3F8HA

Crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
b'NLYFQGMNDTIARYFDAFNAGDTDGMLACLSEDVAHHVNEGNIRVGKEKFAAFCAHMSHCYKEELTDMVIFATPDATRAAAEYTVNGTYLATDEGLPEARQQSYKLPAGSFFDLRDGLITRVTTYYNLSDWIKQVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (YP_611791.1) from SILICIBACTER SP. TM1040 at 2.00 A resolution
rcsb
source organism Silicibacter sp. tm1040
molecule tags Unknown function
total genus 38
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f8hA00
3MKIA 1EG9B 1O7GB 2A15A 2R4IA 1OUNA 1W00A 5BVBA 1OF5A 1GY6A 3CNXA 1OGXA 2Z76A 1JKGA 2RFRA 3JUPA 1IDPA 3JUMA 4FCMA 3EX9A 3G16A 5EVHA 2IMJA 1JB2A 1C7HA 4L8PA 1O7MB 2PZVA 3A76A 4HM2B 4HZBB 4Q53A 3D9RA 1GS3A 1OCVA 1ASKA 1O7PB 1ZO2A 4N3VA 2HMMB 3OV4A 3B8LA 4XBTA 1VZZA 4LGQA 4X2OA 1Q40B 1ULJB 4H3UA 4R1KA 4L8OA 3K7CA 3RGAA 4OUQA 3NV0B 3JUQA 3DM8A 2XRXB 4HM3B 1OGZA 1GYBA 4J8TA 1ZX2A 5CXOA 3BB9A 1OHOA 4KVHA 2Z7AA 3KSPA 1DMQA 1OH0A 4K1UA 2GBXB 3DZLA 3K0ZA 1WQLB 1W02A 3HK4A 2YFLB 5D83A 5DRVA 5AIHA 3ER7A 2XSHB 4LEHA 3BLZA 1STDA 4WP5A 4HM1B 2K54A 5KP1A 3F9SA 3IPTA 3JUNA 3VSYA 5IF6A 2GBWB 3MHEA 4RZMA 3G0KA 2B24B 1ULIB 3NBRA 3LYGA 5KP3A 1HKXA 2XR8B 1Q42A 1GY7A 4HM4B 2HMOB 3SOYA 1EA2A 3OWUA 5CLKA 3HX8A 3NHXA 3G8ZA 3CPOA 3SEDA 3DMCA 5JPUA 1TP6A 2CKFB 3UNLA 4U13A 4L7KA 5HGRA 1Q40A 8CHOA 3WMDA 3EN8A 3FLJA 3EBYA 5AIGA 4I4KA 3GWRA 5AEWB 2I9WA 2OWPA 2B1XB 5STDA 3NV0A 3ECFA 1W01A 3DUKA 3NXJA 6STDA 3SOAA 5CF1A 1E97A 1DMNA 4HM6B 4MJDA 3H3HA 3OX9A 3OWYA 1O7NB 2UX0A 3MG3A 1W6YA 2GEYA 4HM0B 2YFJB 3EJVA 5AIFA 1JN5A 2HMNB 1ISKA 5D82A 5TGNA 3NUVA 5IG5A 3EN1B 1SJWA 4XB5A 3MSOA 2BMQB 1O7WB 3B7CA 3B4PA 3OWSA 1TUHA 5CK6A 1Z1SA 1A2KA 4J9AA 1JB5A 4XM4A 4HM5B 2W2CA 5IENA 4WYKB 4HM7B 3F7XA 3S5CA 7STDA 3LZAA 1JN5B 3RGRA 3GZRA 3ROBA 1DMMA 4HZ9B 1K41A 3KZTA 3GRDA 5IG3A 3FKAA 3FSDA 4HKVB 5IEPA 2HMJB 5IG0A 1E3VA 2HMLB 1NU3A 5FW5A 2XSOB 3GZYB 1JB4A 1OHPA 4LMIA 2HMKB 3DXOA 4FCJA 4X2HA 3EF8A 3F40A 4STDA 3KKGA 4XDWA 5AIIA 5JPPA 3M8CA 3VGNA 5BXQA 4HJLB 5IG4A 1QMAA 1NWWA 4XDVA 1UUVB 2GXFA 3GZXB 3KE7A 3UJMA 1UUWB 2BMRB 2F86B 4OVMA 4GB5A 5G2GA 3EC9A 4XBYA 2F99A 1NDOB 5DREA 2RGQA 4WYKA 1OHSA 3JUOA 2QGUA 2RCDA 3NM2A 3E99A 4CDLA 3B4OA 3T8NA 5IEOA 3MG1A 1CQSA 5AEUB 2BNGA 3EQQB 3STDA 4HM8B 4PEJA 2STDA 3HZPA 2Z77A 3F8XA 4R9KA 3CU3A 2F98A 3I0YA 1OF5B 2JQ5A 4IIAA 1JKGB 3CNMA 3FF2A 2GEXA 3FH1A 1AR0A 3Q90A 2CHCA 2QIYA 3F7SA 1U5OA 3FF0A 4ORLA 1O7HB 1BUQA 3T8UA 3FGYA 5D81A 5KP4A 3EHCA 4XBXA 5CF2A 2BMOB 3H51A 1QJGA 5AI1A 4K1VA 1GY5A 1S5AA 1OPYA 4HVNA 2INXA 3EBTA 3MYTA 3GZBA 4R9LA 3FZWA 5IERA 3F14A 2YFIB 1E3RA 4WWUC 3MG2A 3F8HA 3OXAA
chains in the Genus database with same CATH superfamily
1T2HA 3MKIA 1EG9B 1FGMA 1TFKA 3G713 1O7GB 3DGNA 1NB5I 2A15A 1I2FA 2R4IA 1OUNA 1W00A 3KCHA 1UCKA 4MMXB 1ZGXA 2UGIA 3D5GA 5M1AA 7RNTA 5BVBA 1JNQA 4FR9A 1OF5A 2ZHXB 1GY6A 1IVVA 3CNXA 8RNTA 1OGXA 2Z76A 3PXMA 4WHAA 1JKGA 2RFRA 3JUPA 1IDPA 5AYSC 1B2UA 3JUMA 4FCMA 3EX9A 4BL2A 2E2VA 1T5YA 2IYJA 3G16A 4GSPA 2IMJA 3QK9A 1JB2A 3L0RA 3HOHA 5EVHA 3S67A 3CCL3 1C7HA 3G4S3 1Y4KA 1NO3A 2P05A 1PFPA 2CIUA 4L8PA 3LTBA 1O7MB 1NNVA 2PZVA 3A76A 1RN7A 1FGQA 3A5EA 4FMBA 4MMZB 4H61A 2ML5A 4HM2B 4HZBB 4Q53A 2QA43 3D3LA 1MWRA 3D9RA 1GS3A 5ELUA 4HOHA 1WTHA 1OCVA 5LC6A 1D6ZA 1A2PA 3D5IA 1ASKA 1IK3A 2CH9A 1G02A 4RNYA 1BNRA 1IU7A 1O7PB 1U8CB 1STFI 1ZO2A 4O2HA 1FUWA 1AY7A 1RDSA 5EQLA 1VQ93 1YI23 4N3VA 2HMMB 3OV4A 3I563 3B8LA 1TIJA 3K9MC 2E2UA 4R4KA 1BSDA 2CFDA 3V99A 3JVCA 4XBTA 5GSPA 1VZZA 4LGQA 1EEJA 4X2OA 1Q40B 2JDIH 1VQM3 1RCLA 3I553 1FGRA 4FMCA 1X1XA 4AEQA 2SARA 1J2BA 4IT7A 1BNJA 1EQKA 1ULJB 1DE3A 1B20A 1R4CA 4N6OB 1JBSA 1IV7A 1TTOA 2GU3A 1I2EA 1BNSA 4H3UA 2J8XB 4HBRA 4R1KA 4L8OA 3K7CA 3PGBA 3KN4A 3RGAA 4GL6A 3Q1CA 2F56A 4N6V0 1IQXA 2ZA4A 4N6TA 4OUQA 1GMPA 3NV0B 1GD4A 3JUQA 2WOFA 3DM8A 1HU9A 2XRXB 2ZDJA 3PS8A 4HM3B 1JBRA 1OGZA 2XGLA 1GYBA 4J8TA 4O3VA 3LOYA 2Z6BA 1ZX2A 5CXOA 1K9M4 3HI7A 1VQ43 2OTJ3 3BB9A 4BU4A 4AKZA 1TRQA 3DGOA 4KFDA 1OHOA 4KVHA 2HOHA 2Z7AA 2WO0A 2XEPA 3KSPA 1DMQA 4O02B 1OH0A 2XFSA 4K1UA 3MWZA 5G1LA 2GBXB 1V57A 3DZLA 5M19A 1WMPA 3K0ZA 4TX4A 1WQLB 1W02A 3X3YA 3HK4A 3DGMA 1VQN3 1AVKA 2YFLB 2BIRA 4FCZA 5D83A 2FXTA 4J5KA 3PYJA 5DRVA 2L4VA 3ER7A 5AIHA 1BANA 3GSPA 3BNEA 1UDII 3V92A 2XSHB 4LEHA 3LT8A 3BLZA 1STDA 1RJOA 4WP5A 1B3SA 1GD3A 2CFLA 4HM1B 2FNQA 4EV2A 2K54A 3UL6A 1BRNL 5KP1A 1MNLA 3F9SA 3IPTA 1PY3A 5BU4A 5FGOA 3JUNA 3VSYA 5M18A 2CC3A 4EYCA 5IF6A 1GOUA 3LXUX 1FW7A 1RMSA 1DYUA 2F4YA 1RCKA 1KD14 1YJ93 2GBWB 3MHEA 4NPBA 4RZMA 2P0MA 3G0KA 2B24B 1ULIB 3K63A 3NBRA 1I2GA 3LYGA 1I8VA 1VQP3 1N8QA 1RNTA 1RRLA 1GMQA 5KP3A 1HKXA 2XR8B 1RGGA 1W6GA 4R80A 1Q42A 1BRJA 1UCLA 2P38A 1N9EA 1BRHA 1GY7A 4RBNA 4HM4B 1YGWA 2HMOB 3VF1A 1JJ22 3SOYA 1SIIA 1YVSA 1EA2A 3FG4A 3S29A 4RNZA 3OWUA 3CXC2 5CLKA 1I0XA 1UI8A 3HX8A 3NHXA 1MWUA 3G8ZA 1VQL3 3CPOA 3SEDA 1Q7Y4 3BNBA 3DMCA 3DY5A 1BRSA 3PCSA 5JPUA 1NB3I 1TP6A 2CKFB 3UNLA 1C54A 4U13A 4L7KA 1BIRA 1Q40A 3KSED 5HGRA 1EUIC 8CHOA 3WMDA 5EEOA 3EN8A 4LSOA 2CG1A 3G6E3 3SXXA 1YIJ3 3FLJA 4MEIA 3EBYA 2KXGA 1Q864 5AIGA 3AGOA 1GOYA 1US1A 1BOXA 1BNGA 3URPA 4FMDA 1FGTA 1I3FA 3GWRA 4I4KA 1WMNA 1G0TA 3RDEA 2H0HA 2I9WA 5AEWB 1GSPA 1V58A 2ZL8A 4LYLB 2OWPA 1IYYA 2B1XB 1VQ73 5STDA 3NV0A 2CK3H 3ECFA 1ROVA 1RRHA 1W01A 1QVF2 4RNTA 3DUKA 3NXJA 2IUJA 1UGIA 6STDA 1BGSA 1W2B2 3CCJ3 1BSAA 3SOAA 5CF1A 5RNTA 1LVNA 1WMOA 3AGNA 2MF7A 3UL5A 1E97A 1RGLA 3LTCA 3X3XA 1DMNA 4HM6B 4MJDA 1SPUA 3H3HA 1B27A 1LXEA 3OX9A 3OWYA 1O7NB 3PZWA 2UX0A 3BIRA 2IA7A 3MG3A 1DVCA 1W6YA 3CD63 2RBIA 2GEYA 4HM0B 2YFJB 1RN1A 3EJVA 4N6MA 5AIFA 1JN5A 1JV2B 1RGFA 2CFGA 2HMNB 1LNHA 1ISKA 1RGEA 2F5MA 1UCIA 2MC8A 2CWUA 1X1YA 5D82A 1LQMB 3D4AA 3O8YA 5TGNA 4EV5A 1FUSA 2YX9A 3NUVA 1G96A 1MOLA 5IG5A 3EN1B 5ELJA 2OQEA 3SVAA 1RLSA 1SJWA 2SBLA 4XB5A 3MSOA 2BMQB 2CWVA 1HYFA 1BUJA 1O7WB 3T0UA 4G1MB 3B7CA 1QAKA 1CYVA 1I0VA 7GSPA 3B4PA 1A67A 3OWSA 4EBGA 2CG0A 3DH2A 1BU4A 1FYSA 4O8SA 1A90A 1T2IA 5LC7A 1TUHA 1Z1SA 4J9AA 1A2KA 5CK6A 4QWTA 1JB5A 3LMLA 1N8R4 5HOHA 1JRQA 1Q7HA 3CCU3 4XM4A 1M1XB 2W2CA 4HM5B 5IENA 3WOEB 1MWTA 1W6CA 2LQVA 3BU4A 3LT9A 4WYKB 2W6JH 3J7Yd 1VQO3 1BSBA 2OTL3 4EC6A 4AKYA 1IQ8A 1I70A 1YVBI 3F7XA 4HM7B 3AMOB 3S5CA 3Q2PA 2GSPA 4MMYB 1X1WA 3LZAA 7STDA 2CX0A 1JN5B 4N6NB 3RGRA 3GZRA 3ROBA 1RSNA 1BSEA 4ZM8A 4JF8A 3IMAB 1DMMA 1EKMA 3WA2X 4HZ9B 1K41A 3KZTA 3WR2A 3CMA3 4JRFA 3GRDA 4IPBA 3MPHA 4CPKA 2W04A 1QVG2 1W5ZA 4HAAA 5A0OB 5IG3A 1GMRA 1IQYA 3FKAA 1IVUA 2BHMA 3FSDA 4J5GA 2RSXA 3U1WA 4HKVB 1KSIA 2BU4A 2AADA 1YIT3 5IEPA 2XGNA 1YJW3 2HMJB 5IG0A 1E3VA 2HMLB 1NU3A 5FW5A 4BL3A 1MGWA 3CME3 1SQWA 2XSOB 3GZYB 3LTDA 1RGCA 1JB4A 1OHPA 2QEX3 1IT7A 2IUKA 4N6LA 1QALA 4LMIA 4CJNA 2W9QA 3CCQ3 2HMKB 3CCR3 3SLUA 1CEWI 3DXOA 1TU5A 1VQK3 4FCJA 4X2HA 1M904 3FCSB 3EF8A 1SARA 3F40A 3LTAA 3NQZA 4STDA 5AYRB 1TRPA 1BSCA 3KKGA 4XDWA 1PU4A 1M9GA 5AIIA 5JPPA 1D6UA 3ZG0A 3NBJA 4EW5A 3M8CA 3VGNA 2OOVA 4HJLB 5BXQA 5IG4A 1RGKA 2CW9A 1QMAA 3NQYA 2KF4A 3X40A 1NWWA 1TFOA 4K90B 1IVWA 4XDVA 1B2MA 3AHWA 3UB1A 1V74A 2C11A 2K0MA 1UUVB 1FUTA 2IY2A 1KC84 2GXFA 1LOYA 1BAOA 1BNEA 3GZXB 3KE7A 3UJMA 4BTXA 2P09A 1UUWB 1CYUA 1GOVA 2W03A 2BMRB 3NX0A 2WGQA 5JBSA 2BO9B 4ILFA 2C4BA 1RTUA 3NM7A 1FGOA 2F5WA 2F86B 2Y73A 3BNCA 4OVMA 1B2SA 4GB5A 5I97A 2W56B 5G2GA 2R41A 1Q814 3EE1A 1BVIA 3EC9A 2CFKA 4I5QA 1N9JA 3OW22 1B2ZA 1UI7A 4XBYA 1VQ53 2F99A 2ML6A 4BTWA 3PCRA 3KFQC 1LOWA 4KZ1A 1DVDA 2OOVC 1NDOB 5DREA 2RGQA 1N5HA 3SX1A 1RN4A 4CCVA 5BIRA 3IJEB 1ZS7A 1BNFA 4NHFA 4WYKA 1OHSA 2H0IA 3JUOA 2QGUA 2RCDA 2XFTA 4GHOA 1YJN3 3NM2A 3E99A 4CDLA 3AMOA 3B4OA 1W4NA 1LOXA 2C10A 2Y74A 1VQQA 2KF6A 2E2TA 1UW1A 3MG1A 5IEOA 3T8NA 3X42A 6RNTA 1CQSA 2D1WA 1IV9A 1YHQ3 5AEUB 2O9UX 2BNGA 2W9PA 2OCTA 3FG3A 3EQQB 3STDA 1IT8A 3CCS3 2W0QA 1FZUA 4HM8B 1LNIA 4PEJA 2STDA 3HZPA 2Z77A 3AHSA 3F8XA 4N6UA 1T3BA 2KRTA 3ZG5A 4R9KA 1VQ83 3DGYA 3WDGB 3CU3A 3HIIA 3N9HA 2CFWA 2F98A 1ROAA 1W7CA 3EB8A 3V98A 2GU1A 3WA3A 1RHLA 1RGAA 3I0YA 1OF5B 1FA3A 3WOFB 4KT3B 4NREA 2JQ5A 1HZ1A 1IVXA 1KWIA 2FGTA 4IIAA 4WFOA 1LOVA 1BRIA 2KF3A 1JKGB 2XH9A 3CNMA 3FF2A 4DKIA 1PYLA 2GEXA 1JZOA 2M7OA 5G1KA 3FH1A 3WODG 6GSPA 1AR0A 3Q90A 2L1SA 9RNTA 2CHCA 3GAXA 1YGEA 1WNHA 2P0XA 1F8NA 3CC73 1TJDA 1Q9EA 3DGLA 2QIYA 3F7SA 3HIGA 3CC23 1U5OA 4LZIA 1L5GB 3LH4A 2K3DA 3FF0A 4ORLA 3TDGA 2OQEC 1N5PA 1LQGC 3CCE3 1MGRA 1K28A 1R4YA 2BT3A 2LYXA 1O7HB 4K61A 5IW9A 1BUQA 3T8UA 3FGYA 1QAFA 5D81A 5KP4A 1LRAA 1NJI4 1B2XA 1MWSA 4EXRA 3EHCA 1OACA 3N8BA 3Q3FA 1RGHA 4XBXA 1YNVX 3CPW2 3CC43 1UGHI 2H0GA 3X3ZA 5CF2A 2BMOB 2V1LA 3H51A 4KFFA 1QJGA 5AI1A 3RNTA 2WOHA 2KF5A 2XF3A 4OK0A 2UUGC 1RKYA 4BTYA 3NBBA 4K1VA 1W2ZA 2W56A 3FG1A 1AQZA 1GY5A 1S5AA 2CX1A 1K734 1BRGA 1JBTA 2D42A 1OPYA 1VQ63 1UUGB 4HVNA 2INXA 3CCV3 1BRKA 2AAEA 3EBTA 1D6YA 2Q07A 3ZFZA 3MYTA 3WHOA 1AVLA 2KCDA 3SYUA 1DETA 3GZBA 4BIRA 1I3IA 4R9LA 1A2VA 3CCM3 1AV4A 1B21A 1UCJA 3FZWA 3KIIA 5IERA 1S723 1Q824 1RNBA 2CWTA 1SIHA 3F14A 3N54B 3U97A 4FMAA 2RNTA 2YFIB 1CH0A 3BNDA 1X1UA 3S27A 3K5TA 2WGOA 4KFEA 2O3OA 3ALAA 1K8A4 3D79A 1E3RA 2KAAA 1JZDA 3X41A 1M1K4 4WWUC 1BNIA 4HYZA 3MG2A 3F8HA 3OXAA 3S28A 3QRDA 2PNCA 1KQS2
chains in the Genus database with same CATH topology
3MKIA 1EG9B 1FGMA 1TFKA 3G713 1O7GB 3DGNA 1NB5I 2A15A 2R4IA 1OUNA 1W00A 4MMXB 5BVBA 1JNQA 4FR9A 1OF5A 1GY6A 1IVVA 3CNXA 1OGXA 2Z76A 3PXMA 4WHAA 1JKGA 2RFRA 3JUPA 1IDPA 5AYSC 3JUMA 4FCMA 3EX9A 2E2VA 1T5YA 3G16A 5EVHA 2IMJA 3QK9A 1JB2A 3L0RA 3CCL3 3S67A 1C7HA 3G4S3 1Y4KA 1NO3A 2P05A 1PFPA 2CIUA 4L8PA 3LTBA 1O7MB 2PZVA 3A76A 1RN7A 1FGQA 4FMBA 4MMZB 4H61A 2ML5A 4HM2B 4HZBB 4Q53A 2QA43 3D3LA 3D9RA 1GS3A 5ELUA 1WTHA 1OCVA 5LC6A 1D6ZA 1ASKA 1IK3A 2CH9A 4RNYA 1IU7A 1O7PB 1U8CB 1STFI 1ZO2A 4O2HA 1FUWA 5EQLA 1VQ93 1YI23 4N3VA 2HMMB 3OV4A 3I563 3B8LA 1TIJA 3K9MC 2E2UA 4R4KA 2CFDA 3V99A 3JVCA 4XBTA 1VZZA 4LGQA 4X2OA 1Q40B 2JDIH 1VQM3 3I553 1FGRA 4FMCA 1J2BA 4AEQA 1EQKA 4IT7A 1ULJB 1R4CA 4N6OB 1IV7A 2GU3A 4HBRA 4H3UA 4R1KA 4L8OA 3K7CA 3PGBA 3KN4A 3RGAA 4GL6A 3Q1CA 4N6V0 4N6TA 1IQXA 4OUQA 3NV0B 1GD4A 3JUQA 2WOFA 3DM8A 1HU9A 2XRXB 2ZDJA 3PS8A 4HM3B 1OGZA 2XGLA 1GYBA 4J8TA 4O3VA 3LOYA 2Z6BA 1ZX2A 5CXOA 1K9M4 3HI7A 1VQ43 2OTJ3 3BB9A 4AKZA 4KFDA 3DGOA 1OHOA 4KVHA 2Z7AA 2WO0A 2XEPA 3KSPA 1DMQA 4O02B 1OH0A 2XFSA 4K1UA 3MWZA 2GBXB 3DZLA 1WMPA 3K0ZA 4TX4A 1WQLB 1W02A 3X3YA 3HK4A 3DGMA 1VQN3 1AVKA 2YFLB 4FCZA 5D83A 2FXTA 3PYJA 5DRVA 2L4VA 3ER7A 5AIHA 3BNEA 3V92A 2XSHB 4LEHA 3LT8A 3BLZA 1STDA 1RJOA 4WP5A 1GD3A 4HM1B 2CFLA 2FNQA 4EV2A 2K54A 3UL6A 5KP1A 1MNLA 3F9SA 3IPTA 5FGOA 3JUNA 3VSYA 2CC3A 4EYCA 5IF6A 3LXUX 1DYUA 1KD14 1YJ93 2GBWB 3MHEA 4RZMA 2P0MA 3G0KA 2B24B 1ULIB 3K63A 3NBRA 3LYGA 1VQP3 1N8QA 1RRLA 5KP3A 1HKXA 2XR8B 1W6GA 4R80A 1Q42A 2P38A 1N9EA 1GY7A 4RBNA 4HM4B 1JJ22 2HMOB 3VF1A 3SOYA 1SIIA 1EA2A 3FG4A 3S29A 4RNZA 3OWUA 3CXC2 5CLKA 1UI8A 3HX8A 3NHXA 3G8ZA 1VQL3 3CPOA 3SEDA 1Q7Y4 3BNBA 3DMCA 3DY5A 3PCSA 5JPUA 1NB3I 1TP6A 2CKFB 3UNLA 4U13A 4L7KA 3KSED 1Q40A 5HGRA 8CHOA 3WMDA 5EEOA 3EN8A 4LSOA 2CG1A 3G6E3 3SXXA 1YIJ3 3FLJA 4MEIA 3EBYA 2KXGA 1Q864 5AIGA 1US1A 4FMDA 1FGTA 3GWRA 4I4KA 1WMNA 5AEWB 3RDEA 2I9WA 2ZL8A 2OWPA 2B1XB 1VQ73 5STDA 3NV0A 2CK3H 3ECFA 1ROVA 1RRHA 1W01A 1QVF2 3DUKA 3NXJA 2IUJA 6STDA 1W2B2 3CCJ3 3SOAA 5CF1A 1LVNA 1WMOA 2MF7A 3UL5A 1E97A 3LTCA 3X3XA 1DMNA 4HM6B 4MJDA 1SPUA 3H3HA 1LXEA 3OX9A 3OWYA 1O7NB 3PZWA 2UX0A 3MG3A 2IA7A 1DVCA 1W6YA 3CD63 2GEYA 4HM0B 2YFJB 3EJVA 4N6MA 5AIFA 1JN5A 1JV2B 2CFGA 2HMNB 1ISKA 1LNHA 2MC8A 2CWUA 5D82A 3O8YA 5TGNA 4EV5A 2YX9A 3NUVA 1G96A 1MOLA 5IG5A 3EN1B 5ELJA 2OQEA 3SVAA 1SJWA 2SBLA 4XB5A 3MSOA 2BMQB 2CWVA 1O7WB 3T0UA 4G1MB 3B7CA 1QAKA 1CYVA 3B4PA 1A67A 3OWSA 4EBGA 2CG0A 4O8SA 1A90A 5LC7A 1TUHA 1Z1SA 4J9AA 1A2KA 5CK6A 4QWTA 1JB5A 3LMLA 1N8R4 1JRQA 3CCU3 4XM4A 1M1XB 2W2CA 4HM5B 5IENA 3WOEB 4WYKB 1W6CA 2LQVA 3LT9A 3J7Yd 2W6JH 1VQO3 2OTL3 4EC6A 4AKYA 1IQ8A 1YVBI 3F7XA 4HM7B 3S5CA 3AMOB 7STDA 3Q2PA 4MMYB 3LZAA 4N6NB 1JN5B 3RGRA 3GZRA 3ROBA 4ZM8A 4JF8A 3IMAB 1DMMA 1EKMA 3WA2X 4HZ9B 1K41A 3KZTA 3CMA3 4JRFA 3GRDA 4IPBA 3MPHA 2W04A 1QVG2 1W5ZA 5A0OB 5IG3A 1IQYA 3FKAA 1IVUA 2BHMA 3FSDA 3U1WA 2RSXA 4HKVB 1KSIA 1YIT3 5IEPA 2XGNA 1YJW3 2HMJB 5IG0A 1E3VA 2HMLB 1NU3A 5FW5A 3CME3 1SQWA 2XSOB 3GZYB 3LTDA 1JB4A 1OHPA 2QEX3 1IT7A 2IUKA 4N6LA 1QALA 4LMIA 2W9QA 3CCQ3 2HMKB 3CCR3 3SLUA 1CEWI 3DXOA 1TU5A 1VQK3 4FCJA 4X2HA 1M904 3FCSB 3EF8A 3F40A 3LTAA 3NQZA 4STDA 5AYRB 3KKGA 4XDWA 1PU4A 1M9GA 5AIIA 5JPPA 1D6UA 3NBJA 3M8CA 3VGNA 2OOVA 4HJLB 5BXQA 5IG4A 2CW9A 1QMAA 3NQYA 3X40A 1NWWA 1TFOA 4K90B 1IVWA 4XDVA 3UB1A 1V74A 2C11A 2K0MA 1UUVB 1KC84 2GXFA 3GZXB 3KE7A 3UJMA 4BTXA 2P09A 1UUWB 1CYUA 2W03A 2BMRB 3NX0A 2WGQA 5JBSA 2BO9B 3NM7A 1FGOA 2F86B 3BNCA 2Y73A 4OVMA 4GB5A 5I97A 2W56B 5G2GA 1Q814 3EE1A 3EC9A 2CFKA 1N9JA 3OW22 1UI7A 4XBYA 1VQ53 2F99A 2ML6A 4BTWA 3PCRA 3KFQC 1DVDA 4KZ1A 2OOVC 1NDOB 5DREA 2RGQA 1N5HA 3SX1A 4CCVA 3IJEB 4NHFA 4WYKA 1OHSA 3JUOA 2QGUA 2RCDA 2XFTA 1YJN3 3NM2A 3E99A 4CDLA 3AMOA 3B4OA 1W4NA 1LOXA 2C10A 2Y74A 3X42A 3T8NA 2E2TA 1UW1A 3MG1A 5IEOA 1CQSA 2D1WA 1IV9A 1YHQ3 5AEUB 2O9UX 2BNGA 2W9PA 2OCTA 3FG3A 3EQQB 3STDA 1IT8A 3CCS3 2W0QA 4HM8B 4PEJA 2STDA 3HZPA 2Z77A 3F8XA 4N6UA 2KRTA 1VQ83 4R9KA 3WDGB 3CU3A 3HIIA 3N9HA 2CFWA 2F98A 1ROAA 1W7CA 3EB8A 3V98A 2GU1A 3WA3A 3I0YA 1OF5B 1FA3A 3WOFB 4NREA 2JQ5A 1IVXA 1KWIA 2FGTA 4IIAA 4WFOA 1JKGB 2XH9A 3CNMA 3FF2A 2GEXA 2M7OA 3FH1A 3WODG 1AR0A 3Q90A 2CHCA 3GAXA 1YGEA 1WNHA 2P0XA 1F8NA 3CC73 3DGLA 2QIYA 3F7SA 3HIGA 3CC23 1U5OA 4LZIA 1L5GB 3LH4A 3FF0A 4ORLA 3TDGA 2OQEC 1N5PA 3CCE3 1K28A 2BT3A 2LYXA 4K61A 1O7HB 5IW9A 1BUQA 3T8UA 3FGYA 1QAFA 5D81A 5KP4A 1NJI4 4EXRA 3EHCA 1OACA 3N8BA 4XBXA 3CPW2 3CC43 3X3ZA 5CF2A 2BMOB 2V1LA 3H51A 4KFFA 1QJGA 5AI1A 2WOHA 2XF3A 4OK0A 1RKYA 4BTYA 3NBBA 4K1VA 1W2ZA 2W56A 3FG1A 1GY5A 1S5AA 1K734 2D42A 1OPYA 1VQ63 4HVNA 3CCV3 2INXA 3EBTA 1D6YA 2Q07A 3MYTA 1AVLA 2KCDA 3GZBA 4R9LA 1A2VA 3CCM3 1AV4A 3KIIA 1S723 3FZWA 1Q824 5IERA 2CWTA 1SIHA 3F14A 3N54B 3U97A 4FMAA 2YFIB 3BNDA 3S27A 3K5TA 2WGOA 4KFEA 2O3OA 3ALAA 1K8A4 1E3RA 3X41A 1M1K4 4WWUC 4HYZA 3MG2A 3F8HA 3OXAA 3S28A 3QRDA 2PNCA 1KQS2
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKI A;  1EG9 B;  1O7G B;  2A15 A;  2R4I A;  1OUN A;  1W00 A;  5BVB A;  1OF5 A;  1GY6 A;  3CNX A;  1OGX A;  2Z76 A;  1JKG A;  2RFR A;  3JUP A;  1IDP A;  3JUM A;  4FCM A;  3EX9 A;  3G16 A;  5EVH A;  2IMJ A;  1JB2 A;  1C7H A;  4L8P A;  1O7M B;  2PZV A;  3A76 A;  4HM2 B;  4HZB B;  4Q53 A;  3D9R A;  1GS3 A;  1OCV A;  1ASK A;  1O7P B;  1ZO2 A;  4N3V A;  2HMM B;  3OV4 A;  3B8L A;  4XBT A;  1VZZ A;  4LGQ A;  4X2O A;  1Q40 B;  1ULJ B;  4H3U A;  4R1K A;  4L8O A;  3K7C A;  3RGA A;  4OUQ A;  3NV0 B;  3JUQ A;  3DM8 A;  2XRX B;  4HM3 B;  1OGZ A;  1GYB A;  4J8T A;  1ZX2 A;  5CXO A;  3BB9 A;  1OHO A;  4KVH A;  2Z7A A;  3KSP A;  1DMQ A;  1OH0 A;  4K1U A;  2GBX B;  3DZL A;  3K0Z A;  1WQL B;  1W02 A;  3HK4 A;  2YFL B;  5D83 A;  5DRV A;  5AIH A;  3ER7 A;  2XSH B;  4LEH A;  3BLZ A;  1STD A;  4WP5 A;  4HM1 B;  2K54 A;  5KP1 A;  3F9S A;  3IPT A;  3JUN A;  3VSY A;  5IF6 A;  2GBW B;  3MHE A;  4RZM A;  3G0K A;  2B24 B;  1ULI B;  3NBR A;  3LYG A;  5KP3 A;  1HKX A;  2XR8 B;  1Q42 A;  1GY7 A;  4HM4 B;  2HMO B;  3SOY A;  1EA2 A;  3OWU A;  5CLK A;  3HX8 A;  3NHX A;  3G8Z A;  3CPO A;  3SED A;  3DMC A;  5JPU A;  1TP6 A;  2CKF B;  3UNL A;  4U13 A;  4L7K A;  5HGR A;  1Q40 A;  8CHO A;  3WMD A;  3EN8 A;  3FLJ A;  3EBY A;  5AIG A;  4I4K A;  3GWR A;  5AEW B;  2I9W A;  2OWP A;  2B1X B;  5STD A;  3NV0 A;  3ECF A;  1W01 A;  3DUK A;  3NXJ A;  6STD A;  3SOA A;  5CF1 A;  1E97 A;  1DMN A;  4HM6 B;  4MJD A;  3H3H A;  3OX9 A;  3OWY A;  1O7N B;  2UX0 A;  3MG3 A;  1W6Y A;  2GEY A;  4HM0 B;  2YFJ B;  3EJV A;  5AIF A;  1JN5 A;  2HMN B;  1ISK A;  5D82 A;  5TGN A;  3NUV A;  5IG5 A;  3EN1 B;  1SJW A;  4XB5 A;  3MSO A;  2BMQ B;  1O7W B;  3B7C A;  3B4P A;  3OWS A;  1TUH A;  5CK6 A;  1Z1S A;  1A2K A;  4J9A A;  1JB5 A;  4XM4 A;  4HM5 B;  2W2C A;  5IEN A;  4WYK B;  4HM7 B;  3F7X A;  3S5C A;  7STD A;  3LZA A;  1JN5 B;  3RGR A;  3GZR A;  3ROB A;  1DMM A;  4HZ9 B;  1K41 A;  3KZT A;  3GRD A;  5IG3 A;  3FKA A;  3FSD A;  4HKV B;  5IEP A;  2HMJ B;  5IG0 A;  1E3V A;  2HML B;  1NU3 A;  5FW5 A;  2XSO B;  3GZY B;  1JB4 A;  1OHP A;  4LMI A;  2HMK B;  3DXO A;  4FCJ A;  4X2H A;  3EF8 A;  3F40 A;  4STD A;  3KKG A;  4XDW A;  5AII A;  5JPP A;  3M8C A;  3VGN A;  5BXQ A;  4HJL B;  5IG4 A;  1QMA A;  1NWW A;  4XDV A;  1UUV B;  2GXF A;  3GZX B;  3KE7 A;  3UJM A;  1UUW B;  2BMR B;  2F86 B;  4OVM A;  4GB5 A;  5G2G A;  3EC9 A;  4XBY A;  2F99 A;  1NDO B;  5DRE A;  2RGQ A;  4WYK A;  1OHS A;  3JUO A;  2QGU A;  2RCD A;  3NM2 A;  3E99 A;  4CDL A;  3B4O A;  3T8N A;  5IEO A;  3MG1 A;  1CQS A;  5AEU B;  2BNG A;  3EQQ B;  3STD A;  4HM8 B;  4PEJ A;  2STD A;  3HZP A;  2Z77 A;  3F8X A;  4R9K A;  3CU3 A;  2F98 A;  3I0Y A;  1OF5 B;  2JQ5 A;  4IIA A;  1JKG B;  3CNM A;  3FF2 A;  2GEX A;  3FH1 A;  1AR0 A;  3Q90 A;  2CHC A;  2QIY A;  3F7S A;  1U5O A;  3FF0 A;  4ORL A;  1O7H B;  1BUQ A;  3T8U A;  3FGY A;  5D81 A;  5KP4 A;  3EHC A;  4XBX A;  5CF2 A;  2BMO B;  3H51 A;  1QJG A;  5AI1 A;  4K1V A;  1GY5 A;  1S5A A;  1OPY A;  4HVN A;  2INX A;  3EBT A;  3MYT A;  3GZB A;  4R9L A;  3FZW A;  5IER A;  3F14 A;  2YFI B;  1E3R A;  4WWU C;  3MG2 A;  3F8H A;  3OXA A; 
#chains in the Genus database with same CATH topology
 1T2H A;  3MKI A;  1EG9 B;  1FGM A;  1TFK A;  3G71 3;  1O7G B;  3DGN A;  1NB5 I;  2A15 A;  1I2F A;  2R4I A;  1OUN A;  1W00 A;  3KCH A;  1UCK A;  4MMX B;  1ZGX A;  2UGI A;  3D5G A;  5M1A A;  7RNT A;  5BVB A;  1JNQ A;  4FR9 A;  1OF5 A;  2ZHX B;  1GY6 A;  1IVV A;  3CNX A;  8RNT A;  1OGX A;  2Z76 A;  3PXM A;  4WHA A;  1JKG A;  2RFR A;  3JUP A;  1IDP A;  5AYS C;  1B2U A;  3JUM A;  4FCM A;  3EX9 A;  4BL2 A;  2E2V A;  1T5Y A;  2IYJ A;  3G16 A;  4GSP A;  2IMJ A;  3QK9 A;  1JB2 A;  3L0R A;  3HOH A;  5EVH A;  3S67 A;  3CCL 3;  1C7H A;  3G4S 3;  1Y4K A;  1NO3 A;  2P05 A;  1PFP A;  2CIU A;  4L8P A;  3LTB A;  1O7M B;  1NNV A;  2PZV A;  3A76 A;  1RN7 A;  1FGQ A;  3A5E A;  4FMB A;  4MMZ B;  4H61 A;  2ML5 A;  4HM2 B;  4HZB B;  4Q53 A;  2QA4 3;  3D3L A;  1MWR A;  3D9R A;  1GS3 A;  5ELU A;  4HOH A;  1WTH A;  1OCV A;  5LC6 A;  1D6Z A;  1A2P A;  3D5I A;  1ASK A;  1IK3 A;  2CH9 A;  1G02 A;  4RNY A;  1BNR A;  1IU7 A;  1O7P B;  1U8C B;  1STF I;  1ZO2 A;  4O2H A;  1FUW A;  1AY7 A;  1RDS A;  5EQL A;  1VQ9 3;  1YI2 3;  4N3V A;  2HMM B;  3OV4 A;  3I56 3;  3B8L A;  1TIJ A;  3K9M C;  2E2U A;  4R4K A;  1BSD A;  2CFD A;  3V99 A;  3JVC A;  4XBT A;  5GSP A;  1VZZ A;  4LGQ A;  1EEJ A;  4X2O A;  1Q40 B;  2JDI H;  1VQM 3;  1RCL A;  3I55 3;  1FGR A;  4FMC A;  1X1X A;  4AEQ A;  2SAR A;  1J2B A;  4IT7 A;  1BNJ A;  1EQK A;  1ULJ B;  1DE3 A;  1B20 A;  1R4C A;  4N6O B;  1JBS A;  1IV7 A;  1TTO A;  2GU3 A;  1I2E A;  1BNS A;  4H3U A;  2J8X B;  4HBR A;  4R1K A;  4L8O A;  3K7C A;  3PGB A;  3KN4 A;  3RGA A;  4GL6 A;  3Q1C A;  2F56 A;  4N6V 0;  1IQX A;  2ZA4 A;  4N6T A;  4OUQ A;  1GMP A;  3NV0 B;  1GD4 A;  3JUQ A;  2WOF A;  3DM8 A;  1HU9 A;  2XRX B;  2ZDJ A;  3PS8 A;  4HM3 B;  1JBR A;  1OGZ A;  2XGL A;  1GYB A;  4J8T A;  4O3V A;  3LOY A;  2Z6B A;  1ZX2 A;  5CXO A;  1K9M 4;  3HI7 A;  1VQ4 3;  2OTJ 3;  3BB9 A;  4BU4 A;  4AKZ A;  1TRQ A;  3DGO A;  4KFD A;  1OHO A;  4KVH A;  2HOH A;  2Z7A A;  2WO0 A;  2XEP A;  3KSP A;  1DMQ A;  4O02 B;  1OH0 A;  2XFS A;  4K1U A;  3MWZ A;  5G1L A;  2GBX B;  1V57 A;  3DZL A;  5M19 A;  1WMP A;  3K0Z A;  4TX4 A;  1WQL B;  1W02 A;  3X3Y A;  3HK4 A;  3DGM A;  1VQN 3;  1AVK A;  2YFL B;  2BIR A;  4FCZ A;  5D83 A;  2FXT A;  4J5K A;  3PYJ A;  5DRV A;  2L4V A;  3ER7 A;  5AIH A;  1BAN A;  3GSP A;  3BNE A;  1UDI I;  3V92 A;  2XSH B;  4LEH A;  3LT8 A;  3BLZ A;  1STD A;  1RJO A;  4WP5 A;  1B3S A;  1GD3 A;  2CFL A;  4HM1 B;  2FNQ A;  4EV2 A;  2K54 A;  3UL6 A;  1BRN L;  5KP1 A;  1MNL A;  3F9S A;  3IPT A;  1PY3 A;  5BU4 A;  5FGO A;  3JUN A;  3VSY A;  5M18 A;  2CC3 A;  4EYC A;  5IF6 A;  1GOU A;  3LXU X;  1FW7 A;  1RMS A;  1DYU A;  2F4Y A;  1RCK A;  1KD1 4;  1YJ9 3;  2GBW B;  3MHE A;  4NPB A;  4RZM A;  2P0M A;  3G0K A;  2B24 B;  1ULI B;  3K63 A;  3NBR A;  1I2G A;  3LYG A;  1I8V A;  1VQP 3;  1N8Q A;  1RNT A;  1RRL A;  1GMQ A;  5KP3 A;  1HKX A;  2XR8 B;  1RGG A;  1W6G A;  4R80 A;  1Q42 A;  1BRJ A;  1UCL A;  2P38 A;  1N9E A;  1BRH A;  1GY7 A;  4RBN A;  4HM4 B;  1YGW A;  2HMO B;  3VF1 A;  1JJ2 2;  3SOY A;  1SII A;  1YVS A;  1EA2 A;  3FG4 A;  3S29 A;  4RNZ A;  3OWU A;  3CXC 2;  5CLK A;  1I0X A;  1UI8 A;  3HX8 A;  3NHX A;  1MWU A;  3G8Z A;  1VQL 3;  3CPO A;  3SED A;  1Q7Y 4;  3BNB A;  3DMC A;  3DY5 A;  1BRS A;  3PCS A;  5JPU A;  1NB3 I;  1TP6 A;  2CKF B;  3UNL A;  1C54 A;  4U13 A;  4L7K A;  1BIR A;  1Q40 A;  3KSE D;  5HGR A;  1EUI C;  8CHO A;  3WMD A;  5EEO A;  3EN8 A;  4LSO A;  2CG1 A;  3G6E 3;  3SXX A;  1YIJ 3;  3FLJ A;  4MEI A;  3EBY A;  2KXG A;  1Q86 4;  5AIG A;  3AGO A;  1GOY A;  1US1 A;  1BOX A;  1BNG A;  3URP A;  4FMD A;  1FGT A;  1I3F A;  3GWR A;  4I4K A;  1WMN A;  1G0T A;  3RDE A;  2H0H A;  2I9W A;  5AEW B;  1GSP A;  1V58 A;  2ZL8 A;  4LYL B;  2OWP A;  1IYY A;  2B1X B;  1VQ7 3;  5STD A;  3NV0 A;  2CK3 H;  3ECF A;  1ROV A;  1RRH A;  1W01 A;  1QVF 2;  4RNT A;  3DUK A;  3NXJ A;  2IUJ A;  1UGI A;  6STD A;  1BGS A;  1W2B 2;  3CCJ 3;  1BSA A;  3SOA A;  5CF1 A;  5RNT A;  1LVN A;  1WMO A;  3AGN A;  2MF7 A;  3UL5 A;  1E97 A;  1RGL A;  3LTC A;  3X3X A;  1DMN A;  4HM6 B;  4MJD A;  1SPU A;  3H3H A;  1B27 A;  1LXE A;  3OX9 A;  3OWY A;  1O7N B;  3PZW A;  2UX0 A;  3BIR A;  2IA7 A;  3MG3 A;  1DVC A;  1W6Y A;  3CD6 3;  2RBI A;  2GEY A;  4HM0 B;  2YFJ B;  1RN1 A;  3EJV A;  4N6M A;  5AIF A;  1JN5 A;  1JV2 B;  1RGF A;  2CFG A;  2HMN B;  1LNH A;  1ISK A;  1RGE A;  2F5M A;  1UCI A;  2MC8 A;  2CWU A;  1X1Y A;  5D82 A;  1LQM B;  3D4A A;  3O8Y A;  5TGN A;  4EV5 A;  1FUS A;  2YX9 A;  3NUV A;  1G96 A;  1MOL A;  5IG5 A;  3EN1 B;  5ELJ A;  2OQE A;  3SVA A;  1RLS A;  1SJW A;  2SBL A;  4XB5 A;  3MSO A;  2BMQ B;  2CWV A;  1HYF A;  1BUJ A;  1O7W B;  3T0U A;  4G1M B;  3B7C A;  1QAK A;  1CYV A;  1I0V A;  7GSP A;  3B4P A;  1A67 A;  3OWS A;  4EBG A;  2CG0 A;  3DH2 A;  1BU4 A;  1FYS A;  4O8S A;  1A90 A;  1T2I A;  5LC7 A;  1TUH A;  1Z1S A;  4J9A A;  1A2K A;  5CK6 A;  4QWT A;  1JB5 A;  3LML A;  1N8R 4;  5HOH A;  1JRQ A;  1Q7H A;  3CCU 3;  4XM4 A;  1M1X B;  2W2C A;  4HM5 B;  5IEN A;  3WOE B;  1MWT A;  1W6C A;  2LQV A;  3BU4 A;  3LT9 A;  4WYK B;  2W6J H;  3J7Y d;  1VQO 3;  1BSB A;  2OTL 3;  4EC6 A;  4AKY A;  1IQ8 A;  1I70 A;  1YVB I;  3F7X A;  4HM7 B;  3AMO B;  3S5C A;  3Q2P A;  2GSP A;  4MMY B;  1X1W A;  3LZA A;  7STD A;  2CX0 A;  1JN5 B;  4N6N B;  3RGR A;  3GZR A;  3ROB A;  1RSN A;  1BSE A;  4ZM8 A;  4JF8 A;  3IMA B;  1DMM A;  1EKM A;  3WA2 X;  4HZ9 B;  1K41 A;  3KZT A;  3WR2 A;  3CMA 3;  4JRF A;  3GRD A;  4IPB A;  3MPH A;  4CPK A;  2W04 A;  1QVG 2;  1W5Z A;  4HAA A;  5A0O B;  5IG3 A;  1GMR A;  1IQY A;  3FKA A;  1IVU A;  2BHM A;  3FSD A;  4J5G A;  2RSX A;  3U1W A;  4HKV B;  1KSI A;  2BU4 A;  2AAD A;  1YIT 3;  5IEP A;  2XGN A;  1YJW 3;  2HMJ B;  5IG0 A;  1E3V A;  2HML B;  1NU3 A;  5FW5 A;  4BL3 A;  1MGW A;  3CME 3;  1SQW A;  2XSO B;  3GZY B;  3LTD A;  1RGC A;  1JB4 A;  1OHP A;  2QEX 3;  1IT7 A;  2IUK A;  4N6L A;  1QAL A;  4LMI A;  4CJN A;  2W9Q A;  3CCQ 3;  2HMK B;  3CCR 3;  3SLU A;  1CEW I;  3DXO A;  1TU5 A;  1VQK 3;  4FCJ A;  4X2H A;  1M90 4;  3FCS B;  3EF8 A;  1SAR A;  3F40 A;  3LTA A;  3NQZ A;  4STD A;  5AYR B;  1TRP A;  1BSC A;  3KKG A;  4XDW A;  1PU4 A;  1M9G A;  5AII A;  5JPP A;  1D6U A;  3ZG0 A;  3NBJ A;  4EW5 A;  3M8C A;  3VGN A;  2OOV A;  4HJL B;  5BXQ A;  5IG4 A;  1RGK A;  2CW9 A;  1QMA A;  3NQY A;  2KF4 A;  3X40 A;  1NWW A;  1TFO A;  4K90 B;  1IVW A;  4XDV A;  1B2M A;  3AHW A;  3UB1 A;  1V74 A;  2C11 A;  2K0M A;  1UUV B;  1FUT A;  2IY2 A;  1KC8 4;  2GXF A;  1LOY A;  1BAO A;  1BNE A;  3GZX B;  3KE7 A;  3UJM A;  4BTX A;  2P09 A;  1UUW B;  1CYU A;  1GOV A;  2W03 A;  2BMR B;  3NX0 A;  2WGQ A;  5JBS A;  2BO9 B;  4ILF A;  2C4B A;  1RTU A;  3NM7 A;  1FGO A;  2F5W A;  2F86 B;  2Y73 A;  3BNC A;  4OVM A;  1B2S A;  4GB5 A;  5I97 A;  2W56 B;  5G2G A;  2R41 A;  1Q81 4;  3EE1 A;  1BVI A;  3EC9 A;  2CFK A;  4I5Q A;  1N9J A;  3OW2 2;  1B2Z A;  1UI7 A;  4XBY A;  1VQ5 3;  2F99 A;  2ML6 A;  4BTW A;  3PCR A;  3KFQ C;  1LOW A;  4KZ1 A;  1DVD A;  2OOV C;  1NDO B;  5DRE A;  2RGQ A;  1N5H A;  3SX1 A;  1RN4 A;  4CCV A;  5BIR A;  3IJE B;  1ZS7 A;  1BNF A;  4NHF A;  4WYK A;  1OHS A;  2H0I A;  3JUO A;  2QGU A;  2RCD A;  2XFT A;  4GHO A;  1YJN 3;  3NM2 A;  3E99 A;  4CDL A;  3AMO A;  3B4O A;  1W4N A;  1LOX A;  2C10 A;  2Y74 A;  1VQQ A;  2KF6 A;  2E2T A;  1UW1 A;  3MG1 A;  5IEO A;  3T8N A;  3X42 A;  6RNT A;  1CQS A;  2D1W A;  1IV9 A;  1YHQ 3;  5AEU B;  2O9U X;  2BNG A;  2W9P A;  2OCT A;  3FG3 A;  3EQQ B;  3STD A;  1IT8 A;  3CCS 3;  2W0Q A;  1FZU A;  4HM8 B;  1LNI A;  4PEJ A;  2STD A;  3HZP A;  2Z77 A;  3AHS A;  3F8X A;  4N6U A;  1T3B A;  2KRT A;  3ZG5 A;  4R9K A;  1VQ8 3;  3DGY A;  3WDG B;  3CU3 A;  3HII A;  3N9H A;  2CFW A;  2F98 A;  1ROA A;  1W7C A;  3EB8 A;  3V98 A;  2GU1 A;  3WA3 A;  1RHL A;  1RGA A;  3I0Y A;  1OF5 B;  1FA3 A;  3WOF B;  4KT3 B;  4NRE A;  2JQ5 A;  1HZ1 A;  1IVX A;  1KWI A;  2FGT A;  4IIA A;  4WFO A;  1LOV A;  1BRI A;  2KF3 A;  1JKG B;  2XH9 A;  3CNM A;  3FF2 A;  4DKI A;  1PYL A;  2GEX A;  1JZO A;  2M7O A;  5G1K A;  3FH1 A;  3WOD G;  6GSP A;  1AR0 A;  3Q90 A;  2L1S A;  9RNT A;  2CHC A;  3GAX A;  1YGE A;  1WNH A;  2P0X A;  1F8N A;  3CC7 3;  1TJD A;  1Q9E A;  3DGL A;  2QIY A;  3F7S A;  3HIG A;  3CC2 3;  1U5O A;  4LZI A;  1L5G B;  3LH4 A;  2K3D A;  3FF0 A;  4ORL A;  3TDG A;  2OQE C;  1N5P A;  1LQG C;  3CCE 3;  1MGR A;  1K28 A;  1R4Y A;  2BT3 A;  2LYX A;  1O7H B;  4K61 A;  5IW9 A;  1BUQ A;  3T8U A;  3FGY A;  1QAF A;  5D81 A;  5KP4 A;  1LRA A;  1NJI 4;  1B2X A;  1MWS A;  4EXR A;  3EHC A;  1OAC A;  3N8B A;  3Q3F A;  1RGH A;  4XBX A;  1YNV X;  3CPW 2;  3CC4 3;  1UGH I;  2H0G A;  3X3Z A;  5CF2 A;  2BMO B;  2V1L A;  3H51 A;  4KFF A;  1QJG A;  5AI1 A;  3RNT A;  2WOH A;  2KF5 A;  2XF3 A;  4OK0 A;  2UUG C;  1RKY A;  4BTY A;  3NBB A;  4K1V A;  1W2Z A;  2W56 A;  3FG1 A;  1AQZ A;  1GY5 A;  1S5A A;  2CX1 A;  1K73 4;  1BRG A;  1JBT A;  2D42 A;  1OPY A;  1VQ6 3;  1UUG B;  4HVN A;  2INX A;  3CCV 3;  1BRK A;  2AAE A;  3EBT A;  1D6Y A;  2Q07 A;  3ZFZ A;  3MYT A;  3WHO A;  1AVL A;  2KCD A;  3SYU A;  1DET A;  3GZB A;  4BIR A;  1I3I A;  4R9L A;  1A2V A;  3CCM 3;  1AV4 A;  1B21 A;  1UCJ A;  3FZW A;  3KII A;  5IER A;  1S72 3;  1Q82 4;  1RNB A;  2CWT A;  1SIH A;  3F14 A;  3N54 B;  3U97 A;  4FMA A;  2RNT A;  2YFI B;  1CH0 A;  3BND A;  1X1U A;  3S27 A;  3K5T A;  2WGO A;  4KFE A;  2O3O A;  3ALA A;  1K8A 4;  3D79 A;  1E3R A;  2KAA A;  1JZD A;  3X41 A;  1M1K 4;  4WWU C;  1BNI A;  4HYZ A;  3MG2 A;  3F8H A;  3OXA A;  3S28 A;  3QRD A;  2PNC A;  1KQS 2; 
#chains in the Genus database with same CATH homology
 3MKI A;  1EG9 B;  1FGM A;  1TFK A;  3G71 3;  1O7G B;  3DGN A;  1NB5 I;  2A15 A;  2R4I A;  1OUN A;  1W00 A;  4MMX B;  5BVB A;  1JNQ A;  4FR9 A;  1OF5 A;  1GY6 A;  1IVV A;  3CNX A;  1OGX A;  2Z76 A;  3PXM A;  4WHA A;  1JKG A;  2RFR A;  3JUP A;  1IDP A;  5AYS C;  3JUM A;  4FCM A;  3EX9 A;  2E2V A;  1T5Y A;  3G16 A;  5EVH A;  2IMJ A;  3QK9 A;  1JB2 A;  3L0R A;  3CCL 3;  3S67 A;  1C7H A;  3G4S 3;  1Y4K A;  1NO3 A;  2P05 A;  1PFP A;  2CIU A;  4L8P A;  3LTB A;  1O7M B;  2PZV A;  3A76 A;  1RN7 A;  1FGQ A;  4FMB A;  4MMZ B;  4H61 A;  2ML5 A;  4HM2 B;  4HZB B;  4Q53 A;  2QA4 3;  3D3L A;  3D9R A;  1GS3 A;  5ELU A;  1WTH A;  1OCV A;  5LC6 A;  1D6Z A;  1ASK A;  1IK3 A;  2CH9 A;  4RNY A;  1IU7 A;  1O7P B;  1U8C B;  1STF I;  1ZO2 A;  4O2H A;  1FUW A;  5EQL A;  1VQ9 3;  1YI2 3;  4N3V A;  2HMM B;  3OV4 A;  3I56 3;  3B8L A;  1TIJ A;  3K9M C;  2E2U A;  4R4K A;  2CFD A;  3V99 A;  3JVC A;  4XBT A;  1VZZ A;  4LGQ A;  4X2O A;  1Q40 B;  2JDI H;  1VQM 3;  3I55 3;  1FGR A;  4FMC A;  1J2B A;  4AEQ A;  1EQK A;  4IT7 A;  1ULJ B;  1R4C A;  4N6O B;  1IV7 A;  2GU3 A;  4HBR A;  4H3U A;  4R1K A;  4L8O A;  3K7C A;  3PGB A;  3KN4 A;  3RGA A;  4GL6 A;  3Q1C A;  4N6V 0;  4N6T A;  1IQX A;  4OUQ A;  3NV0 B;  1GD4 A;  3JUQ A;  2WOF A;  3DM8 A;  1HU9 A;  2XRX B;  2ZDJ A;  3PS8 A;  4HM3 B;  1OGZ A;  2XGL A;  1GYB A;  4J8T A;  4O3V A;  3LOY A;  2Z6B A;  1ZX2 A;  5CXO A;  1K9M 4;  3HI7 A;  1VQ4 3;  2OTJ 3;  3BB9 A;  4AKZ A;  4KFD A;  3DGO A;  1OHO A;  4KVH A;  2Z7A A;  2WO0 A;  2XEP A;  3KSP A;  1DMQ A;  4O02 B;  1OH0 A;  2XFS A;  4K1U A;  3MWZ A;  2GBX B;  3DZL A;  1WMP A;  3K0Z A;  4TX4 A;  1WQL B;  1W02 A;  3X3Y A;  3HK4 A;  3DGM A;  1VQN 3;  1AVK A;  2YFL B;  4FCZ A;  5D83 A;  2FXT A;  3PYJ A;  5DRV A;  2L4V A;  3ER7 A;  5AIH A;  3BNE A;  3V92 A;  2XSH B;  4LEH A;  3LT8 A;  3BLZ A;  1STD A;  1RJO A;  4WP5 A;  1GD3 A;  4HM1 B;  2CFL A;  2FNQ A;  4EV2 A;  2K54 A;  3UL6 A;  5KP1 A;  1MNL A;  3F9S A;  3IPT A;  5FGO A;  3JUN A;  3VSY A;  2CC3 A;  4EYC A;  5IF6 A;  3LXU X;  1DYU A;  1KD1 4;  1YJ9 3;  2GBW B;  3MHE A;  4RZM A;  2P0M A;  3G0K A;  2B24 B;  1ULI B;  3K63 A;  3NBR A;  3LYG A;  1VQP 3;  1N8Q A;  1RRL A;  5KP3 A;  1HKX A;  2XR8 B;  1W6G A;  4R80 A;  1Q42 A;  2P38 A;  1N9E A;  1GY7 A;  4RBN A;  4HM4 B;  1JJ2 2;  2HMO B;  3VF1 A;  3SOY A;  1SII A;  1EA2 A;  3FG4 A;  3S29 A;  4RNZ A;  3OWU A;  3CXC 2;  5CLK A;  1UI8 A;  3HX8 A;  3NHX A;  3G8Z A;  1VQL 3;  3CPO A;  3SED A;  1Q7Y 4;  3BNB A;  3DMC A;  3DY5 A;  3PCS A;  5JPU A;  1NB3 I;  1TP6 A;  2CKF B;  3UNL A;  4U13 A;  4L7K A;  3KSE D;  1Q40 A;  5HGR A;  8CHO A;  3WMD A;  5EEO A;  3EN8 A;  4LSO A;  2CG1 A;  3G6E 3;  3SXX A;  1YIJ 3;  3FLJ A;  4MEI A;  3EBY A;  2KXG A;  1Q86 4;  5AIG A;  1US1 A;  4FMD A;  1FGT A;  3GWR A;  4I4K A;  1WMN A;  5AEW B;  3RDE A;  2I9W A;  2ZL8 A;  2OWP A;  2B1X B;  1VQ7 3;  5STD A;  3NV0 A;  2CK3 H;  3ECF A;  1ROV A;  1RRH A;  1W01 A;  1QVF 2;  3DUK A;  3NXJ A;  2IUJ A;  6STD A;  1W2B 2;  3CCJ 3;  3SOA A;  5CF1 A;  1LVN A;  1WMO A;  2MF7 A;  3UL5 A;  1E97 A;  3LTC A;  3X3X A;  1DMN A;  4HM6 B;  4MJD A;  1SPU A;  3H3H A;  1LXE A;  3OX9 A;  3OWY A;  1O7N B;  3PZW A;  2UX0 A;  3MG3 A;  2IA7 A;  1DVC A;  1W6Y A;  3CD6 3;  2GEY A;  4HM0 B;  2YFJ B;  3EJV A;  4N6M A;  5AIF A;  1JN5 A;  1JV2 B;  2CFG A;  2HMN B;  1ISK A;  1LNH A;  2MC8 A;  2CWU A;  5D82 A;  3O8Y A;  5TGN A;  4EV5 A;  2YX9 A;  3NUV A;  1G96 A;  1MOL A;  5IG5 A;  3EN1 B;  5ELJ A;  2OQE A;  3SVA A;  1SJW A;  2SBL A;  4XB5 A;  3MSO A;  2BMQ B;  2CWV A;  1O7W B;  3T0U A;  4G1M B;  3B7C A;  1QAK A;  1CYV A;  3B4P A;  1A67 A;  3OWS A;  4EBG A;  2CG0 A;  4O8S A;  1A90 A;  5LC7 A;  1TUH A;  1Z1S A;  4J9A A;  1A2K A;  5CK6 A;  4QWT A;  1JB5 A;  3LML A;  1N8R 4;  1JRQ A;  3CCU 3;  4XM4 A;  1M1X B;  2W2C A;  4HM5 B;  5IEN A;  3WOE B;  4WYK B;  1W6C A;  2LQV A;  3LT9 A;  3J7Y d;  2W6J H;  1VQO 3;  2OTL 3;  4EC6 A;  4AKY A;  1IQ8 A;  1YVB I;  3F7X A;  4HM7 B;  3S5C A;  3AMO B;  7STD A;  3Q2P A;  4MMY B;  3LZA A;  4N6N B;  1JN5 B;  3RGR A;  3GZR A;  3ROB A;  4ZM8 A;  4JF8 A;  3IMA B;  1DMM A;  1EKM A;  3WA2 X;  4HZ9 B;  1K41 A;  3KZT A;  3CMA 3;  4JRF A;  3GRD A;  4IPB A;  3MPH A;  2W04 A;  1QVG 2;  1W5Z A;  5A0O B;  5IG3 A;  1IQY A;  3FKA A;  1IVU A;  2BHM A;  3FSD A;  3U1W A;  2RSX A;  4HKV B;  1KSI A;  1YIT 3;  5IEP A;  2XGN A;  1YJW 3;  2HMJ B;  5IG0 A;  1E3V A;  2HML B;  1NU3 A;  5FW5 A;  3CME 3;  1SQW A;  2XSO B;  3GZY B;  3LTD A;  1JB4 A;  1OHP A;  2QEX 3;  1IT7 A;  2IUK A;  4N6L A;  1QAL A;  4LMI A;  2W9Q A;  3CCQ 3;  2HMK B;  3CCR 3;  3SLU A;  1CEW I;  3DXO A;  1TU5 A;  1VQK 3;  4FCJ A;  4X2H A;  1M90 4;  3FCS B;  3EF8 A;  3F40 A;  3LTA A;  3NQZ A;  4STD A;  5AYR B;  3KKG A;  4XDW A;  1PU4 A;  1M9G A;  5AII A;  5JPP A;  1D6U A;  3NBJ A;  3M8C A;  3VGN A;  2OOV A;  4HJL B;  5BXQ A;  5IG4 A;  2CW9 A;  1QMA A;  3NQY A;  3X40 A;  1NWW A;  1TFO A;  4K90 B;  1IVW A;  4XDV A;  3UB1 A;  1V74 A;  2C11 A;  2K0M A;  1UUV B;  1KC8 4;  2GXF A;  3GZX B;  3KE7 A;  3UJM A;  4BTX A;  2P09 A;  1UUW B;  1CYU A;  2W03 A;  2BMR B;  3NX0 A;  2WGQ A;  5JBS A;  2BO9 B;  3NM7 A;  1FGO A;  2F86 B;  3BNC A;  2Y73 A;  4OVM A;  4GB5 A;  5I97 A;  2W56 B;  5G2G A;  1Q81 4;  3EE1 A;  3EC9 A;  2CFK A;  1N9J A;  3OW2 2;  1UI7 A;  4XBY A;  1VQ5 3;  2F99 A;  2ML6 A;  4BTW A;  3PCR A;  3KFQ C;  1DVD A;  4KZ1 A;  2OOV C;  1NDO B;  5DRE A;  2RGQ A;  1N5H A;  3SX1 A;  4CCV A;  3IJE B;  4NHF A;  4WYK A;  1OHS A;  3JUO A;  2QGU A;  2RCD A;  2XFT A;  1YJN 3;  3NM2 A;  3E99 A;  4CDL A;  3AMO A;  3B4O A;  1W4N A;  1LOX A;  2C10 A;  2Y74 A;  3X42 A;  3T8N A;  2E2T A;  1UW1 A;  3MG1 A;  5IEO A;  1CQS A;  2D1W A;  1IV9 A;  1YHQ 3;  5AEU B;  2O9U X;  2BNG A;  2W9P A;  2OCT A;  3FG3 A;  3EQQ B;  3STD A;  1IT8 A;  3CCS 3;  2W0Q A;  4HM8 B;  4PEJ A;  2STD A;  3HZP A;  2Z77 A;  3F8X A;  4N6U A;  2KRT A;  1VQ8 3;  4R9K A;  3WDG B;  3CU3 A;  3HII A;  3N9H A;  2CFW A;  2F98 A;  1ROA A;  1W7C A;  3EB8 A;  3V98 A;  2GU1 A;  3WA3 A;  3I0Y A;  1OF5 B;  1FA3 A;  3WOF B;  4NRE A;  2JQ5 A;  1IVX A;  1KWI A;  2FGT A;  4IIA A;  4WFO A;  1JKG B;  2XH9 A;  3CNM A;  3FF2 A;  2GEX A;  2M7O A;  3FH1 A;  3WOD G;  1AR0 A;  3Q90 A;  2CHC A;  3GAX A;  1YGE A;  1WNH A;  2P0X A;  1F8N A;  3CC7 3;  3DGL A;  2QIY A;  3F7S A;  3HIG A;  3CC2 3;  1U5O A;  4LZI A;  1L5G B;  3LH4 A;  3FF0 A;  4ORL A;  3TDG A;  2OQE C;  1N5P A;  3CCE 3;  1K28 A;  2BT3 A;  2LYX A;  4K61 A;  1O7H B;  5IW9 A;  1BUQ A;  3T8U A;  3FGY A;  1QAF A;  5D81 A;  5KP4 A;  1NJI 4;  4EXR A;  3EHC A;  1OAC A;  3N8B A;  4XBX A;  3CPW 2;  3CC4 3;  3X3Z A;  5CF2 A;  2BMO B;  2V1L A;  3H51 A;  4KFF A;  1QJG A;  5AI1 A;  2WOH A;  2XF3 A;  4OK0 A;  1RKY A;  4BTY A;  3NBB A;  4K1V A;  1W2Z A;  2W56 A;  3FG1 A;  1GY5 A;  1S5A A;  1K73 4;  2D42 A;  1OPY A;  1VQ6 3;  4HVN A;  3CCV 3;  2INX A;  3EBT A;  1D6Y A;  2Q07 A;  3MYT A;  1AVL A;  2KCD A;  3GZB A;  4R9L A;  1A2V A;  3CCM 3;  1AV4 A;  3KII A;  1S72 3;  3FZW A;  1Q82 4;  5IER A;  2CWT A;  1SIH A;  3F14 A;  3N54 B;  3U97 A;  4FMA A;  2YFI B;  3BND A;  3S27 A;  3K5T A;  2WGO A;  4KFE A;  2O3O A;  3ALA A;  1K8A 4;  1E3R A;  3X41 A;  1M1K 4;  4WWU C;  4HYZ A;  3MG2 A;  3F8H A;  3OXA A;  3S28 A;  3QRD A;  2PNC A;  1KQS 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...