1DMNA

Crystal structure of mutant enzyme y32f/y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 29
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmnA00
4HM3B 4HZBB 3NV0A 3F14A 1DMMA 1QMAA 3MYTA 1O7HB 3FKAA 4XDVA 3F9SA 3FH1A 1GY6A 5CF2A 2STDA 1Q40A 2HMNB 4HKVB 4LGQA 4XBYA 1SJWA 3JUOA 2OWPA 1EA2A 3HK4A 4HM5B 2YFIB 3DXOA 1STDA 2GEYA 3OV4A 3HX8A 4HZ9B 3EN8A 5D82A 2PZVA 5EVHA 3EBYA 1JB2A 5JPUA 1Q42A 2HMOB 4HM4B 4LMIA 3OXAA 3K7CA 2GBXB 1DMNA 1OHPA 3EHCA 5AIFA 1O7NB 3F8XA 4K1UA 2I9WA 3F40A 3F8HA 1UUVB 1OF5B 1C7HA 1ASKA 2HMJB 5AIGA 2BNGA 3FF2A 3G16A 5FW5A 1NU3A 4J8TA 5JPPA 3ECFA 3OWUA 4KVHA 6STDA 4WYKA 2Z76A 2UX0A 3FSDA 1GY5A 3VGNA 2CHCA 1W02A 2RFRA 4OUQA 1ULIB 1UUWB 4ORLA 1QJGA 5AIIA 5IENA 3MSOA 2YFLB 4XB5A 3CNXA 3MG2A 3SOAA 3F7XA 2W2CA 3MHEA 3M8CA 1U5OA 1OGZA 2Z7AA 3EF8A 2JQ5A 3KKGA 3BLZA 3GWRA 4H3UA 2HMMB 4FCJA 4J9AA 5IG5A 1NWWA 3GZYB 5CLKA 1BUQA 3B7CA 1JN5B 3MG3A 4N3VA 2BMQB 4HM0B 3DMCA 4R9KA 3Q90A 4L7KA 1O7GB 3UNLA 4Q53A 3GZRA 3EBTA 1OUNA 3BB9A 4HM8B 3ER7A 1E3VA 3HZPA 5DRVA 4XDWA 2GXFA 3KZTA 4RZMA 3RGAA 3RGRA 3CPOA 2F86B 4GB5A 5BXQA 4X2OA 1AR0A 1Z1SA 2GEXA 5IF6A 2R4IA 3OWSA 3IPTA 4LEHA 1OHSA 3NXJA 1HKXA 3JUQA 3EX9A 2XRXB 3GZXB 5D83A 5CXOA 5STDA 2BMRB 5IG4A 2INXA 3A76A 3G8ZA 1O7WB 5AEUB 1OF5A 3KE7A 3F7SA 8CHOA 2BMOB 5AIHA 1NDOB 2XSOB 2RCDA 2B24B 5D81A 3NUVA 3FZWA 3LYGA 3G0KA 3OX9A 3NM2A 2HMKB 3ROBA 3STDA 3H51A 1E3RA 5KP3A 5TGNA 3LZAA 3B4PA 1ZO2A 3MKIA 3DZLA 2QIYA 3WMDA 2B1XB 1JKGA 3EC9A 1OHOA 3JUMA 3JUPA 4I4KA 3B4OA 4HJLB 1TUHA 2CKFB 5CF1A 4WP5A 3NV0B 2YFJB 1ULJB 1JB4A 4X2HA 4R1KA 1OCVA 4OVMA 1A2KA 5KP1A 5IEOA 3T8UA 1Q40B 2K54A 3T8NA 2XSHB 1W01A 1K41A 1OGXA 5DREA 1S5AA 4HM2B 4FCMA 5IERA 1JN5A 2Z77A 1GS3A 4K1VA 5G2GA 1O7PB 3SEDA 2RGQA 3B8LA 1GY7A 3GRDA 5AEWB 5HGRA 3JUNA 5IEPA 4U13A 1GYBA 3SOYA 4XBTA 1ZX2A 4HM6B 1CQSA 3DUKA 3I0YA 5IG3A 3NBRA 3EJVA 4CDLA 4XM4A 5KP4A 7STDA 4HM7B 1W6YA 2GBWB 1WQLB 3EQQB 4WYKB 1VZZA 4IIAA 4XBXA 5IG0A 3GZBA 2QGUA 1DMQA 2F98A 3KSPA 4PEJA 3K0ZA 3FGYA 3D9RA 3EN1B 3OWYA 5AI1A 4L8PA 4HM1B 3E99A 3VSYA 4WWUC 2F99A 1OPYA 3FF0A 3NHXA 3FLJA 4HVNA 4STDA 3DM8A 4MJDA 5CK6A 2A15A 5BVBA 1IDPA 1JKGB 3S5CA 3H3HA 3MG1A 3UJMA 4L8OA 1ISKA 2HMLB 2IMJA 1O7MB 1W00A 1EG9B 1OH0A 3CU3A 1E97A 4R9LA 2XR8B 3CNMA 1TP6A 1JB5A
chains in the Genus database with same CATH superfamily
1HYFA 2KF3A 3CCJ3 1W5ZA 5RNTA 2XFTA 2CX0A 1T2HA 1B2SA 3AHSA 4HM3B 2WOFA 1W2B2 4O8SA 3N8BA 1BGSA 3BNCA 1QAKA 1M9GA 4N6NB 3GSPA 4HZBB 5LC7A 5M1AA 3NV0A 4R4KA 3F14A 2BIRA 3V92A 1YI23 1DMMA 1QMAA 1BOXA 4N6LA 3MYTA 1O7HB 3FKAA 4ILFA 3F9SA 3FH1A 4XDVA 6GSPA 1GY6A 4I5QA 1A2VA 1SIHA 5CF2A 1LQGC 2STDA 1Q40A 2IUJA 2CK3H 2HMNB 1IYYA 4HKVB 1I2EA 4EXRA 4LGQA 1I0XA 2Q07A 4XBYA 7GSPA 1BRJA 2K3DA 1GD3A 1SJWA 2RNTA 4K61A 4AKZA 3JUOA 1B20A 4BTXA 5ELJA 1BNFA 2OWPA 1PY3A 1EA2A 3HK4A 2C11A 3NQZA 2W9QA 4HM5B 2YFIB 3DXOA 7RNTA 1STDA 2GEYA 3OV4A 2LYXA 3LT9A 3HX8A 4HZ9B 3EN8A 1BSCA 1ROVA 1BNRA 1BIRA 1V58A 1AV4A 4KT3B 5D82A 2Z6BA 1BVIA 1TIJA 4JRFA 2PZVA 1WMOA 5EVHA 5A0OB 3LTCA 3HIGA 3NX0A 3EBYA 5AYSC 3T0UA 1KSIA 1MWSA 1JB2A 1W4NA 1EKMA 1EEJA 5JPUA 4TX4A 4DKIA 1Q42A 2HMOB 4HM4B 2P38A 3S67A 1PFPA 1YGWA 4LMIA 3OXAA 1VQ83 3K7CA 2GBXB 1UW1A 1JBTA 1DMNA 1RHLA 3K5TA 1UGHI 1KWIA 1OHPA 3EHCA 5AIFA 1N8R4 1O7NB 3HOHA 3IJEB 6RNTA 3F8XA 3PXMA 1SARA 2CWUA 1TTOA 1UUGB 2I9WA 4K1UA 3F40A 1LRAA 1N9EA 3F8HA 1RN1A 1UUVB 1OF5B 1C7HA 1ASKA 4G1MB 2HMJB 3X42A 2UGIA 5AIGA 2BNGA 2CFWA 3FF2A 1RCKA 4H61A 3G16A 4RNTA 1IT8A 1YVSA 4IPBA 5FW5A 1VQO3 1I3FA 1BSDA 1NU3A 1RGHA 3CCR3 4J8TA 3SXXA 2L1SA 4BIRA 2F56A 2H0HA 2CC3A 5JPPA 1M1XB 1PYLA 2M7OA 3DGLA 3ECFA 3OWUA 4K90B 2CG1A 1AQZA 4KVHA 1X1XA 3DGMA 4FMAA 1L5GB 6STDA 1CYVA 1IQYA 3CCV3 1A90A 4WYKA 1UCLA 4MMYB 3TDGA 2Z76A 1OACA 2UX0A 3UL5A 3FSDA 1GY5A 5I97A 3VGNA 1X1WA 2KF4A 4RNYA 4BU4A 1BUJA 2CHCA 1W02A 2RFRA 2XFSA 4AEQA 4OUQA 4HYZA 1K28A 2QA43 3EB8A 1ULIB 1UUWB 4ORLA 1B2XA 3CCS3 1QJGA 1A2PA 2O3OA 4O3VA 3AMOA 2GU3A 2IY2A 1RMSA 5AIIA 4NPBA 5IENA 3U1WA 3OW22 3MSOA 2YFLB 3DY5A 4XB5A 4BTYA 4HBRA 4IT7A 1DETA 1ZS7A 3LTBA 3S27A 3WA3A 3CNXA 3MG2A 3EE1A 1JBRA 1Q864 3SOAA 3F7XA 3RDEA 3CCQ3 3WOFB 2CFLA 5AYRB 1RCLA 2W2CA 3MHEA 3MPHA 3LTAA 1W6GA 1BNSA 1U5OA 1YGEA 2P09A 3M8CA 1IK3A 3S28A 1OGZA 1MWRA 2Z7AA 3EF8A 1WTHA 4HOHA 3DH2A 2CH9A 3V99A 2JQ5A 2W56A 3KKGA 4EV5A 3BLZA 3GWRA 1T3BA 3FG4A 4H3UA 2HMMB 3X3ZA 4FCJA 4J9AA 1BNIA 2CFDA 4O02B 1VQ63 5IG5A 1B2UA 1NWWA 2LQVA 3KN4A 3GZYB 1J2BA 3KCHA 3DGYA 1KD14 3WDGB 3D5IA 5CLKA 3I563 1YNVX 3QRDA 1BUQA 3B7CA 1JN5B 3MG3A 1M1K4 4N3VA 1W6CA 4N6UA 3D4AA 3G713 1TRQA 2WOHA 1Q814 3Q1CA 1T2IA 2BMQB 4HM0B 3DMCA 1C54A 4R9KA 1DVCA 3Q90A 4L7KA 1RGCA 1O7GB 2YX9A 3UNLA 2FNQA 4J5GA 1Q9EA 4Q53A 3GZRA 1VQL3 3CC73 1LNIA 3EBTA 1IV7A 2XH9A 1RGKA 1IQXA 1W2ZA 3Q3FA 1RGGA 4KFEA 1GSPA 2E2TA 1WMPA 1OUNA 1RLSA 1ZGXA 3BU4A 3BB9A 1BNGA 1R4CA 1CH0A 1G96A 2OCTA 1JV2B 4NHFA 4HM8B 1FGOA 1IV9A 1RJOA 2R41A 3ER7A 4LSOA 1E3VA 3HZPA 3ZFZA 5BIRA 1VQP3 3CXC2 1NB3I 1FYSA 5JBSA 1NO3A 1GD4A 3Q2PA 3AGOA 4XDWA 5DRVA 2GXFA 3I553 1D6UA 1UCIA 1IVVA 2IYJA 3KZTA 4RZMA 3CC23 3NQYA 4EC6A 3RGAA 3RGRA 2ML5A 3CPOA 3D5GA 1R4YA 3WA2X 1VQQA 2F86B 4GB5A 4FMCA 5BXQA 1B2ZA 4X2OA 1AR0A 1LQMB 1Z1SA 2GEXA 1LOVA 2BU4A 2W0QA 3DGOA 4N6MA 2UUGC 1RGLA 4KFFA 4HAAA 5IF6A 2R4IA 3CMA3 1BRHA 1BU4A 2O9UX 3OWSA 3SLUA 3IPTA 4LEHA 1FGRA 3DGNA 1VQ53 1OHSA 3FCSB 3ZG0A 3UB1A 3NXJA 1HKXA 4WFOA 2CFGA 3ZG5A 2BHMA 4AKYA 1VQ93 3PS8A 1VQ73 3JUQA 3CC43 1LOXA 2F5WA 1IU7A 1IVUA 1SIIA 1FGMA 3EX9A 2XRXB 3GZXB 2D1WA 3LXUX 1YJN3 1RNBA 5D83A 1MWUA 2D42A 2CWVA 2ZL8A 5CXOA 2W03A 1RN4A 1YIT3 3KIIA 2OTJ3 2AAEA 1IT7A 5STDA 1BRIA 1QALA 2Y74A 4CJNA 2BMRB 3AGNA 5IG4A 2INXA 1QVF2 2P05A 3A76A 3G8ZA 1O7WB 1US1A 5AEUB 1OF5A 3KE7A 2P0XA 3F7SA 8CHOA 3X40A 2BMOB 5AIHA 2IA7A 1FUSA 3D3LA 1YJW3 1RN7A 1NDOB 3NM7A 2XGNA 3ALAA 3CCM3 1Y4KA 3CCU3 2PNCA 3KSED 3NBJA 2XGLA 3AMOB 2XSOB 2RCDA 2B24B 5D81A 5FGOA 2GU1A 3NBBA 1AY7A 3NUVA 2CFKA 2WGQA 3FZWA 3LYGA 3G0KA 1N9JA 5GSPA 1X1UA 2GSPA 1LXEA 3OX9A 3MWZA 3NM2A 1Q824 1GMRA 3HIIA 1VQN3 2CW9A 2ML6A 3V98A 2HMKB 2OQEA 8RNTA 4FMBA 3ROBA 1JBSA 3STDA 3H51A 1E3RA 2F4YA 4FR9A 1I70A 2MF7A 3UL6A 3BNEA 5KP3A 5TGNA 3LZAA 3B4PA 1ZO2A 3RNTA 3MKIA 2QEX3 1RKYA 1YIJ3 3DZLA 2QIYA 3U97A 3WMDA 3A5EA 5BU4A 1BANA 2B1XB 2KRTA 1U8CB 4GHOA 4LZIA 4EV2A 3KFQC 1LOYA 4EW5A 3HI7A 1MNLA 4NREA 2KAAA 1JKGA 3EC9A 3PCSA 1OHOA 1WNHA 3JUMA 2CG0A 1D6YA 3JUPA 4I4KA 2KXGA 3B4OA 1RRHA 1HZ1A 4HJLB 1TUHA 1UDII 1KQS2 1GMPA 1I0VA 2CKFB 1N5PA 2FXTA 4OK0A 1I8VA 1TRPA 5CF1A 2OOVA 3CPW2 3VF1A 4WP5A 3BIRA 3NV0B 3CME3 1VQM3 4N6OB 2YFJB 1BSBA 1ULJB 1MOLA 1AVLA 1JB4A 2W04A 3LOYA 1G0TA 1V57A 4X2HA 4R1KA 4KZ1A 1OCVA 4OVMA 1A2KA 5KP1A 3LT8A 2ZHXB 1BRGA 5IEOA 1LNHA 4EYCA 1A67A 1DVDA 2KF6A 2Y73A 3T8UA 4CCVA 1Q40B 1RDSA 2K54A 4GL6A 1FW7A 3T8NA 1CEWI 1I2FA 1RGEA 2XSHB 4EBGA 3PCRA 5EQLA 1BSEA 1TFKA 4LYLB 1GOYA 1W01A 2ZDJA 1K41A 1OGXA 1GOVA 5DREA 1S5AA 2KCDA 4HM2B 4CPKA 4FCMA 1BNEA 4GSPA 5IERA 1JN5A 1N5HA 2Z77A 1BRNL 9RNTA 1GS3A 4QWTA 4K1VA 1Q7Y4 5G2GA 1O7PB 1G02A 3SEDA 1RRLA 2RGQA 3G6E3 3B8LA 3SX1A 1GY7A 3WR2A 2XEPA 1BSAA 1UCKA 2E2UA 3GRDA 5AEWB 4WHAA 3GAXA 5HGRA 1LOWA 1V74A 1K9M4 3JUNA 4FCZA 1WMNA 1QAFA 1YVBI 5IEPA 2OTL3 1TU5A 4U13A 1GYBA 3SOYA 1RTUA 1X1YA 4XBTA 1RGFA 1ZX2A 1IQ8A 3N9HA 4HM6B 2WO0A 1CYUA 1K734 1JZOA 2C4BA 2V1LA 3BNBA 3S29A 1CQSA 2F5MA 3L0RA 1QVG2 3DUKA 3JVCA 4JF8A 3I0YA 2CIUA 1STFI 5IG3A 3NBRA 3EJVA 1RNTA 4CDLA 1RSNA 3J7Yd 1T5YA 2RSXA 1DE3A 1BRKA 1D6ZA 4XM4A 1N8QA 5G1LA 5KP4A 5M18A 1JJ22 2BO9B 7STDA 3LH4A 3CD63 1KC84 1BRSA 4HM7B 3N54B 1W6YA 1IVXA 1MGRA 2L4VA 3FG3A 3QK9A 2MC8A 1SQWA 2GBWB 1MWTA 1WQLB 2HOHA 3G4S3 2W9PA 3WODG 2JDIH 1FUWA 2WGOA 3EQQB 4KFDA 4BL3A 4WYKB 3SVAA 1NJI4 1TJDA 1VZZA 4IIAA 4MMZB 4ZM8A 1GOUA 4XBXA 3AHWA 5IG0A 3GZBA 4BTWA 1JZDA 3WOEB 3CCE3 2QGUA 5HOHA 1K8A4 1DMQA 1F8NA 2F98A 2CWTA 3KSPA 1ROAA 1B27A 1JNQA 2H0GA 4MMXB 4PEJA 3SYUA 3K0ZA 1AVKA 1YJ93 1B3SA 3X41A 1UI8A 4J5KA 1DYUA 3FGYA 3X3XA 3D9RA 1IVWA 3EN1B 3OWYA 3PZWA 4N6V0 5AI1A 4N6TA 4L8PA 1PU4A 4HM1B 1LVNA 1FGTA 3E99A 1MGWA 3VSYA 4WWUC 3O8YA 2F99A 1OPYA 4MEIA 4RNZA 1YHQ3 5G1KA 3FF0A 4FMDA 2SBLA 1B21A 3IMAB 3X3YA 1VQ43 3NHXA 2K0MA 3D79A 1BNJA 3FLJA 1EUIC 4HVNA 3DM8A 4STDA 2W56B 4MJDA 1M904 5CK6A 1HU9A 2A15A 5BVBA 1IDPA 4RBNA 3PYJA 1RGAA 1Q7HA 1JKGB 2OQEC 2KF5A 3S5CA 3LMLA 3H3HA 4R80A 5ELUA 5EEOA 1FA3A 1I3IA 3WHOA 1NB5I 5IW9A 1FGQA 3MG1A 1TFOA 2P0MA 2XF3A 3UJMA 2H0IA 2AADA 2C10A 1FZUA 1UI7A 2RBIA 3FG1A 1S723 5M19A 2FGTA 2W6JH 2CX1A 4L8OA 1JRQA 1ISKA 1VQK3 1W7CA 2BT3A 1SPUA 1EQKA 2HMLB 2IMJA 1O7MB 4O2HA 1W00A 1EG9B 1OH0A 2SARA 3CCL3 1I2GA 3BNDA 3CU3A 1E97A 1UGIA 4R9LA 2XR8B 1GMQA 2ZA4A 3LTDA 3PGBA 3CNMA 3K9MC 1TP6A 2J8XB 2OOVC 3URPA 4BL2A 1B2MA 1JB5A 1BAOA 1NNVA 2E2VA 2IUKA 3K63A 5LC6A 1FUTA 1UCJA
chains in the Genus database with same CATH topology
3CCJ3 1W5ZA 2XFTA 1W2B2 4HM3B 2WOFA 4O8SA 3N8BA 3BNCA 1QAKA 1M9GA 4N6NB 4HZBB 5LC7A 3NV0A 4R4KA 3F14A 3V92A 1YI23 1DMMA 1QMAA 4N6LA 3MYTA 1O7HB 3FKAA 4XDVA 3F9SA 3FH1A 1GY6A 1A2VA 1SIHA 5CF2A 2STDA 1Q40A 2IUJA 2CK3H 2HMNB 4HKVB 4EXRA 4LGQA 2Q07A 4XBYA 1GD3A 1SJWA 4AKZA 4K61A 3JUOA 4BTXA 5ELJA 2OWPA 1EA2A 3HK4A 2C11A 3NQZA 2W9QA 4HM5B 2YFIB 3DXOA 1STDA 2GEYA 3OV4A 2LYXA 3LT9A 3HX8A 4HZ9B 3EN8A 1ROVA 1AV4A 5D82A 2Z6BA 1TIJA 4JRFA 2PZVA 1WMOA 5EVHA 5A0OB 3LTCA 3HIGA 3NX0A 3EBYA 5AYSC 3T0UA 1KSIA 1JB2A 1W4NA 1EKMA 5JPUA 4TX4A 1Q42A 2HMOB 4HM4B 2P38A 3S67A 1PFPA 4LMIA 3OXAA 1VQ83 3K7CA 2GBXB 1UW1A 1DMNA 3K5TA 1KWIA 1OHPA 3EHCA 5AIFA 1N8R4 1O7NB 3IJEB 3F8XA 3PXMA 2CWUA 4K1UA 2I9WA 3F40A 1N9EA 3F8HA 1UUVB 1OF5B 1C7HA 1ASKA 4G1MB 2HMJB 3X42A 5AIGA 2BNGA 2CFWA 3FF2A 4H61A 3G16A 1IT8A 4IPBA 5FW5A 1VQO3 1NU3A 3CCR3 4J8TA 3SXXA 2CC3A 5JPPA 1M1XB 3DGLA 2M7OA 3ECFA 3OWUA 4K90B 2CG1A 4KVHA 3DGMA 4FMAA 1L5GB 6STDA 1CYVA 1IQYA 3CCV3 1A90A 4WYKA 4MMYB 3TDGA 2Z76A 1OACA 2UX0A 3UL5A 3FSDA 1GY5A 5I97A 3VGNA 4RNYA 2CHCA 1W02A 2RFRA 2XFSA 4AEQA 4OUQA 4HYZA 1K28A 2QA43 3EB8A 1ULIB 1UUWB 4ORLA 3CCS3 1QJGA 2O3OA 4O3VA 3AMOA 2GU3A 5AIIA 5IENA 3OW22 3U1WA 3MSOA 2YFLB 3DY5A 4XB5A 4BTYA 4HBRA 4IT7A 3LTBA 3S27A 3WA3A 3CNXA 3MG2A 3EE1A 1Q864 3SOAA 3F7XA 3RDEA 3CCQ3 3WOFB 2CFLA 5AYRB 2W2CA 3MHEA 3MPHA 3LTAA 1W6GA 3M8CA 1U5OA 1YGEA 2P09A 1IK3A 3S28A 1OGZA 2Z7AA 3EF8A 1WTHA 2CH9A 3V99A 2JQ5A 2W56A 3KKGA 4EV5A 3BLZA 3GWRA 3FG4A 4H3UA 2HMMB 3X3ZA 4FCJA 4J9AA 2CFDA 4O02B 1VQ63 5IG5A 2LQVA 1NWWA 3KN4A 3GZYB 1J2BA 1KD14 3WDGB 5CLKA 3I563 1BUQA 3QRDA 3B7CA 1JN5B 3MG3A 1M1K4 4N3VA 1W6CA 4N6UA 3G713 2WOHA 1Q814 3Q1CA 2BMQB 4HM0B 3DMCA 4R9KA 1DVCA 3Q90A 4L7KA 1O7GB 2YX9A 3UNLA 2FNQA 1VQL3 4Q53A 3GZRA 3CC73 3EBTA 1IV7A 2XH9A 1IQXA 1W2ZA 4KFEA 2E2TA 1WMPA 1OUNA 3BB9A 2OCTA 1R4CA 1G96A 1JV2B 4NHFA 4HM8B 1FGOA 1IV9A 1RJOA 3ER7A 4LSOA 1E3VA 3HZPA 1VQP3 3CXC2 1NB3I 5JBSA 1NO3A 1GD4A 3Q2PA 5DRVA 4XDWA 2GXFA 3I553 1D6UA 1IVVA 3KZTA 4RZMA 3CC23 3NQYA 4EC6A 3RGAA 3RGRA 2ML5A 3CPOA 3WA2X 2F86B 4GB5A 4FMCA 5BXQA 4X2OA 1AR0A 1Z1SA 2GEXA 4N6MA 3DGOA 2W0QA 4KFFA 5IF6A 2R4IA 3CMA3 2O9UX 3OWSA 3SLUA 3IPTA 4LEHA 1FGRA 3DGNA 1VQ53 1OHSA 3FCSB 3UB1A 3NXJA 1HKXA 4WFOA 2CFGA 4AKYA 2BHMA 1VQ93 3PS8A 1VQ73 3JUQA 3CC43 1LOXA 1IU7A 1IVUA 1SIIA 1FGMA 3EX9A 2XRXB 3GZXB 2D1WA 3LXUX 1YJN3 5D83A 2D42A 2CWVA 2ZL8A 5CXOA 2W03A 1YIT3 2OTJ3 3KIIA 5STDA 1IT7A 1QALA 2Y74A 2BMRB 5IG4A 2INXA 1QVF2 2P05A 3A76A 3G8ZA 1O7WB 1US1A 5AEUB 1OF5A 3KE7A 2P0XA 3F7SA 8CHOA 3X40A 2BMOB 5AIHA 2IA7A 3D3LA 1YJW3 1RN7A 1NDOB 3NM7A 2XGNA 3ALAA 3CCM3 1Y4KA 3CCU3 2PNCA 3KSED 3NBJA 2XGLA 3AMOB 2XSOB 2RCDA 2B24B 5D81A 2GU1A 3NBBA 3NUVA 2CFKA 2WGQA 3FZWA 3LYGA 3G0KA 1N9JA 1LXEA 3OX9A 3MWZA 3NM2A 1Q824 3HIIA 1VQN3 2CW9A 2ML6A 3V98A 2HMKB 2OQEA 4FMBA 3ROBA 3STDA 3H51A 1E3RA 4FR9A 2MF7A 3UL6A 3BNEA 5KP3A 5TGNA 3LZAA 3B4PA 1ZO2A 2QEX3 3MKIA 1YIJ3 1RKYA 3DZLA 2QIYA 3U97A 3WMDA 2KRTA 2B1XB 1U8CB 4LZIA 4EV2A 3KFQC 3HI7A 1MNLA 4NREA 1JKGA 3EC9A 3PCSA 1OHOA 1WNHA 3JUMA 2CG0A 1D6YA 3JUPA 4I4KA 2KXGA 3B4OA 1RRHA 4HJLB 1TUHA 1KQS2 2CKFB 1N5PA 2FXTA 4OK0A 5CF1A 3CPW2 2OOVA 3VF1A 4WP5A 3NV0B 3CME3 1VQM3 4N6OB 2YFJB 1ULJB 1MOLA 1AVLA 1JB4A 2W04A 3LOYA 4X2HA 4R1KA 4KZ1A 1OCVA 4OVMA 1A2KA 5KP1A 3LT8A 5IEOA 1LNHA 4EYCA 1A67A 1DVDA 2Y73A 3T8UA 4CCVA 1Q40B 4GL6A 2K54A 3T8NA 1CEWI 2XSHB 4EBGA 3PCRA 5EQLA 1TFKA 1W01A 2ZDJA 1K41A 1OGXA 5DREA 1S5AA 2KCDA 4HM2B 4FCMA 5IERA 1JN5A 1N5HA 2Z77A 1GS3A 4QWTA 4K1VA 1Q7Y4 5G2GA 1O7PB 3SEDA 1RRLA 2RGQA 3G6E3 3B8LA 3SX1A 1GY7A 2XEPA 2E2UA 3GRDA 5AEWB 1K9M4 4WHAA 3GAXA 5HGRA 1V74A 2OTL3 3JUNA 4FCZA 1WMNA 1QAFA 1YVBI 5IEPA 1TU5A 4U13A 1GYBA 3SOYA 4XBTA 1ZX2A 1IQ8A 3N9HA 4HM6B 2WO0A 1CYUA 1K734 2V1LA 3BNBA 3S29A 1CQSA 3L0RA 1QVG2 3DUKA 3JVCA 4JF8A 3I0YA 2CIUA 1STFI 5IG3A 3NBRA 3EJVA 4CDLA 3J7Yd 1T5YA 2RSXA 1D6ZA 4XM4A 1N8QA 5KP4A 1JJ22 2BO9B 7STDA 3LH4A 3CD63 1KC84 4HM7B 3N54B 1W6YA 1IVXA 2L4VA 3FG3A 3QK9A 2MC8A 1SQWA 2GBWB 1WQLB 3G4S3 3WODG 2JDIH 1FUWA 2WGOA 3EQQB 4KFDA 4WYKB 3SVAA 1NJI4 4MMZB 1VZZA 4IIAA 4ZM8A 4XBXA 3CCE3 5IG0A 3GZBA 4BTWA 3WOEB 2QGUA 1K8A4 1DMQA 1F8NA 2F98A 2CWTA 3KSPA 1ROAA 1JNQA 4MMXB 4PEJA 3K0ZA 1AVKA 1YJ93 3X41A 1UI8A 1DYUA 3FGYA 3X3XA 3D9RA 1IVWA 3EN1B 3OWYA 3PZWA 4N6V0 5AI1A 4N6TA 4L8PA 1PU4A 4HM1B 1LVNA 1FGTA 3E99A 3VSYA 4WWUC 3O8YA 2F99A 1OPYA 4MEIA 4RNZA 1YHQ3 3FF0A 4FMDA 2SBLA 3IMAB 3X3YA 1VQ43 3NHXA 2K0MA 3FLJA 4HVNA 4STDA 3DM8A 2W56B 4MJDA 1M904 5CK6A 1HU9A 2A15A 5BVBA 1IDPA 4RBNA 3PYJA 1JKGB 2OQEC 3S5CA 3LMLA 3H3HA 4R80A 5ELUA 5EEOA 1FA3A 1NB5I 5IW9A 1FGQA 3MG1A 1TFOA 2P0MA 2XF3A 3UJMA 2C10A 1UI7A 3FG1A 1S723 2FGTA 2W6JH 4L8OA 1JRQA 1ISKA 1VQK3 1W7CA 2BT3A 1SPUA 1EQKA 2HMLB 2IMJA 1O7MB 4O2HA 1W00A 1EG9B 1OH0A 3CCL3 3BNDA 3CU3A 1E97A 4R9LA 2XR8B 3LTDA 3PGBA 3CNMA 3K9MC 1TP6A 2OOVC 1JB5A 2IUKA 3K63A 2E2VA 5FGOA 5LC6A 2W9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM3 B;  4HZB B;  3NV0 A;  3F14 A;  1DMM A;  1QMA A;  3MYT A;  1O7H B;  3FKA A;  4XDV A;  3F9S A;  3FH1 A;  1GY6 A;  5CF2 A;  2STD A;  1Q40 A;  2HMN B;  4HKV B;  4LGQ A;  4XBY A;  1SJW A;  3JUO A;  2OWP A;  1EA2 A;  3HK4 A;  4HM5 B;  2YFI B;  3DXO A;  1STD A;  2GEY A;  3OV4 A;  3HX8 A;  4HZ9 B;  3EN8 A;  5D82 A;  2PZV A;  5EVH A;  3EBY A;  1JB2 A;  5JPU A;  1Q42 A;  2HMO B;  4HM4 B;  4LMI A;  3OXA A;  3K7C A;  2GBX B;  1DMN A;  1OHP A;  3EHC A;  5AIF A;  1O7N B;  3F8X A;  4K1U A;  2I9W A;  3F40 A;  3F8H A;  1UUV B;  1OF5 B;  1C7H A;  1ASK A;  2HMJ B;  5AIG A;  2BNG A;  3FF2 A;  3G16 A;  5FW5 A;  1NU3 A;  4J8T A;  5JPP A;  3ECF A;  3OWU A;  4KVH A;  6STD A;  4WYK A;  2Z76 A;  2UX0 A;  3FSD A;  1GY5 A;  3VGN A;  2CHC A;  1W02 A;  2RFR A;  4OUQ A;  1ULI B;  1UUW B;  4ORL A;  1QJG A;  5AII A;  5IEN A;  3MSO A;  2YFL B;  4XB5 A;  3CNX A;  3MG2 A;  3SOA A;  3F7X A;  2W2C A;  3MHE A;  3M8C A;  1U5O A;  1OGZ A;  2Z7A A;  3EF8 A;  2JQ5 A;  3KKG A;  3BLZ A;  3GWR A;  4H3U A;  2HMM B;  4FCJ A;  4J9A A;  5IG5 A;  1NWW A;  3GZY B;  5CLK A;  1BUQ A;  3B7C A;  1JN5 B;  3MG3 A;  4N3V A;  2BMQ B;  4HM0 B;  3DMC A;  4R9K A;  3Q90 A;  4L7K A;  1O7G B;  3UNL A;  4Q53 A;  3GZR A;  3EBT A;  1OUN A;  3BB9 A;  4HM8 B;  3ER7 A;  1E3V A;  3HZP A;  5DRV A;  4XDW A;  2GXF A;  3KZT A;  4RZM A;  3RGA A;  3RGR A;  3CPO A;  2F86 B;  4GB5 A;  5BXQ A;  4X2O A;  1AR0 A;  1Z1S A;  2GEX A;  5IF6 A;  2R4I A;  3OWS A;  3IPT A;  4LEH A;  1OHS A;  3NXJ A;  1HKX A;  3JUQ A;  3EX9 A;  2XRX B;  3GZX B;  5D83 A;  5CXO A;  5STD A;  2BMR B;  5IG4 A;  2INX A;  3A76 A;  3G8Z A;  1O7W B;  5AEU B;  1OF5 A;  3KE7 A;  3F7S A;  8CHO A;  2BMO B;  5AIH A;  1NDO B;  2XSO B;  2RCD A;  2B24 B;  5D81 A;  3NUV A;  3FZW A;  3LYG A;  3G0K A;  3OX9 A;  3NM2 A;  2HMK B;  3ROB A;  3STD A;  3H51 A;  1E3R A;  5KP3 A;  5TGN A;  3LZA A;  3B4P A;  1ZO2 A;  3MKI A;  3DZL A;  2QIY A;  3WMD A;  2B1X B;  1JKG A;  3EC9 A;  1OHO A;  3JUM A;  3JUP A;  4I4K A;  3B4O A;  4HJL B;  1TUH A;  2CKF B;  5CF1 A;  4WP5 A;  3NV0 B;  2YFJ B;  1ULJ B;  1JB4 A;  4X2H A;  4R1K A;  1OCV A;  4OVM A;  1A2K A;  5KP1 A;  5IEO A;  3T8U A;  1Q40 B;  2K54 A;  3T8N A;  2XSH B;  1W01 A;  1K41 A;  1OGX A;  5DRE A;  1S5A A;  4HM2 B;  4FCM A;  5IER A;  1JN5 A;  2Z77 A;  1GS3 A;  4K1V A;  5G2G A;  1O7P B;  3SED A;  2RGQ A;  3B8L A;  1GY7 A;  3GRD A;  5AEW B;  5HGR A;  3JUN A;  5IEP A;  4U13 A;  1GYB A;  3SOY A;  4XBT A;  1ZX2 A;  4HM6 B;  1CQS A;  3DUK A;  3I0Y A;  5IG3 A;  3NBR A;  3EJV A;  4CDL A;  4XM4 A;  5KP4 A;  7STD A;  4HM7 B;  1W6Y A;  2GBW B;  1WQL B;  3EQQ B;  4WYK B;  1VZZ A;  4IIA A;  4XBX A;  5IG0 A;  3GZB A;  2QGU A;  1DMQ A;  2F98 A;  3KSP A;  4PEJ A;  3K0Z A;  3FGY A;  3D9R A;  3EN1 B;  3OWY A;  5AI1 A;  4L8P A;  4HM1 B;  3E99 A;  3VSY A;  4WWU C;  2F99 A;  1OPY A;  3FF0 A;  3NHX A;  3FLJ A;  4HVN A;  4STD A;  3DM8 A;  4MJD A;  5CK6 A;  2A15 A;  5BVB A;  1IDP A;  1JKG B;  3S5C A;  3H3H A;  3MG1 A;  3UJM A;  4L8O A;  1ISK A;  2HML B;  2IMJ A;  1O7M B;  1W00 A;  1EG9 B;  1OH0 A;  3CU3 A;  1E97 A;  4R9L A;  2XR8 B;  3CNM A;  1TP6 A;  1JB5 A; 
#chains in the Genus database with same CATH topology
 1HYF A;  2KF3 A;  3CCJ 3;  1W5Z A;  5RNT A;  2XFT A;  2CX0 A;  1T2H A;  1B2S A;  3AHS A;  4HM3 B;  2WOF A;  1W2B 2;  4O8S A;  3N8B A;  1BGS A;  3BNC A;  1QAK A;  1M9G A;  4N6N B;  3GSP A;  4HZB B;  5LC7 A;  5M1A A;  3NV0 A;  4R4K A;  3F14 A;  2BIR A;  3V92 A;  1YI2 3;  1DMM A;  1QMA A;  1BOX A;  4N6L A;  3MYT A;  1O7H B;  3FKA A;  4ILF A;  3F9S A;  3FH1 A;  4XDV A;  6GSP A;  1GY6 A;  4I5Q A;  1A2V A;  1SIH A;  5CF2 A;  1LQG C;  2STD A;  1Q40 A;  2IUJ A;  2CK3 H;  2HMN B;  1IYY A;  4HKV B;  1I2E A;  4EXR A;  4LGQ A;  1I0X A;  2Q07 A;  4XBY A;  7GSP A;  1BRJ A;  2K3D A;  1GD3 A;  1SJW A;  2RNT A;  4K61 A;  4AKZ A;  3JUO A;  1B20 A;  4BTX A;  5ELJ A;  1BNF A;  2OWP A;  1PY3 A;  1EA2 A;  3HK4 A;  2C11 A;  3NQZ A;  2W9Q A;  4HM5 B;  2YFI B;  3DXO A;  7RNT A;  1STD A;  2GEY A;  3OV4 A;  2LYX A;  3LT9 A;  3HX8 A;  4HZ9 B;  3EN8 A;  1BSC A;  1ROV A;  1BNR A;  1BIR A;  1V58 A;  1AV4 A;  4KT3 B;  5D82 A;  2Z6B A;  1BVI A;  1TIJ A;  4JRF A;  2PZV A;  1WMO A;  5EVH A;  5A0O B;  3LTC A;  3HIG A;  3NX0 A;  3EBY A;  5AYS C;  3T0U A;  1KSI A;  1MWS A;  1JB2 A;  1W4N A;  1EKM A;  1EEJ A;  5JPU A;  4TX4 A;  4DKI A;  1Q42 A;  2HMO B;  4HM4 B;  2P38 A;  3S67 A;  1PFP A;  1YGW A;  4LMI A;  3OXA A;  1VQ8 3;  3K7C A;  2GBX B;  1UW1 A;  1JBT A;  1DMN A;  1RHL A;  3K5T A;  1UGH I;  1KWI A;  1OHP A;  3EHC A;  5AIF A;  1N8R 4;  1O7N B;  3HOH A;  3IJE B;  6RNT A;  3F8X A;  3PXM A;  1SAR A;  2CWU A;  1TTO A;  1UUG B;  2I9W A;  4K1U A;  3F40 A;  1LRA A;  1N9E A;  3F8H A;  1RN1 A;  1UUV B;  1OF5 B;  1C7H A;  1ASK A;  4G1M B;  2HMJ B;  3X42 A;  2UGI A;  5AIG A;  2BNG A;  2CFW A;  3FF2 A;  1RCK A;  4H61 A;  3G16 A;  4RNT A;  1IT8 A;  1YVS A;  4IPB A;  5FW5 A;  1VQO 3;  1I3F A;  1BSD A;  1NU3 A;  1RGH A;  3CCR 3;  4J8T A;  3SXX A;  2L1S A;  4BIR A;  2F56 A;  2H0H A;  2CC3 A;  5JPP A;  1M1X B;  1PYL A;  2M7O A;  3DGL A;  3ECF A;  3OWU A;  4K90 B;  2CG1 A;  1AQZ A;  4KVH A;  1X1X A;  3DGM A;  4FMA A;  1L5G B;  6STD A;  1CYV A;  1IQY A;  3CCV 3;  1A90 A;  4WYK A;  1UCL A;  4MMY B;  3TDG A;  2Z76 A;  1OAC A;  2UX0 A;  3UL5 A;  3FSD A;  1GY5 A;  5I97 A;  3VGN A;  1X1W A;  2KF4 A;  4RNY A;  4BU4 A;  1BUJ A;  2CHC A;  1W02 A;  2RFR A;  2XFS A;  4AEQ A;  4OUQ A;  4HYZ A;  1K28 A;  2QA4 3;  3EB8 A;  1ULI B;  1UUW B;  4ORL A;  1B2X A;  3CCS 3;  1QJG A;  1A2P A;  2O3O A;  4O3V A;  3AMO A;  2GU3 A;  2IY2 A;  1RMS A;  5AII A;  4NPB A;  5IEN A;  3U1W A;  3OW2 2;  3MSO A;  2YFL B;  3DY5 A;  4XB5 A;  4BTY A;  4HBR A;  4IT7 A;  1DET A;  1ZS7 A;  3LTB A;  3S27 A;  3WA3 A;  3CNX A;  3MG2 A;  3EE1 A;  1JBR A;  1Q86 4;  3SOA A;  3F7X A;  3RDE A;  3CCQ 3;  3WOF B;  2CFL A;  5AYR B;  1RCL A;  2W2C A;  3MHE A;  3MPH A;  3LTA A;  1W6G A;  1BNS A;  1U5O A;  1YGE A;  2P09 A;  3M8C A;  1IK3 A;  3S28 A;  1OGZ A;  1MWR A;  2Z7A A;  3EF8 A;  1WTH A;  4HOH A;  3DH2 A;  2CH9 A;  3V99 A;  2JQ5 A;  2W56 A;  3KKG A;  4EV5 A;  3BLZ A;  3GWR A;  1T3B A;  3FG4 A;  4H3U A;  2HMM B;  3X3Z A;  4FCJ A;  4J9A A;  1BNI A;  2CFD A;  4O02 B;  1VQ6 3;  5IG5 A;  1B2U A;  1NWW A;  2LQV A;  3KN4 A;  3GZY B;  1J2B A;  3KCH A;  3DGY A;  1KD1 4;  3WDG B;  3D5I A;  5CLK A;  3I56 3;  1YNV X;  3QRD A;  1BUQ A;  3B7C A;  1JN5 B;  3MG3 A;  1M1K 4;  4N3V A;  1W6C A;  4N6U A;  3D4A A;  3G71 3;  1TRQ A;  2WOH A;  1Q81 4;  3Q1C A;  1T2I A;  2BMQ B;  4HM0 B;  3DMC A;  1C54 A;  4R9K A;  1DVC A;  3Q90 A;  4L7K A;  1RGC A;  1O7G B;  2YX9 A;  3UNL A;  2FNQ A;  4J5G A;  1Q9E A;  4Q53 A;  3GZR A;  1VQL 3;  3CC7 3;  1LNI A;  3EBT A;  1IV7 A;  2XH9 A;  1RGK A;  1IQX A;  1W2Z A;  3Q3F A;  1RGG A;  4KFE A;  1GSP A;  2E2T A;  1WMP A;  1OUN A;  1RLS A;  1ZGX A;  3BU4 A;  3BB9 A;  1BNG A;  1R4C A;  1CH0 A;  1G96 A;  2OCT A;  1JV2 B;  4NHF A;  4HM8 B;  1FGO A;  1IV9 A;  1RJO A;  2R41 A;  3ER7 A;  4LSO A;  1E3V A;  3HZP A;  3ZFZ A;  5BIR A;  1VQP 3;  3CXC 2;  1NB3 I;  1FYS A;  5JBS A;  1NO3 A;  1GD4 A;  3Q2P A;  3AGO A;  4XDW A;  5DRV A;  2GXF A;  3I55 3;  1D6U A;  1UCI A;  1IVV A;  2IYJ A;  3KZT A;  4RZM A;  3CC2 3;  3NQY A;  4EC6 A;  3RGA A;  3RGR A;  2ML5 A;  3CPO A;  3D5G A;  1R4Y A;  3WA2 X;  1VQQ A;  2F86 B;  4GB5 A;  4FMC A;  5BXQ A;  1B2Z A;  4X2O A;  1AR0 A;  1LQM B;  1Z1S A;  2GEX A;  1LOV A;  2BU4 A;  2W0Q A;  3DGO A;  4N6M A;  2UUG C;  1RGL A;  4KFF A;  4HAA A;  5IF6 A;  2R4I A;  3CMA 3;  1BRH A;  1BU4 A;  2O9U X;  3OWS A;  3SLU A;  3IPT A;  4LEH A;  1FGR A;  3DGN A;  1VQ5 3;  1OHS A;  3FCS B;  3ZG0 A;  3UB1 A;  3NXJ A;  1HKX A;  4WFO A;  2CFG A;  3ZG5 A;  2BHM A;  4AKY A;  1VQ9 3;  3PS8 A;  1VQ7 3;  3JUQ A;  3CC4 3;  1LOX A;  2F5W A;  1IU7 A;  1IVU A;  1SII A;  1FGM A;  3EX9 A;  2XRX B;  3GZX B;  2D1W A;  3LXU X;  1YJN 3;  1RNB A;  5D83 A;  1MWU A;  2D42 A;  2CWV A;  2ZL8 A;  5CXO A;  2W03 A;  1RN4 A;  1YIT 3;  3KII A;  2OTJ 3;  2AAE A;  1IT7 A;  5STD A;  1BRI A;  1QAL A;  2Y74 A;  4CJN A;  2BMR B;  3AGN A;  5IG4 A;  2INX A;  1QVF 2;  2P05 A;  3A76 A;  3G8Z A;  1O7W B;  1US1 A;  5AEU B;  1OF5 A;  3KE7 A;  2P0X A;  3F7S A;  8CHO A;  3X40 A;  2BMO B;  5AIH A;  2IA7 A;  1FUS A;  3D3L A;  1YJW 3;  1RN7 A;  1NDO B;  3NM7 A;  2XGN A;  3ALA A;  3CCM 3;  1Y4K A;  3CCU 3;  2PNC A;  3KSE D;  3NBJ A;  2XGL A;  3AMO B;  2XSO B;  2RCD A;  2B24 B;  5D81 A;  5FGO A;  2GU1 A;  3NBB A;  1AY7 A;  3NUV A;  2CFK A;  2WGQ A;  3FZW A;  3LYG A;  3G0K A;  1N9J A;  5GSP A;  1X1U A;  2GSP A;  1LXE A;  3OX9 A;  3MWZ A;  3NM2 A;  1Q82 4;  1GMR A;  3HII A;  1VQN 3;  2CW9 A;  2ML6 A;  3V98 A;  2HMK B;  2OQE A;  8RNT A;  4FMB A;  3ROB A;  1JBS A;  3STD A;  3H51 A;  1E3R A;  2F4Y A;  4FR9 A;  1I70 A;  2MF7 A;  3UL6 A;  3BNE A;  5KP3 A;  5TGN A;  3LZA A;  3B4P A;  1ZO2 A;  3RNT A;  3MKI A;  2QEX 3;  1RKY A;  1YIJ 3;  3DZL A;  2QIY A;  3U97 A;  3WMD A;  3A5E A;  5BU4 A;  1BAN A;  2B1X B;  2KRT A;  1U8C B;  4GHO A;  4LZI A;  4EV2 A;  3KFQ C;  1LOY A;  4EW5 A;  3HI7 A;  1MNL A;  4NRE A;  2KAA A;  1JKG A;  3EC9 A;  3PCS A;  1OHO A;  1WNH A;  3JUM A;  2CG0 A;  1D6Y A;  3JUP A;  4I4K A;  2KXG A;  3B4O A;  1RRH A;  1HZ1 A;  4HJL B;  1TUH A;  1UDI I;  1KQS 2;  1GMP A;  1I0V A;  2CKF B;  1N5P A;  2FXT A;  4OK0 A;  1I8V A;  1TRP A;  5CF1 A;  2OOV A;  3CPW 2;  3VF1 A;  4WP5 A;  3BIR A;  3NV0 B;  3CME 3;  1VQM 3;  4N6O B;  2YFJ B;  1BSB A;  1ULJ B;  1MOL A;  1AVL A;  1JB4 A;  2W04 A;  3LOY A;  1G0T A;  1V57 A;  4X2H A;  4R1K A;  4KZ1 A;  1OCV A;  4OVM A;  1A2K A;  5KP1 A;  3LT8 A;  2ZHX B;  1BRG A;  5IEO A;  1LNH A;  4EYC A;  1A67 A;  1DVD A;  2KF6 A;  2Y73 A;  3T8U A;  4CCV A;  1Q40 B;  1RDS A;  2K54 A;  4GL6 A;  1FW7 A;  3T8N A;  1CEW I;  1I2F A;  1RGE A;  2XSH B;  4EBG A;  3PCR A;  5EQL A;  1BSE A;  1TFK A;  4LYL B;  1GOY A;  1W01 A;  2ZDJ A;  1K41 A;  1OGX A;  1GOV A;  5DRE A;  1S5A A;  2KCD A;  4HM2 B;  4CPK A;  4FCM A;  1BNE A;  4GSP A;  5IER A;  1JN5 A;  1N5H A;  2Z77 A;  1BRN L;  9RNT A;  1GS3 A;  4QWT A;  4K1V A;  1Q7Y 4;  5G2G A;  1O7P B;  1G02 A;  3SED A;  1RRL A;  2RGQ A;  3G6E 3;  3B8L A;  3SX1 A;  1GY7 A;  3WR2 A;  2XEP A;  1BSA A;  1UCK A;  2E2U A;  3GRD A;  5AEW B;  4WHA A;  3GAX A;  5HGR A;  1LOW A;  1V74 A;  1K9M 4;  3JUN A;  4FCZ A;  1WMN A;  1QAF A;  1YVB I;  5IEP A;  2OTL 3;  1TU5 A;  4U13 A;  1GYB A;  3SOY A;  1RTU A;  1X1Y A;  4XBT A;  1RGF A;  1ZX2 A;  1IQ8 A;  3N9H A;  4HM6 B;  2WO0 A;  1CYU A;  1K73 4;  1JZO A;  2C4B A;  2V1L A;  3BNB A;  3S29 A;  1CQS A;  2F5M A;  3L0R A;  1QVG 2;  3DUK A;  3JVC A;  4JF8 A;  3I0Y A;  2CIU A;  1STF I;  5IG3 A;  3NBR A;  3EJV A;  1RNT A;  4CDL A;  1RSN A;  3J7Y d;  1T5Y A;  2RSX A;  1DE3 A;  1BRK A;  1D6Z A;  4XM4 A;  1N8Q A;  5G1L A;  5KP4 A;  5M18 A;  1JJ2 2;  2BO9 B;  7STD A;  3LH4 A;  3CD6 3;  1KC8 4;  1BRS A;  4HM7 B;  3N54 B;  1W6Y A;  1IVX A;  1MGR A;  2L4V A;  3FG3 A;  3QK9 A;  2MC8 A;  1SQW A;  2GBW B;  1MWT A;  1WQL B;  2HOH A;  3G4S 3;  2W9P A;  3WOD G;  2JDI H;  1FUW A;  2WGO A;  3EQQ B;  4KFD A;  4BL3 A;  4WYK B;  3SVA A;  1NJI 4;  1TJD A;  1VZZ A;  4IIA A;  4MMZ B;  4ZM8 A;  1GOU A;  4XBX A;  3AHW A;  5IG0 A;  3GZB A;  4BTW A;  1JZD A;  3WOE B;  3CCE 3;  2QGU A;  5HOH A;  1K8A 4;  1DMQ A;  1F8N A;  2F98 A;  2CWT A;  3KSP A;  1ROA A;  1B27 A;  1JNQ A;  2H0G A;  4MMX B;  4PEJ A;  3SYU A;  3K0Z A;  1AVK A;  1YJ9 3;  1B3S A;  3X41 A;  1UI8 A;  4J5K A;  1DYU A;  3FGY A;  3X3X A;  3D9R A;  1IVW A;  3EN1 B;  3OWY A;  3PZW A;  4N6V 0;  5AI1 A;  4N6T A;  4L8P A;  1PU4 A;  4HM1 B;  1LVN A;  1FGT A;  3E99 A;  1MGW A;  3VSY A;  4WWU C;  3O8Y A;  2F99 A;  1OPY A;  4MEI A;  4RNZ A;  1YHQ 3;  5G1K A;  3FF0 A;  4FMD A;  2SBL A;  1B21 A;  3IMA B;  3X3Y A;  1VQ4 3;  3NHX A;  2K0M A;  3D79 A;  1BNJ A;  3FLJ A;  1EUI C;  4HVN A;  3DM8 A;  4STD A;  2W56 B;  4MJD A;  1M90 4;  5CK6 A;  1HU9 A;  2A15 A;  5BVB A;  1IDP A;  4RBN A;  3PYJ A;  1RGA A;  1Q7H A;  1JKG B;  2OQE C;  2KF5 A;  3S5C A;  3LML A;  3H3H A;  4R80 A;  5ELU A;  5EEO A;  1FA3 A;  1I3I A;  3WHO A;  1NB5 I;  5IW9 A;  1FGQ A;  3MG1 A;  1TFO A;  2P0M A;  2XF3 A;  3UJM A;  2H0I A;  2AAD A;  2C10 A;  1FZU A;  1UI7 A;  2RBI A;  3FG1 A;  1S72 3;  5M19 A;  2FGT A;  2W6J H;  2CX1 A;  4L8O A;  1JRQ A;  1ISK A;  1VQK 3;  1W7C A;  2BT3 A;  1SPU A;  1EQK A;  2HML B;  2IMJ A;  1O7M B;  4O2H A;  1W00 A;  1EG9 B;  1OH0 A;  2SAR A;  3CCL 3;  1I2G A;  3BND A;  3CU3 A;  1E97 A;  1UGI A;  4R9L A;  2XR8 B;  1GMQ A;  2ZA4 A;  3LTD A;  3PGB A;  3CNM A;  3K9M C;  1TP6 A;  2J8X B;  2OOV C;  3URP A;  4BL2 A;  1B2M A;  1JB5 A;  1BAO A;  1NNV A;  2E2V A;  2IUK A;  3K63 A;  5LC6 A;  1FUT A;  1UCJ A; 
#chains in the Genus database with same CATH homology
 3CCJ 3;  1W5Z A;  2XFT A;  1W2B 2;  4HM3 B;  2WOF A;  4O8S A;  3N8B A;  3BNC A;  1QAK A;  1M9G A;  4N6N B;  4HZB B;  5LC7 A;  3NV0 A;  4R4K A;  3F14 A;  3V92 A;  1YI2 3;  1DMM A;  1QMA A;  4N6L A;  3MYT A;  1O7H B;  3FKA A;  4XDV A;  3F9S A;  3FH1 A;  1GY6 A;  1A2V A;  1SIH A;  5CF2 A;  2STD A;  1Q40 A;  2IUJ A;  2CK3 H;  2HMN B;  4HKV B;  4EXR A;  4LGQ A;  2Q07 A;  4XBY A;  1GD3 A;  1SJW A;  4AKZ A;  4K61 A;  3JUO A;  4BTX A;  5ELJ A;  2OWP A;  1EA2 A;  3HK4 A;  2C11 A;  3NQZ A;  2W9Q A;  4HM5 B;  2YFI B;  3DXO A;  1STD A;  2GEY A;  3OV4 A;  2LYX A;  3LT9 A;  3HX8 A;  4HZ9 B;  3EN8 A;  1ROV A;  1AV4 A;  5D82 A;  2Z6B A;  1TIJ A;  4JRF A;  2PZV A;  1WMO A;  5EVH A;  5A0O B;  3LTC A;  3HIG A;  3NX0 A;  3EBY A;  5AYS C;  3T0U A;  1KSI A;  1JB2 A;  1W4N A;  1EKM A;  5JPU A;  4TX4 A;  1Q42 A;  2HMO B;  4HM4 B;  2P38 A;  3S67 A;  1PFP A;  4LMI A;  3OXA A;  1VQ8 3;  3K7C A;  2GBX B;  1UW1 A;  1DMN A;  3K5T A;  1KWI A;  1OHP A;  3EHC A;  5AIF A;  1N8R 4;  1O7N B;  3IJE B;  3F8X A;  3PXM A;  2CWU A;  4K1U A;  2I9W A;  3F40 A;  1N9E A;  3F8H A;  1UUV B;  1OF5 B;  1C7H A;  1ASK A;  4G1M B;  2HMJ B;  3X42 A;  5AIG A;  2BNG A;  2CFW A;  3FF2 A;  4H61 A;  3G16 A;  1IT8 A;  4IPB A;  5FW5 A;  1VQO 3;  1NU3 A;  3CCR 3;  4J8T A;  3SXX A;  2CC3 A;  5JPP A;  1M1X B;  3DGL A;  2M7O A;  3ECF A;  3OWU A;  4K90 B;  2CG1 A;  4KVH A;  3DGM A;  4FMA A;  1L5G B;  6STD A;  1CYV A;  1IQY A;  3CCV 3;  1A90 A;  4WYK A;  4MMY B;  3TDG A;  2Z76 A;  1OAC A;  2UX0 A;  3UL5 A;  3FSD A;  1GY5 A;  5I97 A;  3VGN A;  4RNY A;  2CHC A;  1W02 A;  2RFR A;  2XFS A;  4AEQ A;  4OUQ A;  4HYZ A;  1K28 A;  2QA4 3;  3EB8 A;  1ULI B;  1UUW B;  4ORL A;  3CCS 3;  1QJG A;  2O3O A;  4O3V A;  3AMO A;  2GU3 A;  5AII A;  5IEN A;  3OW2 2;  3U1W A;  3MSO A;  2YFL B;  3DY5 A;  4XB5 A;  4BTY A;  4HBR A;  4IT7 A;  3LTB A;  3S27 A;  3WA3 A;  3CNX A;  3MG2 A;  3EE1 A;  1Q86 4;  3SOA A;  3F7X A;  3RDE A;  3CCQ 3;  3WOF B;  2CFL A;  5AYR B;  2W2C A;  3MHE A;  3MPH A;  3LTA A;  1W6G A;  3M8C A;  1U5O A;  1YGE A;  2P09 A;  1IK3 A;  3S28 A;  1OGZ A;  2Z7A A;  3EF8 A;  1WTH A;  2CH9 A;  3V99 A;  2JQ5 A;  2W56 A;  3KKG A;  4EV5 A;  3BLZ A;  3GWR A;  3FG4 A;  4H3U A;  2HMM B;  3X3Z A;  4FCJ A;  4J9A A;  2CFD A;  4O02 B;  1VQ6 3;  5IG5 A;  2LQV A;  1NWW A;  3KN4 A;  3GZY B;  1J2B A;  1KD1 4;  3WDG B;  5CLK A;  3I56 3;  1BUQ A;  3QRD A;  3B7C A;  1JN5 B;  3MG3 A;  1M1K 4;  4N3V A;  1W6C A;  4N6U A;  3G71 3;  2WOH A;  1Q81 4;  3Q1C A;  2BMQ B;  4HM0 B;  3DMC A;  4R9K A;  1DVC A;  3Q90 A;  4L7K A;  1O7G B;  2YX9 A;  3UNL A;  2FNQ A;  1VQL 3;  4Q53 A;  3GZR A;  3CC7 3;  3EBT A;  1IV7 A;  2XH9 A;  1IQX A;  1W2Z A;  4KFE A;  2E2T A;  1WMP A;  1OUN A;  3BB9 A;  2OCT A;  1R4C A;  1G96 A;  1JV2 B;  4NHF A;  4HM8 B;  1FGO A;  1IV9 A;  1RJO A;  3ER7 A;  4LSO A;  1E3V A;  3HZP A;  1VQP 3;  3CXC 2;  1NB3 I;  5JBS A;  1NO3 A;  1GD4 A;  3Q2P A;  5DRV A;  4XDW A;  2GXF A;  3I55 3;  1D6U A;  1IVV A;  3KZT A;  4RZM A;  3CC2 3;  3NQY A;  4EC6 A;  3RGA A;  3RGR A;  2ML5 A;  3CPO A;  3WA2 X;  2F86 B;  4GB5 A;  4FMC A;  5BXQ A;  4X2O A;  1AR0 A;  1Z1S A;  2GEX A;  4N6M A;  3DGO A;  2W0Q A;  4KFF A;  5IF6 A;  2R4I A;  3CMA 3;  2O9U X;  3OWS A;  3SLU A;  3IPT A;  4LEH A;  1FGR A;  3DGN A;  1VQ5 3;  1OHS A;  3FCS B;  3UB1 A;  3NXJ A;  1HKX A;  4WFO A;  2CFG A;  4AKY A;  2BHM A;  1VQ9 3;  3PS8 A;  1VQ7 3;  3JUQ A;  3CC4 3;  1LOX A;  1IU7 A;  1IVU A;  1SII A;  1FGM A;  3EX9 A;  2XRX B;  3GZX B;  2D1W A;  3LXU X;  1YJN 3;  5D83 A;  2D42 A;  2CWV A;  2ZL8 A;  5CXO A;  2W03 A;  1YIT 3;  2OTJ 3;  3KII A;  5STD A;  1IT7 A;  1QAL A;  2Y74 A;  2BMR B;  5IG4 A;  2INX A;  1QVF 2;  2P05 A;  3A76 A;  3G8Z A;  1O7W B;  1US1 A;  5AEU B;  1OF5 A;  3KE7 A;  2P0X A;  3F7S A;  8CHO A;  3X40 A;  2BMO B;  5AIH A;  2IA7 A;  3D3L A;  1YJW 3;  1RN7 A;  1NDO B;  3NM7 A;  2XGN A;  3ALA A;  3CCM 3;  1Y4K A;  3CCU 3;  2PNC A;  3KSE D;  3NBJ A;  2XGL A;  3AMO B;  2XSO B;  2RCD A;  2B24 B;  5D81 A;  2GU1 A;  3NBB A;  3NUV A;  2CFK A;  2WGQ A;  3FZW A;  3LYG A;  3G0K A;  1N9J A;  1LXE A;  3OX9 A;  3MWZ A;  3NM2 A;  1Q82 4;  3HII A;  1VQN 3;  2CW9 A;  2ML6 A;  3V98 A;  2HMK B;  2OQE A;  4FMB A;  3ROB A;  3STD A;  3H51 A;  1E3R A;  4FR9 A;  2MF7 A;  3UL6 A;  3BNE A;  5KP3 A;  5TGN A;  3LZA A;  3B4P A;  1ZO2 A;  2QEX 3;  3MKI A;  1YIJ 3;  1RKY A;  3DZL A;  2QIY A;  3U97 A;  3WMD A;  2KRT A;  2B1X B;  1U8C B;  4LZI A;  4EV2 A;  3KFQ C;  3HI7 A;  1MNL A;  4NRE A;  1JKG A;  3EC9 A;  3PCS A;  1OHO A;  1WNH A;  3JUM A;  2CG0 A;  1D6Y A;  3JUP A;  4I4K A;  2KXG A;  3B4O A;  1RRH A;  4HJL B;  1TUH A;  1KQS 2;  2CKF B;  1N5P A;  2FXT A;  4OK0 A;  5CF1 A;  3CPW 2;  2OOV A;  3VF1 A;  4WP5 A;  3NV0 B;  3CME 3;  1VQM 3;  4N6O B;  2YFJ B;  1ULJ B;  1MOL A;  1AVL A;  1JB4 A;  2W04 A;  3LOY A;  4X2H A;  4R1K A;  4KZ1 A;  1OCV A;  4OVM A;  1A2K A;  5KP1 A;  3LT8 A;  5IEO A;  1LNH A;  4EYC A;  1A67 A;  1DVD A;  2Y73 A;  3T8U A;  4CCV A;  1Q40 B;  4GL6 A;  2K54 A;  3T8N A;  1CEW I;  2XSH B;  4EBG A;  3PCR A;  5EQL A;  1TFK A;  1W01 A;  2ZDJ A;  1K41 A;  1OGX A;  5DRE A;  1S5A A;  2KCD A;  4HM2 B;  4FCM A;  5IER A;  1JN5 A;  1N5H A;  2Z77 A;  1GS3 A;  4QWT A;  4K1V A;  1Q7Y 4;  5G2G A;  1O7P B;  3SED A;  1RRL A;  2RGQ A;  3G6E 3;  3B8L A;  3SX1 A;  1GY7 A;  2XEP A;  2E2U A;  3GRD A;  5AEW B;  1K9M 4;  4WHA A;  3GAX A;  5HGR A;  1V74 A;  2OTL 3;  3JUN A;  4FCZ A;  1WMN A;  1QAF A;  1YVB I;  5IEP A;  1TU5 A;  4U13 A;  1GYB A;  3SOY A;  4XBT A;  1ZX2 A;  1IQ8 A;  3N9H A;  4HM6 B;  2WO0 A;  1CYU A;  1K73 4;  2V1L A;  3BNB A;  3S29 A;  1CQS A;  3L0R A;  1QVG 2;  3DUK A;  3JVC A;  4JF8 A;  3I0Y A;  2CIU A;  1STF I;  5IG3 A;  3NBR A;  3EJV A;  4CDL A;  3J7Y d;  1T5Y A;  2RSX A;  1D6Z A;  4XM4 A;  1N8Q A;  5KP4 A;  1JJ2 2;  2BO9 B;  7STD A;  3LH4 A;  3CD6 3;  1KC8 4;  4HM7 B;  3N54 B;  1W6Y A;  1IVX A;  2L4V A;  3FG3 A;  3QK9 A;  2MC8 A;  1SQW A;  2GBW B;  1WQL B;  3G4S 3;  3WOD G;  2JDI H;  1FUW A;  2WGO A;  3EQQ B;  4KFD A;  4WYK B;  3SVA A;  1NJI 4;  4MMZ B;  1VZZ A;  4IIA A;  4ZM8 A;  4XBX A;  3CCE 3;  5IG0 A;  3GZB A;  4BTW A;  3WOE B;  2QGU A;  1K8A 4;  1DMQ A;  1F8N A;  2F98 A;  2CWT A;  3KSP A;  1ROA A;  1JNQ A;  4MMX B;  4PEJ A;  3K0Z A;  1AVK A;  1YJ9 3;  3X41 A;  1UI8 A;  1DYU A;  3FGY A;  3X3X A;  3D9R A;  1IVW A;  3EN1 B;  3OWY A;  3PZW A;  4N6V 0;  5AI1 A;  4N6T A;  4L8P A;  1PU4 A;  4HM1 B;  1LVN A;  1FGT A;  3E99 A;  3VSY A;  4WWU C;  3O8Y A;  2F99 A;  1OPY A;  4MEI A;  4RNZ A;  1YHQ 3;  3FF0 A;  4FMD A;  2SBL A;  3IMA B;  3X3Y A;  1VQ4 3;  3NHX A;  2K0M A;  3FLJ A;  4HVN A;  4STD A;  3DM8 A;  2W56 B;  4MJD A;  1M90 4;  5CK6 A;  1HU9 A;  2A15 A;  5BVB A;  1IDP A;  4RBN A;  3PYJ A;  1JKG B;  2OQE C;  3S5C A;  3LML A;  3H3H A;  4R80 A;  5ELU A;  5EEO A;  1FA3 A;  1NB5 I;  5IW9 A;  1FGQ A;  3MG1 A;  1TFO A;  2P0M A;  2XF3 A;  3UJM A;  2C10 A;  1UI7 A;  3FG1 A;  1S72 3;  2FGT A;  2W6J H;  4L8O A;  1JRQ A;  1ISK A;  1VQK 3;  1W7C A;  2BT3 A;  1SPU A;  1EQK A;  2HML B;  2IMJ A;  1O7M B;  4O2H A;  1W00 A;  1EG9 B;  1OH0 A;  3CCL 3;  3BND A;  3CU3 A;  1E97 A;  4R9L A;  2XR8 B;  3LTD A;  3PGB A;  3CNM A;  3K9M C;  1TP6 A;  2OOV C;  1JB5 A;  2IUK A;  3K63 A;  2E2V A;  5FGO A;  5LC6 A;  2W9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...