1DMNA

Crystal structure of mutant enzyme y32f/y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 29
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmnA00
3MG3A 3OWUA 2F98A 2XSOB 3BB9A 4U13A 4HM6B 2F99A 5IG3A 2BNGA 2OWPA 5CLKA 1AR0A 3DM8A 3LZAA 5IENA 3EHCA 3WMDA 3B7CA 5AIFA 3B8LA 2B1XB 1E3VA 2RCDA 1E3RA 5AI1A 4XBXA 2UX0A 4STDA 1Z1SA 4R9LA 4LEHA 2RGQA 4LMIA 4HKVB 4PEJA 3G8ZA 1UUWB 4X2HA 2PZVA 1OHSA 1JB5A 1OHPA 5DREA 5AIGA 5EVHA 1E97A 3MHEA 3GZYB 4OVMA 1OGXA 3LYGA 1ULIB 3EJVA 1W02A 3MG2A 2F86B 3H3HA 1EG9B 2Z7AA 1OCVA 1NU3A 4GB5A 3NHXA 3SOYA 1OF5B 4HVNA 3JUMA 3GZXB 1NDOB 1K41A 1VZZA 3G16A 3OV4A 4WYKB 3F7SA 2XRXB 3GWRA 4XBTA 8CHOA 1GS3A 5D81A 1ASKA 2BMQB 3OXAA 4HZ9B 4R9KA 3FH1A 4HJLB 3K7CA 3HZPA 4Q53A 1OGZA 1SJWA 3FF2A 1OHOA 1GY7A 2YFLB 1BUQA 4XDWA 2HMNB 5AEWB 2YFIB 3FZWA 1GY5A 1OF5A 1ZO2A 5IEOA 4WYKA 4XB5A 5D82A 3EX9A 4FCJA 5KP4A 1W6YA 1O7HB 3GZBA 2GEXA 5KP1A 2QGUA 1S5AA 4H3UA 1O7GB 2GBXB 3GZRA 3VSYA 4XBYA 2JQ5A 3HK4A 3CU3A 3ROBA 3CNXA 3DUKA 3ECFA 1O7PB 2HMMB 3M8CA 5IERA 3STDA 1A2KA 3D9RA 4RZMA 3Q90A 3F8XA 3KE7A 2QIYA 4IIAA 5IF6A 3JUQA 3EN1B 3FGYA 1TUHA 2W2CA 1NWWA 3JUPA 3NV0B 5CK6A 3B4OA 3KZTA 2HMKB 2XSHB 3FSDA 3MYTA 3FF0A 1WQLB 2A15A 3F14A 1JN5B 4HM0B 1QMAA 2GBWB 5FW5A 4I4KA 3E99A 1ZX2A 1OUNA 4HM1B 4HM5B 2CHCA 3OWYA 1DMNA 2STDA 3A76A 3FLJA 4FCMA 7STDA 4HM4B 4J9AA 5CXOA 4L8PA 1GYBA 3NV0A 3S5CA 3DZLA 2Z77A 1ISKA 5IG0A 4XDVA 6STDA 1Q40B 3EF8A 5STDA 2I9WA 1CQSA 1JN5A 2YFJB 3MSOA 3NXJA 5AIIA 5AEUB 1OPYA 5BVBA 3G0KA 2GEYA 4HM2B 3H51A 1O7NB 3OX9A 1JB2A 1DMMA 3NUVA 2K54A 3F7XA 3F9SA 4HM3B 5HGRA 1U5OA 2BMRB 3BLZA 2R4IA 4HM7B 1DMQA 3NM2A 3T8UA 3CPOA 1Q40A 3GRDA 1JKGA 1ULJB 4R1KA 4J8TA 5JPPA 3EC9A 3EN8A 3CNMA 3JUNA 5CF2A 1QJGA 3UNLA 4N3VA 2B24B 4K1VA 3I0YA 4L7KA 4LGQA 3RGAA 4K1UA 2HMJB 3DXOA 5DRVA 1UUVB 2HMOB 4XM4A 4HZBB 3B4PA 1GY6A 4MJDA 3T8NA 5G2GA 3FKAA 5KP3A 3MG1A 3EBTA 3F40A 4CDLA 2RFRA 1TP6A 4X2OA 3DMCA 4WWUC 1W00A 1HKXA 5D83A 3EBYA 3VGNA 3ER7A 3KKGA 2IMJA 3HX8A 3SOAA 2INXA 2BMOB 3NBRA 4OUQA 1IDPA 5AIHA 1STDA 5TGNA 2HMLB 1JKGB 2Z76A 5IG5A 3JUOA 3K0ZA 4L8OA 3KSPA 1EA2A 1OH0A 1O7WB 1C7HA 3F8HA 3MKIA 3IPTA 2XR8B 3UJMA 5BXQA 3EQQB 5JPUA 4WP5A 3OWSA 2CKFB 1JB4A 1Q42A 3SEDA 5CF1A 4KVHA 5IG4A 4ORLA 5IEPA 4HM8B 1O7MB 1W01A 3RGRA 2GXFA
chains in the Genus database with same CATH superfamily
4WYKB 1Q864 3MG3A 3EE1A 3OWUA 1GMPA 1RN1A 4I5QA 3DH2A 1VQN3 1V57A 2F98A 3DGLA 8RNTA 2XSOB 3BB9A 4U13A 1A2PA 2KAAA 4FMAA 2F5MA 4O3VA 3X3XA 1X1YA 1W2B2 1FW7A 1G0TA 2PNCA 2OCTA 4HM6B 1PU4A 3WODG 4LSOA 6GSPA 2Y73A 2F99A 2KF3A 5IG3A 1HU9A 1LOYA 1YGEA 3LMLA 4AKYA 2BNGA 5M1AA 2OWPA 3D5IA 3CCR3 1UGHI 5CLKA 2IYJA 1BRJA 1AR0A 1JRQA 2BU4A 2IA7A 1AV4A 3DGMA 3DM8A 3EHCA 3LZAA 5EQLA 5IENA 2RSXA 3WMDA 3B7CA 1N9EA 2XGLA 1RGGA 1LVNA 5AIFA 4J5GA 2E2VA 2B1XB 1E3VA 1I3IA 3B8LA 3UL5A 3G4S3 2RCDA 1E3RA 5LC6A 4O2HA 5AI1A 4XBXA 1BAOA 2UX0A 4EXRA 4STDA 1Z1SA 4R9LA 4LEHA 1QVG2 1BVIA 1MWUA 2RGQA 1YVBI 4LMIA 2V1LA 4HKVB 4PEJA 2OTL3 2OOVC 7RNTA 3G8ZA 1UUWB 2KF4A 4X2HA 2PZVA 2XFTA 3ZG5A 3Q2PA 1B3SA 1IVXA 1OHSA 1LQMB 4N6TA 4N6LA 2W6JH 1JB5A 1W2ZA 1Y4KA 1JV2B 3D5GA 4BU4A 1OHPA 5DREA 1BSAA 5AIGA 2UGIA 5EVHA 1VQM3 2QEX3 1ROVA 1RRHA 1E97A 2H0GA 2L4VA 1WMPA 3GZYB 3MHEA 2AAEA 3CC73 1K734 3FCSB 1LOWA 4OVMA 4EW5A 1DYUA 1MWRA 3CC23 3RNTA 3N54B 4EYCA 1OGXA 1YJN3 1N5HA 1B2SA 1VQK3 3LYGA 4BTWA 2CWVA 3DGNA 1ULIB 4JF8A 4NREA 2C10A 2CFWA 3EJVA 3SLUA 1CEWI 1W02A 3WHOA 3MG2A 4N6UA 2F86B 4GSPA 3SXXA 3H3HA 1SPUA 3LT8A 1EG9B 2Z7AA 2MC8A 1UUGB 2WOFA 1T2HA 1OCVA 4ZM8A 3SX1A 3UB1A 1NU3A 2KXGA 4GB5A 1A90A 4G1MB 3NHXA 2BT3A 3SOYA 3I563 1ZS7A 1OF5B 4HVNA 3CCL3 1R4CA 3A5EA 3JUMA 3ALAA 1IV7A 1D6YA 3GZXB 1BRKA 1BNGA 1K41A 1NDOB 1RMSA 1VZZA 3G16A 3OV4A 3F7SA 4J5KA 3BIRA 4RNYA 2XRXB 3GWRA 1EKMA 1M1K4 1M9GA 1UDII 4XBTA 8CHOA 2J8XB 1GS3A 3PCSA 3LT9A 5D81A 2E2TA 3NQYA 1AY7A 1BRGA 1ASKA 2BMQB 2OQEC 3OXAA 3X3ZA 1VQQA 4HZ9B 1RTUA 1LOVA 4R9KA 3S27A 1AQZA 3FH1A 2KCDA 1BRIA 4HJLB 2GSPA 3HI7A 2OOVA 4EV2A 3K7CA 1L5GB 1VQ83 1YJW3 3HZPA 1X1WA 1PFPA 1GOVA 3AGOA 1MOLA 1OGZA 2RNTA 4Q53A 3X40A 1SJWA 3FF2A 2QA43 1R4YA 2CG0A 5ELUA 3V92A 3LH4A 1NB3I 1UI8A 4N6V0 3JVCA 2W03A 1OHOA 1D6ZA 2Z6BA 1JZOA 1MWSA 1GY7A 1NO3A 3IJEB 3PXMA 5RNTA 2YFLB 1BUQA 3NM7A 4XDWA 2HMNB 5AEWB 1F8NA 1Q9EA 2YFIB 3FZWA 1GD4A 1GY5A 1OF5A 4AKZA 1ZO2A 2UUGC 3NBJA 2W9QA 3BNDA 1LXEA 1BNIA 5IEOA 3LXUX 4MMYB 1FUSA 2O9UX 3RDEA 4WYKA 1YNVX 4BTYA 4BTXA 4XB5A 6RNTA 3CXC2 1RGKA 1VQO3 1STFI 5D82A 3EX9A 4OK0A 2F56A 1YHQ3 1KC84 3K63A 1YI23 1CYUA 3KIIA 4FCJA 1W5ZA 1FGTA 3V98A 1W6YA 3LOYA 1ZGXA 5KP4A 3CCU3 1IT8A 2KF5A 1RN7A 4ILFA 1TFKA 4KFEA 1O7HB 4RNTA 1W7CA 3KCHA 3GZBA 3Q1CA 2GEXA 1RNBA 5KP1A 3K5TA 3I553 3ZG0A 5JBSA 1BSDA 1QVF2 1RCLA 2QGUA 1BNEA 1S5AA 1IVUA 2ML5A 2C4BA 4O02B 4H3UA 1O7GB 1I0VA 9RNTA 2GBXB 2OQEA 1PYLA 3GZRA 4BL2A 1UGIA 3VSYA 4XBYA 2IUKA 2JQ5A 2P0XA 1W4NA 1KQS2 2CW9A 1RHLA 1U8CB 3HK4A 1T2IA 2CX0A 4WHAA 1BSBA 1Q824 3CU3A 3ROBA 2WGOA 3BNEA 5M18A 2OTJ3 3CNXA 3LTCA 3DUKA 2CFLA 2M7OA 2P0MA 3ECFA 2FXTA 1BOXA 1FZUA 1O7PB 2HMMB 4HOHA 1TTOA 1X1XA 3M8CA 1RGHA 2Y74A 5IERA 4N6OB 1BSEA 3KFQC 3STDA 1PY3A 1A2KA 3CPW2 3G713 3D9RA 4RZMA 4FMDA 1HYFA 1QAFA 2R41A 2GU3A 3PYJA 4TX4A 1LOXA 3S67A 3Q90A 3F8XA 4MEIA 1CH0A 1UI7A 1YGWA 1EQKA 1N8R4 3KE7A 2QIYA 4IIAA 1B2MA 4H61A 1UCKA 5IF6A 2E2UA 1B2ZA 3GSPA 3JUQA 1GSPA 1IK3A 3EN1B 3FGYA 4R4KA 1TUHA 1UCIA 2P05A 2W2CA 2XH9A 4RBNA 1NWWA 2CH9A 3JUPA 3NV0B 2KRTA 5CK6A 1YIT3 1VQ53 3B4OA 1W6CA 3KZTA 3NQZA 3PGBA 2HMKB 2XSHB 1GMRA 3FSDA 2F5WA 1TRPA 3MYTA 1QAKA 3FF0A 3LTDA 1WQLB 3NX0A 1WTHA 4MMXB 2A15A 1IYYA 3AMOA 3F14A 1X1UA 1JN5B 2SARA 3ZFZA 4HM0B 1QMAA 1WNHA 3DGYA 1I2GA 2ZDJA 1FUTA 3PCRA 2FGTA 2H0IA 2GBWB 2AADA 3PS8A 4KFFA 5FW5A 1VQ63 4BIRA 4I4KA 3MWZA 2XFSA 3CD63 1IT7A 4LZIA 3X3YA 3OW22 1BSCA 3E99A 1ZX2A 3D4AA 2HOHA 1OUNA 1K28A 1RN4A 1RGEA 1RJOA 4HM1B 4N6MA 4HM5B 2CHCA 3OWYA 1N8QA 2WO0A 3KSED 1DMNA 1I8VA 2LQVA 2CC3A 3K9MC 2STDA 1IQYA 4CPKA 3A76A 1LNHA 3FLJA 4FCMA 2JDIH 7STDA 1RGCA 4HM4B 4J9AA 5CXOA 1BIRA 4L8PA 1GYBA 2XEPA 3NV0A 3S5CA 7GSPA 3DZLA 1FYSA 3WOEB 3GAXA 1YJ93 1IQ8A 2Z77A 1ISKA 1TIJA 5IG0A 4XDVA 4KZ1A 3WOFB 1B2UA 6STDA 3G6E3 1BNRA 3Q3FA 1US1A 3NBBA 1Q40B 4WFOA 2P38A 2W9PA 4HAAA 1KD14 2C11A 2BO9B 3FG1A 2CIUA 3EF8A 1GD3A 2D42A 1GMQA 2I9WA 1CQSA 1JN5A 3L0RA 5STDA 2YFJB 3MSOA 3LTBA 3NXJA 5AIIA 5AEUB 5I97A 1VQ43 2WGQA 1OPYA 4EC6A 1G96A 1KSIA 3G0KA 5BVBA 1JBTA 1IV9A 1NB5I 2GEYA 4HM2B 1I3FA 3H51A 1FGMA 1DVCA 1O7NB 1BRHA 3OX9A 2CWTA 5G1KA 1JB2A 1SARA 1WMOA 1DMMA 3NUVA 2K54A 5G1LA 3F7XA 2YX9A 1BNJA 3F9SA 4HM3B 5BIRA 1DETA 5HGRA 1VQP3 4HYZA 3O8YA 4GHOA 2W0QA 1U5OA 2BMRB 3FG3A 3WDGB 3BLZA 2R4IA 3SYUA 4HM7B 3UL6A 4DKIA 1V74A 3VF1A 3FG4A 1FGQA 1DMQA 3D3LA 1IVVA 3U1WA 1C54A 2CFDA 3NM2A 3S28A 4BL3A 1JZDA 3CCS3 1Q7Y4 3N8BA 3T8UA 4IT7A 3CCE3 3CPOA 1GOYA 1Q40A 2ZL8A 1JKGA 3GRDA 3EB8A 1ULJB 5ELJA 4R1KA 1KWIA 4J8TA 3HOHA 3AMOB 3IMAB 1B2XA 5JPPA 2CK3H 1D6UA 3EC9A 1FA3A 1YIJ3 1JJ22 5IW9A 5A0OB 2CG1A 3EN8A 3QRDA 1B20A 2RBIA 3CNMA 1I70A 4LYLB 4JRFA 3JUNA 5CF2A 2CX1A 3URPA 1TRQA 4FMBA 1QJGA 3AGNA 3UNLA 1MWTA 4K90B 4N3VA 4N6NB 3DY5A 5HOHA 4CJNA 2B24B 4K1VA 3S29A 5BU4A 1RDSA 3I0YA 3D79A 4L7KA 4LGQA 5M19A 4KT3B 2W56B 4O8SA 4HBRA 3BNCA 1SQWA 3RGAA 4K1UA 2HMJB 1MGRA 3DXOA 5LC7A 1G02A 5DRVA 1VQ93 1UUVB 1BNSA 2HMOB 4KFDA 1AVLA 1SIHA 3WA3A 2SBLA 4XM4A 2L1SA 2XGNA 2GU1A 3B4PA 3DGOA 4HZBB 1N9JA 5EEOA 1V58A 1GY6A 1CYVA 1RSNA 1AVKA 4NPBA 2D1WA 4MJDA 1J2BA 3T8NA 1NNVA 1VQL3 1QALA 5G2GA 1I0XA 1VQ73 3HIGA 1EEJA 3U97A 3V99A 1UW1A 1DVDA 3FKAA 5KP3A 1RRLA 3J7Yd 1MGWA 1GOUA 3X42A 2ML6A 3MG1A 1IVWA 1M1XB 1LQGC 3EBTA 3F40A 1I2FA 4CDLA 1NJI4 2RFRA 4NHFA 3T0UA 1UCJA 1B21A 5GSPA 1TP6A 4X2OA 2KF6A 4FCZA 2IUJA 5FGOA 1S723 3CMA3 3DMCA 1OACA 2O3OA 1T3BA 4WWUC 1RGLA 4RNZA 1Q814 2P09A 1W00A 3X41A 1HKXA 2ZA4A 2W56A 1FUWA 5D83A 3EBYA 1DE3A 3WA2X 3VGNA 1IU7A 3BNBA 1RLSA 3ER7A 3CCQ3 1RKYA 1BU4A 1BGSA 3KKGA 2IMJA 1BRSA 3HX8A 5AYSC 3QK9A 3SOAA 3WR2A 4EBGA 4EV5A 1BRNL 3SVAA 2INXA 1M904 3HIIA 2F4YA 1I2EA 4GL6A 2BMOB 3AHSA 3NBRA 4OUQA 2K0MA 5AYRB 1IDPA 4CCVA 3BU4A 1UCLA 5AIHA 1STDA 5TGNA 4K61A 1MNLA 4MMZB 2FNQA 1TFOA 1FGRA 1JKGB 2HMLB 2Z76A 1LRAA 2CFKA 3TDGA 5IG5A 3JUOA 3K0ZA 3LTAA 1K9M4 4L8OA 3CME3 1JNQA 3CCM3 1RGFA 1B27A 1BNFA 3KSPA 1FGOA 1T5YA 3PZWA 1JBRA 1EA2A 3AHWA 1A2VA 2H0HA 1EUIC 2K3DA 1RNTA 2CFGA 1BUJA 3CCJ3 1LNIA 1OH0A 1O7WB 2MF7A 1C7HA 3F8HA 3MKIA 1SIIA 3MPHA 3IPTA 3CC43 1TU5A 2CWUA 2WOHA 2BHMA 2XR8B 1BANA 3UJMA 4IPBA 1ROAA 4FMCA 5BXQA 4AEQA 3EQQB 1Q7HA 3KN4A 5JPUA 4FR9A 1A67A 4WP5A 2W04A 2LYXA 3OWSA 1JBSA 2CKFB 2IY2A 1JB4A 1RGAA 1K8A4 1N5PA 1IQXA 1Q42A 4R80A 3N9HA 3SEDA 1YVSA 4QWTA 5CF1A 4KVHA 5IG4A 2XF3A 4ORLA 2BIRA 5IEPA 4HM8B 1O7MB 1W01A 1WMNA 1HZ1A 2ZHXB 1RCKA 2Q07A 3CCV3 3RGRA 2GXFA 1TJDA 1W6GA
chains in the Genus database with same CATH topology
1Q864 3MG3A 3EE1A 3OWUA 1VQN3 2F98A 3DGLA 2XSOB 3BB9A 4U13A 3X3XA 4FMAA 4O3VA 1W2B2 2PNCA 2OCTA 4HM6B 3WODG 4LSOA 2Y73A 2F99A 5IG3A 1HU9A 1YGEA 3LMLA 4AKYA 2BNGA 2OWPA 3CCR3 5CLKA 1AR0A 1JRQA 2IA7A 3DGMA 1AV4A 3DM8A 3LZAA 3EHCA 5EQLA 5IENA 2RSXA 3WMDA 3B7CA 1N9EA 2XGLA 1LVNA 5AIFA 2E2VA 2B1XB 1E3VA 3B8LA 3UL5A 3G4S3 2RCDA 1E3RA 5LC6A 4O2HA 5AI1A 4XBXA 2UX0A 4EXRA 4STDA 1Z1SA 4R9LA 4LEHA 1QVG2 2RGQA 1YVBI 4LMIA 2V1LA 4HKVB 4PEJA 2OTL3 2OOVC 3G8ZA 1UUWB 4X2HA 2PZVA 2XFTA 3Q2PA 1IVXA 1OHSA 4N6TA 4N6LA 2W6JH 1JB5A 1W2ZA 1Y4KA 1JV2B 1OHPA 5DREA 5AIGA 5EVHA 1VQM3 2QEX3 1ROVA 1RRHA 1E97A 2L4VA 3MHEA 1WMPA 3GZYB 3CC73 1K734 3FCSB 4OVMA 3CC23 1DYUA 4EYCA 3N54B 1OGXA 1YJN3 1N5HA 1VQK3 3LYGA 4BTWA 2CWVA 3DGNA 1ULIB 4JF8A 4NREA 2C10A 2CFWA 3EJVA 3SLUA 1CEWI 1W02A 3MG2A 4N6UA 2F86B 3SXXA 3H3HA 1SPUA 3LT8A 1EG9B 2Z7AA 2MC8A 2WOFA 1OCVA 4ZM8A 3SX1A 3UB1A 1NU3A 2KXGA 4GB5A 1A90A 4G1MB 3NHXA 2BT3A 3SOYA 3I563 1OF5B 4HVNA 3CCL3 1R4CA 3JUMA 3ALAA 1IV7A 1D6YA 3GZXB 1NDOB 1K41A 1VZZA 3G16A 3OV4A 4WYKB 3V99A 3F7SA 4RNYA 1M1K4 2XRXB 3GWRA 1EKMA 1M9GA 4XBTA 8CHOA 1GS3A 3PCSA 3LT9A 5D81A 2E2TA 3NQYA 1ASKA 2BMQB 2OQEC 3OXAA 3X3ZA 4HZ9B 3S27A 4R9KA 3FH1A 2KCDA 4HJLB 3HI7A 2OOVA 4EV2A 3K7CA 1L5GB 1VQ83 1YJW3 3HZPA 1PFPA 3X40A 1MOLA 1OGZA 4Q53A 1SJWA 3FF2A 2QA43 3V92A 2CG0A 5ELUA 3LH4A 1NB3I 1UI8A 4N6V0 3JVCA 2W03A 1OHOA 1D6ZA 2Z6BA 1GY7A 1NO3A 3IJEB 3PXMA 2YFLB 1BUQA 3NM7A 4XDWA 2HMNB 5AEWB 1F8NA 2YFIB 3FZWA 4AKZA 1GD4A 1GY5A 1OF5A 1ZO2A 3NBJA 2W9QA 3BNDA 1LXEA 5IEOA 3LXUX 4MMYB 2O9UX 3RDEA 4WYKA 4BTYA 4BTXA 4XB5A 3CXC2 1VQO3 1STFI 5D82A 3EX9A 4OK0A 1KC84 1YHQ3 3K63A 1YI23 1CYUA 3KIIA 4FCJA 1W5ZA 1FGTA 3V98A 1W6YA 3LOYA 5KP4A 3CCU3 1IT8A 1RN7A 1TFKA 4KFEA 1O7HB 1W7CA 3Q1CA 3GZBA 2GEXA 5KP1A 3K5TA 3I553 5JBSA 1QVF2 2QGUA 1S5AA 1IVUA 2ML5A 4O02B 4H3UA 1O7GB 2GBXB 2OQEA 3GZRA 3VSYA 4XBYA 2IUKA 2JQ5A 2P0XA 1W4NA 1KQS2 2CW9A 1U8CB 3HK4A 4WHAA 1Q824 3CU3A 3ROBA 2WGOA 3BNEA 2OTJ3 3CNXA 3LTCA 3DUKA 2CFLA 2M7OA 2P0MA 3ECFA 2FXTA 1O7PB 2HMMB 3M8CA 2Y74A 5IERA 4N6OB 3STDA 3KFQC 1A2KA 3CPW2 3G713 3D9RA 4RZMA 4FMDA 1QAFA 2GU3A 3PYJA 4TX4A 1LOXA 3S67A 3Q90A 3F8XA 4MEIA 1UI7A 1EQKA 1N8R4 3KE7A 2QIYA 4IIAA 4H61A 5IF6A 2E2UA 3JUQA 1IK3A 3EN1B 3FGYA 4R4KA 1TUHA 2P05A 2W2CA 4RBNA 2XH9A 1NWWA 2CH9A 3JUPA 3NV0B 2KRTA 5CK6A 1YIT3 1VQ53 3B4OA 1W6CA 3KZTA 3NQZA 3PGBA 2HMKB 2XSHB 3FSDA 3MYTA 1QAKA 3FF0A 3LTDA 1WQLB 3NX0A 1WTHA 4MMXB 2A15A 3AMOA 3F14A 1JN5B 4HM0B 1QMAA 1WNHA 2ZDJA 3PCRA 2FGTA 2GBWB 3PS8A 4KFFA 5FW5A 1VQ63 4I4KA 3MWZA 2XFSA 3CD63 1IT7A 4LZIA 3X3YA 3OW22 3E99A 1ZX2A 1OUNA 1K28A 1RJOA 4HM1B 4N6MA 4HM5B 2CHCA 3OWYA 1N8QA 2WO0A 3KSED 1DMNA 2LQVA 2CC3A 3K9MC 2STDA 1IQYA 3A76A 1LNHA 3FLJA 4FCMA 2JDIH 7STDA 4HM4B 4J9AA 5CXOA 4L8PA 1GYBA 2XEPA 3NV0A 3S5CA 3DZLA 3WOEB 3GAXA 1YJ93 1IQ8A 2Z77A 1ISKA 1TIJA 5IG0A 4XDVA 4KZ1A 3WOFB 6STDA 3G6E3 1US1A 3NBBA 1Q40B 4WFOA 2P38A 2W9PA 1KD14 2C11A 2BO9B 3FG1A 2CIUA 3EF8A 1GD3A 2D42A 3L0RA 2I9WA 1CQSA 1JN5A 5STDA 2YFJB 3MSOA 3LTBA 3NXJA 5AIIA 5AEUB 5I97A 1VQ43 2WGQA 1OPYA 4EC6A 1G96A 1KSIA 3G0KA 5BVBA 1NB5I 1IV9A 2GEYA 4HM2B 3H51A 1FGMA 1DVCA 1O7NB 3OX9A 2CWTA 1JB2A 1WMOA 1DMMA 3NUVA 2K54A 3F7XA 2YX9A 3F9SA 4HM3B 5HGRA 1VQP3 4HYZA 3O8YA 2W0QA 1U5OA 2BMRB 3FG3A 3WDGB 3BLZA 2R4IA 4HM7B 3UL6A 1V74A 3VF1A 3FG4A 1FGQA 1DMQA 3D3LA 1IVVA 3U1WA 2CFDA 3NM2A 3S28A 3CCS3 1Q7Y4 3N8BA 3T8UA 4IT7A 3CCE3 3CPOA 1Q40A 2ZL8A 3GRDA 1JKGA 3EB8A 1ULJB 5ELJA 4R1KA 1KWIA 4J8TA 3AMOB 3IMAB 5JPPA 2CK3H 1D6UA 3EC9A 1FA3A 1YIJ3 1JJ22 5IW9A 5A0OB 2CG1A 3EN8A 3QRDA 3CNMA 4JRFA 3JUNA 5CF2A 4FMBA 1QJGA 3UNLA 4K90B 4N3VA 4N6NB 3DY5A 2B24B 4K1VA 3S29A 3I0YA 4L7KA 4LGQA 2W56B 4O8SA 4HBRA 3BNCA 1SQWA 3RGAA 4K1UA 2HMJB 3DXOA 5LC7A 5DRVA 1VQ93 1UUVB 2HMOB 4KFDA 3WA3A 1AVLA 1SIHA 2SBLA 4XM4A 2XGNA 2GU1A 3B4PA 3DGOA 4HZBB 1N9JA 5EEOA 1GY6A 1CYVA 1AVKA 1J2BA 2D1WA 4MJDA 3T8NA 1VQL3 1QALA 5G2GA 1VQ73 1DVDA 3HIGA 3U97A 1UW1A 3FKAA 5KP3A 1RRLA 3J7Yd 3X42A 2ML6A 3MG1A 1IVWA 1M1XB 3EBTA 3F40A 4CDLA 1NJI4 2RFRA 4NHFA 3T0UA 1TP6A 4X2OA 1S723 4FCZA 2IUJA 5FGOA 3CMA3 3DMCA 1OACA 2O3OA 4WWUC 4RNZA 1Q814 2P09A 1W00A 3X41A 1HKXA 2W56A 1FUWA 5D83A 3EBYA 3WA2X 3VGNA 1IU7A 3BNBA 3ER7A 3CCQ3 1RKYA 5AYSC 3KKGA 2IMJA 4EBGA 3HX8A 4EV5A 3QK9A 3SOAA 1PU4A 3SVAA 2INXA 3HIIA 4GL6A 2BMOB 3NBRA 4OUQA 2K0MA 5AYRB 1IDPA 4CCVA 5AIHA 1STDA 5TGNA 4K61A 1MNLA 4MMZB 2FNQA 1TFOA 1FGRA 1JKGB 2HMLB 2Z76A 2CFKA 3TDGA 5IG5A 1M904 3JUOA 3K0ZA 3LTAA 1K9M4 4L8OA 3CME3 1JNQA 3CCM3 3KSPA 3PZWA 1FGOA 1T5YA 1EA2A 1A2VA 2CFGA 3CCJ3 1OH0A 1O7WB 2MF7A 1C7HA 3F8HA 3MKIA 1SIIA 3MPHA 3IPTA 3CC43 1TU5A 2CWUA 2WOHA 2BHMA 2XR8B 3UJMA 4IPBA 1ROAA 4FMCA 5BXQA 4AEQA 3EQQB 3KN4A 5JPUA 4FR9A 1A67A 4WP5A 2W04A 2LYXA 3OWSA 2CKFB 1JB4A 1K8A4 1N5PA 1IQXA 1Q42A 4R80A 3N9HA 3SEDA 4QWTA 5CF1A 4KVHA 5IG4A 2XF3A 4ORLA 5IEPA 4HM8B 1O7MB 1W01A 1WMNA 2Q07A 3CCV3 3RGRA 2GXFA 1W6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MG3 A;  3OWU A;  2F98 A;  2XSO B;  3BB9 A;  4U13 A;  4HM6 B;  2F99 A;  5IG3 A;  2BNG A;  2OWP A;  5CLK A;  1AR0 A;  3DM8 A;  3LZA A;  5IEN A;  3EHC A;  3WMD A;  3B7C A;  5AIF A;  3B8L A;  2B1X B;  1E3V A;  2RCD A;  1E3R A;  5AI1 A;  4XBX A;  2UX0 A;  4STD A;  1Z1S A;  4R9L A;  4LEH A;  2RGQ A;  4LMI A;  4HKV B;  4PEJ A;  3G8Z A;  1UUW B;  4X2H A;  2PZV A;  1OHS A;  1JB5 A;  1OHP A;  5DRE A;  5AIG A;  5EVH A;  1E97 A;  3MHE A;  3GZY B;  4OVM A;  1OGX A;  3LYG A;  1ULI B;  3EJV A;  1W02 A;  3MG2 A;  2F86 B;  3H3H A;  1EG9 B;  2Z7A A;  1OCV A;  1NU3 A;  4GB5 A;  3NHX A;  3SOY A;  1OF5 B;  4HVN A;  3JUM A;  3GZX B;  1NDO B;  1K41 A;  1VZZ A;  3G16 A;  3OV4 A;  4WYK B;  3F7S A;  2XRX B;  3GWR A;  4XBT A;  8CHO A;  1GS3 A;  5D81 A;  1ASK A;  2BMQ B;  3OXA A;  4HZ9 B;  4R9K A;  3FH1 A;  4HJL B;  3K7C A;  3HZP A;  4Q53 A;  1OGZ A;  1SJW A;  3FF2 A;  1OHO A;  1GY7 A;  2YFL B;  1BUQ A;  4XDW A;  2HMN B;  5AEW B;  2YFI B;  3FZW A;  1GY5 A;  1OF5 A;  1ZO2 A;  5IEO A;  4WYK A;  4XB5 A;  5D82 A;  3EX9 A;  4FCJ A;  5KP4 A;  1W6Y A;  1O7H B;  3GZB A;  2GEX A;  5KP1 A;  2QGU A;  1S5A A;  4H3U A;  1O7G B;  2GBX B;  3GZR A;  3VSY A;  4XBY A;  2JQ5 A;  3HK4 A;  3CU3 A;  3ROB A;  3CNX A;  3DUK A;  3ECF A;  1O7P B;  2HMM B;  3M8C A;  5IER A;  3STD A;  1A2K A;  3D9R A;  4RZM A;  3Q90 A;  3F8X A;  3KE7 A;  2QIY A;  4IIA A;  5IF6 A;  3JUQ A;  3EN1 B;  3FGY A;  1TUH A;  2W2C A;  1NWW A;  3JUP A;  3NV0 B;  5CK6 A;  3B4O A;  3KZT A;  2HMK B;  2XSH B;  3FSD A;  3MYT A;  3FF0 A;  1WQL B;  2A15 A;  3F14 A;  1JN5 B;  4HM0 B;  1QMA A;  2GBW B;  5FW5 A;  4I4K A;  3E99 A;  1ZX2 A;  1OUN A;  4HM1 B;  4HM5 B;  2CHC A;  3OWY A;  1DMN A;  2STD A;  3A76 A;  3FLJ A;  4FCM A;  7STD A;  4HM4 B;  4J9A A;  5CXO A;  4L8P A;  1GYB A;  3NV0 A;  3S5C A;  3DZL A;  2Z77 A;  1ISK A;  5IG0 A;  4XDV A;  6STD A;  1Q40 B;  3EF8 A;  5STD A;  2I9W A;  1CQS A;  1JN5 A;  2YFJ B;  3MSO A;  3NXJ A;  5AII A;  5AEU B;  1OPY A;  5BVB A;  3G0K A;  2GEY A;  4HM2 B;  3H51 A;  1O7N B;  3OX9 A;  1JB2 A;  1DMM A;  3NUV A;  2K54 A;  3F7X A;  3F9S A;  4HM3 B;  5HGR A;  1U5O A;  2BMR B;  3BLZ A;  2R4I A;  4HM7 B;  1DMQ A;  3NM2 A;  3T8U A;  3CPO A;  1Q40 A;  3GRD A;  1JKG A;  1ULJ B;  4R1K A;  4J8T A;  5JPP A;  3EC9 A;  3EN8 A;  3CNM A;  3JUN A;  5CF2 A;  1QJG A;  3UNL A;  4N3V A;  2B24 B;  4K1V A;  3I0Y A;  4L7K A;  4LGQ A;  3RGA A;  4K1U A;  2HMJ B;  3DXO A;  5DRV A;  1UUV B;  2HMO B;  4XM4 A;  4HZB B;  3B4P A;  1GY6 A;  4MJD A;  3T8N A;  5G2G A;  3FKA A;  5KP3 A;  3MG1 A;  3EBT A;  3F40 A;  4CDL A;  2RFR A;  1TP6 A;  4X2O A;  3DMC A;  4WWU C;  1W00 A;  1HKX A;  5D83 A;  3EBY A;  3VGN A;  3ER7 A;  3KKG A;  2IMJ A;  3HX8 A;  3SOA A;  2INX A;  2BMO B;  3NBR A;  4OUQ A;  1IDP A;  5AIH A;  1STD A;  5TGN A;  2HML B;  1JKG B;  2Z76 A;  5IG5 A;  3JUO A;  3K0Z A;  4L8O A;  3KSP A;  1EA2 A;  1OH0 A;  1O7W B;  1C7H A;  3F8H A;  3MKI A;  3IPT A;  2XR8 B;  3UJM A;  5BXQ A;  3EQQ B;  5JPU A;  4WP5 A;  3OWS A;  2CKF B;  1JB4 A;  1Q42 A;  3SED A;  5CF1 A;  4KVH A;  5IG4 A;  4ORL A;  5IEP A;  4HM8 B;  1O7M B;  1W01 A;  3RGR A;  2GXF A; 
#chains in the Genus database with same CATH topology
 4WYK B;  1Q86 4;  3MG3 A;  3EE1 A;  3OWU A;  1GMP A;  1RN1 A;  4I5Q A;  3DH2 A;  1VQN 3;  1V57 A;  2F98 A;  3DGL A;  8RNT A;  2XSO B;  3BB9 A;  4U13 A;  1A2P A;  2KAA A;  4FMA A;  2F5M A;  4O3V A;  3X3X A;  1X1Y A;  1W2B 2;  1FW7 A;  1G0T A;  2PNC A;  2OCT A;  4HM6 B;  1PU4 A;  3WOD G;  4LSO A;  6GSP A;  2Y73 A;  2F99 A;  2KF3 A;  5IG3 A;  1HU9 A;  1LOY A;  1YGE A;  3LML A;  4AKY A;  2BNG A;  5M1A A;  2OWP A;  3D5I A;  3CCR 3;  1UGH I;  5CLK A;  2IYJ A;  1BRJ A;  1AR0 A;  1JRQ A;  2BU4 A;  2IA7 A;  1AV4 A;  3DGM A;  3DM8 A;  3EHC A;  3LZA A;  5EQL A;  5IEN A;  2RSX A;  3WMD A;  3B7C A;  1N9E A;  2XGL A;  1RGG A;  1LVN A;  5AIF A;  4J5G A;  2E2V A;  2B1X B;  1E3V A;  1I3I A;  3B8L A;  3UL5 A;  3G4S 3;  2RCD A;  1E3R A;  5LC6 A;  4O2H A;  5AI1 A;  4XBX A;  1BAO A;  2UX0 A;  4EXR A;  4STD A;  1Z1S A;  4R9L A;  4LEH A;  1QVG 2;  1BVI A;  1MWU A;  2RGQ A;  1YVB I;  4LMI A;  2V1L A;  4HKV B;  4PEJ A;  2OTL 3;  2OOV C;  7RNT A;  3G8Z A;  1UUW B;  2KF4 A;  4X2H A;  2PZV A;  2XFT A;  3ZG5 A;  3Q2P A;  1B3S A;  1IVX A;  1OHS A;  1LQM B;  4N6T A;  4N6L A;  2W6J H;  1JB5 A;  1W2Z A;  1Y4K A;  1JV2 B;  3D5G A;  4BU4 A;  1OHP A;  5DRE A;  1BSA A;  5AIG A;  2UGI A;  5EVH A;  1VQM 3;  2QEX 3;  1ROV A;  1RRH A;  1E97 A;  2H0G A;  2L4V A;  1WMP A;  3GZY B;  3MHE A;  2AAE A;  3CC7 3;  1K73 4;  3FCS B;  1LOW A;  4OVM A;  4EW5 A;  1DYU A;  1MWR A;  3CC2 3;  3RNT A;  3N54 B;  4EYC A;  1OGX A;  1YJN 3;  1N5H A;  1B2S A;  1VQK 3;  3LYG A;  4BTW A;  2CWV A;  3DGN A;  1ULI B;  4JF8 A;  4NRE A;  2C10 A;  2CFW A;  3EJV A;  3SLU A;  1CEW I;  1W02 A;  3WHO A;  3MG2 A;  4N6U A;  2F86 B;  4GSP A;  3SXX A;  3H3H A;  1SPU A;  3LT8 A;  1EG9 B;  2Z7A A;  2MC8 A;  1UUG B;  2WOF A;  1T2H A;  1OCV A;  4ZM8 A;  3SX1 A;  3UB1 A;  1NU3 A;  2KXG A;  4GB5 A;  1A90 A;  4G1M B;  3NHX A;  2BT3 A;  3SOY A;  3I56 3;  1ZS7 A;  1OF5 B;  4HVN A;  3CCL 3;  1R4C A;  3A5E A;  3JUM A;  3ALA A;  1IV7 A;  1D6Y A;  3GZX B;  1BRK A;  1BNG A;  1K41 A;  1NDO B;  1RMS A;  1VZZ A;  3G16 A;  3OV4 A;  3F7S A;  4J5K A;  3BIR A;  4RNY A;  2XRX B;  3GWR A;  1EKM A;  1M1K 4;  1M9G A;  1UDI I;  4XBT A;  8CHO A;  2J8X B;  1GS3 A;  3PCS A;  3LT9 A;  5D81 A;  2E2T A;  3NQY A;  1AY7 A;  1BRG A;  1ASK A;  2BMQ B;  2OQE C;  3OXA A;  3X3Z A;  1VQQ A;  4HZ9 B;  1RTU A;  1LOV A;  4R9K A;  3S27 A;  1AQZ A;  3FH1 A;  2KCD A;  1BRI A;  4HJL B;  2GSP A;  3HI7 A;  2OOV A;  4EV2 A;  3K7C A;  1L5G B;  1VQ8 3;  1YJW 3;  3HZP A;  1X1W A;  1PFP A;  1GOV A;  3AGO A;  1MOL A;  1OGZ A;  2RNT A;  4Q53 A;  3X40 A;  1SJW A;  3FF2 A;  2QA4 3;  1R4Y A;  2CG0 A;  5ELU A;  3V92 A;  3LH4 A;  1NB3 I;  1UI8 A;  4N6V 0;  3JVC A;  2W03 A;  1OHO A;  1D6Z A;  2Z6B A;  1JZO A;  1MWS A;  1GY7 A;  1NO3 A;  3IJE B;  3PXM A;  5RNT A;  2YFL B;  1BUQ A;  3NM7 A;  4XDW A;  2HMN B;  5AEW B;  1F8N A;  1Q9E A;  2YFI B;  3FZW A;  1GD4 A;  1GY5 A;  1OF5 A;  4AKZ A;  1ZO2 A;  2UUG C;  3NBJ A;  2W9Q A;  3BND A;  1LXE A;  1BNI A;  5IEO A;  3LXU X;  4MMY B;  1FUS A;  2O9U X;  3RDE A;  4WYK A;  1YNV X;  4BTY A;  4BTX A;  4XB5 A;  6RNT A;  3CXC 2;  1RGK A;  1VQO 3;  1STF I;  5D82 A;  3EX9 A;  4OK0 A;  2F56 A;  1YHQ 3;  1KC8 4;  3K63 A;  1YI2 3;  1CYU A;  3KII A;  4FCJ A;  1W5Z A;  1FGT A;  3V98 A;  1W6Y A;  3LOY A;  1ZGX A;  5KP4 A;  3CCU 3;  1IT8 A;  2KF5 A;  1RN7 A;  4ILF A;  1TFK A;  4KFE A;  1O7H B;  4RNT A;  1W7C A;  3KCH A;  3GZB A;  3Q1C A;  2GEX A;  1RNB A;  5KP1 A;  3K5T A;  3I55 3;  3ZG0 A;  5JBS A;  1BSD A;  1QVF 2;  1RCL A;  2QGU A;  1BNE A;  1S5A A;  1IVU A;  2ML5 A;  2C4B A;  4O02 B;  4H3U A;  1O7G B;  1I0V A;  9RNT A;  2GBX B;  2OQE A;  1PYL A;  3GZR A;  4BL2 A;  1UGI A;  3VSY A;  4XBY A;  2IUK A;  2JQ5 A;  2P0X A;  1W4N A;  1KQS 2;  2CW9 A;  1RHL A;  1U8C B;  3HK4 A;  1T2I A;  2CX0 A;  4WHA A;  1BSB A;  1Q82 4;  3CU3 A;  3ROB A;  2WGO A;  3BNE A;  5M18 A;  2OTJ 3;  3CNX A;  3LTC A;  3DUK A;  2CFL A;  2M7O A;  2P0M A;  3ECF A;  2FXT A;  1BOX A;  1FZU A;  1O7P B;  2HMM B;  4HOH A;  1TTO A;  1X1X A;  3M8C A;  1RGH A;  2Y74 A;  5IER A;  4N6O B;  1BSE A;  3KFQ C;  3STD A;  1PY3 A;  1A2K A;  3CPW 2;  3G71 3;  3D9R A;  4RZM A;  4FMD A;  1HYF A;  1QAF A;  2R41 A;  2GU3 A;  3PYJ A;  4TX4 A;  1LOX A;  3S67 A;  3Q90 A;  3F8X A;  4MEI A;  1CH0 A;  1UI7 A;  1YGW A;  1EQK A;  1N8R 4;  3KE7 A;  2QIY A;  4IIA A;  1B2M A;  4H61 A;  1UCK A;  5IF6 A;  2E2U A;  1B2Z A;  3GSP A;  3JUQ A;  1GSP A;  1IK3 A;  3EN1 B;  3FGY A;  4R4K A;  1TUH A;  1UCI A;  2P05 A;  2W2C A;  2XH9 A;  4RBN A;  1NWW A;  2CH9 A;  3JUP A;  3NV0 B;  2KRT A;  5CK6 A;  1YIT 3;  1VQ5 3;  3B4O A;  1W6C A;  3KZT A;  3NQZ A;  3PGB A;  2HMK B;  2XSH B;  1GMR A;  3FSD A;  2F5W A;  1TRP A;  3MYT A;  1QAK A;  3FF0 A;  3LTD A;  1WQL B;  3NX0 A;  1WTH A;  4MMX B;  2A15 A;  1IYY A;  3AMO A;  3F14 A;  1X1U A;  1JN5 B;  2SAR A;  3ZFZ A;  4HM0 B;  1QMA A;  1WNH A;  3DGY A;  1I2G A;  2ZDJ A;  1FUT A;  3PCR A;  2FGT A;  2H0I A;  2GBW B;  2AAD A;  3PS8 A;  4KFF A;  5FW5 A;  1VQ6 3;  4BIR A;  4I4K A;  3MWZ A;  2XFS A;  3CD6 3;  1IT7 A;  4LZI A;  3X3Y A;  3OW2 2;  1BSC A;  3E99 A;  1ZX2 A;  3D4A A;  2HOH A;  1OUN A;  1K28 A;  1RN4 A;  1RGE A;  1RJO A;  4HM1 B;  4N6M A;  4HM5 B;  2CHC A;  3OWY A;  1N8Q A;  2WO0 A;  3KSE D;  1DMN A;  1I8V A;  2LQV A;  2CC3 A;  3K9M C;  2STD A;  1IQY A;  4CPK A;  3A76 A;  1LNH A;  3FLJ A;  4FCM A;  2JDI H;  7STD A;  1RGC A;  4HM4 B;  4J9A A;  5CXO A;  1BIR A;  4L8P A;  1GYB A;  2XEP A;  3NV0 A;  3S5C A;  7GSP A;  3DZL A;  1FYS A;  3WOE B;  3GAX A;  1YJ9 3;  1IQ8 A;  2Z77 A;  1ISK A;  1TIJ A;  5IG0 A;  4XDV A;  4KZ1 A;  3WOF B;  1B2U A;  6STD A;  3G6E 3;  1BNR A;  3Q3F A;  1US1 A;  3NBB A;  1Q40 B;  4WFO A;  2P38 A;  2W9P A;  4HAA A;  1KD1 4;  2C11 A;  2BO9 B;  3FG1 A;  2CIU A;  3EF8 A;  1GD3 A;  2D42 A;  1GMQ A;  2I9W A;  1CQS A;  1JN5 A;  3L0R A;  5STD A;  2YFJ B;  3MSO A;  3LTB A;  3NXJ A;  5AII A;  5AEU B;  5I97 A;  1VQ4 3;  2WGQ A;  1OPY A;  4EC6 A;  1G96 A;  1KSI A;  3G0K A;  5BVB A;  1JBT A;  1IV9 A;  1NB5 I;  2GEY A;  4HM2 B;  1I3F A;  3H51 A;  1FGM A;  1DVC A;  1O7N B;  1BRH A;  3OX9 A;  2CWT A;  5G1K A;  1JB2 A;  1SAR A;  1WMO A;  1DMM A;  3NUV A;  2K54 A;  5G1L A;  3F7X A;  2YX9 A;  1BNJ A;  3F9S A;  4HM3 B;  5BIR A;  1DET A;  5HGR A;  1VQP 3;  4HYZ A;  3O8Y A;  4GHO A;  2W0Q A;  1U5O A;  2BMR B;  3FG3 A;  3WDG B;  3BLZ A;  2R4I A;  3SYU A;  4HM7 B;  3UL6 A;  4DKI A;  1V74 A;  3VF1 A;  3FG4 A;  1FGQ A;  1DMQ A;  3D3L A;  1IVV A;  3U1W A;  1C54 A;  2CFD A;  3NM2 A;  3S28 A;  4BL3 A;  1JZD A;  3CCS 3;  1Q7Y 4;  3N8B A;  3T8U A;  4IT7 A;  3CCE 3;  3CPO A;  1GOY A;  1Q40 A;  2ZL8 A;  1JKG A;  3GRD A;  3EB8 A;  1ULJ B;  5ELJ A;  4R1K A;  1KWI A;  4J8T A;  3HOH A;  3AMO B;  3IMA B;  1B2X A;  5JPP A;  2CK3 H;  1D6U A;  3EC9 A;  1FA3 A;  1YIJ 3;  1JJ2 2;  5IW9 A;  5A0O B;  2CG1 A;  3EN8 A;  3QRD A;  1B20 A;  2RBI A;  3CNM A;  1I70 A;  4LYL B;  4JRF A;  3JUN A;  5CF2 A;  2CX1 A;  3URP A;  1TRQ A;  4FMB A;  1QJG A;  3AGN A;  3UNL A;  1MWT A;  4K90 B;  4N3V A;  4N6N B;  3DY5 A;  5HOH A;  4CJN A;  2B24 B;  4K1V A;  3S29 A;  5BU4 A;  1RDS A;  3I0Y A;  3D79 A;  4L7K A;  4LGQ A;  5M19 A;  4KT3 B;  2W56 B;  4O8S A;  4HBR A;  3BNC A;  1SQW A;  3RGA A;  4K1U A;  2HMJ B;  1MGR A;  3DXO A;  5LC7 A;  1G02 A;  5DRV A;  1VQ9 3;  1UUV B;  1BNS A;  2HMO B;  4KFD A;  1AVL A;  1SIH A;  3WA3 A;  2SBL A;  4XM4 A;  2L1S A;  2XGN A;  2GU1 A;  3B4P A;  3DGO A;  4HZB B;  1N9J A;  5EEO A;  1V58 A;  1GY6 A;  1CYV A;  1RSN A;  1AVK A;  4NPB A;  2D1W A;  4MJD A;  1J2B A;  3T8N A;  1NNV A;  1VQL 3;  1QAL A;  5G2G A;  1I0X A;  1VQ7 3;  3HIG A;  1EEJ A;  3U97 A;  3V99 A;  1UW1 A;  1DVD A;  3FKA A;  5KP3 A;  1RRL A;  3J7Y d;  1MGW A;  1GOU A;  3X42 A;  2ML6 A;  3MG1 A;  1IVW A;  1M1X B;  1LQG C;  3EBT A;  3F40 A;  1I2F A;  4CDL A;  1NJI 4;  2RFR A;  4NHF A;  3T0U A;  1UCJ A;  1B21 A;  5GSP A;  1TP6 A;  4X2O A;  2KF6 A;  4FCZ A;  2IUJ A;  5FGO A;  1S72 3;  3CMA 3;  3DMC A;  1OAC A;  2O3O A;  1T3B A;  4WWU C;  1RGL A;  4RNZ A;  1Q81 4;  2P09 A;  1W00 A;  3X41 A;  1HKX A;  2ZA4 A;  2W56 A;  1FUW A;  5D83 A;  3EBY A;  1DE3 A;  3WA2 X;  3VGN A;  1IU7 A;  3BNB A;  1RLS A;  3ER7 A;  3CCQ 3;  1RKY A;  1BU4 A;  1BGS A;  3KKG A;  2IMJ A;  1BRS A;  3HX8 A;  5AYS C;  3QK9 A;  3SOA A;  3WR2 A;  4EBG A;  4EV5 A;  1BRN L;  3SVA A;  2INX A;  1M90 4;  3HII A;  2F4Y A;  1I2E A;  4GL6 A;  2BMO B;  3AHS A;  3NBR A;  4OUQ A;  2K0M A;  5AYR B;  1IDP A;  4CCV A;  3BU4 A;  1UCL A;  5AIH A;  1STD A;  5TGN A;  4K61 A;  1MNL A;  4MMZ B;  2FNQ A;  1TFO A;  1FGR A;  1JKG B;  2HML B;  2Z76 A;  1LRA A;  2CFK A;  3TDG A;  5IG5 A;  3JUO A;  3K0Z A;  3LTA A;  1K9M 4;  4L8O A;  3CME 3;  1JNQ A;  3CCM 3;  1RGF A;  1B27 A;  1BNF A;  3KSP A;  1FGO A;  1T5Y A;  3PZW A;  1JBR A;  1EA2 A;  3AHW A;  1A2V A;  2H0H A;  1EUI C;  2K3D A;  1RNT A;  2CFG A;  1BUJ A;  3CCJ 3;  1LNI A;  1OH0 A;  1O7W B;  2MF7 A;  1C7H A;  3F8H A;  3MKI A;  1SII A;  3MPH A;  3IPT A;  3CC4 3;  1TU5 A;  2CWU A;  2WOH A;  2BHM A;  2XR8 B;  1BAN A;  3UJM A;  4IPB A;  1ROA A;  4FMC A;  5BXQ A;  4AEQ A;  3EQQ B;  1Q7H A;  3KN4 A;  5JPU A;  4FR9 A;  1A67 A;  4WP5 A;  2W04 A;  2LYX A;  3OWS A;  1JBS A;  2CKF B;  2IY2 A;  1JB4 A;  1RGA A;  1K8A 4;  1N5P A;  1IQX A;  1Q42 A;  4R80 A;  3N9H A;  3SED A;  1YVS A;  4QWT A;  5CF1 A;  4KVH A;  5IG4 A;  2XF3 A;  4ORL A;  2BIR A;  5IEP A;  4HM8 B;  1O7M B;  1W01 A;  1WMN A;  1HZ1 A;  2ZHX B;  1RCK A;  2Q07 A;  3CCV 3;  3RGR A;  2GXF A;  1TJD A;  1W6G A; 
#chains in the Genus database with same CATH homology
 1Q86 4;  3MG3 A;  3EE1 A;  3OWU A;  1VQN 3;  2F98 A;  3DGL A;  2XSO B;  3BB9 A;  4U13 A;  3X3X A;  4FMA A;  4O3V A;  1W2B 2;  2PNC A;  2OCT A;  4HM6 B;  3WOD G;  4LSO A;  2Y73 A;  2F99 A;  5IG3 A;  1HU9 A;  1YGE A;  3LML A;  4AKY A;  2BNG A;  2OWP A;  3CCR 3;  5CLK A;  1AR0 A;  1JRQ A;  2IA7 A;  3DGM A;  1AV4 A;  3DM8 A;  3LZA A;  3EHC A;  5EQL A;  5IEN A;  2RSX A;  3WMD A;  3B7C A;  1N9E A;  2XGL A;  1LVN A;  5AIF A;  2E2V A;  2B1X B;  1E3V A;  3B8L A;  3UL5 A;  3G4S 3;  2RCD A;  1E3R A;  5LC6 A;  4O2H A;  5AI1 A;  4XBX A;  2UX0 A;  4EXR A;  4STD A;  1Z1S A;  4R9L A;  4LEH A;  1QVG 2;  2RGQ A;  1YVB I;  4LMI A;  2V1L A;  4HKV B;  4PEJ A;  2OTL 3;  2OOV C;  3G8Z A;  1UUW B;  4X2H A;  2PZV A;  2XFT A;  3Q2P A;  1IVX A;  1OHS A;  4N6T A;  4N6L A;  2W6J H;  1JB5 A;  1W2Z A;  1Y4K A;  1JV2 B;  1OHP A;  5DRE A;  5AIG A;  5EVH A;  1VQM 3;  2QEX 3;  1ROV A;  1RRH A;  1E97 A;  2L4V A;  3MHE A;  1WMP A;  3GZY B;  3CC7 3;  1K73 4;  3FCS B;  4OVM A;  3CC2 3;  1DYU A;  4EYC A;  3N54 B;  1OGX A;  1YJN 3;  1N5H A;  1VQK 3;  3LYG A;  4BTW A;  2CWV A;  3DGN A;  1ULI B;  4JF8 A;  4NRE A;  2C10 A;  2CFW A;  3EJV A;  3SLU A;  1CEW I;  1W02 A;  3MG2 A;  4N6U A;  2F86 B;  3SXX A;  3H3H A;  1SPU A;  3LT8 A;  1EG9 B;  2Z7A A;  2MC8 A;  2WOF A;  1OCV A;  4ZM8 A;  3SX1 A;  3UB1 A;  1NU3 A;  2KXG A;  4GB5 A;  1A90 A;  4G1M B;  3NHX A;  2BT3 A;  3SOY A;  3I56 3;  1OF5 B;  4HVN A;  3CCL 3;  1R4C A;  3JUM A;  3ALA A;  1IV7 A;  1D6Y A;  3GZX B;  1NDO B;  1K41 A;  1VZZ A;  3G16 A;  3OV4 A;  4WYK B;  3V99 A;  3F7S A;  4RNY A;  1M1K 4;  2XRX B;  3GWR A;  1EKM A;  1M9G A;  4XBT A;  8CHO A;  1GS3 A;  3PCS A;  3LT9 A;  5D81 A;  2E2T A;  3NQY A;  1ASK A;  2BMQ B;  2OQE C;  3OXA A;  3X3Z A;  4HZ9 B;  3S27 A;  4R9K A;  3FH1 A;  2KCD A;  4HJL B;  3HI7 A;  2OOV A;  4EV2 A;  3K7C A;  1L5G B;  1VQ8 3;  1YJW 3;  3HZP A;  1PFP A;  3X40 A;  1MOL A;  1OGZ A;  4Q53 A;  1SJW A;  3FF2 A;  2QA4 3;  3V92 A;  2CG0 A;  5ELU A;  3LH4 A;  1NB3 I;  1UI8 A;  4N6V 0;  3JVC A;  2W03 A;  1OHO A;  1D6Z A;  2Z6B A;  1GY7 A;  1NO3 A;  3IJE B;  3PXM A;  2YFL B;  1BUQ A;  3NM7 A;  4XDW A;  2HMN B;  5AEW B;  1F8N A;  2YFI B;  3FZW A;  4AKZ A;  1GD4 A;  1GY5 A;  1OF5 A;  1ZO2 A;  3NBJ A;  2W9Q A;  3BND A;  1LXE A;  5IEO A;  3LXU X;  4MMY B;  2O9U X;  3RDE A;  4WYK A;  4BTY A;  4BTX A;  4XB5 A;  3CXC 2;  1VQO 3;  1STF I;  5D82 A;  3EX9 A;  4OK0 A;  1KC8 4;  1YHQ 3;  3K63 A;  1YI2 3;  1CYU A;  3KII A;  4FCJ A;  1W5Z A;  1FGT A;  3V98 A;  1W6Y A;  3LOY A;  5KP4 A;  3CCU 3;  1IT8 A;  1RN7 A;  1TFK A;  4KFE A;  1O7H B;  1W7C A;  3Q1C A;  3GZB A;  2GEX A;  5KP1 A;  3K5T A;  3I55 3;  5JBS A;  1QVF 2;  2QGU A;  1S5A A;  1IVU A;  2ML5 A;  4O02 B;  4H3U A;  1O7G B;  2GBX B;  2OQE A;  3GZR A;  3VSY A;  4XBY A;  2IUK A;  2JQ5 A;  2P0X A;  1W4N A;  1KQS 2;  2CW9 A;  1U8C B;  3HK4 A;  4WHA A;  1Q82 4;  3CU3 A;  3ROB A;  2WGO A;  3BNE A;  2OTJ 3;  3CNX A;  3LTC A;  3DUK A;  2CFL A;  2M7O A;  2P0M A;  3ECF A;  2FXT A;  1O7P B;  2HMM B;  3M8C A;  2Y74 A;  5IER A;  4N6O B;  3STD A;  3KFQ C;  1A2K A;  3CPW 2;  3G71 3;  3D9R A;  4RZM A;  4FMD A;  1QAF A;  2GU3 A;  3PYJ A;  4TX4 A;  1LOX A;  3S67 A;  3Q90 A;  3F8X A;  4MEI A;  1UI7 A;  1EQK A;  1N8R 4;  3KE7 A;  2QIY A;  4IIA A;  4H61 A;  5IF6 A;  2E2U A;  3JUQ A;  1IK3 A;  3EN1 B;  3FGY A;  4R4K A;  1TUH A;  2P05 A;  2W2C A;  4RBN A;  2XH9 A;  1NWW A;  2CH9 A;  3JUP A;  3NV0 B;  2KRT A;  5CK6 A;  1YIT 3;  1VQ5 3;  3B4O A;  1W6C A;  3KZT A;  3NQZ A;  3PGB A;  2HMK B;  2XSH B;  3FSD A;  3MYT A;  1QAK A;  3FF0 A;  3LTD A;  1WQL B;  3NX0 A;  1WTH A;  4MMX B;  2A15 A;  3AMO A;  3F14 A;  1JN5 B;  4HM0 B;  1QMA A;  1WNH A;  2ZDJ A;  3PCR A;  2FGT A;  2GBW B;  3PS8 A;  4KFF A;  5FW5 A;  1VQ6 3;  4I4K A;  3MWZ A;  2XFS A;  3CD6 3;  1IT7 A;  4LZI A;  3X3Y A;  3OW2 2;  3E99 A;  1ZX2 A;  1OUN A;  1K28 A;  1RJO A;  4HM1 B;  4N6M A;  4HM5 B;  2CHC A;  3OWY A;  1N8Q A;  2WO0 A;  3KSE D;  1DMN A;  2LQV A;  2CC3 A;  3K9M C;  2STD A;  1IQY A;  3A76 A;  1LNH A;  3FLJ A;  4FCM A;  2JDI H;  7STD A;  4HM4 B;  4J9A A;  5CXO A;  4L8P A;  1GYB A;  2XEP A;  3NV0 A;  3S5C A;  3DZL A;  3WOE B;  3GAX A;  1YJ9 3;  1IQ8 A;  2Z77 A;  1ISK A;  1TIJ A;  5IG0 A;  4XDV A;  4KZ1 A;  3WOF B;  6STD A;  3G6E 3;  1US1 A;  3NBB A;  1Q40 B;  4WFO A;  2P38 A;  2W9P A;  1KD1 4;  2C11 A;  2BO9 B;  3FG1 A;  2CIU A;  3EF8 A;  1GD3 A;  2D42 A;  3L0R A;  2I9W A;  1CQS A;  1JN5 A;  5STD A;  2YFJ B;  3MSO A;  3LTB A;  3NXJ A;  5AII A;  5AEU B;  5I97 A;  1VQ4 3;  2WGQ A;  1OPY A;  4EC6 A;  1G96 A;  1KSI A;  3G0K A;  5BVB A;  1NB5 I;  1IV9 A;  2GEY A;  4HM2 B;  3H51 A;  1FGM A;  1DVC A;  1O7N B;  3OX9 A;  2CWT A;  1JB2 A;  1WMO A;  1DMM A;  3NUV A;  2K54 A;  3F7X A;  2YX9 A;  3F9S A;  4HM3 B;  5HGR A;  1VQP 3;  4HYZ A;  3O8Y A;  2W0Q A;  1U5O A;  2BMR B;  3FG3 A;  3WDG B;  3BLZ A;  2R4I A;  4HM7 B;  3UL6 A;  1V74 A;  3VF1 A;  3FG4 A;  1FGQ A;  1DMQ A;  3D3L A;  1IVV A;  3U1W A;  2CFD A;  3NM2 A;  3S28 A;  3CCS 3;  1Q7Y 4;  3N8B A;  3T8U A;  4IT7 A;  3CCE 3;  3CPO A;  1Q40 A;  2ZL8 A;  3GRD A;  1JKG A;  3EB8 A;  1ULJ B;  5ELJ A;  4R1K A;  1KWI A;  4J8T A;  3AMO B;  3IMA B;  5JPP A;  2CK3 H;  1D6U A;  3EC9 A;  1FA3 A;  1YIJ 3;  1JJ2 2;  5IW9 A;  5A0O B;  2CG1 A;  3EN8 A;  3QRD A;  3CNM A;  4JRF A;  3JUN A;  5CF2 A;  4FMB A;  1QJG A;  3UNL A;  4K90 B;  4N3V A;  4N6N B;  3DY5 A;  2B24 B;  4K1V A;  3S29 A;  3I0Y A;  4L7K A;  4LGQ A;  2W56 B;  4O8S A;  4HBR A;  3BNC A;  1SQW A;  3RGA A;  4K1U A;  2HMJ B;  3DXO A;  5LC7 A;  5DRV A;  1VQ9 3;  1UUV B;  2HMO B;  4KFD A;  3WA3 A;  1AVL A;  1SIH A;  2SBL A;  4XM4 A;  2XGN A;  2GU1 A;  3B4P A;  3DGO A;  4HZB B;  1N9J A;  5EEO A;  1GY6 A;  1CYV A;  1AVK A;  1J2B A;  2D1W A;  4MJD A;  3T8N A;  1VQL 3;  1QAL A;  5G2G A;  1VQ7 3;  1DVD A;  3HIG A;  3U97 A;  1UW1 A;  3FKA A;  5KP3 A;  1RRL A;  3J7Y d;  3X42 A;  2ML6 A;  3MG1 A;  1IVW A;  1M1X B;  3EBT A;  3F40 A;  4CDL A;  1NJI 4;  2RFR A;  4NHF A;  3T0U A;  1TP6 A;  4X2O A;  1S72 3;  4FCZ A;  2IUJ A;  5FGO A;  3CMA 3;  3DMC A;  1OAC A;  2O3O A;  4WWU C;  4RNZ A;  1Q81 4;  2P09 A;  1W00 A;  3X41 A;  1HKX A;  2W56 A;  1FUW A;  5D83 A;  3EBY A;  3WA2 X;  3VGN A;  1IU7 A;  3BNB A;  3ER7 A;  3CCQ 3;  1RKY A;  5AYS C;  3KKG A;  2IMJ A;  4EBG A;  3HX8 A;  4EV5 A;  3QK9 A;  3SOA A;  1PU4 A;  3SVA A;  2INX A;  3HII A;  4GL6 A;  2BMO B;  3NBR A;  4OUQ A;  2K0M A;  5AYR B;  1IDP A;  4CCV A;  5AIH A;  1STD A;  5TGN A;  4K61 A;  1MNL A;  4MMZ B;  2FNQ A;  1TFO A;  1FGR A;  1JKG B;  2HML B;  2Z76 A;  2CFK A;  3TDG A;  5IG5 A;  1M90 4;  3JUO A;  3K0Z A;  3LTA A;  1K9M 4;  4L8O A;  3CME 3;  1JNQ A;  3CCM 3;  3KSP A;  3PZW A;  1FGO A;  1T5Y A;  1EA2 A;  1A2V A;  2CFG A;  3CCJ 3;  1OH0 A;  1O7W B;  2MF7 A;  1C7H A;  3F8H A;  3MKI A;  1SII A;  3MPH A;  3IPT A;  3CC4 3;  1TU5 A;  2CWU A;  2WOH A;  2BHM A;  2XR8 B;  3UJM A;  4IPB A;  1ROA A;  4FMC A;  5BXQ A;  4AEQ A;  3EQQ B;  3KN4 A;  5JPU A;  4FR9 A;  1A67 A;  4WP5 A;  2W04 A;  2LYX A;  3OWS A;  2CKF B;  1JB4 A;  1K8A 4;  1N5P A;  1IQX A;  1Q42 A;  4R80 A;  3N9H A;  3SED A;  4QWT A;  5CF1 A;  4KVH A;  5IG4 A;  2XF3 A;  4ORL A;  5IEP A;  4HM8 B;  1O7M B;  1W01 A;  1WMN A;  2Q07 A;  3CCV 3;  3RGR A;  2GXF A;  1W6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...