1DMNA

Crystal structure of mutant enzyme y32f/y57f of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
123
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFFRQGLKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Contribution of the hydrogen-bond network involving a tyrosine triad in the active site to the structure and function of a highly proficient ketosteroid isomerase from Pseudomonas putida biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 29
structure length 123
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 1999-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1dmnA00
3KZTA 1WQLB 1ASKA 1JB2A 1NWWA 3F7SA 2YFLB 3DUKA 2QGUA 5D82A 3SEDA 2Z76A 1O7WB 3B4PA 2BMOB 3FSDA 2GBXB 3DZLA 4STDA 8CHOA 2IMJA 4U13A 3EN1B 3B7CA 3BB9A 3CNXA 3F40A 2Z7AA 3F9SA 1ZO2A 4LMIA 7STDA 4OVMA 5IG5A 3BLZA 5D83A 4R1KA 1K41A 3NUVA 2GBWB 3NV0A 3FGYA 2YFIB 3FF0A 1CQSA 2INXA 3JUOA 4HZBB 4LEHA 5IG0A 1E97A 3EBYA 5IG4A 3EN8A 1ISKA 3EQQB 5KP4A 2PZVA 3STDA 3HK4A 5D81A 3CNMA 5KP3A 1GY7A 3I0YA 3JUQA 3NM2A 3JUNA 5AIHA 2QIYA 4MJDA 4R9KA 1OHPA 3E99A 4GB5A 1W6YA 4N3VA 5CXOA 1GS3A 4K1UA 1OF5A 2BNGA 3OX9A 4FCMA 1O7GB 1OUNA 2CKFB 5KP1A 3VSYA 3MG1A 4XBXA 1STDA 1Q40A 3GWRA 2B1XB 1NDOB 2B24B 3T8UA 3B8LA 3K7CA 3NV0B 4ORLA 3LZAA 1ZX2A 1EG9B 3EF8A 3ER7A 5IF6A 5JPPA 2HMNB 2BMRB 2HMMB 1U5OA 5CF2A 2HMKB 3DMCA 4HM6B 4HM8B 3GZXB 2R4IA 4L8OA 3RGAA 3UNLA 4FCJA 4Q53A 4HM5B 3MHEA 3KKGA 2XRXB 2F98A 3FLJA 5DREA 4J9AA 1C7HA 4HM0B 5AIFA 4XDWA 1OF5B 3NXJA 3G16A 3F8XA 1Q40B 3M8CA 3FZWA 3HX8A 4LGQA 1SJWA 4WWUC 4IIAA 4X2OA 1JB5A 1ULJB 1TUHA 3G8ZA 3FF2A 1OGXA 3H51A 1JN5A 2HMJB 3H3HA 2Z77A 5BXQA 4XBYA 3A76A 6STDA 1QMAA 5AIIA 3MSOA 3OV4A 1DMMA 3OXAA 5IEOA 1TP6A 3FKAA 1GY5A 3EC9A 3CU3A 2CHCA 1W02A 4HJLB 1OH0A 1A2KA 2GEYA 3MYTA 2HMOB 3NBRA 5IERA 3OWSA 4HM7B 2GXFA 3NHXA 3LYGA 5HGRA 1O7MB 1IDPA 2I9WA 1DMNA 4J8TA 1EA2A 3JUMA 1NU3A 1HKXA 5TGNA 1JN5B 3EHCA 3S5CA 5G2GA 1E3VA 1OCVA 3HZPA 2YFJB 1OPYA 2HMLB 4HM4B 2XSOB 1Z1SA 3MG2A 2W2CA 1Q42A 5AI1A 4KVHA 5CLKA 2RGQA 3Q90A 1DMQA 3GZRA 5IG3A 3RGRA 3VGNA 1OHSA 1W01A 1JKGA 4R9LA 2F86B 1UUVB 2XSHB 1O7PB 3GZYB 5IENA 3EX9A 1W00A 3FH1A 2STDA 1S5AA 5IEPA 1O7HB 3OWYA 3KSPA 4HVNA 1E3RA 3WMDA 2F99A 5FW5A 2UX0A 2XR8B 3DM8A 4XDVA 4HKVB 5CK6A 2RCDA 1AR0A 4OUQA 4HZ9B 4L8PA 4HM2B 4RZMA 3SOAA 3IPTA 2RFRA 5EVHA 3F14A 3CPOA 4WYKA 3B4OA 3GRDA 4XBTA 4CDLA 4X2HA 3OWUA 4WP5A 2JQ5A 5JPUA 5BVBA 5AEWB 3MKIA 3DXOA 3EJVA 1JKGB 3JUPA 2BMQB 3GZBA 1GYBA 4PEJA 2A15A 4H3UA 3UJMA 4HM3B 1VZZA 3F8HA 3EBTA 2K54A 3T8NA 3MG3A 5DRVA 1UUWB 4HM1B 1OGZA 3ECFA 5AIGA 2GEXA 1O7NB 4I4KA 4XB5A 3D9RA 1ULIB 5CF1A 1GY6A 3K0ZA 4K1VA 3ROBA 1JB4A 5STDA 4WYKB 4XM4A 5AEUB 4L7KA 1BUQA 3KE7A 3SOYA 3F7XA 3G0KA 1OHOA 2OWPA 1QJGA
chains in the Genus database with same CATH superfamily
4AKYA 3KZTA 3KN4A 1WQLB 3GAXA 3LTBA 1RGEA 1ASKA 2Z6BA 4N6TA 4RNZA 4I5QA 1QAKA 2F5MA 1JB2A 2W03A 4HBRA 1NWWA 2XF3A 3F7SA 2YFLB 3DUKA 2QGUA 2CFKA 1VQ43 2ML5A 1YGEA 3HI7A 1SQWA 3KFQC 2PNCA 4G1MB 5D82A 1ROVA 3DH2A 3SEDA 2ZA4A 2Z76A 1FUWA 5M18A 1O7WB 1RNTA 2F4YA 2C10A 4RBNA 3AHWA 1UW1A 3B4PA 4JRFA 1YVBI 2BMOB 2GSPA 3FSDA 2GBXB 1JJ22 1EQKA 1LRAA 3DZLA 3Q3FA 4NPBA 4STDA 3GSPA 2CWUA 8CHOA 3J7Yd 1M904 5IENA 3MPHA 1RJOA 1I3FA 1TJDA 2IMJA 4U13A 1S723 3EN1B 3LOYA 1X1WA 3PYJA 3B7CA 4CPKA 1W2B2 4EBGA 2QEX3 3U1WA 3BB9A 3CNXA 3F40A 3BU4A 2Z7AA 4AKZA 1G02A 3F9SA 1ZO2A 1YJ93 3D3LA 4LMIA 6RNTA 7STDA 4OVMA 5IG5A 3BLZA 1BNJA 5D83A 2CFDA 1ZS7A 3NX0A 4WFOA 3G4S3 2CFWA 4R1KA 1K41A 3NUVA 2GBWB 4H61A 3BNDA 3NQYA 3NV0A 3MWZA 3PS8A 2P38A 3FGYA 1RDSA 1BRNL 4BU4A 2YFIB 3FF0A 1CQSA 2INXA 4KZ1A 1UCIA 4MEIA 3JUOA 4HZBB 3KCHA 4LEHA 5IG0A 3DGMA 1RN1A 1E97A 2UUGC 3DGOA 5G1KA 1RGKA 1AVLA 1RGAA 3EBYA 3EB8A 3KSED 5IG4A 2W9QA 4N6V0 3CXC2 3UB1A 3OW22 3EN8A 2OCTA 1ISKA 3AGOA 1WNHA 2CIUA 3EQQB 1FYSA 5KP4A 1BU4A 2PZVA 1VQK3 4RNYA 3STDA 1N5PA 2MF7A 2ZHXB 3HK4A 5D81A 7GSPA 3CNMA 3HOHA 1C54A 5KP3A 1GY7A 3I0YA 3JUQA 3NM2A 3JUNA 1Q814 2CG0A 2SARA 1BRHA 1QVG2 5AIHA 1IV7A 2QIYA 2R41A 3D4AA 4O8SA 4MJDA 1R4YA 4R9KA 1F8NA 3SVAA 3G713 1BSEA 1BVIA 1YHQ3 1OHPA 2AADA 1MGRA 3E99A 4GB5A 2BU4A 2WOFA 3PCSA 5AYRB 3CCU3 1W6YA 1FGOA 2XFTA 1LNIA 5ELJA 3WA3A 1YJW3 1J2BA 5JBSA 4N3VA 5CXOA 4GSPA 1YI23 1GS3A 1TIJA 2LQVA 4BTWA 4K1UA 2RBIA 3ZG5A 1US1A 1MWUA 4OK0A 1OF5A 1KSIA 4N6OB 1VQN3 2BNGA 5M1AA 4K90B 5A0OB 3OX9A 4FCMA 1BNEA 1O7GB 1OUNA 1W4NA 5EEOA 1I2EA 1JRQA 2CKFB 3PGBA 5KP1A 3FG4A 3VSYA 3MG1A 2W56B 1RRHA 1STDA 4XBXA 1Q40A 3PCRA 3FG1A 3GWRA 2B1XB 1NDOB 2B24B 3T8UA 3ZG0A 1B27A 2GU1A 3K9MC 3B8LA 3K7CA 1BAOA 1IVVA 3NV0B 1RLSA 1STFI 2RNTA 1VQP3 3URPA 3CPW2 4ORLA 3LZAA 1ZX2A 1EG9B 4FR9A 2E2VA 2H0IA 4EW5A 2XFSA 1MWRA 1TRPA 1LQGC 4EV2A 1BUJA 1PU4A 1G0TA 2D1WA 2MC8A 1Q7HA 3EF8A 2JDIH 3ER7A 5IF6A 5JPPA 1N5HA 2HMNB 2K3DA 2BMRB 2HMMB 3DY5A 7RNTA 1X1UA 4FMCA 1PY3A 1U5OA 3X41A 4BTXA 3PZWA 3WA2X 5CF2A 6GSPA 4NHFA 1T2IA 1V58A 4O02B 1Q9EA 3I563 2HMKB 3DMCA 3V92A 4HM6B 4HM8B 1LXEA 2H0HA 3GZXB 1FUSA 2V1LA 1V74A 2R4IA 1N9EA 1GSPA 4L8OA 3RGAA 1I2FA 3UNLA 4FCJA 3IMAB 1I0XA 2CH9A 4Q53A 2BT3A 4HM5B 1MWTA 2F56A 1BSDA 3MHEA 1KD14 3BNCA 3KKGA 2XRXB 3QRDA 3CCJ3 4FMDA 3CC73 2L1SA 2F98A 1BRJA 1X1YA 2IYJA 2IUJA 3FLJA 5DREA 4LSOA 3LTCA 4J9AA 1C7HA 4HM0B 1CYUA 5AIFA 3D79A 1RRLA 4XDWA 1OF5B 1UI7A 3NXJA 2F5WA 1V57A 3G16A 3UL6A 1Q864 1DVDA 3LXUX 1QVF2 2XEPA 2KF6A 1NNVA 1N9JA 3F8XA 1Q40B 1YVSA 1GOVA 1BRSA 1RGHA 3FZWA 3M8CA 2ZDJA 2W56A 4O3VA 3HX8A 1I8VA 1VQM3 4LGQA 4ZM8A 2XH9A 1SJWA 2C11A 1I0VA 4WWUC 4JF8A 2E2UA 5AYSC 2WOHA 4O2HA 3V99A 5BU4A 1IK3A 2KF5A 1BSAA 1RSNA 1W6CA 1WMNA 3BNEA 1VQ83 2WO0A 1BNSA 3X3ZA 2W9PA 3N8BA 4IIAA 5HOHA 1L5GB 1Q7Y4 4K61A 4X2OA 3SXXA 1UCLA 2H0GA 1JB5A 1ULJB 1TUHA 1R4CA 3FF2A 3G8ZA 1NJI4 1AVKA 1OGXA 3H51A 1JN5A 1UGHI 2HMJB 1T5YA 2OTJ3 1KWIA 1UUGB 3DGNA 4MMYB 1DYUA 2K0MA 3O8YA 1I2GA 3H3HA 4FCZA 2Z77A 3G6E3 2O9UX 5BXQA 1B21A 2UGIA 4XBYA 3WDGB 5RNTA 3JVCA 3WR2A 3U97A 3A76A 6STDA 1RGGA 1QMAA 5AIIA 1BOXA 2Y74A 1I70A 3S67A 3MSOA 3OV4A 3X42A 1D6ZA 1RMSA 4MMXB 5FGOA 1DMMA 3OXAA 3LT9A 3AGNA 5IEOA 1TP6A 3FKAA 2CFLA 1GY5A 1VQO3 4J5GA 1HYFA 3DGLA 1FA3A 1A90A 2P05A 4LYLB 1ROAA 4J5KA 1W7CA 3N9HA 3EC9A 3CU3A 4FMBA 2CHCA 2OTL3 2W6JH 1FW7A 1SPUA 3ALAA 1W02A 1B2ZA 1I3IA 4HJLB 3QK9A 3UL5A 1JZDA 3I553 1OH0A 1B2MA 4DKIA 1RCLA 1A2KA 1GMQA 2BIRA 2QA43 2SBLA 2GEYA 3L0RA 2FNQA 4KFEA 1B2XA 2WGOA 3AMOA 3K63A 3VF1A 3MYTA 2HMOB 3NBRA 5IERA 2GU3A 3OWSA 4HM7B 2CG1A 3T0UA 1T2HA 2GXFA 3IJEB 3NHXA 4KFFA 2P0XA 3WODG 1RTUA 3LYGA 5HGRA 1RGCA 3SYUA 1FZUA 4CCVA 4IPBA 3X3YA 1KC84 1B20A 1O7MB 1LOVA 1RN4A 1VQ73 1BNRA 1IDPA 1W2ZA 1DMNA 1LOXA 2I9WA 4J8TA 3CCE3 1EA2A 2KRTA 1FGMA 3RNTA 1YGWA 1JNQA 4EC6A 1JBTA 3JUMA 2FGTA 2Y73A 1NU3A 4WHAA 1VQL3 1HKXA 1BSBA 5TGNA 5GSPA 1JN5B 3V98A 1LOWA 3WOFB 2Q07A 3EHCA 4HYZA 4BTYA 1YNVX 3S5CA 1B2UA 1AV4A 5G2GA 4AEQA 9RNTA 1E3VA 1OCVA 2BHMA 1K734 2KCDA 3HZPA 1Y4KA 3CCQ3 5ELUA 1IVUA 1HU9A 2YFJB 2RSXA 3RDEA 2OQEC 1RKYA 1OPYA 1GOUA 3CCM3 1M1XB 1TFKA 1PFPA 1TFOA 2HMLB 1B3SA 2XSOB 1Z1SA 4HM4B 4R4KA 5M19A 2BO9B 1SIIA 3MG2A 2W2CA 3HIIA 3CCL3 1IV9A 1Q42A 4N6UA 5AI1A 2ML6A 4KVHA 5CLKA 1B2SA 1DETA 3S27A 2RGQA 3Q90A 1BRIA 1GD4A 1DMQA 3AHSA 1TU5A 1K9M4 4MMZB 2KAAA 1UCKA 4EXRA 3CC23 1YJN3 2IY2A 3GZRA 1IU7A 3RGRA 3TDGA 3VGNA 5IG3A 1EEJA 1OHSA 1W01A 2C4BA 1JKGA 4R9LA 1JBRA 1UCJA 1IVWA 1JV2B 1UI8A 2F86B 1UUVB 3NBJA 3FG3A 2XSHB 5LC6A 1O7PB 3GZYB 2CW9A 4KT3B 2M7OA 2OOVA 2J8XB 3AMOB 3EX9A 1QAFA 4BL3A 3CCR3 1W00A 2CK3H 1AY7A 1G96A 3FH1A 2HOHA 2CC3A 1NB3I 1MGWA 2STDA 1S5AA 4GHOA 3N54B 1BGSA 5IEPA 4TX4A 1O7HB 3KSPA 2E2TA 3OWYA 3ZFZA 3CCS3 1GMPA 4HVNA 1HZ1A 3WOEB 3NQZA 2OQEA 1E3RA 4BIRA 1BANA 1YIJ3 1BNIA 3WHOA 3WMDA 2F99A 2CX0A 3LTDA 4KFDA 2UX0A 5FW5A 1RHLA 4EV5A 1IQ8A 2P09A 2XR8B 3DM8A 4N6NB 4QWTA 2W04A 4XDVA 4HKVB 5CK6A 1RN7A 1BRGA 2RCDA 3X3XA 3Q2PA 1BSCA 1N8R4 1AR0A 1QALA 4OUQA 4HZ9B 4L8PA 1IYYA 1Q824 4HM2B 4RZMA 3SOAA 1A2VA 1GMRA 2W0QA 3IPTA 4CJNA 2RFRA 4N6MA 1EUIC 1T3BA 1BNGA 3NBBA 3FCSB 5EVHA 3A5EA 1X1XA 3F14A 1CYVA 1JZOA 1D6UA 2O3OA 3CPOA 4LZIA 3CMA3 3KIIA 4N6LA 4WYKA 1IT7A 1K8A4 1M1K4 1LNHA 2ZL8A 3D5IA 4HOHA 3B4OA 5I97A 1VQ93 1ZGXA 2AAEA 3CD63 3GRDA 4XBTA 1YIT3 1DE3A 2CX1A 4ILFA 4CDLA 1VQ63 2KXGA 4X2HA 3OWUA 4WP5A 2JQ5A 3NM7A 5JPUA 5BVBA 5AEWB 1N8QA 1IVXA 1IT8A 3MKIA 1IQYA 3DXOA 2IUKA 1MNLA 2FXTA 3EJVA 1JKGB 1BRKA 1RCKA 2IA7A 1W6GA 3JUPA 2BMQB 1A2PA 1FGQA 1KQS2 3CC43 3BNBA 1GOYA 1GYBA 3GZBA 2A15A 4PEJA 1JBSA 1VQ53 2CWTA 4H3UA 3BIRA 3PXMA 3CME3 1MWSA 3UJMA 1FGRA 1PYLA 2P0MA 2CFGA 1LQMB 1D6YA 1AQZA 3S29A 5IW9A 1SARA 2L4VA 3LH4A 4HM3B 1MOLA 2KF4A 1NB5I 4R80A 1VZZA 1WTHA 2KF3A 2CWVA 3F8HA 1GD3A 3EBTA 4EYCA 3SLUA 1SIHA 1W5ZA 4GL6A 3D5GA 2K54A 1LVNA 2YX9A 3Q1CA 1RGLA 2D42A 3EE1A 3T8NA 1WMOA 1OACA 3MG3A 4RNTA 5DRVA 1UUWB 5BIRA 1BIRA 2OOVC 3S28A 5G1LA 4HM1B 1OGZA 1DVCA 3ECFA 5AIGA 1A67A 1UGIA 2GEXA 1M9GA 3K5TA 1O7NB 4HAAA 4I4KA 1U8CB 1CEWI 3HIGA 4XB5A 2LYXA 3D9RA 1EKMA 1ULIB 4NREA 5CF1A 1GY6A 1WMPA 1TRQA 3K0ZA 4K1VA 1VQQA 5LC7A 1CH0A 1UDII 1FUTA 3ROBA 1JB4A 4FMAA 5STDA 2XGLA 4WYKB 4XM4A 1LOYA 1FGTA 5AEUB 4L7KA 1BNFA 5EQLA 8RNTA 3LMLA 1RNBA 1BUQA 1TTOA 4BL2A 3X40A 3LT8A 2WGQA 3LTAA 1K28A 1IQXA 3KE7A 3SOYA 3DGYA 3F7XA 3SX1A 1NO3A 3G0KA 2XGNA 3CCV3 1OHOA 4IT7A 1RGFA 2OWPA 1QJGA
chains in the Genus database with same CATH topology
4AKYA 3KZTA 3KN4A 1WQLB 3GAXA 3LTBA 4N6TA 1ASKA 2Z6BA 4RNZA 1QAKA 1JB2A 2W03A 4HBRA 1NWWA 2XF3A 3F7SA 2YFLB 3DUKA 2QGUA 2CFKA 1VQ43 2ML5A 1YGEA 3HI7A 1SQWA 3KFQC 2PNCA 4G1MB 5D82A 1ROVA 3SEDA 2Z76A 1FUWA 1O7WB 2C10A 4RBNA 1UW1A 3B4PA 4JRFA 1YVBI 2BMOB 3FSDA 2GBXB 1JJ22 1EQKA 3DZLA 4STDA 2CWUA 8CHOA 3J7Yd 1M904 3MPHA 1RJOA 2IMJA 4U13A 1S723 3EN1B 3LOYA 3PYJA 3B7CA 1W2B2 4EBGA 2QEX3 3U1WA 3BB9A 3CNXA 3F40A 2Z7AA 4AKZA 3F9SA 1ZO2A 1YJ93 3D3LA 4LMIA 7STDA 4OVMA 5IG5A 3BLZA 5D83A 2CFDA 3NX0A 4WFOA 3G4S3 2CFWA 4R1KA 1K41A 3NUVA 2GBWB 4H61A 3BNDA 3NQYA 3NV0A 3MWZA 3PS8A 2P38A 3FGYA 2YFIB 3FF0A 1CQSA 2INXA 4KZ1A 4MEIA 3JUOA 4HZBB 4LEHA 5IG0A 3DGMA 1E97A 3DGOA 1AVLA 3EBYA 3EB8A 3KSED 5IG4A 2W9QA 4N6V0 3CXC2 3UB1A 3OW22 3EN8A 2OCTA 1ISKA 1WNHA 2CIUA 3EQQB 5KP4A 2PZVA 1VQK3 4RNYA 3STDA 1N5PA 2MF7A 3HK4A 5D81A 3CNMA 5KP3A 1GY7A 3I0YA 3JUQA 3NM2A 3JUNA 1Q814 2CG0A 1QVG2 5AIHA 1IV7A 2QIYA 4O8SA 4MJDA 4R9KA 1F8NA 3SVAA 3G713 1YHQ3 1OHPA 3E99A 4GB5A 2WOFA 3PCSA 5AYRB 3CCU3 1W6YA 1FGOA 2XFTA 5ELJA 3WA3A 1YJW3 1J2BA 5JBSA 4N3VA 5CXOA 1YI23 1GS3A 1TIJA 2LQVA 4BTWA 4K1UA 1US1A 4OK0A 1OF5A 1KSIA 4N6OB 1VQN3 2BNGA 5A0OB 4K90B 3OX9A 4FCMA 1O7GB 1OUNA 1W4NA 5EEOA 1JRQA 2CKFB 3PGBA 5KP1A 3FG4A 3VSYA 3MG1A 2W56B 1RRHA 1STDA 4XBXA 1Q40A 3PCRA 3FG1A 3GWRA 2B1XB 1NDOB 2B24B 3T8UA 2GU1A 3K9MC 3B8LA 3K7CA 1IVVA 3NV0B 1STFI 1VQP3 3CPW2 4ORLA 3LZAA 1ZX2A 1EG9B 4FR9A 2E2VA 2XFSA 4EV2A 1PU4A 2D1WA 2MC8A 3EF8A 3ER7A 2JDIH 5IF6A 5JPPA 1N5HA 2HMNB 2BMRB 2HMMB 3DY5A 4FMCA 1U5OA 3X41A 4BTXA 3PZWA 3WA2X 5CF2A 4NHFA 4O02B 3I563 2HMKB 3DMCA 3V92A 4HM6B 4HM8B 1LXEA 3GZXB 2V1LA 1V74A 2R4IA 1N9EA 4L8OA 3RGAA 3UNLA 4FCJA 3IMAB 2CH9A 4Q53A 2BT3A 4HM5B 1KD14 3MHEA 3BNCA 3KKGA 2XRXB 3QRDA 3CCJ3 4FMDA 3CC73 2F98A 2IUJA 3FLJA 5DREA 4LSOA 3LTCA 4J9AA 1C7HA 4HM0B 1CYUA 5AIFA 1RRLA 4XDWA 1OF5B 1UI7A 3NXJA 3G16A 3UL6A 1Q864 1DVDA 3LXUX 1QVF2 2XEPA 1N9JA 3F8XA 1Q40B 3M8CA 3FZWA 2ZDJA 2W56A 4O3VA 3HX8A 1VQM3 4LGQA 4ZM8A 2XH9A 1SJWA 2C11A 4WWUC 4JF8A 2E2UA 5AYSC 2WOHA 4O2HA 3V99A 1IK3A 3BNEA 1WMNA 1W6CA 1VQ83 2WO0A 3X3ZA 2W9PA 3N8BA 4IIAA 1L5GB 1Q7Y4 4K61A 4X2OA 3SXXA 1JB5A 1ULJB 1TUHA 1R4CA 3FF2A 3G8ZA 1NJI4 1AVKA 1OGXA 3H51A 1JN5A 2HMJB 1T5YA 2OTJ3 1KWIA 3DGNA 4MMYB 1DYUA 2K0MA 3O8YA 3H3HA 4FCZA 2Z77A 3G6E3 2O9UX 5BXQA 4XBYA 3WDGB 3JVCA 3U97A 3A76A 6STDA 1QMAA 5AIIA 2Y74A 3S67A 3MSOA 3OV4A 3X42A 1D6ZA 4MMXB 5FGOA 1DMMA 3OXAA 3LT9A 5IEOA 1TP6A 3FKAA 2CFLA 1GY5A 1VQO3 3DGLA 1FA3A 1A90A 2P05A 1ROAA 1W7CA 3N9HA 3EC9A 3CU3A 4FMBA 2CHCA 2OTL3 2W6JH 1SPUA 3ALAA 1W02A 4HJLB 3QK9A 3UL5A 3I553 1OH0A 1A2KA 2QA43 2SBLA 2GEYA 3L0RA 2FNQA 4KFEA 2WGOA 3AMOA 3K63A 3VF1A 3MYTA 2HMOB 3NBRA 5IERA 2GU3A 3OWSA 4HM7B 2CG1A 3T0UA 2GXFA 3IJEB 3NHXA 4KFFA 3WODG 2P0XA 3LYGA 5HGRA 4CCVA 4IPBA 3X3YA 1KC84 1O7MB 1VQ73 1IDPA 1W2ZA 1DMNA 1LOXA 2I9WA 4J8TA 3CCE3 1EA2A 2KRTA 1FGMA 1JNQA 4EC6A 3JUMA 2FGTA 2Y73A 1NU3A 4WHAA 1VQL3 1HKXA 5TGNA 1JN5B 3V98A 3WOFB 2Q07A 3EHCA 4HYZA 4BTYA 3S5CA 1AV4A 5G2GA 4AEQA 1E3VA 1OCVA 2BHMA 1K734 2KCDA 3HZPA 1Y4KA 3CCQ3 5ELUA 1IVUA 1HU9A 2YFJB 2RSXA 3RDEA 2OQEC 1RKYA 1OPYA 3CCM3 1M1XB 1TFKA 1PFPA 1TFOA 2HMLB 4HM4B 2XSOB 1Z1SA 4R4KA 2BO9B 1SIIA 3MG2A 2W2CA 3HIIA 3CCL3 1IV9A 1Q42A 4N6UA 5AI1A 2ML6A 4KVHA 5CLKA 3S27A 2RGQA 3Q90A 1GD4A 1DMQA 1TU5A 1K9M4 4MMZB 4EXRA 3CC23 1YJN3 3GZRA 5IG3A 1IU7A 3RGRA 3TDGA 3VGNA 1OHSA 1W01A 1JKGA 4R9LA 1IVWA 1JV2B 1UI8A 2F86B 1UUVB 3NBJA 3FG3A 2XSHB 5LC6A 1O7PB 3GZYB 2CW9A 2OOVA 2M7OA 5IENA 3AMOB 3EX9A 1QAFA 3CCR3 1W00A 2CK3H 1G96A 3FH1A 2CC3A 1NB3I 2STDA 1S5AA 3N54B 5IEPA 4TX4A 1O7HB 3KSPA 2E2TA 3OWYA 3CCS3 4HVNA 3WOEB 3NQZA 2OQEA 1E3RA 1YIJ3 3WMDA 2F99A 3LTDA 4KFDA 2UX0A 5FW5A 4EV5A 1IQ8A 2P09A 2XR8B 3DM8A 4N6NB 4QWTA 2W04A 4XDVA 4HKVB 5CK6A 1RN7A 2RCDA 3X3XA 3Q2PA 1N8R4 1AR0A 1QALA 4OUQA 4HZ9B 4L8PA 1Q824 4HM2B 4RZMA 3SOAA 1A2VA 2W0QA 3IPTA 2RFRA 4N6MA 3NBBA 3FCSB 5EVHA 3F14A 1CYVA 2O3OA 1D6UA 3CPOA 4LZIA 3CMA3 3KIIA 4N6LA 4WYKA 1IT7A 1K8A4 1M1K4 1LNHA 2ZL8A 5I97A 1VQ93 3B4OA 3CD63 3GRDA 4XBTA 1YIT3 4CDLA 1VQ63 2KXGA 4X2HA 3OWUA 4WP5A 2JQ5A 3NM7A 5JPUA 5BVBA 5AEWB 1N8QA 1IVXA 1IT8A 3MKIA 1IQYA 3DXOA 2IUKA 1MNLA 2FXTA 3EJVA 1JKGB 3JUPA 2IA7A 1W6GA 2BMQB 1KQS2 1FGQA 3CC43 3BNBA 1GYBA 3GZBA 4PEJA 2A15A 1VQ53 2CWTA 4H3UA 3PXMA 3CME3 3UJMA 1FGRA 2P0MA 2CFGA 1D6YA 3S29A 5IW9A 2L4VA 3LH4A 4HM3B 1MOLA 1NB5I 4R80A 1VZZA 1WTHA 2CWVA 3F8HA 1GD3A 3EBTA 4EYCA 3SLUA 1SIHA 1W5ZA 4GL6A 2K54A 1LVNA 2YX9A 3Q1CA 2D42A 3EE1A 3T8NA 1WMOA 1OACA 3MG3A 5DRVA 1UUWB 2OOVC 3S28A 4HM1B 1OGZA 1DVCA 3ECFA 5AIGA 1A67A 2GEXA 3K5TA 1M9GA 1O7NB 4I4KA 1U8CB 1CEWI 3HIGA 4XB5A 2LYXA 3D9RA 1EKMA 1ULIB 4NREA 5CF1A 1GY6A 1WMPA 3K0ZA 4K1VA 5LC7A 3ROBA 1JB4A 4FMAA 5STDA 2XGLA 4WYKB 4XM4A 1FGTA 5AEUB 4L7KA 5EQLA 3LMLA 1BUQA 3X40A 3LT8A 2WGQA 3LTAA 1K28A 1IQXA 3KE7A 3SOYA 3SX1A 3F7XA 1NO3A 3G0KA 2XGNA 3CCV3 1OHOA 4IT7A 2OWPA 1QJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZT A;  1WQL B;  1ASK A;  1JB2 A;  1NWW A;  3F7S A;  2YFL B;  3DUK A;  2QGU A;  5D82 A;  3SED A;  2Z76 A;  1O7W B;  3B4P A;  2BMO B;  3FSD A;  2GBX B;  3DZL A;  4STD A;  8CHO A;  2IMJ A;  4U13 A;  3EN1 B;  3B7C A;  3BB9 A;  3CNX A;  3F40 A;  2Z7A A;  3F9S A;  1ZO2 A;  4LMI A;  7STD A;  4OVM A;  5IG5 A;  3BLZ A;  5D83 A;  4R1K A;  1K41 A;  3NUV A;  2GBW B;  3NV0 A;  3FGY A;  2YFI B;  3FF0 A;  1CQS A;  2INX A;  3JUO A;  4HZB B;  4LEH A;  5IG0 A;  1E97 A;  3EBY A;  5IG4 A;  3EN8 A;  1ISK A;  3EQQ B;  5KP4 A;  2PZV A;  3STD A;  3HK4 A;  5D81 A;  3CNM A;  5KP3 A;  1GY7 A;  3I0Y A;  3JUQ A;  3NM2 A;  3JUN A;  5AIH A;  2QIY A;  4MJD A;  4R9K A;  1OHP A;  3E99 A;  4GB5 A;  1W6Y A;  4N3V A;  5CXO A;  1GS3 A;  4K1U A;  1OF5 A;  2BNG A;  3OX9 A;  4FCM A;  1O7G B;  1OUN A;  2CKF B;  5KP1 A;  3VSY A;  3MG1 A;  4XBX A;  1STD A;  1Q40 A;  3GWR A;  2B1X B;  1NDO B;  2B24 B;  3T8U A;  3B8L A;  3K7C A;  3NV0 B;  4ORL A;  3LZA A;  1ZX2 A;  1EG9 B;  3EF8 A;  3ER7 A;  5IF6 A;  5JPP A;  2HMN B;  2BMR B;  2HMM B;  1U5O A;  5CF2 A;  2HMK B;  3DMC A;  4HM6 B;  4HM8 B;  3GZX B;  2R4I A;  4L8O A;  3RGA A;  3UNL A;  4FCJ A;  4Q53 A;  4HM5 B;  3MHE A;  3KKG A;  2XRX B;  2F98 A;  3FLJ A;  5DRE A;  4J9A A;  1C7H A;  4HM0 B;  5AIF A;  4XDW A;  1OF5 B;  3NXJ A;  3G16 A;  3F8X A;  1Q40 B;  3M8C A;  3FZW A;  3HX8 A;  4LGQ A;  1SJW A;  4WWU C;  4IIA A;  4X2O A;  1JB5 A;  1ULJ B;  1TUH A;  3G8Z A;  3FF2 A;  1OGX A;  3H51 A;  1JN5 A;  2HMJ B;  3H3H A;  2Z77 A;  5BXQ A;  4XBY A;  3A76 A;  6STD A;  1QMA A;  5AII A;  3MSO A;  3OV4 A;  1DMM A;  3OXA A;  5IEO A;  1TP6 A;  3FKA A;  1GY5 A;  3EC9 A;  3CU3 A;  2CHC A;  1W02 A;  4HJL B;  1OH0 A;  1A2K A;  2GEY A;  3MYT A;  2HMO B;  3NBR A;  5IER A;  3OWS A;  4HM7 B;  2GXF A;  3NHX A;  3LYG A;  5HGR A;  1O7M B;  1IDP A;  2I9W A;  1DMN A;  4J8T A;  1EA2 A;  3JUM A;  1NU3 A;  1HKX A;  5TGN A;  1JN5 B;  3EHC A;  3S5C A;  5G2G A;  1E3V A;  1OCV A;  3HZP A;  2YFJ B;  1OPY A;  2HML B;  4HM4 B;  2XSO B;  1Z1S A;  3MG2 A;  2W2C A;  1Q42 A;  5AI1 A;  4KVH A;  5CLK A;  2RGQ A;  3Q90 A;  1DMQ A;  3GZR A;  5IG3 A;  3RGR A;  3VGN A;  1OHS A;  1W01 A;  1JKG A;  4R9L A;  2F86 B;  1UUV B;  2XSH B;  1O7P B;  3GZY B;  5IEN A;  3EX9 A;  1W00 A;  3FH1 A;  2STD A;  1S5A A;  5IEP A;  1O7H B;  3OWY A;  3KSP A;  4HVN A;  1E3R A;  3WMD A;  2F99 A;  5FW5 A;  2UX0 A;  2XR8 B;  3DM8 A;  4XDV A;  4HKV B;  5CK6 A;  2RCD A;  1AR0 A;  4OUQ A;  4HZ9 B;  4L8P A;  4HM2 B;  4RZM A;  3SOA A;  3IPT A;  2RFR A;  5EVH A;  3F14 A;  3CPO A;  4WYK A;  3B4O A;  3GRD A;  4XBT A;  4CDL A;  4X2H A;  3OWU A;  4WP5 A;  2JQ5 A;  5JPU A;  5BVB A;  5AEW B;  3MKI A;  3DXO A;  3EJV A;  1JKG B;  3JUP A;  2BMQ B;  3GZB A;  1GYB A;  4PEJ A;  2A15 A;  4H3U A;  3UJM A;  4HM3 B;  1VZZ A;  3F8H A;  3EBT A;  2K54 A;  3T8N A;  3MG3 A;  5DRV A;  1UUW B;  4HM1 B;  1OGZ A;  3ECF A;  5AIG A;  2GEX A;  1O7N B;  4I4K A;  4XB5 A;  3D9R A;  1ULI B;  5CF1 A;  1GY6 A;  3K0Z A;  4K1V A;  3ROB A;  1JB4 A;  5STD A;  4WYK B;  4XM4 A;  5AEU B;  4L7K A;  1BUQ A;  3KE7 A;  3SOY A;  3F7X A;  3G0K A;  1OHO A;  2OWP A;  1QJG A; 
#chains in the Genus database with same CATH topology
 4AKY A;  3KZT A;  3KN4 A;  1WQL B;  3GAX A;  3LTB A;  1RGE A;  1ASK A;  2Z6B A;  4N6T A;  4RNZ A;  4I5Q A;  1QAK A;  2F5M A;  1JB2 A;  2W03 A;  4HBR A;  1NWW A;  2XF3 A;  3F7S A;  2YFL B;  3DUK A;  2QGU A;  2CFK A;  1VQ4 3;  2ML5 A;  1YGE A;  3HI7 A;  1SQW A;  3KFQ C;  2PNC A;  4G1M B;  5D82 A;  1ROV A;  3DH2 A;  3SED A;  2ZA4 A;  2Z76 A;  1FUW A;  5M18 A;  1O7W B;  1RNT A;  2F4Y A;  2C10 A;  4RBN A;  3AHW A;  1UW1 A;  3B4P A;  4JRF A;  1YVB I;  2BMO B;  2GSP A;  3FSD A;  2GBX B;  1JJ2 2;  1EQK A;  1LRA A;  3DZL A;  3Q3F A;  4NPB A;  4STD A;  3GSP A;  2CWU A;  8CHO A;  3J7Y d;  1M90 4;  5IEN A;  3MPH A;  1RJO A;  1I3F A;  1TJD A;  2IMJ A;  4U13 A;  1S72 3;  3EN1 B;  3LOY A;  1X1W A;  3PYJ A;  3B7C A;  4CPK A;  1W2B 2;  4EBG A;  2QEX 3;  3U1W A;  3BB9 A;  3CNX A;  3F40 A;  3BU4 A;  2Z7A A;  4AKZ A;  1G02 A;  3F9S A;  1ZO2 A;  1YJ9 3;  3D3L A;  4LMI A;  6RNT A;  7STD A;  4OVM A;  5IG5 A;  3BLZ A;  1BNJ A;  5D83 A;  2CFD A;  1ZS7 A;  3NX0 A;  4WFO A;  3G4S 3;  2CFW A;  4R1K A;  1K41 A;  3NUV A;  2GBW B;  4H61 A;  3BND A;  3NQY A;  3NV0 A;  3MWZ A;  3PS8 A;  2P38 A;  3FGY A;  1RDS A;  1BRN L;  4BU4 A;  2YFI B;  3FF0 A;  1CQS A;  2INX A;  4KZ1 A;  1UCI A;  4MEI A;  3JUO A;  4HZB B;  3KCH A;  4LEH A;  5IG0 A;  3DGM A;  1RN1 A;  1E97 A;  2UUG C;  3DGO A;  5G1K A;  1RGK A;  1AVL A;  1RGA A;  3EBY A;  3EB8 A;  3KSE D;  5IG4 A;  2W9Q A;  4N6V 0;  3CXC 2;  3UB1 A;  3OW2 2;  3EN8 A;  2OCT A;  1ISK A;  3AGO A;  1WNH A;  2CIU A;  3EQQ B;  1FYS A;  5KP4 A;  1BU4 A;  2PZV A;  1VQK 3;  4RNY A;  3STD A;  1N5P A;  2MF7 A;  2ZHX B;  3HK4 A;  5D81 A;  7GSP A;  3CNM A;  3HOH A;  1C54 A;  5KP3 A;  1GY7 A;  3I0Y A;  3JUQ A;  3NM2 A;  3JUN A;  1Q81 4;  2CG0 A;  2SAR A;  1BRH A;  1QVG 2;  5AIH A;  1IV7 A;  2QIY A;  2R41 A;  3D4A A;  4O8S A;  4MJD A;  1R4Y A;  4R9K A;  1F8N A;  3SVA A;  3G71 3;  1BSE A;  1BVI A;  1YHQ 3;  1OHP A;  2AAD A;  1MGR A;  3E99 A;  4GB5 A;  2BU4 A;  2WOF A;  3PCS A;  5AYR B;  3CCU 3;  1W6Y A;  1FGO A;  2XFT A;  1LNI A;  5ELJ A;  3WA3 A;  1YJW 3;  1J2B A;  5JBS A;  4N3V A;  5CXO A;  4GSP A;  1YI2 3;  1GS3 A;  1TIJ A;  2LQV A;  4BTW A;  4K1U A;  2RBI A;  3ZG5 A;  1US1 A;  1MWU A;  4OK0 A;  1OF5 A;  1KSI A;  4N6O B;  1VQN 3;  2BNG A;  5M1A A;  4K90 B;  5A0O B;  3OX9 A;  4FCM A;  1BNE A;  1O7G B;  1OUN A;  1W4N A;  5EEO A;  1I2E A;  1JRQ A;  2CKF B;  3PGB A;  5KP1 A;  3FG4 A;  3VSY A;  3MG1 A;  2W56 B;  1RRH A;  1STD A;  4XBX A;  1Q40 A;  3PCR A;  3FG1 A;  3GWR A;  2B1X B;  1NDO B;  2B24 B;  3T8U A;  3ZG0 A;  1B27 A;  2GU1 A;  3K9M C;  3B8L A;  3K7C A;  1BAO A;  1IVV A;  3NV0 B;  1RLS A;  1STF I;  2RNT A;  1VQP 3;  3URP A;  3CPW 2;  4ORL A;  3LZA A;  1ZX2 A;  1EG9 B;  4FR9 A;  2E2V A;  2H0I A;  4EW5 A;  2XFS A;  1MWR A;  1TRP A;  1LQG C;  4EV2 A;  1BUJ A;  1PU4 A;  1G0T A;  2D1W A;  2MC8 A;  1Q7H A;  3EF8 A;  2JDI H;  3ER7 A;  5IF6 A;  5JPP A;  1N5H A;  2HMN B;  2K3D A;  2BMR B;  2HMM B;  3DY5 A;  7RNT A;  1X1U A;  4FMC A;  1PY3 A;  1U5O A;  3X41 A;  4BTX A;  3PZW A;  3WA2 X;  5CF2 A;  6GSP A;  4NHF A;  1T2I A;  1V58 A;  4O02 B;  1Q9E A;  3I56 3;  2HMK B;  3DMC A;  3V92 A;  4HM6 B;  4HM8 B;  1LXE A;  2H0H A;  3GZX B;  1FUS A;  2V1L A;  1V74 A;  2R4I A;  1N9E A;  1GSP A;  4L8O A;  3RGA A;  1I2F A;  3UNL A;  4FCJ A;  3IMA B;  1I0X A;  2CH9 A;  4Q53 A;  2BT3 A;  4HM5 B;  1MWT A;  2F56 A;  1BSD A;  3MHE A;  1KD1 4;  3BNC A;  3KKG A;  2XRX B;  3QRD A;  3CCJ 3;  4FMD A;  3CC7 3;  2L1S A;  2F98 A;  1BRJ A;  1X1Y A;  2IYJ A;  2IUJ A;  3FLJ A;  5DRE A;  4LSO A;  3LTC A;  4J9A A;  1C7H A;  4HM0 B;  1CYU A;  5AIF A;  3D79 A;  1RRL A;  4XDW A;  1OF5 B;  1UI7 A;  3NXJ A;  2F5W A;  1V57 A;  3G16 A;  3UL6 A;  1Q86 4;  1DVD A;  3LXU X;  1QVF 2;  2XEP A;  2KF6 A;  1NNV A;  1N9J A;  3F8X A;  1Q40 B;  1YVS A;  1GOV A;  1BRS A;  1RGH A;  3FZW A;  3M8C A;  2ZDJ A;  2W56 A;  4O3V A;  3HX8 A;  1I8V A;  1VQM 3;  4LGQ A;  4ZM8 A;  2XH9 A;  1SJW A;  2C11 A;  1I0V A;  4WWU C;  4JF8 A;  2E2U A;  5AYS C;  2WOH A;  4O2H A;  3V99 A;  5BU4 A;  1IK3 A;  2KF5 A;  1BSA A;  1RSN A;  1W6C A;  1WMN A;  3BNE A;  1VQ8 3;  2WO0 A;  1BNS A;  3X3Z A;  2W9P A;  3N8B A;  4IIA A;  5HOH A;  1L5G B;  1Q7Y 4;  4K61 A;  4X2O A;  3SXX A;  1UCL A;  2H0G A;  1JB5 A;  1ULJ B;  1TUH A;  1R4C A;  3FF2 A;  3G8Z A;  1NJI 4;  1AVK A;  1OGX A;  3H51 A;  1JN5 A;  1UGH I;  2HMJ B;  1T5Y A;  2OTJ 3;  1KWI A;  1UUG B;  3DGN A;  4MMY B;  1DYU A;  2K0M A;  3O8Y A;  1I2G A;  3H3H A;  4FCZ A;  2Z77 A;  3G6E 3;  2O9U X;  5BXQ A;  1B21 A;  2UGI A;  4XBY A;  3WDG B;  5RNT A;  3JVC A;  3WR2 A;  3U97 A;  3A76 A;  6STD A;  1RGG A;  1QMA A;  5AII A;  1BOX A;  2Y74 A;  1I70 A;  3S67 A;  3MSO A;  3OV4 A;  3X42 A;  1D6Z A;  1RMS A;  4MMX B;  5FGO A;  1DMM A;  3OXA A;  3LT9 A;  3AGN A;  5IEO A;  1TP6 A;  3FKA A;  2CFL A;  1GY5 A;  1VQO 3;  4J5G A;  1HYF A;  3DGL A;  1FA3 A;  1A90 A;  2P05 A;  4LYL B;  1ROA A;  4J5K A;  1W7C A;  3N9H A;  3EC9 A;  3CU3 A;  4FMB A;  2CHC A;  2OTL 3;  2W6J H;  1FW7 A;  1SPU A;  3ALA A;  1W02 A;  1B2Z A;  1I3I A;  4HJL B;  3QK9 A;  3UL5 A;  1JZD A;  3I55 3;  1OH0 A;  1B2M A;  4DKI A;  1RCL A;  1A2K A;  1GMQ A;  2BIR A;  2QA4 3;  2SBL A;  2GEY A;  3L0R A;  2FNQ A;  4KFE A;  1B2X A;  2WGO A;  3AMO A;  3K63 A;  3VF1 A;  3MYT A;  2HMO B;  3NBR A;  5IER A;  2GU3 A;  3OWS A;  4HM7 B;  2CG1 A;  3T0U A;  1T2H A;  2GXF A;  3IJE B;  3NHX A;  4KFF A;  2P0X A;  3WOD G;  1RTU A;  3LYG A;  5HGR A;  1RGC A;  3SYU A;  1FZU A;  4CCV A;  4IPB A;  3X3Y A;  1KC8 4;  1B20 A;  1O7M B;  1LOV A;  1RN4 A;  1VQ7 3;  1BNR A;  1IDP A;  1W2Z A;  1DMN A;  1LOX A;  2I9W A;  4J8T A;  3CCE 3;  1EA2 A;  2KRT A;  1FGM A;  3RNT A;  1YGW A;  1JNQ A;  4EC6 A;  1JBT A;  3JUM A;  2FGT A;  2Y73 A;  1NU3 A;  4WHA A;  1VQL 3;  1HKX A;  1BSB A;  5TGN A;  5GSP A;  1JN5 B;  3V98 A;  1LOW A;  3WOF B;  2Q07 A;  3EHC A;  4HYZ A;  4BTY A;  1YNV X;  3S5C A;  1B2U A;  1AV4 A;  5G2G A;  4AEQ A;  9RNT A;  1E3V A;  1OCV A;  2BHM A;  1K73 4;  2KCD A;  3HZP A;  1Y4K A;  3CCQ 3;  5ELU A;  1IVU A;  1HU9 A;  2YFJ B;  2RSX A;  3RDE A;  2OQE C;  1RKY A;  1OPY A;  1GOU A;  3CCM 3;  1M1X B;  1TFK A;  1PFP A;  1TFO A;  2HML B;  1B3S A;  2XSO B;  1Z1S A;  4HM4 B;  4R4K A;  5M19 A;  2BO9 B;  1SII A;  3MG2 A;  2W2C A;  3HII A;  3CCL 3;  1IV9 A;  1Q42 A;  4N6U A;  5AI1 A;  2ML6 A;  4KVH A;  5CLK A;  1B2S A;  1DET A;  3S27 A;  2RGQ A;  3Q90 A;  1BRI A;  1GD4 A;  1DMQ A;  3AHS A;  1TU5 A;  1K9M 4;  4MMZ B;  2KAA A;  1UCK A;  4EXR A;  3CC2 3;  1YJN 3;  2IY2 A;  3GZR A;  1IU7 A;  3RGR A;  3TDG A;  3VGN A;  5IG3 A;  1EEJ A;  1OHS A;  1W01 A;  2C4B A;  1JKG A;  4R9L A;  1JBR A;  1UCJ A;  1IVW A;  1JV2 B;  1UI8 A;  2F86 B;  1UUV B;  3NBJ A;  3FG3 A;  2XSH B;  5LC6 A;  1O7P B;  3GZY B;  2CW9 A;  4KT3 B;  2M7O A;  2OOV A;  2J8X B;  3AMO B;  3EX9 A;  1QAF A;  4BL3 A;  3CCR 3;  1W00 A;  2CK3 H;  1AY7 A;  1G96 A;  3FH1 A;  2HOH A;  2CC3 A;  1NB3 I;  1MGW A;  2STD A;  1S5A A;  4GHO A;  3N54 B;  1BGS A;  5IEP A;  4TX4 A;  1O7H B;  3KSP A;  2E2T A;  3OWY A;  3ZFZ A;  3CCS 3;  1GMP A;  4HVN A;  1HZ1 A;  3WOE B;  3NQZ A;  2OQE A;  1E3R A;  4BIR A;  1BAN A;  1YIJ 3;  1BNI A;  3WHO A;  3WMD A;  2F99 A;  2CX0 A;  3LTD A;  4KFD A;  2UX0 A;  5FW5 A;  1RHL A;  4EV5 A;  1IQ8 A;  2P09 A;  2XR8 B;  3DM8 A;  4N6N B;  4QWT A;  2W04 A;  4XDV A;  4HKV B;  5CK6 A;  1RN7 A;  1BRG A;  2RCD A;  3X3X A;  3Q2P A;  1BSC A;  1N8R 4;  1AR0 A;  1QAL A;  4OUQ A;  4HZ9 B;  4L8P A;  1IYY A;  1Q82 4;  4HM2 B;  4RZM A;  3SOA A;  1A2V A;  1GMR A;  2W0Q A;  3IPT A;  4CJN A;  2RFR A;  4N6M A;  1EUI C;  1T3B A;  1BNG A;  3NBB A;  3FCS B;  5EVH A;  3A5E A;  1X1X A;  3F14 A;  1CYV A;  1JZO A;  1D6U A;  2O3O A;  3CPO A;  4LZI A;  3CMA 3;  3KII A;  4N6L A;  4WYK A;  1IT7 A;  1K8A 4;  1M1K 4;  1LNH A;  2ZL8 A;  3D5I A;  4HOH A;  3B4O A;  5I97 A;  1VQ9 3;  1ZGX A;  2AAE A;  3CD6 3;  3GRD A;  4XBT A;  1YIT 3;  1DE3 A;  2CX1 A;  4ILF A;  4CDL A;  1VQ6 3;  2KXG A;  4X2H A;  3OWU A;  4WP5 A;  2JQ5 A;  3NM7 A;  5JPU A;  5BVB A;  5AEW B;  1N8Q A;  1IVX A;  1IT8 A;  3MKI A;  1IQY A;  3DXO A;  2IUK A;  1MNL A;  2FXT A;  3EJV A;  1JKG B;  1BRK A;  1RCK A;  2IA7 A;  1W6G A;  3JUP A;  2BMQ B;  1A2P A;  1FGQ A;  1KQS 2;  3CC4 3;  3BNB A;  1GOY A;  1GYB A;  3GZB A;  2A15 A;  4PEJ A;  1JBS A;  1VQ5 3;  2CWT A;  4H3U A;  3BIR A;  3PXM A;  3CME 3;  1MWS A;  3UJM A;  1FGR A;  1PYL A;  2P0M A;  2CFG A;  1LQM B;  1D6Y A;  1AQZ A;  3S29 A;  5IW9 A;  1SAR A;  2L4V A;  3LH4 A;  4HM3 B;  1MOL A;  2KF4 A;  1NB5 I;  4R80 A;  1VZZ A;  1WTH A;  2KF3 A;  2CWV A;  3F8H A;  1GD3 A;  3EBT A;  4EYC A;  3SLU A;  1SIH A;  1W5Z A;  4GL6 A;  3D5G A;  2K54 A;  1LVN A;  2YX9 A;  3Q1C A;  1RGL A;  2D42 A;  3EE1 A;  3T8N A;  1WMO A;  1OAC A;  3MG3 A;  4RNT A;  5DRV A;  1UUW B;  5BIR A;  1BIR A;  2OOV C;  3S28 A;  5G1L A;  4HM1 B;  1OGZ A;  1DVC A;  3ECF A;  5AIG A;  1A67 A;  1UGI A;  2GEX A;  1M9G A;  3K5T A;  1O7N B;  4HAA A;  4I4K A;  1U8C B;  1CEW I;  3HIG A;  4XB5 A;  2LYX A;  3D9R A;  1EKM A;  1ULI B;  4NRE A;  5CF1 A;  1GY6 A;  1WMP A;  1TRQ A;  3K0Z A;  4K1V A;  1VQQ A;  5LC7 A;  1CH0 A;  1UDI I;  1FUT A;  3ROB A;  1JB4 A;  4FMA A;  5STD A;  2XGL A;  4WYK B;  4XM4 A;  1LOY A;  1FGT A;  5AEU B;  4L7K A;  1BNF A;  5EQL A;  8RNT A;  3LML A;  1RNB A;  1BUQ A;  1TTO A;  4BL2 A;  3X40 A;  3LT8 A;  2WGQ A;  3LTA A;  1K28 A;  1IQX A;  3KE7 A;  3SOY A;  3DGY A;  3F7X A;  3SX1 A;  1NO3 A;  3G0K A;  2XGN A;  3CCV 3;  1OHO A;  4IT7 A;  1RGF A;  2OWP A;  1QJG A; 
#chains in the Genus database with same CATH homology
 4AKY A;  3KZT A;  3KN4 A;  1WQL B;  3GAX A;  3LTB A;  4N6T A;  1ASK A;  2Z6B A;  4RNZ A;  1QAK A;  1JB2 A;  2W03 A;  4HBR A;  1NWW A;  2XF3 A;  3F7S A;  2YFL B;  3DUK A;  2QGU A;  2CFK A;  1VQ4 3;  2ML5 A;  1YGE A;  3HI7 A;  1SQW A;  3KFQ C;  2PNC A;  4G1M B;  5D82 A;  1ROV A;  3SED A;  2Z76 A;  1FUW A;  1O7W B;  2C10 A;  4RBN A;  1UW1 A;  3B4P A;  4JRF A;  1YVB I;  2BMO B;  3FSD A;  2GBX B;  1JJ2 2;  1EQK A;  3DZL A;  4STD A;  2CWU A;  8CHO A;  3J7Y d;  1M90 4;  3MPH A;  1RJO A;  2IMJ A;  4U13 A;  1S72 3;  3EN1 B;  3LOY A;  3PYJ A;  3B7C A;  1W2B 2;  4EBG A;  2QEX 3;  3U1W A;  3BB9 A;  3CNX A;  3F40 A;  2Z7A A;  4AKZ A;  3F9S A;  1ZO2 A;  1YJ9 3;  3D3L A;  4LMI A;  7STD A;  4OVM A;  5IG5 A;  3BLZ A;  5D83 A;  2CFD A;  3NX0 A;  4WFO A;  3G4S 3;  2CFW A;  4R1K A;  1K41 A;  3NUV A;  2GBW B;  4H61 A;  3BND A;  3NQY A;  3NV0 A;  3MWZ A;  3PS8 A;  2P38 A;  3FGY A;  2YFI B;  3FF0 A;  1CQS A;  2INX A;  4KZ1 A;  4MEI A;  3JUO A;  4HZB B;  4LEH A;  5IG0 A;  3DGM A;  1E97 A;  3DGO A;  1AVL A;  3EBY A;  3EB8 A;  3KSE D;  5IG4 A;  2W9Q A;  4N6V 0;  3CXC 2;  3UB1 A;  3OW2 2;  3EN8 A;  2OCT A;  1ISK A;  1WNH A;  2CIU A;  3EQQ B;  5KP4 A;  2PZV A;  1VQK 3;  4RNY A;  3STD A;  1N5P A;  2MF7 A;  3HK4 A;  5D81 A;  3CNM A;  5KP3 A;  1GY7 A;  3I0Y A;  3JUQ A;  3NM2 A;  3JUN A;  1Q81 4;  2CG0 A;  1QVG 2;  5AIH A;  1IV7 A;  2QIY A;  4O8S A;  4MJD A;  4R9K A;  1F8N A;  3SVA A;  3G71 3;  1YHQ 3;  1OHP A;  3E99 A;  4GB5 A;  2WOF A;  3PCS A;  5AYR B;  3CCU 3;  1W6Y A;  1FGO A;  2XFT A;  5ELJ A;  3WA3 A;  1YJW 3;  1J2B A;  5JBS A;  4N3V A;  5CXO A;  1YI2 3;  1GS3 A;  1TIJ A;  2LQV A;  4BTW A;  4K1U A;  1US1 A;  4OK0 A;  1OF5 A;  1KSI A;  4N6O B;  1VQN 3;  2BNG A;  5A0O B;  4K90 B;  3OX9 A;  4FCM A;  1O7G B;  1OUN A;  1W4N A;  5EEO A;  1JRQ A;  2CKF B;  3PGB A;  5KP1 A;  3FG4 A;  3VSY A;  3MG1 A;  2W56 B;  1RRH A;  1STD A;  4XBX A;  1Q40 A;  3PCR A;  3FG1 A;  3GWR A;  2B1X B;  1NDO B;  2B24 B;  3T8U A;  2GU1 A;  3K9M C;  3B8L A;  3K7C A;  1IVV A;  3NV0 B;  1STF I;  1VQP 3;  3CPW 2;  4ORL A;  3LZA A;  1ZX2 A;  1EG9 B;  4FR9 A;  2E2V A;  2XFS A;  4EV2 A;  1PU4 A;  2D1W A;  2MC8 A;  3EF8 A;  3ER7 A;  2JDI H;  5IF6 A;  5JPP A;  1N5H A;  2HMN B;  2BMR B;  2HMM B;  3DY5 A;  4FMC A;  1U5O A;  3X41 A;  4BTX A;  3PZW A;  3WA2 X;  5CF2 A;  4NHF A;  4O02 B;  3I56 3;  2HMK B;  3DMC A;  3V92 A;  4HM6 B;  4HM8 B;  1LXE A;  3GZX B;  2V1L A;  1V74 A;  2R4I A;  1N9E A;  4L8O A;  3RGA A;  3UNL A;  4FCJ A;  3IMA B;  2CH9 A;  4Q53 A;  2BT3 A;  4HM5 B;  1KD1 4;  3MHE A;  3BNC A;  3KKG A;  2XRX B;  3QRD A;  3CCJ 3;  4FMD A;  3CC7 3;  2F98 A;  2IUJ A;  3FLJ A;  5DRE A;  4LSO A;  3LTC A;  4J9A A;  1C7H A;  4HM0 B;  1CYU A;  5AIF A;  1RRL A;  4XDW A;  1OF5 B;  1UI7 A;  3NXJ A;  3G16 A;  3UL6 A;  1Q86 4;  1DVD A;  3LXU X;  1QVF 2;  2XEP A;  1N9J A;  3F8X A;  1Q40 B;  3M8C A;  3FZW A;  2ZDJ A;  2W56 A;  4O3V A;  3HX8 A;  1VQM 3;  4LGQ A;  4ZM8 A;  2XH9 A;  1SJW A;  2C11 A;  4WWU C;  4JF8 A;  2E2U A;  5AYS C;  2WOH A;  4O2H A;  3V99 A;  1IK3 A;  3BNE A;  1WMN A;  1W6C A;  1VQ8 3;  2WO0 A;  3X3Z A;  2W9P A;  3N8B A;  4IIA A;  1L5G B;  1Q7Y 4;  4K61 A;  4X2O A;  3SXX A;  1JB5 A;  1ULJ B;  1TUH A;  1R4C A;  3FF2 A;  3G8Z A;  1NJI 4;  1AVK A;  1OGX A;  3H51 A;  1JN5 A;  2HMJ B;  1T5Y A;  2OTJ 3;  1KWI A;  3DGN A;  4MMY B;  1DYU A;  2K0M A;  3O8Y A;  3H3H A;  4FCZ A;  2Z77 A;  3G6E 3;  2O9U X;  5BXQ A;  4XBY A;  3WDG B;  3JVC A;  3U97 A;  3A76 A;  6STD A;  1QMA A;  5AII A;  2Y74 A;  3S67 A;  3MSO A;  3OV4 A;  3X42 A;  1D6Z A;  4MMX B;  5FGO A;  1DMM A;  3OXA A;  3LT9 A;  5IEO A;  1TP6 A;  3FKA A;  2CFL A;  1GY5 A;  1VQO 3;  3DGL A;  1FA3 A;  1A90 A;  2P05 A;  1ROA A;  1W7C A;  3N9H A;  3EC9 A;  3CU3 A;  4FMB A;  2CHC A;  2OTL 3;  2W6J H;  1SPU A;  3ALA A;  1W02 A;  4HJL B;  3QK9 A;  3UL5 A;  3I55 3;  1OH0 A;  1A2K A;  2QA4 3;  2SBL A;  2GEY A;  3L0R A;  2FNQ A;  4KFE A;  2WGO A;  3AMO A;  3K63 A;  3VF1 A;  3MYT A;  2HMO B;  3NBR A;  5IER A;  2GU3 A;  3OWS A;  4HM7 B;  2CG1 A;  3T0U A;  2GXF A;  3IJE B;  3NHX A;  4KFF A;  3WOD G;  2P0X A;  3LYG A;  5HGR A;  4CCV A;  4IPB A;  3X3Y A;  1KC8 4;  1O7M B;  1VQ7 3;  1IDP A;  1W2Z A;  1DMN A;  1LOX A;  2I9W A;  4J8T A;  3CCE 3;  1EA2 A;  2KRT A;  1FGM A;  1JNQ A;  4EC6 A;  3JUM A;  2FGT A;  2Y73 A;  1NU3 A;  4WHA A;  1VQL 3;  1HKX A;  5TGN A;  1JN5 B;  3V98 A;  3WOF B;  2Q07 A;  3EHC A;  4HYZ A;  4BTY A;  3S5C A;  1AV4 A;  5G2G A;  4AEQ A;  1E3V A;  1OCV A;  2BHM A;  1K73 4;  2KCD A;  3HZP A;  1Y4K A;  3CCQ 3;  5ELU A;  1IVU A;  1HU9 A;  2YFJ B;  2RSX A;  3RDE A;  2OQE C;  1RKY A;  1OPY A;  3CCM 3;  1M1X B;  1TFK A;  1PFP A;  1TFO A;  2HML B;  4HM4 B;  2XSO B;  1Z1S A;  4R4K A;  2BO9 B;  1SII A;  3MG2 A;  2W2C A;  3HII A;  3CCL 3;  1IV9 A;  1Q42 A;  4N6U A;  5AI1 A;  2ML6 A;  4KVH A;  5CLK A;  3S27 A;  2RGQ A;  3Q90 A;  1GD4 A;  1DMQ A;  1TU5 A;  1K9M 4;  4MMZ B;  4EXR A;  3CC2 3;  1YJN 3;  3GZR A;  5IG3 A;  1IU7 A;  3RGR A;  3TDG A;  3VGN A;  1OHS A;  1W01 A;  1JKG A;  4R9L A;  1IVW A;  1JV2 B;  1UI8 A;  2F86 B;  1UUV B;  3NBJ A;  3FG3 A;  2XSH B;  5LC6 A;  1O7P B;  3GZY B;  2CW9 A;  2OOV A;  2M7O A;  5IEN A;  3AMO B;  3EX9 A;  1QAF A;  3CCR 3;  1W00 A;  2CK3 H;  1G96 A;  3FH1 A;  2CC3 A;  1NB3 I;  2STD A;  1S5A A;  3N54 B;  5IEP A;  4TX4 A;  1O7H B;  3KSP A;  2E2T A;  3OWY A;  3CCS 3;  4HVN A;  3WOE B;  3NQZ A;  2OQE A;  1E3R A;  1YIJ 3;  3WMD A;  2F99 A;  3LTD A;  4KFD A;  2UX0 A;  5FW5 A;  4EV5 A;  1IQ8 A;  2P09 A;  2XR8 B;  3DM8 A;  4N6N B;  4QWT A;  2W04 A;  4XDV A;  4HKV B;  5CK6 A;  1RN7 A;  2RCD A;  3X3X A;  3Q2P A;  1N8R 4;  1AR0 A;  1QAL A;  4OUQ A;  4HZ9 B;  4L8P A;  1Q82 4;  4HM2 B;  4RZM A;  3SOA A;  1A2V A;  2W0Q A;  3IPT A;  2RFR A;  4N6M A;  3NBB A;  3FCS B;  5EVH A;  3F14 A;  1CYV A;  2O3O A;  1D6U A;  3CPO A;  4LZI A;  3CMA 3;  3KII A;  4N6L A;  4WYK A;  1IT7 A;  1K8A 4;  1M1K 4;  1LNH A;  2ZL8 A;  5I97 A;  1VQ9 3;  3B4O A;  3CD6 3;  3GRD A;  4XBT A;  1YIT 3;  4CDL A;  1VQ6 3;  2KXG A;  4X2H A;  3OWU A;  4WP5 A;  2JQ5 A;  3NM7 A;  5JPU A;  5BVB A;  5AEW B;  1N8Q A;  1IVX A;  1IT8 A;  3MKI A;  1IQY A;  3DXO A;  2IUK A;  1MNL A;  2FXT A;  3EJV A;  1JKG B;  3JUP A;  2IA7 A;  1W6G A;  2BMQ B;  1KQS 2;  1FGQ A;  3CC4 3;  3BNB A;  1GYB A;  3GZB A;  4PEJ A;  2A15 A;  1VQ5 3;  2CWT A;  4H3U A;  3PXM A;  3CME 3;  3UJM A;  1FGR A;  2P0M A;  2CFG A;  1D6Y A;  3S29 A;  5IW9 A;  2L4V A;  3LH4 A;  4HM3 B;  1MOL A;  1NB5 I;  4R80 A;  1VZZ A;  1WTH A;  2CWV A;  3F8H A;  1GD3 A;  3EBT A;  4EYC A;  3SLU A;  1SIH A;  1W5Z A;  4GL6 A;  2K54 A;  1LVN A;  2YX9 A;  3Q1C A;  2D42 A;  3EE1 A;  3T8N A;  1WMO A;  1OAC A;  3MG3 A;  5DRV A;  1UUW B;  2OOV C;  3S28 A;  4HM1 B;  1OGZ A;  1DVC A;  3ECF A;  5AIG A;  1A67 A;  2GEX A;  3K5T A;  1M9G A;  1O7N B;  4I4K A;  1U8C B;  1CEW I;  3HIG A;  4XB5 A;  2LYX A;  3D9R A;  1EKM A;  1ULI B;  4NRE A;  5CF1 A;  1GY6 A;  1WMP A;  3K0Z A;  4K1V A;  5LC7 A;  3ROB A;  1JB4 A;  4FMA A;  5STD A;  2XGL A;  4WYK B;  4XM4 A;  1FGT A;  5AEU B;  4L7K A;  5EQL A;  3LML A;  1BUQ A;  3X40 A;  3LT8 A;  2WGQ A;  3LTA A;  1K28 A;  1IQX A;  3KE7 A;  3SOY A;  3SX1 A;  3F7X A;  1NO3 A;  3G0K A;  2XGN A;  3CCV 3;  1OHO A;  4IT7 A;  2OWP A;  1QJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...