1K9M 4;  1VQ7 3;  1EA2 A;  4N6T A;  3WOE B;  1FUT A;  3QK9 A;  2W03 A;  1DMN A;  2R41 A;  3F14 A;  1LOX A;  2OOV C;  2OCT A;  2CWU A;  1YJN 3;  4HJL B;  1I70 A;  2BIR A;  3AMO A;  4N6U A;  4FCZ A;  3WR2 A;  1Q40 B;  4FMA A;  1YHQ 3;  4GL6 A;  1VQ4 3;  2F4Y A;  3BB9 A;  4AKY A;  4XDV A;  1VQO 3;  3GZX B;  1PYL A;  3SED A;  3WOF B;  3VSY A;  1MOL A;  4MMX B;  4OVM A;  3SYU A;  1WMP A;  3N9H A;  4LGQ A;  1IU7 A;  4QWT A;  3SVA A;  1LVN A;  5G1L A;  4LEH A;  3AGO A;  1KWI A;  2P0X A;  2BU4 A;  2W0Q A;  3WDG B;  1ZO2 A;  1MWT A;  1UGI A;  5AYS C;  2XGL A;  3SXX A;  4CDL A;  4L8O A;  1CYU A;  1TIJ A;  2P0M A;  3MSO A;  3NV0 B;  4FR9 A;  3DY5 A;  3OWU A;  5M18 A;  5FGO A;  1IQX A;  1MGW A;  3GZY B;  4CCV A;  1BUJ A;  3ECF A;  2MC8 A;  1SII A;  4GB5 A;  3CME 3;  1CQS A;  1B20 A;  1LNI A;  1JKG A;  5A0O B;  3CNX A;  1AV4 A;  3AHS A;  1L5G B;  1W02 A;  1UCK A;  2J8X B;  1I8V A;  3CPW 2;  1RGE A;  1RHL A;  4HM1 B;  5LC7 A;  1TRQ A;  3EJV A;  4HM3 B;  3LTB A;  3V99 A;  1UUW B;  4NPB A;  1FGR A;  1CH0 A;  3GRD A;  3K9M C;  6GSP A;  3BNE A;  1A67 A;  1OH0 A;  4PEJ A;  3JUM A;  2YX9 A;  1Q7H A;  3CU3 A;  3S67 A;  1BRN L;  3BNB A;  1PFP A;  2KRT A;  2HMK B;  2CWV A;  5IEN A;  3FH1 A;  3PCS A;  1BSD A;  1DMM A;  4G1M B;  4RNY A;  3K7C A;  1T2H A;  4BL2 A;  4OK0 A;  1QVG 2;  3DM8 A;  1IVV A;  2GU3 A;  2PNC A;  5AIF A;  1JV2 B;  1JZO A;  5ELJ A;  2HMN B;  2P09 A;  1K41 A;  3DGN A;  4KFE A;  1W6Y A;  1WMN A;  1GY6 A;  1QJG A;  4WP5 A;  4X2H A;  1NJI 4;  4BIR A;  1VQ9 3;  1IT8 A;  3CCV 3;  1DYU A;  3MHE A;  1GSP A;  3LT9 A;  4K90 B;  1DET A;  3FCS B;  1F8N A;  5G2G A;  3T8N A;  1MNL A;  1M90 4;  1OF5 A;  4NHF A;  4HAA A;  1YJ9 3;  3EE1 A;  1HYF A;  2XSH B;  5IG3 A;  1JBT A;  1UDI I;  1I2G A;  3H3H A;  4TX4 A;  1SAR A;  3ZG0 A;  3CD6 3;  3PCR A;  1ROA A;  3MG1 A;  8RNT A;  1TJD A;  1OCV A;  2GXF A;  3GZR A;  4O2H A;  3NQZ A;  5DRV A;  1STF I;  3BLZ A;  4NRE A;  1OHS A;  2H0H A;  2WO0 A;  1Z1S A;  3WOD G;  1O7N B;  2L4V A;  4HM5 B;  3RDE A;  4XBX A;  1S5A A;  2HOH A;  4XDW A;  1GMQ A;  1YVB I;  5G1K A;  3URP A;  2CFW A;  2GSP A;  3B7C A;  1IV7 A;  3FF0 A;  4LMI A;  3FZW A;  3G6E 3;  3CC4 3;  3LZA A;  3NBJ A;  2L1S A;  3AMO B;  1BUQ A;  1RCL A;  1NWW A;  2GBX B;  4FMB A;  1O7G B;  4R9K A;  1IYY A;  3MG3 A;  4XBT A;  5TGN A;  1N8R 4;  4BTX A;  1W4N A;  1CYV A;  3B4P A;  1JB4 A;  2BO9 B;  1BNI A;  1WNH A;  3JUP A;  3KE7 A;  3TDG A;  1IQY A;  1FYS A;  1JJ2 2;  1VQL 3;  1UW1 A;  2BT3 A;  2R4I A;  1VQQ A;  1BVI A;  1DVC A;  2F56 A;  2HMO B;  2OOV A;  1IV9 A;  3G16 A;  1O7W B;  1RGK A;  1TUH A;  4CPK A;  3NQY A;  1ZGX A;  1KSI A;  1Q81 4;  3G0K A;  1GY7 A;  2IA7 A;  4R80 A;  5KP1 A;  2GU1 A;  4EV5 A;  4KT3 B;  2F86 B;  3EC9 A;  2I9W A;  1BSE A;  2GEX A;  1BRJ A;  1OPY A;  1GOV A;  3UNL A;  3HI7 A;  3HIG A;  1YGE A;  3N54 B;  3PXM A;  1K28 A;  1Q86 4;  3ZFZ A;  1D6Z A;  1NU3 A;  3V92 A;  2M7O A;  2MF7 A;  2OWP A;  4KFD A;  1UCJ A;  2B1X B;  1RNT A;  4N6O B;  1BNR A;  3X3X A;  2CC3 A;  2WGO A;  3PZW A;  3EN8 A;  1BNJ A;  1VQ8 3;  2Q07 A;  3F7S A;  1LNH A;  4IIA A;  1VQ6 3;  3JUO A;  1V57 A;  1FGT A;  2K3D A;  1FUS A;  2RGQ A;  2YFL B;  3UJM A;  2OQE C;  1I0X A;  3EF8 A;  4KZ1 A;  1FGQ A;  1WTH A;  4XB5 A;  2YFI B;  1W2B 2;  1ROV A;  4H61 A;  1UCL A;  1A2V A;  1BSC A;  3J7Y d;  1NO3 A;  1GD3 A;  6STD A;  1UGH I;  1SJW A;  1I3F A;  4IPB A;  7STD A;  1B2M A;  3EN1 B;  2Z7A A;  3QRD A;  1RGG A;  3K63 A;  1BNE A;  3FG1 A;  5EVH A;  1GYB A;  1BSA A;  5EEO A;  1KQS 2;  4K61 A;  2ML5 A;  4EW5 A;  2RCD A;  3CPO A;  4LSO A;  1YI2 3;  2IY2 A;  2UUG C;  2STD A;  2GEY A;  1AQZ A;  2WOH A;  2KF3 A;  5DRE A;  3K5T A;  3MPH A;  4J5G A;  3Q3F A;  4KVH A;  1FZU A;  4R9L A;  3NBB A;  4I4K A;  1E97 A;  1Q9E A;  3X3Z A;  1I2E A;  3WA3 A;  3I55 3;  4MMZ B;  5EQL A;  1G0T A;  2D42 A;  4HVN A;  1AR0 A;  3I0Y A;  2IYJ A;  4RNT A;  3SX1 A;  2K54 A;  1QAL A;  1T2I A;  3HX8 A;  1T5Y A;  5BU4 A;  1SPU A;  1TFK A;  1U8C B;  1Q82 4;  1AVL A;  1C54 A;  2YFJ B;  2WOF A;  1BRI A;  3VGN A;  2BNG A;  1OAC A;  3PS8 A;  6RNT A;  4I5Q A;  5CF1 A;  5KP3 A;  2W9Q A;  1LRA A;  3D3L A;  4WFO A;  2AAE A;  4MJD A;  1ZS7 A;  3GWR A;  3ZG5 A;  1RSN A;  1X1Y A;  1RGC A;  1FW7 A;  3CCU 3;  1OUN A;  3JUN A;  2HML B;  4HYZ A;  1FA3 A;  4K1U A;  2CFD A;  1U5O A;  4HM7 B;  4O8S A;  1LQG C;  2A15 A;  1BOX A;  1BRS A;  3A76 A;  1GOU A;  1PY3 A;  2FNQ A;  4STD A;  2CIU A;  2XRX B;  1YIT 3;  4AKZ A;  5CK6 A;  4XM4 A;  1BNS A;  2ZDJ A;  4J5K A;  2BMQ B;  1LXE A;  2W2C A;  3FSD A;  1GS3 A;  3MG2 A;  1RGH A;  1OHP A;  2H0G A;  3Q1C A;  3RGA A;  5IEP A;  3OW2 2;  5JPP A;  2WGQ A;  1DMQ A;  3HII A;  1YJW 3;  3OX9 A;  3UL6 A;  4FCJ A;  3U1W A;  1M1X B;  1TRP A;  4AEQ A;  1EKM A;  2CX1 A;  3HOH A;  3WHO A;  3X41 A;  3F9S A;  1D6U A;  4X2O A;  3CCJ 3;  3N8B A;  1US1 A;  1ZX2 A;  4J8T A;  1EEJ A;  5BIR A;  1ISK A;  1GOY A;  1IK3 A;  2ZHX B;  4JRF A;  1JBS A;  2PZV A;  1BAO A;  1AVK A;  1BNG A;  1I3I A;  1YVS A;  3BU4 A;  3EHC A;  3FKA A;  3NBR A;  1TP6 A;  1B2U A;  4HM0 B;  2IUJ A;  3X42 A;  2OTJ 3;  4EV2 A;  1RGL A;  2W56 A;  2CFK A;  3BNC A;  2K0M A;  3KFQ C;  2CG1 A;  2W6J H;  4LZI A;  1RMS A;  4XBY A;  2UX0 A;  2CH9 A;  1IVX A;  3NHX A;  1YNV X;  2KAA A;  2Z77 A;  1D6Y A;  4N6M A;  5AIH A;  2RSX A;  1N9E A;  4O3V A;  2O9U X;  5CLK A;  3X3Y A; 
#chains in the Genus database with same CATH homology
 1JN5 A;  1C7H A;  1VQP 3;  5STD A;  3Q2P A;  3S29 A;  5IG5 A;  4HM4 B;  3LTA A;  4N6V 0;  2HMM B;  1ASK A;  3EX9 A;  2KCD A;  1R4C A;  1EG9 B;  5BVB A;  2BMR B;  1VQM 3;  5D81 A;  5D83 A;  2OQE A;  3SLU A;  3T8U A;  1O7M B;  3NX0 A;  3IMA B;  3JUQ A;  3UB1 A;  5I97 A;  3KKG A;  1JKG B;  4R4K A;  2Y74 A;  5AYR B;  3S27 A;  2C11 A;  2ZL8 A;  3ALA A;  3IJE B;  4HKV B;  1DVD A;  5AII A;  2XFT A;  3KSE D;  5IW9 A;  3ROB A;  4MEI A;  3VF1 A;  1CEW I;  1O7P B;  3K0Z A;  3DUK A;  4ORL A;  1G96 A;  3MKI A;  3EBT A;  3EB8 A;  4KFF A;  4U13 A;  3GZB A;  3EBY A;  2E2T A;  1IT7 A;  4O02 B;  2JQ5 A;  3Q90 A;  5BXQ A;  2BMO B;  2CFG A;  1O7H B;  1W01 A;  2B24 B;  2CKF B;  1RKY A;  5CF2 A;  1QAF A;  4R1K A;  4RBN A;  2OTL 3;  1UUV B;  1W7C A;  1OGX A;  5LC6 A;  3B4O A;  1QMA A;  4HZ9 B;  5IEO A;  1JB5 A;  5D82 A;  4EC6 A;  3DMC A;  1VQK 3;  5IG4 A;  2XGN A;  3HZP A;  3CCL 3;  2CG0 A;  3G4S 3;  1K8A 4;  2XR8 B;  3LOY A;  3LTD A;  4BTY A;  3NM7 A;  1IVU A;  3HK4 A;  1Q7Y 4;  1FGO A;  1RRL A;  3CCQ 3;  1NB3 I;  1W6G A;  3F7X A;  1QVF 2;  3SOA A;  1STD A;  2XH9 A;  4FMD A;  1W00 A;  3IPT A;  2F98 A;  3U97 A;  3CMA 3;  3B8L A;  3ER7 A;  3PGB A;  3DGL A;  3G71 3;  2XEP A;  3STD A;  3UL5 A;  1OGZ A;  1E3V A;  1WQL B;  4MMY B;  1J2B A;  3BND A;  3WA2 X;  4JF8 A;  3DGO A;  1RRH A;  1OF5 B;  2QEX 3;  3PYJ A;  1ULI B;  4N6N B;  3KZT A;  1S72 3;  3O8Y A;  1M9G A;  2LYX A;  2HMJ B;  4OUQ A;  2XSO B;  3FF2 A;  5AEW B;  4WYK A;  1IVW A;  1W6C A;  4HM2 B;  8CHO A;  1Q42 A;  2C10 A;  2FXT A;  1HKX A;  2V1L A;  3CC2 3;  3F8X A;  2RFR A;  5AI1 A;  1N8Q A;  1IDP A;  1NDO B;  1VQN 3;  1Q40 A;  1OHO A;  3OXA A;  2SBL A;  2W56 B;  3DZL A;  1TU5 A;  3CCS 3;  1K73 4;  2W04 A;  1A2K A;  1JB2 A;  3S5C A;  3LML A;  4HM6 B;  4RNZ A;  4K1V A;  1VZZ A;  4WWU C;  5ELU A;  2E2V A;  2E2U A;  3LH4 A;  3MWZ A;  3KN4 A;  3OWS A;  4FCM A;  3CCM 3;  1QAK A;  2Z6B A;  2CWT A;  3CCR 3;  5JPU A;  3LTC A;  1JN5 B;  3H51 A;  3KSP A;  4H3U A;  3FG3 A;  4N3V A;  1V74 A;  4HM8 B;  2IUK A;  3NV0 A;  4EBG A;  5IER A;  3SOY A;  2CHC A;  3CXC 2;  1E3R A;  3LT8 A;  1SIH A;  2FGT A;  2IMJ A;  1A90 A;  2KXG A;  3CCE 3;  3DXO A;  3M8C A;  2Y73 A;  1HU9 A;  2QA4 3;  5AIG A;  4N6L A;  4HZB B;  1N9J A;  1W5Z A;  1NB5 I;  4EXR A;  1UI8 A;  1EQK A;  1KD1 4;  1GY5 A;  1Y4K A;  3LXU X;  3S28 A;  1FUW A;  1ULJ B;  2XF3 A;  2F99 A;  3T0U A;  2BHM A;  3NUV A;  4J9A A;  1PU4 A;  2XFS A;  2GBW B;  4WHA A;  3X40 A;  1N5H A;  5HGR A;  3F40 A;  1N5P A;  3LYG A;  3I56 3;  1IQ8 A;  3RGR A;  5CXO A;  5IF6 A;  3FG4 A;  3FGY A;  3OWY A;  5IG0 A;  3E99 A;  3G8Z A;  1M1K 4;  3NXJ A;  3D9R A;  5AEU B;  4HBR A;  5JBS A;  2D1W A;  4RZM A;  3WMD A;  3GAX A;  1KC8 4;  2CW9 A;  2QIY A;  2JDI H;  3MYT A;  4FMC A;  3OV4 A;  3DGM A;  1RJO A;  2O3O A;  2INX A;  1JNQ A;  3L0R A;  1TFO A;  3JVC A;  3CNM A;  1VQ5 3;  4IT7 A;  1SQW A;  5FW5 A;  2LQV A;  3FLJ A;  4EYC A;  1RN7 A;  4ZM8 A;  5KP4 A;  3CC7 3;  2QGU A;  2Z76 A;  1UI7 A;  4BTW A;  1WMO A;  3EQQ B;  3F8H A;  2ML6 A;  2P38 A;  1JRQ A;  1FGM A;  1W2Z A;  4L7K A;  3KII A;  4L8P A;  3V98 A;  4Q53 A;  4WYK B;  2P05 A;  1GD4 A;  3NM2 A;  2W9P A;  1YIJ 3;  2CFL A;  2CK3 H;  1K9M 4;  1VQ7 3;  1EA2 A;  3WOE B;  3QK9 A;  2W03 A;  1DMN A;  3F14 A;  1LOX A;  2OOV C;  2OCT A;  2CWU A;  1YJN 3;  4HJL B;  3AMO A;  4N6U A;  4FCZ A;  1Q40 B;  4FMA A;  1YHQ 3;  4GL6 A;  1VQ4 3;  3BB9 A;  4AKY A;  4XDV A;  1VQO 3;  3GZX B;  3SED A;  3WOF B;  3VSY A;  1MOL A;  4MMX B;  4OVM A;  1WMP A;  3N9H A;  4LGQ A;  1IU7 A;  4QWT A;  3SVA A;  1LVN A;  4LEH A;  1KWI A;  2P0X A;  2W0Q A;  3WDG B;  1ZO2 A;  5AYS C;  2XGL A;  3SXX A;  4CDL A;  4L8O A;  1CYU A;  1TIJ A;  2P0M A;  3MSO A;  3NV0 B;  4FR9 A;  3DY5 A;  3OWU A;  5FGO A;  1IQX A;  3GZY B;  4CCV A;  3ECF A;  2MC8 A;  1SII A;  4GB5 A;  3CME 3;  1CQS A;  1JKG A;  5A0O B;  3CNX A;  1AV4 A;  1L5G B;  1W02 A;  3CPW 2;  5LC7 A;  4HM1 B;  3EJV A;  4HM3 B;  3LTB A;  3V99 A;  1UUW B;  1FGR A;  3GRD A;  3K9M C;  3BNE A;  1A67 A;  1OH0 A;  4PEJ A;  3JUM A;  2YX9 A;  3CU3 A;  3S67 A;  3BNB A;  1PFP A;  2KRT A;  2HMK B;  2CWV A;  5IEN A;  3FH1 A;  3PCS A;  1DMM A;  4G1M B;  4RNY A;  3K7C A;  1QVG 2;  4OK0 A;  3DM8 A;  1IVV A;  2GU3 A;  2PNC A;  5AIF A;  1JV2 B;  5ELJ A;  2HMN B;  2P09 A;  1K41 A;  3DGN A;  4KFE A;  1W6Y A;  1WMN A;  1GY6 A;  1QJG A;  4WP5 A;  4X2H A;  1NJI 4;  1VQ9 3;  1IT8 A;  3CCV 3;  1DYU A;  3MHE A;  3LT9 A;  4K90 B;  3FCS B;  1F8N A;  5G2G A;  3T8N A;  1MNL A;  1M90 4;  1OF5 A;  4NHF A;  1YJ9 3;  3EE1 A;  2XSH B;  5IG3 A;  4TX4 A;  3H3H A;  3CD6 3;  3PCR A;  1ROA A;  3MG1 A;  1OCV A;  2GXF A;  3GZR A;  4O2H A;  3NQZ A;  5DRV A;  1STF I;  3BLZ A;  4NRE A;  1OHS A;  2WO0 A;  3WOD G;  1Z1S A;  1O7N B;  2L4V A;  4HM5 B;  3RDE A;  4XBX A;  1S5A A;  4XDW A;  1YVB I;  2CFW A;  3B7C A;  1IV7 A;  3FF0 A;  4LMI A;  3FZW A;  3G6E 3;  3CC4 3;  3LZA A;  3NBJ A;  3AMO B;  1BUQ A;  4FMB A;  1NWW A;  2GBX B;  4R9K A;  1O7G B;  3MG3 A;  4XBT A;  5TGN A;  1N8R 4;  4BTX A;  1W4N A;  1CYV A;  3B4P A;  1JB4 A;  2BO9 B;  1WNH A;  3JUP A;  3KE7 A;  3TDG A;  1JJ2 2;  1IQY A;  1VQL 3;  1UW1 A;  2BT3 A;  2R4I A;  1DVC A;  2HMO B;  2OOV A;  1IV9 A;  3G16 A;  1O7W B;  1TUH A;  3NQY A;  1KSI A;  1Q81 4;  3G0K A;  1GY7 A;  2IA7 A;  4R80 A;  5KP1 A;  2GU1 A;  4EV5 A;  2F86 B;  3EC9 A;  2I9W A;  2GEX A;  1OPY A;  3UNL A;  3HI7 A;  3HIG A;  1YGE A;  3N54 B;  3PXM A;  1K28 A;  1Q86 4;  1D6Z A;  1NU3 A;  3V92 A;  2M7O A;  2MF7 A;  2OWP A;  4KFD A;  4N6O B;  2B1X B;  3X3X A;  2CC3 A;  2WGO A;  3PZW A;  3EN8 A;  1VQ8 3;  2Q07 A;  3F7S A;  1LNH A;  4IIA A;  1VQ6 3;  3JUO A;  1FGT A;  2RGQ A;  2YFL B;  3UJM A;  2OQE C;  3EF8 A;  4KZ1 A;  1FGQ A;  1WTH A;  4XB5 A;  2YFI B;  1W2B 2;  1ROV A;  4H61 A;  1A2V A;  3J7Y d;  1NO3 A;  1GD3 A;  6STD A;  1SJW A;  4IPB A;  7STD A;  3EN1 B;  2Z7A A;  3QRD A;  3K63 A;  3FG1 A;  5EVH A;  1GYB A;  5EEO A;  1KQS 2;  4K61 A;  2ML5 A;  2RCD A;  3CPO A;  4LSO A;  1YI2 3;  2STD A;  2GEY A;  2WOH A;  5DRE A;  3K5T A;  3MPH A;  4R9L A;  4KVH A;  3NBB A;  4I4K A;  1E97 A;  3X3Z A;  3WA3 A;  3I55 3;  4MMZ B;  5EQL A;  2D42 A;  4HVN A;  1AR0 A;  3I0Y A;  3SX1 A;  2K54 A;  1QAL A;  3HX8 A;  1T5Y A;  1SPU A;  1TFK A;  1U8C B;  1Q82 4;  1AVL A;  2YFJ B;  2WOF A;  3VGN A;  2BNG A;  1OAC A;  3PS8 A;  5CF1 A;  5KP3 A;  2W9Q A;  4WFO A;  3D3L A;  4MJD A;  3GWR A;  3CCU 3;  1OUN A;  3JUN A;  2HML B;  4HYZ A;  1FA3 A;  4K1U A;  2CFD A;  1U5O A;  4HM7 B;  4O8S A;  2A15 A;  3A76 A;  4STD A;  2FNQ A;  2CIU A;  2XRX B;  1YIT 3;  4AKZ A;  5CK6 A;  4XM4 A;  2ZDJ A;  2BMQ B;  1LXE A;  2W2C A;  3FSD A;  1GS3 A;  3MG2 A;  1OHP A;  3Q1C A;  3RGA A;  5IEP A;  3OW2 2;  5JPP A;  2WGQ A;  1DMQ A;  3HII A;  1YJW 3;  3OX9 A;  3UL6 A;  4FCJ A;  3U1W A;  1M1X B;  4AEQ A;  1EKM A;  3X41 A;  3F9S A;  1D6U A;  4X2O A;  3CCJ 3;  3N8B A;  1US1 A;  1ZX2 A;  4J8T A;  1ISK A;  1IK3 A;  4JRF A;  2PZV A;  1AVK A;  4N6T A;  3FKA A;  3EHC A;  4HM0 B;  3NBR A;  1TP6 A;  2IUJ A;  3X42 A;  2OTJ 3;  4EV2 A;  2W56 A;  2CFK A;  3BNC A;  2K0M A;  3KFQ C;  2CG1 A;  2W6J H;  4LZI A;  4XBY A;  2UX0 A;  2CH9 A;  1IVX A;  3NHX A;  2Z77 A;  1D6Y A;  4N6M A;  5AIH A;  2RSX A;  1N9E A;  4O3V A;  2O9U X;  5CLK A;  3X3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...