3F8HA

Crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
NLYFQGMNDTIARYFDAFNAGDTDGMLACLSEDVAHHVNEGNIRVGKEKFAAFCAHMSHCYKEELTDMVIFATPDATRAAAEYTVNGTYLATDEGLPEARQQSYKLPAGSFFDLRDGLITRVTTYYNLSDWIKQVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (YP_611791.1) from SILICIBACTER SP. TM1040 at 2.00 A resolution
rcsb
source organism Silicibacter sp. tm1040
total genus 38
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f8hA00
3NBRA 5AIFA 5CLKA 1HKXA 2Z77A 4CDLA 4HM4B 2XR8B 1ULIB 3UNLA 3I0YA 3ROBA 1ASKA 3H51A 1WQLB 3MKIA 3OWYA 1DMQA 3S5CA 1C7HA 2RCDA 1O7HB 4HM1B 2HMKB 4HKVB 1OF5B 4J8TA 5IEOA 5AIIA 1GYBA 1GY6A 3F14A 1JKGB 1Z1SA 2BMRB 3EC9A 2I9WA 3FF0A 4WYKB 5D83A 4XDWA 2IMJA 3OV4A 3NUVA 4XB5A 3OWSA 1NU3A 1GY7A 1K41A 4WP5A 3LZAA 4LGQA 3EQQB 5CXOA 2CHCA 4LEHA 3B4PA 3B7CA 3H3HA 1NWWA 3NHXA 8CHOA 3BLZA 3KE7A 1NDOB 1O7PB 5DREA 3VSYA 1OGZA 5EVHA 1SJWA 2B1XB 4K1UA 1E3RA 3OX9A 1STDA 1Q40A 1JN5B 5HGRA 1O7NB 3KKGA 2GEXA 3EN1B 4WWUC 4X2HA 3GRDA 5IEPA 2BNGA 3F7XA 2STDA 3JUNA 2XSOB 3G8ZA 4K1VA 5IG4A 1UUVB 2HMOB 1OHPA 4XBXA 1ULJB 3CPOA 4HVNA 5BVBA 3EN8A 4HZ9B 3F40A 1TUHA 5IG5A 1S5AA 4XBTA 5KP3A 3ECFA 1OHOA 3K0ZA 1UUWB 2GBXB 1OGXA 3MYTA 4OUQA 2INXA 2HMMB 3A76A 5AIGA 7STDA 5AEUB 4STDA 5KP4A 2HMNB 2QGUA 2JQ5A 3EF8A 3B4OA 1OHSA 3FGYA 3F8HA 4XDVA 3RGRA 2Z76A 3NV0B 5IERA 3GZRA 3STDA 3OXAA 5FW5A 4H3UA 3T8UA 5AEWB 3B8LA 3SEDA 4R9LA 1TP6A 1O7WB 3OWUA 4XBYA 1DMNA 4HM2B 3F7SA 3F9SA 3RGAA 3FH1A 4R9KA 3FLJA 1Q42A 2YFIB 5D82A 1CQSA 1OF5A 2GEYA 1IDPA 4HM8B 4HM7B 3EX9A 3JUPA 1OCVA 1JKGA 3HZPA 3JUQA 5CF2A 1ISKA 5D81A 1JB5A 2RFRA 4WYKA 3HX8A 5TGNA 5DRVA 2UX0A 2YFJB 2QIYA 3EBYA 1ZX2A 3ER7A 5STDA 5G2GA 3GZBA 4KVHA 3DXOA 3CNXA 1OPYA 1JB2A 4Q53A 4LMIA 1DMMA 1W02A 1EA2A 4L8OA 1JB4A 3LYGA 1AR0A 2HMJB 3JUMA 3SOAA 3GZXB 3HK4A 1W6YA 4FCMA 4HM3B 5JPPA 5IF6A 3SOYA 3DUKA 1OUNA 3JUOA 2OWPA 2W2CA 5IG3A 4HM5B 3MHEA 3EJVA 1JN5A 3DZLA 2RGQA 1E97A 1OH0A 1GS3A 2B24B 3G0KA 4R1KA 3VGNA 4L7KA 5IENA 4MJDA 4HM0B 4ORLA 3MG3A 3FZWA 1Q40B 3FKAA 4U13A 1O7GB 3E99A 2F99A 4XM4A 4HZBB 5IG0A 3MSOA 3MG1A 2A15A 3G16A 3NM2A 3DMCA 3Q90A 3FSDA 2Z7AA 1W00A 2K54A 1U5OA 1E3VA 4IIAA 3DM8A 1QJGA 1A2KA 4N3VA 2F86B 3CU3A 2YFLB 5CK6A 3D9RA 2XRXB 5KP1A 1BUQA 3FF2A 5AIHA 3T8NA 2GXFA 3EHCA 3F8XA 4GB5A 1GY5A 5CF1A 4I4KA 3KSPA 2GBWB 1ZO2A 4X2OA 4OVMA 2F98A 3BB9A 3UJMA 5JPUA 2CKFB 3WMDA 3CNMA 4L8PA 4PEJA 3GWRA 1VZZA 2PZVA 4J9AA 2XSHB 3M8CA 3K7CA 3NV0A 2HMLB 3IPTA 3MG2A 1QMAA 2BMQB 3EBTA 4RZMA 5BXQA 3KZTA 3GZYB 4HJLB 1EG9B 4FCJA 5AI1A 1W01A 3NXJA 2R4IA 6STDA 2BMOB 1O7MB 4HM6B
chains in the Genus database with same CATH superfamily
3PCSA 3NBRA 1BRSA 5AIFA 2ML5A 2HOHA 5CLKA 1KQS2 2P09A 3I563 1I3FA 3KSED 3ZG0A 1HKXA 2Z77A 1YGEA 2F5MA 4CDLA 3WA3A 3LMLA 1VQ73 4HM4B 3PYJA 2XR8B 1ULIB 4QWTA 3UNLA 1YJ93 3I0YA 1WMOA 1JZDA 3ROBA 3U97A 7GSPA 1B27A 4ZM8A 3N8BA 1ASKA 5LC6A 3H51A 1WQLB 1GMPA 3AGOA 1FYSA 3MKIA 3OWYA 1LQMB 3CCL3 1DMQA 2CFDA 3S5CA 1G0TA 2W56A 3KIIA 2C4BA 1D6YA 1C7HA 1JV2B 2RCDA 1O7HB 3FCSB 1KWIA 2CFGA 4HBRA 4MEIA 1Q7Y4 3PCRA 3OW22 1FA3A 2KRTA 4HM1B 2HMKB 4HKVB 2CFLA 1I8VA 1Q824 3WOFB 1OF5B 2CWVA 4J8TA 5IEOA 3V92A 2GU3A 5AIIA 1GYBA 1GY6A 1V57A 2L4VA 2ZA4A 3F14A 4JF8A 1KC84 2KXGA 2Y74A 1QVF2 1JKGB 3MPHA 4O8SA 1RDSA 1Z1SA 1B2UA 3LTCA 2BMRB 1B2ZA 3EC9A 3WDGB 2I9WA 4R80A 2K0MA 3FF0A 4WYKB 5D83A 1W2B2 4XDWA 1SIHA 2IMJA 3OV4A 2GU1A 2CFKA 1RGGA 3AGNA 3NUVA 1YIJ3 1LOVA 5JBSA 4XB5A 1GD3A 3OWSA 4GSPA 1BRJA 1CYVA 1Q864 2XFTA 1NU3A 3CCU3 4NHFA 1NB5I 5ELJA 4EV2A 1GY7A 1MWTA 1K41A 4N6LA 3CD63 1B20A 4DKIA 1BNFA 3J7Yd 4R4KA 3I553 1MGRA 1WNHA 1I2EA 2CK3H 1K28A 1LNIA 4WP5A 1IK3A 3LZAA 4LGQA 3EQQB 1N8QA 2CIUA 1ZS7A 1VQ93 5CXOA 2CHCA 3ALAA 2CW9A 4IPBA 3CCV3 1RSNA 4LEHA 3WA2X 3D5IA 3B4PA 2H0HA 3B7CA 1T2HA 3HI7A 1N9JA 1RN4A 3H3HA 4FMCA 1NWWA 1RN1A 2OCTA 2ZHXB 1SPUA 4N6UA 3CCS3 2W0QA 3NHXA 4RNTA 2BT3A 5I97A 1DE3A 8CHOA 1K9M4 2WGOA 3BLZA 3X41A 3NBBA 3KE7A 4N6NB 1NDOB 4HYZA 1O7PB 2OQEC 5DREA 3VSYA 3DGYA 1W6GA 3DY5A 1JBRA 3LTBA 3S27A 1YVBI 1JNQA 1BANA 1OGZA 5EVHA 1K734 1SJWA 2B1XB 4K1UA 1E3RA 1N9EA 5A0OB 3OX9A 5G1KA 1STDA 4OK0A 3X3YA 1Q40A 1IVVA 3CCR3 2D1WA 1JN5B 5HGRA 2CFWA 6GSPA 2XGNA 3N9HA 1BSBA 1BVIA 2R41A 3PXMA 4N6OB 2CX1A 3Q1CA 2KF5A 1O7NB 3KKGA 4BU4A 3CCJ3 2GEXA 3EN1B 3LXUX 3D79A 4WWUC 3ZFZA 2C11A 2OQEA 3K5TA 1BSDA 3HOHA 4X2HA 1YHQ3 1VQQA 1IT8A 3GRDA 3FG4A 1I70A 1IV9A 3GSPA 5IEPA 1KSIA 1RGAA 1I0VA 2SBLA 3D5GA 2BNGA 3F7XA 2STDA 4RNZA 1BRNL 4EBGA 3JUNA 1DVCA 2XSOB 3G8ZA 3BNDA 4K1VA 5ELUA 5IG4A 4GHOA 1LVNA 1UUVB 3CC73 1TFOA 1VQM3 2XF3A 1VQP3 2HMOB 1S723 2BHMA 1RCKA 1CYUA 1M1XB 3D3LA 4TX4A 1OHPA 5BU4A 2Y73A 1FUTA 4JRFA 2V1LA 4XBXA 3G713 3AHSA 1ULJB 3CPOA 1YIT3 4HVNA 1AVLA 5BVBA 3EN8A 1NB3I 3A5EA 4HZ9B 1WMPA 3KFQC 1QAFA 3F40A 1TUHA 5IG5A 1LNHA 3SYUA 1VQ83 1DYUA 3NBJA 3D4AA 4AKYA 5M18A 1S5AA 3LTAA 3MWZA 2MC8A 1W2ZA 1GMQA 4XBTA 1M904 1UCLA 3SVAA 1QALA 4EC6A 1YI23 5IW9A 1AVKA 1JJ22 4NPBA 5KP3A 3HIGA 3ECFA 2CX0A 3AMOB 1T2IA 3UL5A 1OHOA 1IQYA 1GMRA 3K0ZA 2CG1A 1BSCA 4FMAA 1UUWB 2GBXB 1OGXA 3MYTA 1IVXA 2W9PA 3QRDA 4OUQA 1V74A 3CC23 3PGBA 2INXA 2HMMB 4GL6A 1UW1A 3A76A 4MMZB 4WHAA 5AIGA 1JBSA 1IV7A 2IYJA 4N6TA 4LZIA 7STDA 5AEUB 4BTYA 1TIJA 4STDA 5KP4A 2HMNB 4FR9A 2BIRA 2QGUA 3Q2PA 1BNSA 2JQ5A 3CME3 2K3DA 5EQLA 1A67A 1V58A 3B4OA 3EF8A 3S67A 1RRHA 2PNCA 1OHSA 3FGYA 1L5GB 2GSPA 3F8HA 1G96A 1T5YA 1C54A 1SARA 1BUJA 3U1WA 1PY3A 3NX0A 4XDVA 3S28A 1ZGXA 3DGOA 4EW5A 1TTOA 4IT7A 1LOWA 1Y4KA 1GOUA 3RGRA 2AAEA 4FCZA 2F56A 2Z76A 1STFI 2W6JH 1RNBA 3NV0B 2FGTA 1EQKA 5IERA 1CH0A 3GZRA 7RNTA 3STDA 4G1MB 3OXAA 1FUSA 3FG3A 5FW5A 4H3UA 2KF3A 3RDEA 4KFEA 3T8UA 1NO3A 1X1YA 5AEWB 3B8LA 3SEDA 3TDGA 1R4YA 2D42A 4R9LA 1TP6A 1G02A 1BU4A 1O7WB 2CC3A 3OWUA 4XBYA 3X3XA 1RKYA 2OTL3 1DMNA 1LXEA 4HM2B 3LOYA 3F7SA 3F9SA 1BRGA 3RGAA 1LOYA 2BU4A 2LYXA 3FH1A 4R9KA 1BGSA 2SARA 3FLJA 2IY2A 2P0XA 1Q42A 1M9GA 2YFIB 4N6V0 1UCIA 5RNTA 5D82A 3WODG 1CQSA 1AQZA 1OF5A 2GEYA 1MWUA 1SQWA 1Q9EA 1IDPA 2AADA 4HM8B 1W4NA 4HM7B 3EX9A 1BNEA 3JUPA 4FMBA 4O02B 1OCVA 1VQK3 1JBTA 1JKGA 2YX9A 1GSPA 2CWUA 3HZPA 3V99A 3JUQA 5CF2A 2RSXA 1ISKA 5LC7A 3QK9A 3N54B 5D81A 1JB5A 2RFRA 4K90B 4WYKA 1QAKA 1VQN3 1AY7A 3HX8A 5TGNA 2UX0A 2YFJB 1DETA 2QIYA 3DGMA 4H61A 2XFSA 5DRVA 1W7CA 2W56B 3EBYA 1ZX2A 3T0UA 2IUJA 3ER7A 4MMYB 1K8A4 3K63A 1VQ53 1UGHI 5STDA 3DGLA 5G2GA 1TU5A 3KCHA 3K9MC 1R4CA 1T3BA 1TFKA 2CG0A 2CWTA 3GZBA 2E2UA 1BNIA 2Q07A 4KFDA 1IVWA 4KVHA 4BIRA 1PFPA 3DXOA 4CCVA 1VQL3 3CNXA 4HOHA 1UCJA 1OPYA 1JB2A 4Q53A 1BAOA 1IQ8A 1MOLA 2F4YA 4LMIA 1DMMA 2W04A 1HYFA 1OACA 3EE1A 1W02A 2WGQA 1NJI4 1VQO3 1EA2A 1NNVA 1RNTA 3L0RA 4EXRA 1YJN3 3CCQ3 1N8R4 4L8OA 1X1UA 1JB4A 2UGIA 3LYGA 1YGWA 1IYYA 2Z6BA 2WO0A 1BRIA 1QVG2 3VF1A 4BTXA 1AR0A 1D6ZA 1U8CB 2IA7A 2HMJB 1VQ43 2ML6A 1BRHA 5M1AA 3JUMA 3SOAA 2P38A 3BU4A 2OTJ3 1Q7HA 4LSOA 3BNBA 3GZXB 3HK4A 3PS8A 3LT9A 3S29A 1ROVA 1B2XA 1W6YA 1DVDA 1D6UA 4FCMA 2H0IA 1UGIA 1I0XA 4HM3B 1LRAA 3NM7A 2LQVA 2L1SA 5JPPA 3X3ZA 1MWRA 5IF6A 1MWSA 1BOXA 2UUGC 8RNTA 3SOYA 3GAXA 1FGMA 1RGHA 3WHOA 3DUKA 3LTDA 1MGWA 1OUNA 3JUOA 2OWPA 2W2CA 5IG3A 3IMAB 1RN7A 1FGOA 4HM5B 3CPW2 1RCLA 1RGKA 3EJVA 3MHEA 3CCM3 2XGLA 1I2GA 1B3SA 5M19A 1JN5A 4BL2A 2OOVC 1RGEA 3EB8A 2P0MA 1JZOA 1RGFA 1UI8A 2RBIA 4RNYA 2IUKA 1IVUA 4ILFA 3DZLA 1O7MB 4KT3B 1N5PA 5G1LA 1RGCA 2RNTA 2RGQA 3CCE3 1E97A 5AYSC 1RHLA 1OH0A 1WMNA 3WR2A 2KAAA 3AHWA 3HIIA 4N6MA 2H0GA 1GS3A 2B24B 3G0KA 2WOFA 4R1KA 1RTUA 3VGNA 1W6CA 2QA43 4L7KA 1GD4A 2J8XB 1GOVA 2KF4A 3X42A 4HAAA 1Q814 4CJNA 4MJDA 5IENA 2O3OA 4HM0B 4ORLA 3BNCA 3MG3A 3FZWA 1Q40B 3FKAA 2ZL8A 1TRQA 4U13A 6RNTA 1O7GB 1KD14 1UUGB 3RNTA 1ROAA 1BNJA 1FGQA 2FXTA 4AEQA 2ZDJA 3DGNA 4J5KA 1UCKA 3E99A 2BO9B 2F99A 4XM4A 2OOVA 2JDIH 3PZWA 1RJOA 4HZBB 4J5GA 5IG0A 1IQXA 1UI7A 2W03A 1RLSA 3URPA 3BIRA 3MSOA 1RRLA 1IU7A 3CC43 2KF6A 3MG1A 2A15A 5GSPA 3G16A 3NM2A 2CH9A 3DMCA 3Q90A 3FSDA 4EYCA 2Z7AA 1W5ZA 2W9QA 3DH2A 1W00A 2K54A 1U5OA 3ZG5A 1E3VA 2C10A 4IIAA 1PU4A 3DM8A 3G4S3 1QJGA 1FGRA 1HU9A 1TRPA 1EEJA 1A2KA 4N3VA 1J2BA 3SX1A 1X1WA 3UL6A 4BL3A 2F86B 4FMDA 3CU3A 3KN4A 3LT8A 1B21A 4BTWA 2YFLB 5CK6A 1FUWA 3AMOA 3D9RA 2XRXB 5KP1A 1BUQA 3SXXA 3FF2A 5AIHA 1YNVX 1FZUA 2E2VA 5FGOA 1VQ63 3NQYA 3T8NA 1BNRA 1BRKA 1FW7A 1TJDA 2MF7A 1HZ1A 1IT7A 2GXFA 2P05A 1GOYA 3UB1A 3EHCA 9RNTA 3F8XA 4WFOA 1BSAA 4GB5A 1GY5A 2KCDA 1LQGC 4KZ1A 1RGLA 5CF1A 1A2VA 1N5HA 3CXC2 4I4KA 3KSPA 1LOXA 3WOEB 1EUIC 3SLUA 2GBWB 3FG1A 4I5QA 3Q3FA 1ZO2A 2O9UX 3NQZA 1A2PA 1BIRA 4X2OA 4OVMA 2XH9A 2F98A 3V98A 3BB9A 1UDII 1AV4A 3CMA3 1BNGA 1X1XA 2XEPA 4O2HA 1FGTA 1B2SA 3UJMA 1BSEA 3X40A 1US1A 5JPUA 1A90A 4O3VA 2CKFB 3WMDA 4EV5A 1JRQA 3CNMA 4AKZA 4L8PA 4MMXB 2M7OA 4PEJA 4KFFA 4LYLB 3GWRA 1VZZA 2PZVA 3JVCA 4J9AA 1PYLA 2QEX3 1SIIA 2XSHB 5EEOA 1I2FA 3O8YA 3M8CA 3K7CA 3NV0A 2FNQA 4K61A 2HMLB 3IPTA 4RBNA 5AYRB 4CPKA 3MG2A 1QMAA 2BMQB 3BNEA 3EBTA 4RZMA 5BXQA 1RMSA 3LH4A 3IJEB 3KZTA 1M1K4 1B2MA 3GZYB 4HJLB 5BIRA 1EG9B 1YJW3 1F8NA 4FCJA 5AI1A 1W01A 1MNLA 3NXJA 2R4IA 1EKMA 5HOHA 6STDA 2E2TA 1CEWI 4NREA 2WOHA 3G6E3 1I3IA 2F5WA 2BMOB 1YVSA 4HM6B 1WTHA
chains in the Genus database with same CATH topology
3PCSA 3NBRA 5AIFA 2ML5A 5CLKA 1KQS2 2P09A 3I563 3KSED 1HKXA 2Z77A 1YGEA 4CDLA 3WA3A 3LMLA 1VQ73 4HM4B 3PYJA 2XR8B 1ULIB 4QWTA 3UNLA 1YJ93 3I0YA 1WMOA 3ROBA 3U97A 4ZM8A 3N8BA 1ASKA 5LC6A 3H51A 1WQLB 3MKIA 3OWYA 3CCL3 1DMQA 2CFDA 3S5CA 2W56A 3KIIA 1D6YA 1JV2B 1C7HA 2RCDA 1O7HB 3FCSB 1KWIA 2CFGA 4HBRA 4MEIA 1Q7Y4 3PCRA 3OW22 1FA3A 2KRTA 4HM1B 2HMKB 4HKVB 2CFLA 1Q824 3WOFB 1OF5B 2CWVA 4J8TA 5IEOA 3V92A 2GU3A 5AIIA 1GYBA 1GY6A 2L4VA 3F14A 4JF8A 1KC84 2KXGA 2Y74A 1QVF2 1JKGB 3MPHA 4O8SA 1Z1SA 3LTCA 2BMRB 3EC9A 3WDGB 2I9WA 4R80A 2K0MA 3FF0A 4WYKB 5D83A 1W2B2 4XDWA 1SIHA 2IMJA 3OV4A 2GU1A 2CFKA 3NUVA 1YIJ3 5JBSA 4XB5A 1GD3A 3OWSA 1Q864 1CYVA 2XFTA 1NU3A 3CCU3 4NHFA 1NB5I 5ELJA 4EV2A 1GY7A 1K41A 4N6LA 3CD63 3J7Yd 4R4KA 3I553 1WNHA 2CK3H 1K28A 4WP5A 1IK3A 3LZAA 4LGQA 3EQQB 1N8QA 2CIUA 1VQ93 5CXOA 2CHCA 3ALAA 2CW9A 4IPBA 3CCV3 4LEHA 3WA2X 3B4PA 3B7CA 3HI7A 1N9JA 3H3HA 4FMCA 1NWWA 2OCTA 1SPUA 4N6UA 3CCS3 2W0QA 3NHXA 5I97A 2BT3A 8CHOA 1K9M4 2WGOA 3BLZA 3X41A 3NBBA 3KE7A 4N6NB 1NDOB 4HYZA 1O7PB 2OQEC 5DREA 3VSYA 1W6GA 3DY5A 3LTBA 3S27A 1YVBI 1JNQA 1OGZA 5EVHA 1K734 1SJWA 2B1XB 4K1UA 1E3RA 1N9EA 5A0OB 3OX9A 1STDA 4OK0A 3X3YA 1Q40A 1IVVA 3CCR3 2D1WA 1JN5B 5HGRA 2CFWA 2XGNA 3N9HA 3PXMA 4N6OB 3Q1CA 1O7NB 3KKGA 3CCJ3 2GEXA 3EN1B 3LXUX 4WWUC 2C11A 2OQEA 3K5TA 1YHQ3 4X2HA 1IT8A 3GRDA 3FG4A 1IV9A 5IEPA 1KSIA 2SBLA 2BNGA 3F7XA 2STDA 4RNZA 4EBGA 3JUNA 1DVCA 2XSOB 3G8ZA 3BNDA 4K1VA 5ELUA 5IG4A 3CC73 1LVNA 1UUVB 1TFOA 1VQM3 2XF3A 1VQP3 2HMOB 1S723 2BHMA 1CYUA 1M1XB 3D3LA 4TX4A 1OHPA 2Y73A 4JRFA 4XBXA 2V1LA 3G713 1ULJB 3CPOA 1YIT3 4HVNA 1AVLA 5BVBA 3EN8A 1NB3I 4HZ9B 1WMPA 3KFQC 1QAFA 3F40A 1TUHA 5IG5A 1LNHA 1VQ83 1DYUA 3NBJA 4AKYA 1S5AA 3LTAA 3MWZA 2MC8A 1W2ZA 4XBTA 1M904 3SVAA 4EC6A 1QALA 1YI23 5IW9A 1AVKA 1JJ22 5KP3A 3HIGA 3ECFA 3AMOB 3UL5A 1OHOA 1IQYA 3K0ZA 2CG1A 4FMAA 1UUWB 2GBXB 1OGXA 3MYTA 1IVXA 2W9PA 3QRDA 4OUQA 1V74A 3CC23 3PGBA 2INXA 2HMMB 4GL6A 1UW1A 3A76A 4MMZB 4WHAA 5AIGA 1IV7A 4N6TA 4LZIA 7STDA 5AEUB 4BTYA 1TIJA 4STDA 5KP4A 2HMNB 4FR9A 2QGUA 3Q2PA 3CME3 2JQ5A 5EQLA 1A67A 3EF8A 3B4OA 3S67A 1RRHA 2PNCA 1OHSA 3FGYA 1L5GB 3F8HA 1G96A 1T5YA 3U1WA 3NX0A 4XDVA 3S28A 3DGOA 4IT7A 1Y4KA 3RGRA 4FCZA 2Z76A 1STFI 2W6JH 3NV0B 2FGTA 1EQKA 5IERA 3GZRA 3STDA 4G1MB 3OXAA 3FG3A 5FW5A 4H3UA 3RDEA 4KFEA 3T8UA 1NO3A 5AEWB 3B8LA 3SEDA 3TDGA 2D42A 4R9LA 1TP6A 1O7WB 3OWUA 4XBYA 2CC3A 3X3XA 2OTL3 1RKYA 1DMNA 1LXEA 4HM2B 3LOYA 3F7SA 3F9SA 3RGAA 2LYXA 3FH1A 4R9KA 3FLJA 2P0XA 1Q42A 1M9GA 2YFIB 4N6V0 5D82A 3WODG 1CQSA 1OF5A 2GEYA 1SQWA 1IDPA 4HM8B 1W4NA 4HM7B 3EX9A 3JUPA 4FMBA 4O02B 1OCVA 1VQK3 2YX9A 1JKGA 3HZPA 2CWUA 3V99A 3JUQA 5CF2A 2RSXA 1ISKA 5LC7A 3QK9A 3N54B 5D81A 1JB5A 2RFRA 4K90B 4WYKA 1QAKA 1VQN3 3HX8A 5TGNA 1TU5A 2UX0A 2YFJB 5DRVA 2QIYA 3DGMA 4H61A 2XFSA 1W7CA 2W56B 3EBYA 1ZX2A 3T0UA 2IUJA 3ER7A 4MMYB 1K8A4 3K63A 1VQ53 5STDA 3DGLA 5G2GA 3K9MC 1R4CA 2CG0A 1TFKA 2CWTA 3GZBA 2E2UA 2Q07A 4KFDA 1IVWA 4KVHA 1PFPA 3DXOA 4CCVA 1VQL3 3CNXA 1OPYA 1JB2A 4Q53A 1IQ8A 4LMIA 1MOLA 1DMMA 2W04A 1OACA 3EE1A 1W02A 2WGQA 1NJI4 1VQO3 1EA2A 3L0RA 4EXRA 1YJN3 3CCQ3 1N8R4 4L8OA 1JB4A 3LYGA 2Z6BA 2WO0A 1QVG2 3VF1A 4BTXA 1AR0A 1D6ZA 1U8CB 2IA7A 2HMJB 1VQ43 2ML6A 3JUMA 3SOAA 2P38A 2OTJ3 4LSOA 3BNBA 3GZXB 3HK4A 3PS8A 3LT9A 3S29A 1ROVA 1W6YA 1DVDA 1D6UA 4FCMA 4HM3B 5JPPA 3NM7A 2LQVA 3X3ZA 5IF6A 3SOYA 3GAXA 1FGMA 3DUKA 3LTDA 1OUNA 3JUOA 2OWPA 2W2CA 5IG3A 3IMAB 1RN7A 1FGOA 4HM5B 3CPW2 3MHEA 3EJVA 3CCM3 2XGLA 1JN5A 2OOVC 3EB8A 2P0MA 1UI8A 4RNYA 2IUKA 1IVUA 3DZLA 1N5PA 3CCE3 2RGQA 1E97A 5AYSC 1OH0A 1WMNA 3HIIA 4N6MA 1GS3A 2B24B 3G0KA 2WOFA 4R1KA 3VGNA 1W6CA 2QA43 4L7KA 1GD4A 3X42A 1Q814 5IENA 4MJDA 2O3OA 4HM0B 4ORLA 3BNCA 3MG3A 3FZWA 1Q40B 3FKAA 2ZL8A 4U13A 1O7GB 1KD14 1ROAA 1FGQA 2FXTA 4AEQA 2ZDJA 3DGNA 3E99A 2BO9B 2F99A 4XM4A 2OOVA 2JDIH 3PZWA 1RJOA 4HZBB 5IG0A 1IQXA 1UI7A 2W03A 3MSOA 1RRLA 1IU7A 3CC43 3MG1A 2A15A 3G16A 3NM2A 2CH9A 3DMCA 3Q90A 3FSDA 4EYCA 2Z7AA 1W5ZA 2W9QA 1W00A 2K54A 1U5OA 1E3VA 2C10A 4IIAA 1PU4A 3DM8A 3G4S3 1QJGA 1FGRA 1HU9A 1A2KA 4N3VA 1J2BA 3SX1A 3UL6A 2F86B 4FMDA 3CU3A 3KN4A 3LT8A 4BTWA 2YFLB 5CK6A 1FUWA 3AMOA 3D9RA 2XRXB 5KP1A 1BUQA 3SXXA 3FF2A 5AIHA 2E2VA 5FGOA 1VQ63 3NQYA 3T8NA 2MF7A 2GXFA 1IT7A 2P05A 3UB1A 3EHCA 3F8XA 4WFOA 4GB5A 1GY5A 2KCDA 4KZ1A 5CF1A 1A2VA 1N5HA 3CXC2 4I4KA 3KSPA 1LOXA 3WOEB 3SLUA 2GBWB 3FG1A 2O9UX 1ZO2A 3NQZA 4X2OA 4OVMA 2XH9A 2F98A 3V98A 3BB9A 1AV4A 3CMA3 4O2HA 2XEPA 3UJMA 5JPUA 1FGTA 1A90A 3X40A 1US1A 4O3VA 2CKFB 3WMDA 4EV5A 1JRQA 3CNMA 4AKZA 4L8PA 4MMXB 2M7OA 4PEJA 4KFFA 3GWRA 1VZZA 2PZVA 3JVCA 4J9AA 2QEX3 1SIIA 2XSHB 5EEOA 3O8YA 3M8CA 3K7CA 3NV0A 2FNQA 4K61A 2HMLB 3IPTA 4RBNA 5AYRB 3MG2A 1QMAA 2BMQB 3BNEA 3EBTA 4RZMA 5BXQA 3LH4A 3IJEB 3KZTA 1M1K4 3GZYB 4HJLB 1YJW3 1EG9B 1F8NA 4FCJA 5AI1A 1W01A 1MNLA 3NXJA 2R4IA 1EKMA 6STDA 2E2TA 1CEWI 4NREA 2WOHA 3G6E3 2BMOB 1O7MB 4HM6B 1WTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  5AIF A;  5CLK A;  1HKX A;  2Z77 A;  4CDL A;  4HM4 B;  2XR8 B;  1ULI B;  3UNL A;  3I0Y A;  3ROB A;  1ASK A;  3H51 A;  1WQL B;  3MKI A;  3OWY A;  1DMQ A;  3S5C A;  1C7H A;  2RCD A;  1O7H B;  4HM1 B;  2HMK B;  4HKV B;  1OF5 B;  4J8T A;  5IEO A;  5AII A;  1GYB A;  1GY6 A;  3F14 A;  1JKG B;  1Z1S A;  2BMR B;  3EC9 A;  2I9W A;  3FF0 A;  4WYK B;  5D83 A;  4XDW A;  2IMJ A;  3OV4 A;  3NUV A;  4XB5 A;  3OWS A;  1NU3 A;  1GY7 A;  1K41 A;  4WP5 A;  3LZA A;  4LGQ A;  3EQQ B;  5CXO A;  2CHC A;  4LEH A;  3B4P A;  3B7C A;  3H3H A;  1NWW A;  3NHX A;  8CHO A;  3BLZ A;  3KE7 A;  1NDO B;  1O7P B;  5DRE A;  3VSY A;  1OGZ A;  5EVH A;  1SJW A;  2B1X B;  4K1U A;  1E3R A;  3OX9 A;  1STD A;  1Q40 A;  1JN5 B;  5HGR A;  1O7N B;  3KKG A;  2GEX A;  3EN1 B;  4WWU C;  4X2H A;  3GRD A;  5IEP A;  2BNG A;  3F7X A;  2STD A;  3JUN A;  2XSO B;  3G8Z A;  4K1V A;  5IG4 A;  1UUV B;  2HMO B;  1OHP A;  4XBX A;  1ULJ B;  3CPO A;  4HVN A;  5BVB A;  3EN8 A;  4HZ9 B;  3F40 A;  1TUH A;  5IG5 A;  1S5A A;  4XBT A;  5KP3 A;  3ECF A;  1OHO A;  3K0Z A;  1UUW B;  2GBX B;  1OGX A;  3MYT A;  4OUQ A;  2INX A;  2HMM B;  3A76 A;  5AIG A;  7STD A;  5AEU B;  4STD A;  5KP4 A;  2HMN B;  2QGU A;  2JQ5 A;  3EF8 A;  3B4O A;  1OHS A;  3FGY A;  3F8H A;  4XDV A;  3RGR A;  2Z76 A;  3NV0 B;  5IER A;  3GZR A;  3STD A;  3OXA A;  5FW5 A;  4H3U A;  3T8U A;  5AEW B;  3B8L A;  3SED A;  4R9L A;  1TP6 A;  1O7W B;  3OWU A;  4XBY A;  1DMN A;  4HM2 B;  3F7S A;  3F9S A;  3RGA A;  3FH1 A;  4R9K A;  3FLJ A;  1Q42 A;  2YFI B;  5D82 A;  1CQS A;  1OF5 A;  2GEY A;  1IDP A;  4HM8 B;  4HM7 B;  3EX9 A;  3JUP A;  1OCV A;  1JKG A;  3HZP A;  3JUQ A;  5CF2 A;  1ISK A;  5D81 A;  1JB5 A;  2RFR A;  4WYK A;  3HX8 A;  5TGN A;  5DRV A;  2UX0 A;  2YFJ B;  2QIY A;  3EBY A;  1ZX2 A;  3ER7 A;  5STD A;  5G2G A;  3GZB A;  4KVH A;  3DXO A;  3CNX A;  1OPY A;  1JB2 A;  4Q53 A;  4LMI A;  1DMM A;  1W02 A;  1EA2 A;  4L8O A;  1JB4 A;  3LYG A;  1AR0 A;  2HMJ B;  3JUM A;  3SOA A;  3GZX B;  3HK4 A;  1W6Y A;  4FCM A;  4HM3 B;  5JPP A;  5IF6 A;  3SOY A;  3DUK A;  1OUN A;  3JUO A;  2OWP A;  2W2C A;  5IG3 A;  4HM5 B;  3MHE A;  3EJV A;  1JN5 A;  3DZL A;  2RGQ A;  1E97 A;  1OH0 A;  1GS3 A;  2B24 B;  3G0K A;  4R1K A;  3VGN A;  4L7K A;  5IEN A;  4MJD A;  4HM0 B;  4ORL A;  3MG3 A;  3FZW A;  1Q40 B;  3FKA A;  4U13 A;  1O7G B;  3E99 A;  2F99 A;  4XM4 A;  4HZB B;  5IG0 A;  3MSO A;  3MG1 A;  2A15 A;  3G16 A;  3NM2 A;  3DMC A;  3Q90 A;  3FSD A;  2Z7A A;  1W00 A;  2K54 A;  1U5O A;  1E3V A;  4IIA A;  3DM8 A;  1QJG A;  1A2K A;  4N3V A;  2F86 B;  3CU3 A;  2YFL B;  5CK6 A;  3D9R A;  2XRX B;  5KP1 A;  1BUQ A;  3FF2 A;  5AIH A;  3T8N A;  2GXF A;  3EHC A;  3F8X A;  4GB5 A;  1GY5 A;  5CF1 A;  4I4K A;  3KSP A;  2GBW B;  1ZO2 A;  4X2O A;  4OVM A;  2F98 A;  3BB9 A;  3UJM A;  5JPU A;  2CKF B;  3WMD A;  3CNM A;  4L8P A;  4PEJ A;  3GWR A;  1VZZ A;  2PZV A;  4J9A A;  2XSH B;  3M8C A;  3K7C A;  3NV0 A;  2HML B;  3IPT A;  3MG2 A;  1QMA A;  2BMQ B;  3EBT A;  4RZM A;  5BXQ A;  3KZT A;  3GZY B;  4HJL B;  1EG9 B;  4FCJ A;  5AI1 A;  1W01 A;  3NXJ A;  2R4I A;  6STD A;  2BMO B;  1O7M B;  4HM6 B; 
#chains in the Genus database with same CATH topology
 3PCS A;  3NBR A;  1BRS A;  5AIF A;  2ML5 A;  2HOH A;  5CLK A;  1KQS 2;  2P09 A;  3I56 3;  1I3F A;  3KSE D;  3ZG0 A;  1HKX A;  2Z77 A;  1YGE A;  2F5M A;  4CDL A;  3WA3 A;  3LML A;  1VQ7 3;  4HM4 B;  3PYJ A;  2XR8 B;  1ULI B;  4QWT A;  3UNL A;  1YJ9 3;  3I0Y A;  1WMO A;  1JZD A;  3ROB A;  3U97 A;  7GSP A;  1B27 A;  4ZM8 A;  3N8B A;  1ASK A;  5LC6 A;  3H51 A;  1WQL B;  1GMP A;  3AGO A;  1FYS A;  3MKI A;  3OWY A;  1LQM B;  3CCL 3;  1DMQ A;  2CFD A;  3S5C A;  1G0T A;  2W56 A;  3KII A;  2C4B A;  1D6Y A;  1C7H A;  1JV2 B;  2RCD A;  1O7H B;  3FCS B;  1KWI A;  2CFG A;  4HBR A;  4MEI A;  1Q7Y 4;  3PCR A;  3OW2 2;  1FA3 A;  2KRT A;  4HM1 B;  2HMK B;  4HKV B;  2CFL A;  1I8V A;  1Q82 4;  3WOF B;  1OF5 B;  2CWV A;  4J8T A;  5IEO A;  3V92 A;  2GU3 A;  5AII A;  1GYB A;  1GY6 A;  1V57 A;  2L4V A;  2ZA4 A;  3F14 A;  4JF8 A;  1KC8 4;  2KXG A;  2Y74 A;  1QVF 2;  1JKG B;  3MPH A;  4O8S A;  1RDS A;  1Z1S A;  1B2U A;  3LTC A;  2BMR B;  1B2Z A;  3EC9 A;  3WDG B;  2I9W A;  4R80 A;  2K0M A;  3FF0 A;  4WYK B;  5D83 A;  1W2B 2;  4XDW A;  1SIH A;  2IMJ A;  3OV4 A;  2GU1 A;  2CFK A;  1RGG A;  3AGN A;  3NUV A;  1YIJ 3;  1LOV A;  5JBS A;  4XB5 A;  1GD3 A;  3OWS A;  4GSP A;  1BRJ A;  1CYV A;  1Q86 4;  2XFT A;  1NU3 A;  3CCU 3;  4NHF A;  1NB5 I;  5ELJ A;  4EV2 A;  1GY7 A;  1MWT A;  1K41 A;  4N6L A;  3CD6 3;  1B20 A;  4DKI A;  1BNF A;  3J7Y d;  4R4K A;  3I55 3;  1MGR A;  1WNH A;  1I2E A;  2CK3 H;  1K28 A;  1LNI A;  4WP5 A;  1IK3 A;  3LZA A;  4LGQ A;  3EQQ B;  1N8Q A;  2CIU A;  1ZS7 A;  1VQ9 3;  5CXO A;  2CHC A;  3ALA A;  2CW9 A;  4IPB A;  3CCV 3;  1RSN A;  4LEH A;  3WA2 X;  3D5I A;  3B4P A;  2H0H A;  3B7C A;  1T2H A;  3HI7 A;  1N9J A;  1RN4 A;  3H3H A;  4FMC A;  1NWW A;  1RN1 A;  2OCT A;  2ZHX B;  1SPU A;  4N6U A;  3CCS 3;  2W0Q A;  3NHX A;  4RNT A;  2BT3 A;  5I97 A;  1DE3 A;  8CHO A;  1K9M 4;  2WGO A;  3BLZ A;  3X41 A;  3NBB A;  3KE7 A;  4N6N B;  1NDO B;  4HYZ A;  1O7P B;  2OQE C;  5DRE A;  3VSY A;  3DGY A;  1W6G A;  3DY5 A;  1JBR A;  3LTB A;  3S27 A;  1YVB I;  1JNQ A;  1BAN A;  1OGZ A;  5EVH A;  1K73 4;  1SJW A;  2B1X B;  4K1U A;  1E3R A;  1N9E A;  5A0O B;  3OX9 A;  5G1K A;  1STD A;  4OK0 A;  3X3Y A;  1Q40 A;  1IVV A;  3CCR 3;  2D1W A;  1JN5 B;  5HGR A;  2CFW A;  6GSP A;  2XGN A;  3N9H A;  1BSB A;  1BVI A;  2R41 A;  3PXM A;  4N6O B;  2CX1 A;  3Q1C A;  2KF5 A;  1O7N B;  3KKG A;  4BU4 A;  3CCJ 3;  2GEX A;  3EN1 B;  3LXU X;  3D79 A;  4WWU C;  3ZFZ A;  2C11 A;  2OQE A;  3K5T A;  1BSD A;  3HOH A;  4X2H A;  1YHQ 3;  1VQQ A;  1IT8 A;  3GRD A;  3FG4 A;  1I70 A;  1IV9 A;  3GSP A;  5IEP A;  1KSI A;  1RGA A;  1I0V A;  2SBL A;  3D5G A;  2BNG A;  3F7X A;  2STD A;  4RNZ A;  1BRN L;  4EBG A;  3JUN A;  1DVC A;  2XSO B;  3G8Z A;  3BND A;  4K1V A;  5ELU A;  5IG4 A;  4GHO A;  1LVN A;  1UUV B;  3CC7 3;  1TFO A;  1VQM 3;  2XF3 A;  1VQP 3;  2HMO B;  1S72 3;  2BHM A;  1RCK A;  1CYU A;  1M1X B;  3D3L A;  4TX4 A;  1OHP A;  5BU4 A;  2Y73 A;  1FUT A;  4JRF A;  2V1L A;  4XBX A;  3G71 3;  3AHS A;  1ULJ B;  3CPO A;  1YIT 3;  4HVN A;  1AVL A;  5BVB A;  3EN8 A;  1NB3 I;  3A5E A;  4HZ9 B;  1WMP A;  3KFQ C;  1QAF A;  3F40 A;  1TUH A;  5IG5 A;  1LNH A;  3SYU A;  1VQ8 3;  1DYU A;  3NBJ A;  3D4A A;  4AKY A;  5M18 A;  1S5A A;  3LTA A;  3MWZ A;  2MC8 A;  1W2Z A;  1GMQ A;  4XBT A;  1M90 4;  1UCL A;  3SVA A;  1QAL A;  4EC6 A;  1YI2 3;  5IW9 A;  1AVK A;  1JJ2 2;  4NPB A;  5KP3 A;  3HIG A;  3ECF A;  2CX0 A;  3AMO B;  1T2I A;  3UL5 A;  1OHO A;  1IQY A;  1GMR A;  3K0Z A;  2CG1 A;  1BSC A;  4FMA A;  1UUW B;  2GBX B;  1OGX A;  3MYT A;  1IVX A;  2W9P A;  3QRD A;  4OUQ A;  1V74 A;  3CC2 3;  3PGB A;  2INX A;  2HMM B;  4GL6 A;  1UW1 A;  3A76 A;  4MMZ B;  4WHA A;  5AIG A;  1JBS A;  1IV7 A;  2IYJ A;  4N6T A;  4LZI A;  7STD A;  5AEU B;  4BTY A;  1TIJ A;  4STD A;  5KP4 A;  2HMN B;  4FR9 A;  2BIR A;  2QGU A;  3Q2P A;  1BNS A;  2JQ5 A;  3CME 3;  2K3D A;  5EQL A;  1A67 A;  1V58 A;  3B4O A;  3EF8 A;  3S67 A;  1RRH A;  2PNC A;  1OHS A;  3FGY A;  1L5G B;  2GSP A;  3F8H A;  1G96 A;  1T5Y A;  1C54 A;  1SAR A;  1BUJ A;  3U1W A;  1PY3 A;  3NX0 A;  4XDV A;  3S28 A;  1ZGX A;  3DGO A;  4EW5 A;  1TTO A;  4IT7 A;  1LOW A;  1Y4K A;  1GOU A;  3RGR A;  2AAE A;  4FCZ A;  2F56 A;  2Z76 A;  1STF I;  2W6J H;  1RNB A;  3NV0 B;  2FGT A;  1EQK A;  5IER A;  1CH0 A;  3GZR A;  7RNT A;  3STD A;  4G1M B;  3OXA A;  1FUS A;  3FG3 A;  5FW5 A;  4H3U A;  2KF3 A;  3RDE A;  4KFE A;  3T8U A;  1NO3 A;  1X1Y A;  5AEW B;  3B8L A;  3SED A;  3TDG A;  1R4Y A;  2D42 A;  4R9L A;  1TP6 A;  1G02 A;  1BU4 A;  1O7W B;  2CC3 A;  3OWU A;  4XBY A;  3X3X A;  1RKY A;  2OTL 3;  1DMN A;  1LXE A;  4HM2 B;  3LOY A;  3F7S A;  3F9S A;  1BRG A;  3RGA A;  1LOY A;  2BU4 A;  2LYX A;  3FH1 A;  4R9K A;  1BGS A;  2SAR A;  3FLJ A;  2IY2 A;  2P0X A;  1Q42 A;  1M9G A;  2YFI B;  4N6V 0;  1UCI A;  5RNT A;  5D82 A;  3WOD G;  1CQS A;  1AQZ A;  1OF5 A;  2GEY A;  1MWU A;  1SQW A;  1Q9E A;  1IDP A;  2AAD A;  4HM8 B;  1W4N A;  4HM7 B;  3EX9 A;  1BNE A;  3JUP A;  4FMB A;  4O02 B;  1OCV A;  1VQK 3;  1JBT A;  1JKG A;  2YX9 A;  1GSP A;  2CWU A;  3HZP A;  3V99 A;  3JUQ A;  5CF2 A;  2RSX A;  1ISK A;  5LC7 A;  3QK9 A;  3N54 B;  5D81 A;  1JB5 A;  2RFR A;  4K90 B;  4WYK A;  1QAK A;  1VQN 3;  1AY7 A;  3HX8 A;  5TGN A;  2UX0 A;  2YFJ B;  1DET A;  2QIY A;  3DGM A;  4H61 A;  2XFS A;  5DRV A;  1W7C A;  2W56 B;  3EBY A;  1ZX2 A;  3T0U A;  2IUJ A;  3ER7 A;  4MMY B;  1K8A 4;  3K63 A;  1VQ5 3;  1UGH I;  5STD A;  3DGL A;  5G2G A;  1TU5 A;  3KCH A;  3K9M C;  1R4C A;  1T3B A;  1TFK A;  2CG0 A;  2CWT A;  3GZB A;  2E2U A;  1BNI A;  2Q07 A;  4KFD A;  1IVW A;  4KVH A;  4BIR A;  1PFP A;  3DXO A;  4CCV A;  1VQL 3;  3CNX A;  4HOH A;  1UCJ A;  1OPY A;  1JB2 A;  4Q53 A;  1BAO A;  1IQ8 A;  1MOL A;  2F4Y A;  4LMI A;  1DMM A;  2W04 A;  1HYF A;  1OAC A;  3EE1 A;  1W02 A;  2WGQ A;  1NJI 4;  1VQO 3;  1EA2 A;  1NNV A;  1RNT A;  3L0R A;  4EXR A;  1YJN 3;  3CCQ 3;  1N8R 4;  4L8O A;  1X1U A;  1JB4 A;  2UGI A;  3LYG A;  1YGW A;  1IYY A;  2Z6B A;  2WO0 A;  1BRI A;  1QVG 2;  3VF1 A;  4BTX A;  1AR0 A;  1D6Z A;  1U8C B;  2IA7 A;  2HMJ B;  1VQ4 3;  2ML6 A;  1BRH A;  5M1A A;  3JUM A;  3SOA A;  2P38 A;  3BU4 A;  2OTJ 3;  1Q7H A;  4LSO A;  3BNB A;  3GZX B;  3HK4 A;  3PS8 A;  3LT9 A;  3S29 A;  1ROV A;  1B2X A;  1W6Y A;  1DVD A;  1D6U A;  4FCM A;  2H0I A;  1UGI A;  1I0X A;  4HM3 B;  1LRA A;  3NM7 A;  2LQV A;  2L1S A;  5JPP A;  3X3Z A;  1MWR A;  5IF6 A;  1MWS A;  1BOX A;  2UUG C;  8RNT A;  3SOY A;  3GAX A;  1FGM A;  1RGH A;  3WHO A;  3DUK A;  3LTD A;  1MGW A;  1OUN A;  3JUO A;  2OWP A;  2W2C A;  5IG3 A;  3IMA B;  1RN7 A;  1FGO A;  4HM5 B;  3CPW 2;  1RCL A;  1RGK A;  3EJV A;  3MHE A;  3CCM 3;  2XGL A;  1I2G A;  1B3S A;  5M19 A;  1JN5 A;  4BL2 A;  2OOV C;  1RGE A;  3EB8 A;  2P0M A;  1JZO A;  1RGF A;  1UI8 A;  2RBI A;  4RNY A;  2IUK A;  1IVU A;  4ILF A;  3DZL A;  1O7M B;  4KT3 B;  1N5P A;  5G1L A;  1RGC A;  2RNT A;  2RGQ A;  3CCE 3;  1E97 A;  5AYS C;  1RHL A;  1OH0 A;  1WMN A;  3WR2 A;  2KAA A;  3AHW A;  3HII A;  4N6M A;  2H0G A;  1GS3 A;  2B24 B;  3G0K A;  2WOF A;  4R1K A;  1RTU A;  3VGN A;  1W6C A;  2QA4 3;  4L7K A;  1GD4 A;  2J8X B;  1GOV A;  2KF4 A;  3X42 A;  4HAA A;  1Q81 4;  4CJN A;  4MJD A;  5IEN A;  2O3O A;  4HM0 B;  4ORL A;  3BNC A;  3MG3 A;  3FZW A;  1Q40 B;  3FKA A;  2ZL8 A;  1TRQ A;  4U13 A;  6RNT A;  1O7G B;  1KD1 4;  1UUG B;  3RNT A;  1ROA A;  1BNJ A;  1FGQ A;  2FXT A;  4AEQ A;  2ZDJ A;  3DGN A;  4J5K A;  1UCK A;  3E99 A;  2BO9 B;  2F99 A;  4XM4 A;  2OOV A;  2JDI H;  3PZW A;  1RJO A;  4HZB B;  4J5G A;  5IG0 A;  1IQX A;  1UI7 A;  2W03 A;  1RLS A;  3URP A;  3BIR A;  3MSO A;  1RRL A;  1IU7 A;  3CC4 3;  2KF6 A;  3MG1 A;  2A15 A;  5GSP A;  3G16 A;  3NM2 A;  2CH9 A;  3DMC A;  3Q90 A;  3FSD A;  4EYC A;  2Z7A A;  1W5Z A;  2W9Q A;  3DH2 A;  1W00 A;  2K54 A;  1U5O A;  3ZG5 A;  1E3V A;  2C10 A;  4IIA A;  1PU4 A;  3DM8 A;  3G4S 3;  1QJG A;  1FGR A;  1HU9 A;  1TRP A;  1EEJ A;  1A2K A;  4N3V A;  1J2B A;  3SX1 A;  1X1W A;  3UL6 A;  4BL3 A;  2F86 B;  4FMD A;  3CU3 A;  3KN4 A;  3LT8 A;  1B21 A;  4BTW A;  2YFL B;  5CK6 A;  1FUW A;  3AMO A;  3D9R A;  2XRX B;  5KP1 A;  1BUQ A;  3SXX A;  3FF2 A;  5AIH A;  1YNV X;  1FZU A;  2E2V A;  5FGO A;  1VQ6 3;  3NQY A;  3T8N A;  1BNR A;  1BRK A;  1FW7 A;  1TJD A;  2MF7 A;  1HZ1 A;  1IT7 A;  2GXF A;  2P05 A;  1GOY A;  3UB1 A;  3EHC A;  9RNT A;  3F8X A;  4WFO A;  1BSA A;  4GB5 A;  1GY5 A;  2KCD A;  1LQG C;  4KZ1 A;  1RGL A;  5CF1 A;  1A2V A;  1N5H A;  3CXC 2;  4I4K A;  3KSP A;  1LOX A;  3WOE B;  1EUI C;  3SLU A;  2GBW B;  3FG1 A;  4I5Q A;  3Q3F A;  1ZO2 A;  2O9U X;  3NQZ A;  1A2P A;  1BIR A;  4X2O A;  4OVM A;  2XH9 A;  2F98 A;  3V98 A;  3BB9 A;  1UDI I;  1AV4 A;  3CMA 3;  1BNG A;  1X1X A;  2XEP A;  4O2H A;  1FGT A;  1B2S A;  3UJM A;  1BSE A;  3X40 A;  1US1 A;  5JPU A;  1A90 A;  4O3V A;  2CKF B;  3WMD A;  4EV5 A;  1JRQ A;  3CNM A;  4AKZ A;  4L8P A;  4MMX B;  2M7O A;  4PEJ A;  4KFF A;  4LYL B;  3GWR A;  1VZZ A;  2PZV A;  3JVC A;  4J9A A;  1PYL A;  2QEX 3;  1SII A;  2XSH B;  5EEO A;  1I2F A;  3O8Y A;  3M8C A;  3K7C A;  3NV0 A;  2FNQ A;  4K61 A;  2HML B;  3IPT A;  4RBN A;  5AYR B;  4CPK A;  3MG2 A;  1QMA A;  2BMQ B;  3BNE A;  3EBT A;  4RZM A;  5BXQ A;  1RMS A;  3LH4 A;  3IJE B;  3KZT A;  1M1K 4;  1B2M A;  3GZY B;  4HJL B;  5BIR A;  1EG9 B;  1YJW 3;  1F8N A;  4FCJ A;  5AI1 A;  1W01 A;  1MNL A;  3NXJ A;  2R4I A;  1EKM A;  5HOH A;  6STD A;  2E2T A;  1CEW I;  4NRE A;  2WOH A;  3G6E 3;  1I3I A;  2F5W A;  2BMO B;  1YVS A;  4HM6 B;  1WTH A; 
#chains in the Genus database with same CATH homology
 3PCS A;  3NBR A;  5AIF A;  2ML5 A;  5CLK A;  1KQS 2;  2P09 A;  3I56 3;  3KSE D;  1HKX A;  2Z77 A;  1YGE A;  4CDL A;  3WA3 A;  3LML A;  1VQ7 3;  4HM4 B;  3PYJ A;  2XR8 B;  1ULI B;  4QWT A;  3UNL A;  1YJ9 3;  3I0Y A;  1WMO A;  3ROB A;  3U97 A;  4ZM8 A;  3N8B A;  1ASK A;  5LC6 A;  3H51 A;  1WQL B;  3MKI A;  3OWY A;  3CCL 3;  1DMQ A;  2CFD A;  3S5C A;  2W56 A;  3KII A;  1D6Y A;  1JV2 B;  1C7H A;  2RCD A;  1O7H B;  3FCS B;  1KWI A;  2CFG A;  4HBR A;  4MEI A;  1Q7Y 4;  3PCR A;  3OW2 2;  1FA3 A;  2KRT A;  4HM1 B;  2HMK B;  4HKV B;  2CFL A;  1Q82 4;  3WOF B;  1OF5 B;  2CWV A;  4J8T A;  5IEO A;  3V92 A;  2GU3 A;  5AII A;  1GYB A;  1GY6 A;  2L4V A;  3F14 A;  4JF8 A;  1KC8 4;  2KXG A;  2Y74 A;  1QVF 2;  1JKG B;  3MPH A;  4O8S A;  1Z1S A;  3LTC A;  2BMR B;  3EC9 A;  3WDG B;  2I9W A;  4R80 A;  2K0M A;  3FF0 A;  4WYK B;  5D83 A;  1W2B 2;  4XDW A;  1SIH A;  2IMJ A;  3OV4 A;  2GU1 A;  2CFK A;  3NUV A;  1YIJ 3;  5JBS A;  4XB5 A;  1GD3 A;  3OWS A;  1Q86 4;  1CYV A;  2XFT A;  1NU3 A;  3CCU 3;  4NHF A;  1NB5 I;  5ELJ A;  4EV2 A;  1GY7 A;  1K41 A;  4N6L A;  3CD6 3;  3J7Y d;  4R4K A;  3I55 3;  1WNH A;  2CK3 H;  1K28 A;  4WP5 A;  1IK3 A;  3LZA A;  4LGQ A;  3EQQ B;  1N8Q A;  2CIU A;  1VQ9 3;  5CXO A;  2CHC A;  3ALA A;  2CW9 A;  4IPB A;  3CCV 3;  4LEH A;  3WA2 X;  3B4P A;  3B7C A;  3HI7 A;  1N9J A;  3H3H A;  4FMC A;  1NWW A;  2OCT A;  1SPU A;  4N6U A;  3CCS 3;  2W0Q A;  3NHX A;  5I97 A;  2BT3 A;  8CHO A;  1K9M 4;  2WGO A;  3BLZ A;  3X41 A;  3NBB A;  3KE7 A;  4N6N B;  1NDO B;  4HYZ A;  1O7P B;  2OQE C;  5DRE A;  3VSY A;  1W6G A;  3DY5 A;  3LTB A;  3S27 A;  1YVB I;  1JNQ A;  1OGZ A;  5EVH A;  1K73 4;  1SJW A;  2B1X B;  4K1U A;  1E3R A;  1N9E A;  5A0O B;  3OX9 A;  1STD A;  4OK0 A;  3X3Y A;  1Q40 A;  1IVV A;  3CCR 3;  2D1W A;  1JN5 B;  5HGR A;  2CFW A;  2XGN A;  3N9H A;  3PXM A;  4N6O B;  3Q1C A;  1O7N B;  3KKG A;  3CCJ 3;  2GEX A;  3EN1 B;  3LXU X;  4WWU C;  2C11 A;  2OQE A;  3K5T A;  1YHQ 3;  4X2H A;  1IT8 A;  3GRD A;  3FG4 A;  1IV9 A;  5IEP A;  1KSI A;  2SBL A;  2BNG A;  3F7X A;  2STD A;  4RNZ A;  4EBG A;  3JUN A;  1DVC A;  2XSO B;  3G8Z A;  3BND A;  4K1V A;  5ELU A;  5IG4 A;  3CC7 3;  1LVN A;  1UUV B;  1TFO A;  1VQM 3;  2XF3 A;  1VQP 3;  2HMO B;  1S72 3;  2BHM A;  1CYU A;  1M1X B;  3D3L A;  4TX4 A;  1OHP A;  2Y73 A;  4JRF A;  4XBX A;  2V1L A;  3G71 3;  1ULJ B;  3CPO A;  1YIT 3;  4HVN A;  1AVL A;  5BVB A;  3EN8 A;  1NB3 I;  4HZ9 B;  1WMP A;  3KFQ C;  1QAF A;  3F40 A;  1TUH A;  5IG5 A;  1LNH A;  1VQ8 3;  1DYU A;  3NBJ A;  4AKY A;  1S5A A;  3LTA A;  3MWZ A;  2MC8 A;  1W2Z A;  4XBT A;  1M90 4;  3SVA A;  4EC6 A;  1QAL A;  1YI2 3;  5IW9 A;  1AVK A;  1JJ2 2;  5KP3 A;  3HIG A;  3ECF A;  3AMO B;  3UL5 A;  1OHO A;  1IQY A;  3K0Z A;  2CG1 A;  4FMA A;  1UUW B;  2GBX B;  1OGX A;  3MYT A;  1IVX A;  2W9P A;  3QRD A;  4OUQ A;  1V74 A;  3CC2 3;  3PGB A;  2INX A;  2HMM B;  4GL6 A;  1UW1 A;  3A76 A;  4MMZ B;  4WHA A;  5AIG A;  1IV7 A;  4N6T A;  4LZI A;  7STD A;  5AEU B;  4BTY A;  1TIJ A;  4STD A;  5KP4 A;  2HMN B;  4FR9 A;  2QGU A;  3Q2P A;  3CME 3;  2JQ5 A;  5EQL A;  1A67 A;  3EF8 A;  3B4O A;  3S67 A;  1RRH A;  2PNC A;  1OHS A;  3FGY A;  1L5G B;  3F8H A;  1G96 A;  1T5Y A;  3U1W A;  3NX0 A;  4XDV A;  3S28 A;  3DGO A;  4IT7 A;  1Y4K A;  3RGR A;  4FCZ A;  2Z76 A;  1STF I;  2W6J H;  3NV0 B;  2FGT A;  1EQK A;  5IER A;  3GZR A;  3STD A;  4G1M B;  3OXA A;  3FG3 A;  5FW5 A;  4H3U A;  3RDE A;  4KFE A;  3T8U A;  1NO3 A;  5AEW B;  3B8L A;  3SED A;  3TDG A;  2D42 A;  4R9L A;  1TP6 A;  1O7W B;  3OWU A;  4XBY A;  2CC3 A;  3X3X A;  2OTL 3;  1RKY A;  1DMN A;  1LXE A;  4HM2 B;  3LOY A;  3F7S A;  3F9S A;  3RGA A;  2LYX A;  3FH1 A;  4R9K A;  3FLJ A;  2P0X A;  1Q42 A;  1M9G A;  2YFI B;  4N6V 0;  5D82 A;  3WOD G;  1CQS A;  1OF5 A;  2GEY A;  1SQW A;  1IDP A;  4HM8 B;  1W4N A;  4HM7 B;  3EX9 A;  3JUP A;  4FMB A;  4O02 B;  1OCV A;  1VQK 3;  2YX9 A;  1JKG A;  3HZP A;  2CWU A;  3V99 A;  3JUQ A;  5CF2 A;  2RSX A;  1ISK A;  5LC7 A;  3QK9 A;  3N54 B;  5D81 A;  1JB5 A;  2RFR A;  4K90 B;  4WYK A;  1QAK A;  1VQN 3;  3HX8 A;  5TGN A;  1TU5 A;  2UX0 A;  2YFJ B;  5DRV A;  2QIY A;  3DGM A;  4H61 A;  2XFS A;  1W7C A;  2W56 B;  3EBY A;  1ZX2 A;  3T0U A;  2IUJ A;  3ER7 A;  4MMY B;  1K8A 4;  3K63 A;  1VQ5 3;  5STD A;  3DGL A;  5G2G A;  3K9M C;  1R4C A;  2CG0 A;  1TFK A;  2CWT A;  3GZB A;  2E2U A;  2Q07 A;  4KFD A;  1IVW A;  4KVH A;  1PFP A;  3DXO A;  4CCV A;  1VQL 3;  3CNX A;  1OPY A;  1JB2 A;  4Q53 A;  1IQ8 A;  4LMI A;  1MOL A;  1DMM A;  2W04 A;  1OAC A;  3EE1 A;  1W02 A;  2WGQ A;  1NJI 4;  1VQO 3;  1EA2 A;  3L0R A;  4EXR A;  1YJN 3;  3CCQ 3;  1N8R 4;  4L8O A;  1JB4 A;  3LYG A;  2Z6B A;  2WO0 A;  1QVG 2;  3VF1 A;  4BTX A;  1AR0 A;  1D6Z A;  1U8C B;  2IA7 A;  2HMJ B;  1VQ4 3;  2ML6 A;  3JUM A;  3SOA A;  2P38 A;  2OTJ 3;  4LSO A;  3BNB A;  3GZX B;  3HK4 A;  3PS8 A;  3LT9 A;  3S29 A;  1ROV A;  1W6Y A;  1DVD A;  1D6U A;  4FCM A;  4HM3 B;  5JPP A;  3NM7 A;  2LQV A;  3X3Z A;  5IF6 A;  3SOY A;  3GAX A;  1FGM A;  3DUK A;  3LTD A;  1OUN A;  3JUO A;  2OWP A;  2W2C A;  5IG3 A;  3IMA B;  1RN7 A;  1FGO A;  4HM5 B;  3CPW 2;  3MHE A;  3EJV A;  3CCM 3;  2XGL A;  1JN5 A;  2OOV C;  3EB8 A;  2P0M A;  1UI8 A;  4RNY A;  2IUK A;  1IVU A;  3DZL A;  1N5P A;  3CCE 3;  2RGQ A;  1E97 A;  5AYS C;  1OH0 A;  1WMN A;  3HII A;  4N6M A;  1GS3 A;  2B24 B;  3G0K A;  2WOF A;  4R1K A;  3VGN A;  1W6C A;  2QA4 3;  4L7K A;  1GD4 A;  3X42 A;  1Q81 4;  5IEN A;  4MJD A;  2O3O A;  4HM0 B;  4ORL A;  3BNC A;  3MG3 A;  3FZW A;  1Q40 B;  3FKA A;  2ZL8 A;  4U13 A;  1O7G B;  1KD1 4;  1ROA A;  1FGQ A;  2FXT A;  4AEQ A;  2ZDJ A;  3DGN A;  3E99 A;  2BO9 B;  2F99 A;  4XM4 A;  2OOV A;  2JDI H;  3PZW A;  1RJO A;  4HZB B;  5IG0 A;  1IQX A;  1UI7 A;  2W03 A;  3MSO A;  1RRL A;  1IU7 A;  3CC4 3;  3MG1 A;  2A15 A;  3G16 A;  3NM2 A;  2CH9 A;  3DMC A;  3Q90 A;  3FSD A;  4EYC A;  2Z7A A;  1W5Z A;  2W9Q A;  1W00 A;  2K54 A;  1U5O A;  1E3V A;  2C10 A;  4IIA A;  1PU4 A;  3DM8 A;  3G4S 3;  1QJG A;  1FGR A;  1HU9 A;  1A2K A;  4N3V A;  1J2B A;  3SX1 A;  3UL6 A;  2F86 B;  4FMD A;  3CU3 A;  3KN4 A;  3LT8 A;  4BTW A;  2YFL B;  5CK6 A;  1FUW A;  3AMO A;  3D9R A;  2XRX B;  5KP1 A;  1BUQ A;  3SXX A;  3FF2 A;  5AIH A;  2E2V A;  5FGO A;  1VQ6 3;  3NQY A;  3T8N A;  2MF7 A;  2GXF A;  1IT7 A;  2P05 A;  3UB1 A;  3EHC A;  3F8X A;  4WFO A;  4GB5 A;  1GY5 A;  2KCD A;  4KZ1 A;  5CF1 A;  1A2V A;  1N5H A;  3CXC 2;  4I4K A;  3KSP A;  1LOX A;  3WOE B;  3SLU A;  2GBW B;  3FG1 A;  2O9U X;  1ZO2 A;  3NQZ A;  4X2O A;  4OVM A;  2XH9 A;  2F98 A;  3V98 A;  3BB9 A;  1AV4 A;  3CMA 3;  4O2H A;  2XEP A;  3UJM A;  5JPU A;  1FGT A;  1A90 A;  3X40 A;  1US1 A;  4O3V A;  2CKF B;  3WMD A;  4EV5 A;  1JRQ A;  3CNM A;  4AKZ A;  4L8P A;  4MMX B;  2M7O A;  4PEJ A;  4KFF A;  3GWR A;  1VZZ A;  2PZV A;  3JVC A;  4J9A A;  2QEX 3;  1SII A;  2XSH B;  5EEO A;  3O8Y A;  3M8C A;  3K7C A;  3NV0 A;  2FNQ A;  4K61 A;  2HML B;  3IPT A;  4RBN A;  5AYR B;  3MG2 A;  1QMA A;  2BMQ B;  3BNE A;  3EBT A;  4RZM A;  5BXQ A;  3LH4 A;  3IJE B;  3KZT A;  1M1K 4;  3GZY B;  4HJL B;  1YJW 3;  1EG9 B;  1F8N A;  4FCJ A;  5AI1 A;  1W01 A;  1MNL A;  3NXJ A;  2R4I A;  1EKM A;  6STD A;  2E2T A;  1CEW I;  4NRE A;  2WOH A;  3G6E 3;  2BMO B;  1O7M B;  4HM6 B;  1WTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...