3F8HA

Crystal structure of a putative polyketide cyclase (tm1040_3560) from silicibacter sp. tm1040 at 2.00 a resolution
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
137
structure length
137
Chain Sequence
NLYFQGMNDTIARYFDAFNAGDTDGMLACLSEDVAHHVNEGNIRVGKEKFAAFCAHMSHCYKEELTDMVIFATPDATRAAAEYTVNGTYLATDEGLPEARQQSYKLPAGSFFDLRDGLITRVTTYYNLSDWIKQVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (YP_611791.1) from SILICIBACTER SP. TM1040 at 2.00 A resolution
rcsb
source organism Silicibacter sp. tm1040
molecule tags Unknown function
total genus 38
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f8hA00
1DMMA 2YFIB 4R9KA 3CU3A 5AEWB 5AIHA 4HM2B 5FW5A 1NU3A 3EQQB 4HM4B 4HVNA 1GY7A 3EN1B 3IPTA 3BLZA 1OGZA 5JPPA 1WQLB 1JB4A 1W01A 1NWWA 3BB9A 2YFLB 1NDOB 3CNXA 3F8HA 4J8TA 3EF8A 2HMLB 3F8XA 5IENA 1JKGA 2XSHB 3DXOA 2YFJB 1O7PB 1ULIB 3T8NA 5AIGA 2XSOB 5AEUB 2A15A 3F7SA 1QMAA 5STDA 1GYBA 3NV0B 5D83A 3MSOA 4PEJA 3MG2A 5CK6A 1IDPA 3H51A 1ASKA 2CKFB 4H3UA 6STDA 3JUMA 3K0ZA 3JUNA 1OF5B 2K54A 3FH1A 4LMIA 1OUNA 1OPYA 3GZBA 3DZLA 1Q40B 4X2HA 4XBXA 4IIAA 3E99A 3KZTA 5IEPA 5D81A 3JUOA 3T8UA 2GXFA 2BMRB 4K1VA 2XRXB 3SOAA 3CPOA 2RGQA 2GEYA 1ULJB 1DMNA 4I4KA 3GWRA 4L8OA 3NM2A 4J9AA 2JQ5A 4HM6B 4R9LA 3SOYA 4K1UA 5KP1A 2RCDA 3MHEA 1ZO2A 4X2OA 5CF1A 5BVBA 3F7XA 4HM0B 5CXOA 3KE7A 2B24B 3FF2A 2OWPA 5DRVA 2GEXA 4XM4A 1CQSA 4WYKA 2I9WA 2F98A 4L7KA 5DREA 2QGUA 3G8ZA 3RGAA 3OXAA 2HMNB 3GZYB 3FKAA 1W02A 5AIIA 3DM8A 3FGYA 4HM8B 3K7CA 4LEHA 2BNGA 1OGXA 4STDA 3M8CA 4ORLA 3OWSA 1BUQA 3B7CA 3OWUA 5IG0A 3HZPA 2B1XB 5KP3A 1JN5A 1TUHA 4GB5A 2Z7AA 1E97A 2HMOB 4U13A 4HZBB 1AR0A 3FZWA 2GBXB 4WWUC 1QJGA 4HZ9B 1HKXA 1GS3A 3D9RA 3NV0A 4CDLA 2STDA 8CHOA 1OHSA 1UUWB 3GZRA 1EG9B 2W2CA 1JB2A 3MKIA 4HM5B 3WMDA 1OCVA 1SJWA 5CLKA 3H3HA 3EHCA 4HJLB 1GY6A 1JB5A 1O7NB 1O7WB 1OH0A 2F99A 3EBYA 4XB5A 1UUVB 4Q53A 2Z77A 1O7GB 1Q40A 4RZMA 2Z76A 3S5CA 3F9SA 1Q42A 3B8LA 3LYGA 4XDVA 1C7HA 4HM3B 3EX9A 3ECFA 3MYTA 2F86B 3LZAA 1GY5A 1OHOA 3UNLA 1VZZA 2HMMB 5AIFA 3OV4A 1Z1SA 3B4PA 4XBYA 2XR8B 4R1KA 2INXA 5IG4A 3DUKA 4XDWA 3F40A 5AI1A 3RGRA 4FCMA 4WP5A 3FF0A 3HK4A 2R4IA 1JKGB 4MJDA 5CF2A 4L8PA 7STDA 5IERA 3MG1A 5D82A 3ROBA 3Q90A 5IG3A 2HMKB 2RFRA 4N3VA 3MG3A 4HM1B 3A76A 1S5AA 3OWYA 1EA2A 1U5OA 1JN5B 3CNMA 1O7MB 2PZVA 4LGQA 1ZX2A 4HM7B 3JUQA 1E3VA 2HMJB 3NBRA 3F14A 3GZXB 3EC9A 3G16A 5JPUA 1W00A 3B4OA 3KKGA 3DMCA 3EBTA 2UX0A 5HGRA 1TP6A 3UJMA 3JUPA 1W6YA 1E3RA 3EJVA 1O7HB 5EVHA 3G0KA 4FCJA 3GRDA 4XBTA 5BXQA 3KSPA 3SEDA 3HX8A 5IF6A 1OF5A 4KVHA 1STDA 2QIYA 2CHCA 4HKVB 3I0YA 3STDA 1A2KA 1DMQA 1OHPA 2BMOB 3NHXA 3VSYA 5IEOA 4OVMA 3FSDA 4OUQA 3OX9A 2GBWB 1ISKA 5G2GA 3NXJA 3ER7A 2BMQB 4WYKB 1K41A 5TGNA 5IG5A 2IMJA 3NUVA 5KP4A 3EN8A 3VGNA 3FLJA
chains in the Genus database with same CATH superfamily
2CFKA 4J5GA 1DMMA 1MWTA 1WMOA 2YFIB 4R9KA 1BNGA 1UCIA 4R4KA 3CU3A 5AEWB 2L1SA 1LOYA 5AIHA 2OCTA 2XFSA 2CK3H 1RGCA 4HM2B 2KF5A 2W9PA 5FW5A 2XF3A 1NU3A 3EQQB 4HM4B 4HVNA 1GY7A 3EN1B 1STFI 3IPTA 1B2SA 2W03A 1IYYA 4GL6A 2CC3A 3BLZA 1MWSA 1OGZA 4KZ1A 3UB1A 5G1KA 5JPPA 1JZDA 1WQLB 1A67A 1JB4A 3FCSB 1CH0A 2ML5A 1W01A 1NWWA 1D6ZA 2BIRA 3DGMA 2WGOA 2Z6BA 5GSPA 3BB9A 3T0UA 3DGYA 4K90B 4LYLB 1Q814 2YFLB 3WR2A 1NDOB 1W2ZA 3CNXA 4RNYA 3F8HA 2CX1A 2FNQA 2D1WA 4J8TA 1B27A 1K9M4 3BNEA 3EF8A 1RGGA 2HMLB 3BNCA 2Y74A 5RNTA 3F8XA 1BAOA 3CCS3 3LT9A 5IENA 1JKGA 2LYXA 2XSHB 3DXOA 1K8A4 3K5TA 3SX1A 3CME3 1LQGC 1EKMA 3MWZA 2YFJB 1O7PB 1RKYA 2CWTA 3WOFB 1ULIB 3WODG 3MPHA 3T8NA 4BTYA 5AIGA 5M19A 1RN1A 2XSOB 1OACA 5AEUB 1BU4A 2A15A 1QMAA 3F7SA 5STDA 9RNTA 4R80A 1GYBA 3CCU3 1W7CA 3DH2A 1PU4A 1JNQA 1UUGB 3NV0B 5D83A 1Q824 7GSPA 1YHQ3 4O3VA 2OQEA 4MMXB 3MSOA 4PEJA 3MG2A 3X40A 1W2B2 1AVKA 5CK6A 1IDPA 1QALA 1BSBA 3URPA 1PYLA 3GSPA 3H51A 1X1WA 1RSNA 2F5WA 2ZL8A 1ASKA 1BRGA 2IA7A 3K9MC 1TJDA 2KF3A 5HOHA 3CMA3 3L0RA 2ZHXB 4EXRA 1RNTA 2CKFB 2C11A 4H3UA 6STDA 1IK3A 1A2VA 2V1LA 3JUMA 3ALAA 3K0ZA 4HYZA 1DVDA 3JUNA 1FW7A 1OF5B 2C4BA 2K54A 1SQWA 1N8QA 4FCZA 3V92A 2QA43 1X1UA 2PNCA 3FH1A 4LMIA 4WFOA 3SLUA 3RNTA 1NB5I 4HBRA 1OUNA 1AV4A 1OPYA 5AYSC 1I0VA 3GZBA 1RN7A 3QRDA 3LH4A 3AMOA 3DZLA 1VQ73 4BL2A 5EQLA 1Q40B 1AQZA 2P38A 2UUGC 2F5MA 4X2HA 1AY7A 2CFGA 4J5KA 3CXC2 1I2FA 4XBXA 3V99A 3CC23 1N5PA 4IIAA 3E99A 4FR9A 3KZTA 4AKZA 5IEPA 4CCVA 3D5GA 3Q1CA 5D81A 2P09A 4HAAA 3JUOA 3T8UA 2GXFA 2BMRB 1FUTA 1Q7HA 1US1A 1DE3A 3O8YA 4K1VA 4EV5A 4FMCA 2XRXB 1UCJA 1IQXA 3BIRA 1Q864 1EEJA 3SOAA 3CPOA 2RGQA 1R4YA 4CJNA 1BRKA 3PYJA 2GEYA 1ULJB 2FGTA 1Y4KA 1DMNA 3D79A 4I4KA 1UW1A 1BRJA 1SPUA 3GWRA 4L8OA 1UCKA 4NHFA 1VQ63 1IQ8A 3PCRA 3NM2A 3AHSA 4N6V0 3Q3FA 2W9QA 3CCV3 4J9AA 2JQ5A 4K61A 4HM6B 1BRSA 2RSXA 5G1LA 4R9LA 4AKYA 3FG1A 4WHAA 1FYSA 3SOYA 4EW5A 4K1UA 3ZG0A 3A5EA 2CIUA 1UDII 1FGMA 1BRNL 2W6JH 5FGOA 5KP1A 2RCDA 3MHEA 4CPKA 1ZO2A 1TFKA 4MMZB 3LXUX 1JBTA 2M7OA 4QWTA 2AAEA 3TDGA 4X2OA 2BU4A 3Q2PA 1HZ1A 1W4NA 2W0QA 5CF1A 1BSCA 5BVBA 3F7XA 1M1XB 3K63A 2RBIA 4HM0B 1JJ22 1IT7A 3KCHA 1FZUA 3KE7A 5CXOA 2H0GA 2CG1A 1BSAA 3D3LA 1VQ93 1JV2B 2B24B 2UGIA 2OWPA 3FF2A 1BIRA 2F4YA 5DRVA 2GEXA 1FGTA 4XM4A 1BVIA 1FA3A 4LSOA 3EE1A 1B3SA 1X1XA 1CQSA 4WYKA 3PCSA 4MEIA 3DGOA 1NO3A 2I9WA 2BO9B 1UGIA 2F98A 4RBNA 1VQK3 1Q7Y4 1KC84 1I2GA 4L7KA 3G4S3 5DREA 3QK9A 6GSPA 2QGUA 3WHOA 3G8ZA 3OXAA 4JRFA 3RGAA 2HMNB 3LMLA 3X41A 4I5QA 3GZYB 3FKAA 3NX0A 2ZA4A 2CFDA 1ZS7A 2H0IA 1RGAA 1W02A 3WOEB 1AVLA 1SIIA 1FGRA 2L4VA 1LXEA 5AIIA 1J2BA 3NBBA 1LOXA 3LTCA 3DM8A 3FGYA 4OK0A 3WA3A 1RCKA 2WGQA 4KFFA 1VQP3 4HM8B 1A90A 3K7CA 2KF6A 3S27A 1B2XA 2IUKA 3KSED 3SVAA 1N9JA 1W6GA 1BSDA 4LEHA 1IVUA 3X42A 2BNGA 2GU1A 1OGXA 3KIIA 4STDA 2IY2A 7RNTA 5IG5A 2O3OA 3U1WA 3M8CA 1BANA 4ORLA 3CD63 3OWSA 2XGLA 4KFDA 4AEQA 1BUQA 1I8VA 3B7CA 3I563 3OWUA 4FMDA 3PS8A 1WTHA 2E2UA 5IG0A 3HIGA 2OTJ3 2D42A 3HIIA 3HZPA 2B1XB 1GMPA 2WO0A 1T2IA 5KP3A 1LNHA 2CH9A 3V98A 1JN5A 1BSEA 4KFEA 1TUHA 1A2PA 4GB5A 2W56B 2Z7AA 1E97A 4RNZA 1IV7A 1DETA 1SIHA 2HMOB 4U13A 4HZBB 2HOHA 1AR0A 1G96A 1LVNA 3FZWA 1VQL3 2GBXB 1GOYA 2RNTA 3NQYA 4WWUC 1QJGA 1NNVA 1BNIA 4BTXA 1RGHA 4HZ9B 5EEOA 1RRLA 2FXTA 3ZG5A 1HKXA 2CWUA 1W6CA 1T5YA 2OQEC 3AGOA 4N6MA 5I97A 1GS3A 1RRHA 3D9RA 3NV0A 2STDA 3LT8A 3UL5A 4CDLA 8CHOA 1RGFA 3DY5A 1VQN3 1RGKA 1IQYA 3ZFZA 8RNTA 1N8R4 1UUWB 3GZRA 1JBRA 1EG9B 2W2CA 1JZOA 1ROVA 3NQZA 5BIRA 3CCQ3 2OTL3 1JB2A 1FUSA 1K28A 1SARA 1JRQA 1KD14 1ROAA 3MKIA 4HM5B 1VQ53 3WMDA 1UI8A 3S67A 1OCVA 1YGEA 1SJWA 1I2EA 5CLKA 4EV2A 3PZWA 5A0OB 3H3HA 1LQMB 2J8XB 1K734 3EHCA 4DKIA 1JBSA 1RGLA 1ZGXA 1GY6A 1JB5A 4HJLB 1O7NB 1O7WB 3CCJ3 1RCLA 1MWRA 1OH0A 1DVCA 1UGHI 2F99A 1F8NA 2CW9A 2MF7A 3EBYA 4HOHA 1IV9A 1UUVB 4XB5A 4Q53A 1LOWA 2IUJA 2Z77A 3PXMA 1O7GB 1YVBI 5IW9A 4BTWA 1Q40A 2CFWA 2KAAA 4N6OB 4RZMA 5LC6A 1G02A 2Z76A 3KFQC 3F9SA 3S5CA 2IYJA 1W5ZA 2Y73A 1Q42A 3B8LA 3X3XA 3LYGA 4XDVA 1G0TA 4IPBA 1C7HA 3DGLA 2OOVA 3UL6A 4HM3B 3NBJA 1T3BA 1RLSA 3EX9A 1QVF2 1MGRA 3ECFA 3MYTA 2F86B 2CG0A 3LZAA 1X1YA 3WDGB 3I553 4N6LA 1BRIA 2O9UX 1FGQA 1GY5A 1OHOA 2F56A 1YIJ3 3UNLA 2P0XA 3CPW2 1VZZA 3IMAB 2C10A 1KWIA 1RGEA 2HMMB 2K0MA 5AIFA 3G6E3 3OV4A 1Z1SA 4N6TA 3S29A 3B4PA 4XBYA 3D5IA 2XR8B 1TFOA 4R1KA 1GSPA 2INXA 2Q07A 4N6UA 5IG4A 1QAKA 3DUKA 3CCL3 2ML6A 1Q9EA 4XDWA 2R41A 3F40A 5AI1A 3RGRA 1QAFA 1V57A 3CCR3 3OW22 4FCMA 3EN8A 4WP5A 5ELUA 1M904 3FF0A 3HK4A 3CC43 2WOFA 2R4IA 3JVCA 4BL3A 2WOHA 3X3YA 1TU5A 1JKGB 3SXXA 3FG3A 4MJDA 5CF2A 3CCE3 2E2TA 1BNFA 1B20A 1R4CA 3PGBA 4L8PA 7STDA 1BOXA 2BHMA 5IERA 1I3FA 3LTBA 1T2HA 1CYVA 1VQQA 5LC7A 2SBLA 1MWUA 3BU4A 1WNHA 1RN4A 3DGNA 3MG1A 5D82A 3ROBA 3Q90A 5IG3A 1GMQA 3RDEA 1GOUA 4LZIA 2HMKB 2KXGA 2RFRA 1L5GB 1NB3I 4N3VA 1PY3A 3AHWA 3MG3A 4HM1B 4N6NB 2AADA 6RNTA 1KSIA 4O02B 3A76A 4GSPA 1S5AA 3N8BA 3OWYA 1IVXA 1EA2A 1N9EA 3J7Yd 1U5OA 4O2HA 3X3ZA 1QVG2 1JN5B 5BU4A 1U8CB 1RJOA 3CNMA 1O7MB 2PZVA 3KN4A 2KRTA 4KT3B 3IJEB 1BNEA 4LGQA 1ZX2A 4G1MB 1V74A 4HM7B 2E2VA 3EB8A 3JUQA 1FGOA 1E3VA 4GHOA 1YJN3 1BUJA 2HMJB 3NBRA 3F14A 3GZXB 2LQVA 1VQM3 1GD3A 1WMPA 2H0HA 3EC9A 3G16A 1IVWA 5JPUA 1W00A 3B4OA 3KKGA 1C54A 1TTOA 3DMCA 3EBTA 1KQS2 2XEPA 1LRAA 2UX0A 1MGWA 1D6YA 1BNSA 1B2UA 1BRHA 5HGRA 1TP6A 1FUWA 1D6UA 1YI23 3UJMA 2JDIH 3JUPA 3AMOB 3HOHA 4NREA 3U97A 1W6YA 4NPBA 1E3RA 3CC73 3EJVA 2KCDA 1WMNA 1I70A 1VQ43 1O7HB 1RDSA 2ZDJA 2GU3A 5EVHA 2CX0A 4EC6A 3WA2X 1NJI4 2W56A 3G0KA 2CFLA 4FMAA 5AYRB 3S28A 4H61A 1MNLA 4FCJA 1BNJA 2BT3A 1GOVA 3GRDA 1YJW3 3HI7A 1VQO3 4XBTA 1M9GA 3CCM3 5BXQA 1I3IA 1UI7A 3KSPA 3LTDA 3SEDA 2XH9A 3HX8A 5IF6A 4EYCA 1OF5A 1B2MA 1RNBA 3BNDA 3NM7A 1CEWI 4KVHA 1STDA 2QIYA 1PFPA 3N9HA 2XGNA 2CHCA 2K3DA 4HKVB 4BIRA 4EBGA 1EQKA 2YX9A 4ILFA 3I0YA 3STDA 1IVVA 1A2KA 1DMQA 1GD4A 1LOVA 1OHPA 4BU4A 1YGWA 2BMOB 1B21A 1I0XA 3NHXA 4FMBA 1LNIA 5IEOA 3FLJA 4OVMA 3VSYA 3FSDA 4MMYB 3VF1A 1M1K4 1DYUA 4OUQA 2QEX3 3SYUA 2SARA 5ELJA 1YIT3 3OX9A 2MC8A 1BNRA 2GBWB 2P0MA 3BNBA 5G2GA 1ISKA 1VQ83 1TRPA 1IT8A 3NXJA 3GAXA 4IT7A 5M1AA 1B2ZA 4TX4A 1RMSA 1MOLA 3AGNA 2CWVA 5M18A 3ER7A 4ZM8A 2BMQB 1UCLA 1YJ93 1YNVX 3G713 1N5HA 1EUIC 2XFTA 1IU7A 1CYUA 3FG4A 1YVSA 1GMRA 1TIJA 3D4AA 2GSPA 3LTAA 3N54B 1TRQA 1K41A 4WYKB 2KF4A 1HU9A 1V58A 4O8SA 5TGNA 2IMJA 2W04A 1HYFA 3LOYA 4JF8A 1BGSA 1RTUA 3NUVA 4RNTA 1S723 5KP4A 2OOVC 5JBSA 3VGNA 1RHLA 1OHSA 2P05A
chains in the Genus database with same CATH topology
2CFKA 1DMMA 1WMOA 2YFIB 4R9KA 4R4KA 3CU3A 5AEWB 5AIHA 2OCTA 2XFSA 2CK3H 4HM2B 2W9PA 5FW5A 2XF3A 1NU3A 3EQQB 4HM4B 4HVNA 1GY7A 3EN1B 1STFI 3IPTA 2W03A 4GL6A 2CC3A 3BLZA 1OGZA 4KZ1A 3UB1A 5JPPA 1WQLB 1A67A 1JB4A 3FCSB 2ML5A 1W01A 1NWWA 1D6ZA 3DGMA 2WGOA 2Z6BA 3BB9A 3T0UA 4K90B 1Q814 2YFLB 1NDOB 1W2ZA 3CNXA 4RNYA 3F8HA 2FNQA 2D1WA 4J8TA 1K9M4 3BNEA 3EF8A 2HMLB 3BNCA 2Y74A 3CCS3 3F8XA 3LT9A 5IENA 1JKGA 2LYXA 2XSHB 3DXOA 1K8A4 3K5TA 3SX1A 3CME3 1EKMA 3MWZA 2YFJB 1O7PB 1RKYA 2CWTA 3WOFB 1ULIB 3WODG 3MPHA 3T8NA 4BTYA 5AIGA 2XSOB 1OACA 5AEUB 2A15A 3F7SA 1QMAA 5STDA 4R80A 1GYBA 3CCU3 1W7CA 1PU4A 1JNQA 3NV0B 1Q824 5D83A 1YHQ3 4O3VA 2OQEA 4MMXB 3MSOA 4PEJA 3MG2A 3X40A 1W2B2 1AVKA 5CK6A 1IDPA 1QALA 3H51A 2ZL8A 1ASKA 3K9MC 2IA7A 3CMA3 3L0RA 4EXRA 2CKFB 2C11A 4H3UA 6STDA 1IK3A 1A2VA 2V1LA 3JUMA 3ALAA 3K0ZA 4HYZA 1DVDA 3JUNA 1OF5B 2K54A 1SQWA 1N8QA 4FCZA 3V92A 2QA43 2PNCA 3FH1A 4LMIA 3SLUA 1NB5I 4HBRA 1OUNA 1AV4A 1OPYA 5AYSC 3GZBA 1RN7A 3QRDA 3LH4A 3AMOA 3DZLA 1VQ73 5EQLA 1Q40B 2P38A 4X2HA 2CFGA 3CXC2 3V99A 4XBXA 3CC23 1N5PA 4IIAA 3E99A 4FR9A 3KZTA 4AKZA 5IEPA 4CCVA 3Q1CA 5D81A 2P09A 3JUOA 3T8UA 2GXFA 2BMRB 1US1A 3O8YA 4K1VA 4EV5A 4FMCA 2XRXB 1IQXA 1Q864 3SOAA 3CPOA 2RGQA 3PYJA 2GEYA 1ULJB 2FGTA 1Y4KA 1DMNA 4I4KA 1UW1A 1SPUA 4NHFA 3GWRA 4L8OA 1VQ63 1IQ8A 3PCRA 3NM2A 4N6V0 2W9QA 3CCV3 4J9AA 2JQ5A 4K61A 4HM6B 4AKYA 2RSXA 4R9LA 3FG1A 4WHAA 3SOYA 4K1UA 2CIUA 1FGMA 2W6JH 5FGOA 5KP1A 2RCDA 3MHEA 1ZO2A 1TFKA 4MMZB 3LXUX 2M7OA 4QWTA 3TDGA 4X2OA 3Q2PA 1W4NA 2W0QA 5CF1A 5BVBA 3F7XA 1M1XB 3K63A 4HM0B 1JJ22 1IT7A 5CXOA 2CG1A 3KE7A 3D3LA 1VQ93 1JV2B 2B24B 3FF2A 2OWPA 5DRVA 2GEXA 1FGTA 4XM4A 1FA3A 4LSOA 3EE1A 1CQSA 4WYKA 3PCSA 4MEIA 3DGOA 1NO3A 2I9WA 2BO9B 2F98A 4RBNA 1VQK3 1Q7Y4 1KC84 4L7KA 3G4S3 5DREA 3QK9A 2QGUA 3G8ZA 3OXAA 4JRFA 3RGAA 2HMNB 3LMLA 3X41A 3GZYB 3FKAA 3NX0A 2CFDA 3WOEB 1W02A 1AVLA 1SIIA 1FGRA 2L4VA 1LXEA 5AIIA 1J2BA 3NBBA 1LOXA 3LTCA 3DM8A 3FGYA 4OK0A 3WA3A 2WGQA 1VQP3 4KFFA 1A90A 4HM8B 3K7CA 3S27A 2IUKA 3KSED 3SVAA 1N9JA 1W6GA 4LEHA 1IVUA 3X42A 2BNGA 2GU1A 1OGXA 3KIIA 4STDA 2O3OA 3U1WA 3M8CA 4ORLA 3CD63 3OWSA 2XGLA 4KFDA 4AEQA 1BUQA 3B7CA 3I563 3OWUA 4FMDA 3PS8A 1WTHA 2E2UA 5IG0A 3HIGA 2OTJ3 2D42A 3HIIA 3HZPA 2B1XB 2WO0A 5KP3A 1LNHA 2CH9A 3V98A 1JN5A 4KFEA 1TUHA 4GB5A 2W56B 2Z7AA 1E97A 4RNZA 1IV7A 2HMOB 1SIHA 4U13A 4HZBB 1AR0A 1G96A 1LVNA 3FZWA 1VQL3 2GBXB 3NQYA 4WWUC 1QJGA 4BTXA 4HZ9B 5EEOA 1RRLA 2FXTA 1HKXA 2CWUA 1W6CA 1T5YA 2OQEC 4N6MA 3CCL3 1GS3A 1RRHA 3D9RA 3NV0A 2STDA 3LT8A 3UL5A 4CDLA 8CHOA 3DY5A 1VQN3 1IQYA 1N8R4 1UUWB 3GZRA 1EG9B 2W2CA 1ROVA 3NQZA 3CCQ3 2OTL3 1JB2A 1K28A 1JRQA 1KD14 1ROAA 3MKIA 4HM5B 1VQ53 3WMDA 1UI8A 3S67A 1OCVA 1YGEA 1SJWA 5CLKA 4EV2A 3PZWA 5A0OB 3H3HA 1K734 3EHCA 4HJLB 1GY6A 1JB5A 1O7NB 1O7WB 3CCJ3 1OH0A 1DVCA 2F99A 1F8NA 2CW9A 2MF7A 3EBYA 4XB5A 1IV9A 1UUVB 4Q53A 2IUJA 2Z77A 3PXMA 1O7GB 1YVBI 5IW9A 4BTWA 1Q40A 2CFWA 4N6OB 4RZMA 5LC6A 2Z76A 3S5CA 3KFQC 3F9SA 1W5ZA 2Y73A 1Q42A 3B8LA 3X3XA 3LYGA 4XDVA 4IPBA 1C7HA 3DGLA 2OOVA 3UL6A 4HM3B 3NBJA 3EX9A 1QVF2 3ECFA 3MYTA 2F86B 2CG0A 3LZAA 3WDGB 3I553 4N6LA 2O9UX 1FGQA 1GY5A 1OHOA 1YIJ3 3UNLA 2P0XA 3CPW2 1VZZA 3IMAB 2C10A 1KWIA 2K0MA 2HMMB 5AIFA 3G6E3 3OV4A 1Z1SA 4N6TA 3S29A 3B4PA 4XBYA 2XR8B 1TFOA 4R1KA 2INXA 2Q07A 4N6UA 5IG4A 1QAKA 3DUKA 2ML6A 4XDWA 3F40A 5AI1A 3RGRA 1QAFA 3CCR3 3OW22 4FCMA 3EN8A 4WP5A 5ELUA 1M904 3FF0A 3HK4A 3CC43 2WOFA 2R4IA 3JVCA 2WOHA 3X3YA 1TU5A 1JKGB 3SXXA 3FG3A 4MJDA 5CF2A 3CCE3 2E2TA 3PGBA 4L8PA 1R4CA 7STDA 2BHMA 5IERA 3LTBA 1CYVA 5LC7A 2SBLA 1WNHA 3MG1A 3DGNA 5D82A 3ROBA 3Q90A 5IG3A 3RDEA 4LZIA 2HMKB 2RFRA 2KXGA 1L5GB 1NB3I 4N3VA 3MG3A 4HM1B 4N6NB 1KSIA 4O02B 3A76A 1S5AA 3N8BA 3OWYA 1IVXA 1EA2A 1N9EA 3J7Yd 1U5OA 4O2HA 3X3ZA 1QVG2 1JN5B 1U8CB 1RJOA 3CNMA 1O7MB 2PZVA 3KN4A 2KRTA 3IJEB 4LGQA 1ZX2A 4G1MB 1V74A 4HM7B 2E2VA 3EB8A 3JUQA 1FGOA 1E3VA 1YJN3 2HMJB 3NBRA 3F14A 3GZXB 2LQVA 1VQM3 1GD3A 1WMPA 3EC9A 3G16A 1IVWA 5JPUA 1W00A 3B4OA 3KKGA 3DMCA 3EBTA 1KQS2 2XEPA 2UX0A 1D6YA 5HGRA 1FUWA 1TP6A 1D6UA 1YI23 3UJMA 2JDIH 3JUPA 3AMOB 4NREA 3U97A 1W6YA 1E3RA 3CC73 3EJVA 2KCDA 1WMNA 1VQ43 1O7HB 2ZDJA 2GU3A 5EVHA 4EC6A 3WA2X 1NJI4 2W56A 3G0KA 2CFLA 4FMAA 5AYRB 3S28A 4H61A 1MNLA 4FCJA 2BT3A 3GRDA 1YJW3 3HI7A 1VQO3 4XBTA 1M9GA 3CCM3 5BXQA 1UI7A 3KSPA 3LTDA 3SEDA 2XH9A 3HX8A 5IF6A 4EYCA 1OF5A 3BNDA 3NM7A 1CEWI 4KVHA 1STDA 2QIYA 1PFPA 3N9HA 2XGNA 2CHCA 4HKVB 4EBGA 1EQKA 2YX9A 3I0YA 3STDA 1IVVA 1A2KA 1DMQA 1GD4A 1OHPA 2BMOB 3NHXA 3VSYA 4FMBA 5IEOA 3FLJA 4OVMA 3FSDA 4MMYB 3VF1A 1M1K4 1DYUA 4OUQA 2QEX3 5ELJA 1YIT3 3OX9A 2MC8A 2GBWB 2P0MA 3BNBA 5G2GA 1ISKA 1VQ83 1IT8A 3NXJA 3GAXA 4IT7A 4TX4A 1MOLA 2CWVA 3ER7A 4ZM8A 2BMQB 1YJ93 3G713 1N5HA 2XFTA 1CYUA 1IU7A 3FG4A 1TIJA 3LTAA 3N54B 4WYKB 1K41A 5TGNA 5I97A 1HU9A 4O8SA 5IG5A 2IMJA 2W04A 3LOYA 4JF8A 3NUVA 1S723 5KP4A 2OOVC 5JBSA 3VGNA 4WFOA 1OHSA 2P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMM A;  2YFI B;  4R9K A;  3CU3 A;  5AEW B;  5AIH A;  4HM2 B;  5FW5 A;  1NU3 A;  3EQQ B;  4HM4 B;  4HVN A;  1GY7 A;  3EN1 B;  3IPT A;  3BLZ A;  1OGZ A;  5JPP A;  1WQL B;  1JB4 A;  1W01 A;  1NWW A;  3BB9 A;  2YFL B;  1NDO B;  3CNX A;  3F8H A;  4J8T A;  3EF8 A;  2HML B;  3F8X A;  5IEN A;  1JKG A;  2XSH B;  3DXO A;  2YFJ B;  1O7P B;  1ULI B;  3T8N A;  5AIG A;  2XSO B;  5AEU B;  2A15 A;  3F7S A;  1QMA A;  5STD A;  1GYB A;  3NV0 B;  5D83 A;  3MSO A;  4PEJ A;  3MG2 A;  5CK6 A;  1IDP A;  3H51 A;  1ASK A;  2CKF B;  4H3U A;  6STD A;  3JUM A;  3K0Z A;  3JUN A;  1OF5 B;  2K54 A;  3FH1 A;  4LMI A;  1OUN A;  1OPY A;  3GZB A;  3DZL A;  1Q40 B;  4X2H A;  4XBX A;  4IIA A;  3E99 A;  3KZT A;  5IEP A;  5D81 A;  3JUO A;  3T8U A;  2GXF A;  2BMR B;  4K1V A;  2XRX B;  3SOA A;  3CPO A;  2RGQ A;  2GEY A;  1ULJ B;  1DMN A;  4I4K A;  3GWR A;  4L8O A;  3NM2 A;  4J9A A;  2JQ5 A;  4HM6 B;  4R9L A;  3SOY A;  4K1U A;  5KP1 A;  2RCD A;  3MHE A;  1ZO2 A;  4X2O A;  5CF1 A;  5BVB A;  3F7X A;  4HM0 B;  5CXO A;  3KE7 A;  2B24 B;  3FF2 A;  2OWP A;  5DRV A;  2GEX A;  4XM4 A;  1CQS A;  4WYK A;  2I9W A;  2F98 A;  4L7K A;  5DRE A;  2QGU A;  3G8Z A;  3RGA A;  3OXA A;  2HMN B;  3GZY B;  3FKA A;  1W02 A;  5AII A;  3DM8 A;  3FGY A;  4HM8 B;  3K7C A;  4LEH A;  2BNG A;  1OGX A;  4STD A;  3M8C A;  4ORL A;  3OWS A;  1BUQ A;  3B7C A;  3OWU A;  5IG0 A;  3HZP A;  2B1X B;  5KP3 A;  1JN5 A;  1TUH A;  4GB5 A;  2Z7A A;  1E97 A;  2HMO B;  4U13 A;  4HZB B;  1AR0 A;  3FZW A;  2GBX B;  4WWU C;  1QJG A;  4HZ9 B;  1HKX A;  1GS3 A;  3D9R A;  3NV0 A;  4CDL A;  2STD A;  8CHO A;  1OHS A;  1UUW B;  3GZR A;  1EG9 B;  2W2C A;  1JB2 A;  3MKI A;  4HM5 B;  3WMD A;  1OCV A;  1SJW A;  5CLK A;  3H3H A;  3EHC A;  4HJL B;  1GY6 A;  1JB5 A;  1O7N B;  1O7W B;  1OH0 A;  2F99 A;  3EBY A;  4XB5 A;  1UUV B;  4Q53 A;  2Z77 A;  1O7G B;  1Q40 A;  4RZM A;  2Z76 A;  3S5C A;  3F9S A;  1Q42 A;  3B8L A;  3LYG A;  4XDV A;  1C7H A;  4HM3 B;  3EX9 A;  3ECF A;  3MYT A;  2F86 B;  3LZA A;  1GY5 A;  1OHO A;  3UNL A;  1VZZ A;  2HMM B;  5AIF A;  3OV4 A;  1Z1S A;  3B4P A;  4XBY A;  2XR8 B;  4R1K A;  2INX A;  5IG4 A;  3DUK A;  4XDW A;  3F40 A;  5AI1 A;  3RGR A;  4FCM A;  4WP5 A;  3FF0 A;  3HK4 A;  2R4I A;  1JKG B;  4MJD A;  5CF2 A;  4L8P A;  7STD A;  5IER A;  3MG1 A;  5D82 A;  3ROB A;  3Q90 A;  5IG3 A;  2HMK B;  2RFR A;  4N3V A;  3MG3 A;  4HM1 B;  3A76 A;  1S5A A;  3OWY A;  1EA2 A;  1U5O A;  1JN5 B;  3CNM A;  1O7M B;  2PZV A;  4LGQ A;  1ZX2 A;  4HM7 B;  3JUQ A;  1E3V A;  2HMJ B;  3NBR A;  3F14 A;  3GZX B;  3EC9 A;  3G16 A;  5JPU A;  1W00 A;  3B4O A;  3KKG A;  3DMC A;  3EBT A;  2UX0 A;  5HGR A;  1TP6 A;  3UJM A;  3JUP A;  1W6Y A;  1E3R A;  3EJV A;  1O7H B;  5EVH A;  3G0K A;  4FCJ A;  3GRD A;  4XBT A;  5BXQ A;  3KSP A;  3SED A;  3HX8 A;  5IF6 A;  1OF5 A;  4KVH A;  1STD A;  2QIY A;  2CHC A;  4HKV B;  3I0Y A;  3STD A;  1A2K A;  1DMQ A;  1OHP A;  2BMO B;  3NHX A;  3VSY A;  5IEO A;  4OVM A;  3FSD A;  4OUQ A;  3OX9 A;  2GBW B;  1ISK A;  5G2G A;  3NXJ A;  3ER7 A;  2BMQ B;  4WYK B;  1K41 A;  5TGN A;  5IG5 A;  2IMJ A;  3NUV A;  5KP4 A;  3EN8 A;  3VGN A;  3FLJ A; 
#chains in the Genus database with same CATH topology
 2CFK A;  4J5G A;  1DMM A;  1MWT A;  1WMO A;  2YFI B;  4R9K A;  1BNG A;  1UCI A;  4R4K A;  3CU3 A;  5AEW B;  2L1S A;  1LOY A;  5AIH A;  2OCT A;  2XFS A;  2CK3 H;  1RGC A;  4HM2 B;  2KF5 A;  2W9P A;  5FW5 A;  2XF3 A;  1NU3 A;  3EQQ B;  4HM4 B;  4HVN A;  1GY7 A;  3EN1 B;  1STF I;  3IPT A;  1B2S A;  2W03 A;  1IYY A;  4GL6 A;  2CC3 A;  3BLZ A;  1MWS A;  1OGZ A;  4KZ1 A;  3UB1 A;  5G1K A;  5JPP A;  1JZD A;  1WQL B;  1A67 A;  1JB4 A;  3FCS B;  1CH0 A;  2ML5 A;  1W01 A;  1NWW A;  1D6Z A;  2BIR A;  3DGM A;  2WGO A;  2Z6B A;  5GSP A;  3BB9 A;  3T0U A;  3DGY A;  4K90 B;  4LYL B;  1Q81 4;  2YFL B;  3WR2 A;  1NDO B;  1W2Z A;  3CNX A;  4RNY A;  3F8H A;  2CX1 A;  2FNQ A;  2D1W A;  4J8T A;  1B27 A;  1K9M 4;  3BNE A;  3EF8 A;  1RGG A;  2HML B;  3BNC A;  2Y74 A;  5RNT A;  3F8X A;  1BAO A;  3CCS 3;  3LT9 A;  5IEN A;  1JKG A;  2LYX A;  2XSH B;  3DXO A;  1K8A 4;  3K5T A;  3SX1 A;  3CME 3;  1LQG C;  1EKM A;  3MWZ A;  2YFJ B;  1O7P B;  1RKY A;  2CWT A;  3WOF B;  1ULI B;  3WOD G;  3MPH A;  3T8N A;  4BTY A;  5AIG A;  5M19 A;  1RN1 A;  2XSO B;  1OAC A;  5AEU B;  1BU4 A;  2A15 A;  1QMA A;  3F7S A;  5STD A;  9RNT A;  4R80 A;  1GYB A;  3CCU 3;  1W7C A;  3DH2 A;  1PU4 A;  1JNQ A;  1UUG B;  3NV0 B;  5D83 A;  1Q82 4;  7GSP A;  1YHQ 3;  4O3V A;  2OQE A;  4MMX B;  3MSO A;  4PEJ A;  3MG2 A;  3X40 A;  1W2B 2;  1AVK A;  5CK6 A;  1IDP A;  1QAL A;  1BSB A;  3URP A;  1PYL A;  3GSP A;  3H51 A;  1X1W A;  1RSN A;  2F5W A;  2ZL8 A;  1ASK A;  1BRG A;  2IA7 A;  3K9M C;  1TJD A;  2KF3 A;  5HOH A;  3CMA 3;  3L0R A;  2ZHX B;  4EXR A;  1RNT A;  2CKF B;  2C11 A;  4H3U A;  6STD A;  1IK3 A;  1A2V A;  2V1L A;  3JUM A;  3ALA A;  3K0Z A;  4HYZ A;  1DVD A;  3JUN A;  1FW7 A;  1OF5 B;  2C4B A;  2K54 A;  1SQW A;  1N8Q A;  4FCZ A;  3V92 A;  2QA4 3;  1X1U A;  2PNC A;  3FH1 A;  4LMI A;  4WFO A;  3SLU A;  3RNT A;  1NB5 I;  4HBR A;  1OUN A;  1AV4 A;  1OPY A;  5AYS C;  1I0V A;  3GZB A;  1RN7 A;  3QRD A;  3LH4 A;  3AMO A;  3DZL A;  1VQ7 3;  4BL2 A;  5EQL A;  1Q40 B;  1AQZ A;  2P38 A;  2UUG C;  2F5M A;  4X2H A;  1AY7 A;  2CFG A;  4J5K A;  3CXC 2;  1I2F A;  4XBX A;  3V99 A;  3CC2 3;  1N5P A;  4IIA A;  3E99 A;  4FR9 A;  3KZT A;  4AKZ A;  5IEP A;  4CCV A;  3D5G A;  3Q1C A;  5D81 A;  2P09 A;  4HAA A;  3JUO A;  3T8U A;  2GXF A;  2BMR B;  1FUT A;  1Q7H A;  1US1 A;  1DE3 A;  3O8Y A;  4K1V A;  4EV5 A;  4FMC A;  2XRX B;  1UCJ A;  1IQX A;  3BIR A;  1Q86 4;  1EEJ A;  3SOA A;  3CPO A;  2RGQ A;  1R4Y A;  4CJN A;  1BRK A;  3PYJ A;  2GEY A;  1ULJ B;  2FGT A;  1Y4K A;  1DMN A;  3D79 A;  4I4K A;  1UW1 A;  1BRJ A;  1SPU A;  3GWR A;  4L8O A;  1UCK A;  4NHF A;  1VQ6 3;  1IQ8 A;  3PCR A;  3NM2 A;  3AHS A;  4N6V 0;  3Q3F A;  2W9Q A;  3CCV 3;  4J9A A;  2JQ5 A;  4K61 A;  4HM6 B;  1BRS A;  2RSX A;  5G1L A;  4R9L A;  4AKY A;  3FG1 A;  4WHA A;  1FYS A;  3SOY A;  4EW5 A;  4K1U A;  3ZG0 A;  3A5E A;  2CIU A;  1UDI I;  1FGM A;  1BRN L;  2W6J H;  5FGO A;  5KP1 A;  2RCD A;  3MHE A;  4CPK A;  1ZO2 A;  1TFK A;  4MMZ B;  3LXU X;  1JBT A;  2M7O A;  4QWT A;  2AAE A;  3TDG A;  4X2O A;  2BU4 A;  3Q2P A;  1HZ1 A;  1W4N A;  2W0Q A;  5CF1 A;  1BSC A;  5BVB A;  3F7X A;  1M1X B;  3K63 A;  2RBI A;  4HM0 B;  1JJ2 2;  1IT7 A;  3KCH A;  1FZU A;  3KE7 A;  5CXO A;  2H0G A;  2CG1 A;  1BSA A;  3D3L A;  1VQ9 3;  1JV2 B;  2B24 B;  2UGI A;  2OWP A;  3FF2 A;  1BIR A;  2F4Y A;  5DRV A;  2GEX A;  1FGT A;  4XM4 A;  1BVI A;  1FA3 A;  4LSO A;  3EE1 A;  1B3S A;  1X1X A;  1CQS A;  4WYK A;  3PCS A;  4MEI A;  3DGO A;  1NO3 A;  2I9W A;  2BO9 B;  1UGI A;  2F98 A;  4RBN A;  1VQK 3;  1Q7Y 4;  1KC8 4;  1I2G A;  4L7K A;  3G4S 3;  5DRE A;  3QK9 A;  6GSP A;  2QGU A;  3WHO A;  3G8Z A;  3OXA A;  4JRF A;  3RGA A;  2HMN B;  3LML A;  3X41 A;  4I5Q A;  3GZY B;  3FKA A;  3NX0 A;  2ZA4 A;  2CFD A;  1ZS7 A;  2H0I A;  1RGA A;  1W02 A;  3WOE B;  1AVL A;  1SII A;  1FGR A;  2L4V A;  1LXE A;  5AII A;  1J2B A;  3NBB A;  1LOX A;  3LTC A;  3DM8 A;  3FGY A;  4OK0 A;  3WA3 A;  1RCK A;  2WGQ A;  4KFF A;  1VQP 3;  4HM8 B;  1A90 A;  3K7C A;  2KF6 A;  3S27 A;  1B2X A;  2IUK A;  3KSE D;  3SVA A;  1N9J A;  1W6G A;  1BSD A;  4LEH A;  1IVU A;  3X42 A;  2BNG A;  2GU1 A;  1OGX A;  3KII A;  4STD A;  2IY2 A;  7RNT A;  5IG5 A;  2O3O A;  3U1W A;  3M8C A;  1BAN A;  4ORL A;  3CD6 3;  3OWS A;  2XGL A;  4KFD A;  4AEQ A;  1BUQ A;  1I8V A;  3B7C A;  3I56 3;  3OWU A;  4FMD A;  3PS8 A;  1WTH A;  2E2U A;  5IG0 A;  3HIG A;  2OTJ 3;  2D42 A;  3HII A;  3HZP A;  2B1X B;  1GMP A;  2WO0 A;  1T2I A;  5KP3 A;  1LNH A;  2CH9 A;  3V98 A;  1JN5 A;  1BSE A;  4KFE A;  1TUH A;  1A2P A;  4GB5 A;  2W56 B;  2Z7A A;  1E97 A;  4RNZ A;  1IV7 A;  1DET A;  1SIH A;  2HMO B;  4U13 A;  4HZB B;  2HOH A;  1AR0 A;  1G96 A;  1LVN A;  3FZW A;  1VQL 3;  2GBX B;  1GOY A;  2RNT A;  3NQY A;  4WWU C;  1QJG A;  1NNV A;  1BNI A;  4BTX A;  1RGH A;  4HZ9 B;  5EEO A;  1RRL A;  2FXT A;  3ZG5 A;  1HKX A;  2CWU A;  1W6C A;  1T5Y A;  2OQE C;  3AGO A;  4N6M A;  5I97 A;  1GS3 A;  1RRH A;  3D9R A;  3NV0 A;  2STD A;  3LT8 A;  3UL5 A;  4CDL A;  8CHO A;  1RGF A;  3DY5 A;  1VQN 3;  1RGK A;  1IQY A;  3ZFZ A;  8RNT A;  1N8R 4;  1UUW B;  3GZR A;  1JBR A;  1EG9 B;  2W2C A;  1JZO A;  1ROV A;  3NQZ A;  5BIR A;  3CCQ 3;  2OTL 3;  1JB2 A;  1FUS A;  1K28 A;  1SAR A;  1JRQ A;  1KD1 4;  1ROA A;  3MKI A;  4HM5 B;  1VQ5 3;  3WMD A;  1UI8 A;  3S67 A;  1OCV A;  1YGE A;  1SJW A;  1I2E A;  5CLK A;  4EV2 A;  3PZW A;  5A0O B;  3H3H A;  1LQM B;  2J8X B;  1K73 4;  3EHC A;  4DKI A;  1JBS A;  1RGL A;  1ZGX A;  1GY6 A;  1JB5 A;  4HJL B;  1O7N B;  1O7W B;  3CCJ 3;  1RCL A;  1MWR A;  1OH0 A;  1DVC A;  1UGH I;  2F99 A;  1F8N A;  2CW9 A;  2MF7 A;  3EBY A;  4HOH A;  1IV9 A;  1UUV B;  4XB5 A;  4Q53 A;  1LOW A;  2IUJ A;  2Z77 A;  3PXM A;  1O7G B;  1YVB I;  5IW9 A;  4BTW A;  1Q40 A;  2CFW A;  2KAA A;  4N6O B;  4RZM A;  5LC6 A;  1G02 A;  2Z76 A;  3KFQ C;  3F9S A;  3S5C A;  2IYJ A;  1W5Z A;  2Y73 A;  1Q42 A;  3B8L A;  3X3X A;  3LYG A;  4XDV A;  1G0T A;  4IPB A;  1C7H A;  3DGL A;  2OOV A;  3UL6 A;  4HM3 B;  3NBJ A;  1T3B A;  1RLS A;  3EX9 A;  1QVF 2;  1MGR A;  3ECF A;  3MYT A;  2F86 B;  2CG0 A;  3LZA A;  1X1Y A;  3WDG B;  3I55 3;  4N6L A;  1BRI A;  2O9U X;  1FGQ A;  1GY5 A;  1OHO A;  2F56 A;  1YIJ 3;  3UNL A;  2P0X A;  3CPW 2;  1VZZ A;  3IMA B;  2C10 A;  1KWI A;  1RGE A;  2HMM B;  2K0M A;  5AIF A;  3G6E 3;  3OV4 A;  1Z1S A;  4N6T A;  3S29 A;  3B4P A;  4XBY A;  3D5I A;  2XR8 B;  1TFO A;  4R1K A;  1GSP A;  2INX A;  2Q07 A;  4N6U A;  5IG4 A;  1QAK A;  3DUK A;  3CCL 3;  2ML6 A;  1Q9E A;  4XDW A;  2R41 A;  3F40 A;  5AI1 A;  3RGR A;  1QAF A;  1V57 A;  3CCR 3;  3OW2 2;  4FCM A;  3EN8 A;  4WP5 A;  5ELU A;  1M90 4;  3FF0 A;  3HK4 A;  3CC4 3;  2WOF A;  2R4I A;  3JVC A;  4BL3 A;  2WOH A;  3X3Y A;  1TU5 A;  1JKG B;  3SXX A;  3FG3 A;  4MJD A;  5CF2 A;  3CCE 3;  2E2T A;  1BNF A;  1B20 A;  1R4C A;  3PGB A;  4L8P A;  7STD A;  1BOX A;  2BHM A;  5IER A;  1I3F A;  3LTB A;  1T2H A;  1CYV A;  1VQQ A;  5LC7 A;  2SBL A;  1MWU A;  3BU4 A;  1WNH A;  1RN4 A;  3DGN A;  3MG1 A;  5D82 A;  3ROB A;  3Q90 A;  5IG3 A;  1GMQ A;  3RDE A;  1GOU A;  4LZI A;  2HMK B;  2KXG A;  2RFR A;  1L5G B;  1NB3 I;  4N3V A;  1PY3 A;  3AHW A;  3MG3 A;  4HM1 B;  4N6N B;  2AAD A;  6RNT A;  1KSI A;  4O02 B;  3A76 A;  4GSP A;  1S5A A;  3N8B A;  3OWY A;  1IVX A;  1EA2 A;  1N9E A;  3J7Y d;  1U5O A;  4O2H A;  3X3Z A;  1QVG 2;  1JN5 B;  5BU4 A;  1U8C B;  1RJO A;  3CNM A;  1O7M B;  2PZV A;  3KN4 A;  2KRT A;  4KT3 B;  3IJE B;  1BNE A;  4LGQ A;  1ZX2 A;  4G1M B;  1V74 A;  4HM7 B;  2E2V A;  3EB8 A;  3JUQ A;  1FGO A;  1E3V A;  4GHO A;  1YJN 3;  1BUJ A;  2HMJ B;  3NBR A;  3F14 A;  3GZX B;  2LQV A;  1VQM 3;  1GD3 A;  1WMP A;  2H0H A;  3EC9 A;  3G16 A;  1IVW A;  5JPU A;  1W00 A;  3B4O A;  3KKG A;  1C54 A;  1TTO A;  3DMC A;  3EBT A;  1KQS 2;  2XEP A;  1LRA A;  2UX0 A;  1MGW A;  1D6Y A;  1BNS A;  1B2U A;  1BRH A;  5HGR A;  1TP6 A;  1FUW A;  1D6U A;  1YI2 3;  3UJM A;  2JDI H;  3JUP A;  3AMO B;  3HOH A;  4NRE A;  3U97 A;  1W6Y A;  4NPB A;  1E3R A;  3CC7 3;  3EJV A;  2KCD A;  1WMN A;  1I70 A;  1VQ4 3;  1O7H B;  1RDS A;  2ZDJ A;  2GU3 A;  5EVH A;  2CX0 A;  4EC6 A;  3WA2 X;  1NJI 4;  2W56 A;  3G0K A;  2CFL A;  4FMA A;  5AYR B;  3S28 A;  4H61 A;  1MNL A;  4FCJ A;  1BNJ A;  2BT3 A;  1GOV A;  3GRD A;  1YJW 3;  3HI7 A;  1VQO 3;  4XBT A;  1M9G A;  3CCM 3;  5BXQ A;  1I3I A;  1UI7 A;  3KSP A;  3LTD A;  3SED A;  2XH9 A;  3HX8 A;  5IF6 A;  4EYC A;  1OF5 A;  1B2M A;  1RNB A;  3BND A;  3NM7 A;  1CEW I;  4KVH A;  1STD A;  2QIY A;  1PFP A;  3N9H A;  2XGN A;  2CHC A;  2K3D A;  4HKV B;  4BIR A;  4EBG A;  1EQK A;  2YX9 A;  4ILF A;  3I0Y A;  3STD A;  1IVV A;  1A2K A;  1DMQ A;  1GD4 A;  1LOV A;  1OHP A;  4BU4 A;  1YGW A;  2BMO B;  1B21 A;  1I0X A;  3NHX A;  4FMB A;  1LNI A;  5IEO A;  3FLJ A;  4OVM A;  3VSY A;  3FSD A;  4MMY B;  3VF1 A;  1M1K 4;  1DYU A;  4OUQ A;  2QEX 3;  3SYU A;  2SAR A;  5ELJ A;  1YIT 3;  3OX9 A;  2MC8 A;  1BNR A;  2GBW B;  2P0M A;  3BNB A;  5G2G A;  1ISK A;  1VQ8 3;  1TRP A;  1IT8 A;  3NXJ A;  3GAX A;  4IT7 A;  5M1A A;  1B2Z A;  4TX4 A;  1RMS A;  1MOL A;  3AGN A;  2CWV A;  5M18 A;  3ER7 A;  4ZM8 A;  2BMQ B;  1UCL A;  1YJ9 3;  1YNV X;  3G71 3;  1N5H A;  1EUI C;  2XFT A;  1IU7 A;  1CYU A;  3FG4 A;  1YVS A;  1GMR A;  1TIJ A;  3D4A A;  2GSP A;  3LTA A;  3N54 B;  1TRQ A;  1K41 A;  4WYK B;  2KF4 A;  1HU9 A;  1V58 A;  4O8S A;  5TGN A;  2IMJ A;  2W04 A;  1HYF A;  3LOY A;  4JF8 A;  1BGS A;  1RTU A;  3NUV A;  4RNT A;  1S72 3;  5KP4 A;  2OOV C;  5JBS A;  3VGN A;  1RHL A;  1OHS A;  2P05 A; 
#chains in the Genus database with same CATH homology
 2CFK A;  1DMM A;  1WMO A;  2YFI B;  4R9K A;  4R4K A;  3CU3 A;  5AEW B;  5AIH A;  2OCT A;  2XFS A;  2CK3 H;  4HM2 B;  2W9P A;  5FW5 A;  2XF3 A;  1NU3 A;  3EQQ B;  4HM4 B;  4HVN A;  1GY7 A;  3EN1 B;  1STF I;  3IPT A;  2W03 A;  4GL6 A;  2CC3 A;  3BLZ A;  1OGZ A;  4KZ1 A;  3UB1 A;  5JPP A;  1WQL B;  1A67 A;  1JB4 A;  3FCS B;  2ML5 A;  1W01 A;  1NWW A;  1D6Z A;  3DGM A;  2WGO A;  2Z6B A;  3BB9 A;  3T0U A;  4K90 B;  1Q81 4;  2YFL B;  1NDO B;  1W2Z A;  3CNX A;  4RNY A;  3F8H A;  2FNQ A;  2D1W A;  4J8T A;  1K9M 4;  3BNE A;  3EF8 A;  2HML B;  3BNC A;  2Y74 A;  3CCS 3;  3F8X A;  3LT9 A;  5IEN A;  1JKG A;  2LYX A;  2XSH B;  3DXO A;  1K8A 4;  3K5T A;  3SX1 A;  3CME 3;  1EKM A;  3MWZ A;  2YFJ B;  1O7P B;  1RKY A;  2CWT A;  3WOF B;  1ULI B;  3WOD G;  3MPH A;  3T8N A;  4BTY A;  5AIG A;  2XSO B;  1OAC A;  5AEU B;  2A15 A;  3F7S A;  1QMA A;  5STD A;  4R80 A;  1GYB A;  3CCU 3;  1W7C A;  1PU4 A;  1JNQ A;  3NV0 B;  1Q82 4;  5D83 A;  1YHQ 3;  4O3V A;  2OQE A;  4MMX B;  3MSO A;  4PEJ A;  3MG2 A;  3X40 A;  1W2B 2;  1AVK A;  5CK6 A;  1IDP A;  1QAL A;  3H51 A;  2ZL8 A;  1ASK A;  3K9M C;  2IA7 A;  3CMA 3;  3L0R A;  4EXR A;  2CKF B;  2C11 A;  4H3U A;  6STD A;  1IK3 A;  1A2V A;  2V1L A;  3JUM A;  3ALA A;  3K0Z A;  4HYZ A;  1DVD A;  3JUN A;  1OF5 B;  2K54 A;  1SQW A;  1N8Q A;  4FCZ A;  3V92 A;  2QA4 3;  2PNC A;  3FH1 A;  4LMI A;  3SLU A;  1NB5 I;  4HBR A;  1OUN A;  1AV4 A;  1OPY A;  5AYS C;  3GZB A;  1RN7 A;  3QRD A;  3LH4 A;  3AMO A;  3DZL A;  1VQ7 3;  5EQL A;  1Q40 B;  2P38 A;  4X2H A;  2CFG A;  3CXC 2;  3V99 A;  4XBX A;  3CC2 3;  1N5P A;  4IIA A;  3E99 A;  4FR9 A;  3KZT A;  4AKZ A;  5IEP A;  4CCV A;  3Q1C A;  5D81 A;  2P09 A;  3JUO A;  3T8U A;  2GXF A;  2BMR B;  1US1 A;  3O8Y A;  4K1V A;  4EV5 A;  4FMC A;  2XRX B;  1IQX A;  1Q86 4;  3SOA A;  3CPO A;  2RGQ A;  3PYJ A;  2GEY A;  1ULJ B;  2FGT A;  1Y4K A;  1DMN A;  4I4K A;  1UW1 A;  1SPU A;  4NHF A;  3GWR A;  4L8O A;  1VQ6 3;  1IQ8 A;  3PCR A;  3NM2 A;  4N6V 0;  2W9Q A;  3CCV 3;  4J9A A;  2JQ5 A;  4K61 A;  4HM6 B;  4AKY A;  2RSX A;  4R9L A;  3FG1 A;  4WHA A;  3SOY A;  4K1U A;  2CIU A;  1FGM A;  2W6J H;  5FGO A;  5KP1 A;  2RCD A;  3MHE A;  1ZO2 A;  1TFK A;  4MMZ B;  3LXU X;  2M7O A;  4QWT A;  3TDG A;  4X2O A;  3Q2P A;  1W4N A;  2W0Q A;  5CF1 A;  5BVB A;  3F7X A;  1M1X B;  3K63 A;  4HM0 B;  1JJ2 2;  1IT7 A;  5CXO A;  2CG1 A;  3KE7 A;  3D3L A;  1VQ9 3;  1JV2 B;  2B24 B;  3FF2 A;  2OWP A;  5DRV A;  2GEX A;  1FGT A;  4XM4 A;  1FA3 A;  4LSO A;  3EE1 A;  1CQS A;  4WYK A;  3PCS A;  4MEI A;  3DGO A;  1NO3 A;  2I9W A;  2BO9 B;  2F98 A;  4RBN A;  1VQK 3;  1Q7Y 4;  1KC8 4;  4L7K A;  3G4S 3;  5DRE A;  3QK9 A;  2QGU A;  3G8Z A;  3OXA A;  4JRF A;  3RGA A;  2HMN B;  3LML A;  3X41 A;  3GZY B;  3FKA A;  3NX0 A;  2CFD A;  3WOE B;  1W02 A;  1AVL A;  1SII A;  1FGR A;  2L4V A;  1LXE A;  5AII A;  1J2B A;  3NBB A;  1LOX A;  3LTC A;  3DM8 A;  3FGY A;  4OK0 A;  3WA3 A;  2WGQ A;  1VQP 3;  4KFF A;  1A90 A;  4HM8 B;  3K7C A;  3S27 A;  2IUK A;  3KSE D;  3SVA A;  1N9J A;  1W6G A;  4LEH A;  1IVU A;  3X42 A;  2BNG A;  2GU1 A;  1OGX A;  3KII A;  4STD A;  2O3O A;  3U1W A;  3M8C A;  4ORL A;  3CD6 3;  3OWS A;  2XGL A;  4KFD A;  4AEQ A;  1BUQ A;  3B7C A;  3I56 3;  3OWU A;  4FMD A;  3PS8 A;  1WTH A;  2E2U A;  5IG0 A;  3HIG A;  2OTJ 3;  2D42 A;  3HII A;  3HZP A;  2B1X B;  2WO0 A;  5KP3 A;  1LNH A;  2CH9 A;  3V98 A;  1JN5 A;  4KFE A;  1TUH A;  4GB5 A;  2W56 B;  2Z7A A;  1E97 A;  4RNZ A;  1IV7 A;  2HMO B;  1SIH A;  4U13 A;  4HZB B;  1AR0 A;  1G96 A;  1LVN A;  3FZW A;  1VQL 3;  2GBX B;  3NQY A;  4WWU C;  1QJG A;  4BTX A;  4HZ9 B;  5EEO A;  1RRL A;  2FXT A;  1HKX A;  2CWU A;  1W6C A;  1T5Y A;  2OQE C;  4N6M A;  3CCL 3;  1GS3 A;  1RRH A;  3D9R A;  3NV0 A;  2STD A;  3LT8 A;  3UL5 A;  4CDL A;  8CHO A;  3DY5 A;  1VQN 3;  1IQY A;  1N8R 4;  1UUW B;  3GZR A;  1EG9 B;  2W2C A;  1ROV A;  3NQZ A;  3CCQ 3;  2OTL 3;  1JB2 A;  1K28 A;  1JRQ A;  1KD1 4;  1ROA A;  3MKI A;  4HM5 B;  1VQ5 3;  3WMD A;  1UI8 A;  3S67 A;  1OCV A;  1YGE A;  1SJW A;  5CLK A;  4EV2 A;  3PZW A;  5A0O B;  3H3H A;  1K73 4;  3EHC A;  4HJL B;  1GY6 A;  1JB5 A;  1O7N B;  1O7W B;  3CCJ 3;  1OH0 A;  1DVC A;  2F99 A;  1F8N A;  2CW9 A;  2MF7 A;  3EBY A;  4XB5 A;  1IV9 A;  1UUV B;  4Q53 A;  2IUJ A;  2Z77 A;  3PXM A;  1O7G B;  1YVB I;  5IW9 A;  4BTW A;  1Q40 A;  2CFW A;  4N6O B;  4RZM A;  5LC6 A;  2Z76 A;  3S5C A;  3KFQ C;  3F9S A;  1W5Z A;  2Y73 A;  1Q42 A;  3B8L A;  3X3X A;  3LYG A;  4XDV A;  4IPB A;  1C7H A;  3DGL A;  2OOV A;  3UL6 A;  4HM3 B;  3NBJ A;  3EX9 A;  1QVF 2;  3ECF A;  3MYT A;  2F86 B;  2CG0 A;  3LZA A;  3WDG B;  3I55 3;  4N6L A;  2O9U X;  1FGQ A;  1GY5 A;  1OHO A;  1YIJ 3;  3UNL A;  2P0X A;  3CPW 2;  1VZZ A;  3IMA B;  2C10 A;  1KWI A;  2K0M A;  2HMM B;  5AIF A;  3G6E 3;  3OV4 A;  1Z1S A;  4N6T A;  3S29 A;  3B4P A;  4XBY A;  2XR8 B;  1TFO A;  4R1K A;  2INX A;  2Q07 A;  4N6U A;  5IG4 A;  1QAK A;  3DUK A;  2ML6 A;  4XDW A;  3F40 A;  5AI1 A;  3RGR A;  1QAF A;  3CCR 3;  3OW2 2;  4FCM A;  3EN8 A;  4WP5 A;  5ELU A;  1M90 4;  3FF0 A;  3HK4 A;  3CC4 3;  2WOF A;  2R4I A;  3JVC A;  2WOH A;  3X3Y A;  1TU5 A;  1JKG B;  3SXX A;  3FG3 A;  4MJD A;  5CF2 A;  3CCE 3;  2E2T A;  3PGB A;  4L8P A;  1R4C A;  7STD A;  2BHM A;  5IER A;  3LTB A;  1CYV A;  5LC7 A;  2SBL A;  1WNH A;  3MG1 A;  3DGN A;  5D82 A;  3ROB A;  3Q90 A;  5IG3 A;  3RDE A;  4LZI A;  2HMK B;  2RFR A;  2KXG A;  1L5G B;  1NB3 I;  4N3V A;  3MG3 A;  4HM1 B;  4N6N B;  1KSI A;  4O02 B;  3A76 A;  1S5A A;  3N8B A;  3OWY A;  1IVX A;  1EA2 A;  1N9E A;  3J7Y d;  1U5O A;  4O2H A;  3X3Z A;  1QVG 2;  1JN5 B;  1U8C B;  1RJO A;  3CNM A;  1O7M B;  2PZV A;  3KN4 A;  2KRT A;  3IJE B;  4LGQ A;  1ZX2 A;  4G1M B;  1V74 A;  4HM7 B;  2E2V A;  3EB8 A;  3JUQ A;  1FGO A;  1E3V A;  1YJN 3;  2HMJ B;  3NBR A;  3F14 A;  3GZX B;  2LQV A;  1VQM 3;  1GD3 A;  1WMP A;  3EC9 A;  3G16 A;  1IVW A;  5JPU A;  1W00 A;  3B4O A;  3KKG A;  3DMC A;  3EBT A;  1KQS 2;  2XEP A;  2UX0 A;  1D6Y A;  5HGR A;  1FUW A;  1TP6 A;  1D6U A;  1YI2 3;  3UJM A;  2JDI H;  3JUP A;  3AMO B;  4NRE A;  3U97 A;  1W6Y A;  1E3R A;  3CC7 3;  3EJV A;  2KCD A;  1WMN A;  1VQ4 3;  1O7H B;  2ZDJ A;  2GU3 A;  5EVH A;  4EC6 A;  3WA2 X;  1NJI 4;  2W56 A;  3G0K A;  2CFL A;  4FMA A;  5AYR B;  3S28 A;  4H61 A;  1MNL A;  4FCJ A;  2BT3 A;  3GRD A;  1YJW 3;  3HI7 A;  1VQO 3;  4XBT A;  1M9G A;  3CCM 3;  5BXQ A;  1UI7 A;  3KSP A;  3LTD A;  3SED A;  2XH9 A;  3HX8 A;  5IF6 A;  4EYC A;  1OF5 A;  3BND A;  3NM7 A;  1CEW I;  4KVH A;  1STD A;  2QIY A;  1PFP A;  3N9H A;  2XGN A;  2CHC A;  4HKV B;  4EBG A;  1EQK A;  2YX9 A;  3I0Y A;  3STD A;  1IVV A;  1A2K A;  1DMQ A;  1GD4 A;  1OHP A;  2BMO B;  3NHX A;  3VSY A;  4FMB A;  5IEO A;  3FLJ A;  4OVM A;  3FSD A;  4MMY B;  3VF1 A;  1M1K 4;  1DYU A;  4OUQ A;  2QEX 3;  5ELJ A;  1YIT 3;  3OX9 A;  2MC8 A;  2GBW B;  2P0M A;  3BNB A;  5G2G A;  1ISK A;  1VQ8 3;  1IT8 A;  3NXJ A;  3GAX A;  4IT7 A;  4TX4 A;  1MOL A;  2CWV A;  3ER7 A;  4ZM8 A;  2BMQ B;  1YJ9 3;  3G71 3;  1N5H A;  2XFT A;  1CYU A;  1IU7 A;  3FG4 A;  1TIJ A;  3LTA A;  3N54 B;  4WYK B;  1K41 A;  5TGN A;  5I97 A;  1HU9 A;  4O8S A;  5IG5 A;  2IMJ A;  2W04 A;  3LOY A;  4JF8 A;  3NUV A;  1S72 3;  5KP4 A;  2OOV C;  5JBS A;  3VGN A;  4WFO A;  1OHS A;  2P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...