3WMDA

Crystal structure of epoxide hydrolase monbi
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
144
Chain Sequence
MNEFARKKRALEHSRRINAGDLDAIIDLYAPDAVLEDPVGLPPVTGHDALRAHYEPLLAAHLREEAAEPVAGQDATHALIQISSVMDYLPVGPLYAERGWLKAPDAPGTARIHRTAMLVIRMDASGLIRHLKSYWGTSDLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric regulation of epoxide opening cascades by a pair of epoxide hydrolases in monensin biosynthesis
pubmed doi rcsb
source organism Streptomyces cinnamonensis
molecule tags Isomerase
molecule keywords Probable monensin biosynthesis isomerase
total genus 41
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wmdA00
3B7CA 5BXQA 3MSOA 3CNXA 2R4IA 1NU3A 1CQSA 1OF5B 3LYGA 3KE7A 4J9AA 4HM4B 1SJWA 4K1VA 4RZMA 7STDA 2GBXB 1WQLB 3ER7A 3K0ZA 3M8CA 2B24B 3NHXA 3KSPA 3MG2A 5CXOA 1UUVB 3UJMA 4X2HA 1OGZA 1JN5A 3EN1B 3NM2A 2HMLB 3EQQB 3OV4A 8CHOA 3CPOA 2OWPA 5STDA 1QJGA 1ISKA 5AIGA 1A2KA 3DM8A 3EJVA 3VSYA 3G0KA 3FH1A 3EN8A 2Z76A 3GZYB 3MHEA 4HM5B 3WMDA 4HJLB 3GZXB 4IIAA 4X2OA 3DZLA 5G2GA 1UUWB 2QGUA 4HM0B 2UX0A 1EA2A 3K7CA 4H3UA 4XBYA 3GZRA 2HMKB 3EF8A 2Z77A 5D82A 1O7GB 4I4KA 4HVNA 5AIFA 2W2CA 2XSOB 1O7HB 3NUVA 3H3HA 3OX9A 3EC9A 4HZ9B 4FCJA 1GY6A 1O7NB 1JKGB 1HKXA 1QMAA 2F98A 3FKAA 2BMRB 2STDA 3GWRA 3OWUA 4XM4A 2RFRA 5D83A 3T8NA 3JUOA 1O7WB 3HK4A 3EBYA 3MKIA 4WWUC 1ASKA 1S5AA 1JB4A 5CF1A 4L8PA 4LGQA 4L7KA 1GY5A 5KP3A 3JUMA 1DMMA 3A76A 3Q90A 2RCDA 3B8LA 2I9WA 1NWWA 2Z7AA 3I0YA 2CKFB 1IDPA 1ULJB 4XB5A 4OUQA 4LEHA 2K54A 4ORLA 2F99A 3D9RA 5DREA 4FCMA 5IENA 1GY7A 3ECFA 3BLZA 3GZBA 2A15A 4XBTA 1VZZA 3F14A 4N3VA 5BVBA 1W6YA 3H51A 4Q53A 3ROBA 1OH0A 2PZVA 2B1XB 2HMNB 1OPYA 4K1UA 4J8TA 2GBWB 5CLKA 3G8ZA 5CF2A 4U13A 3FLJA 1JB5A 1E3RA 3F8XA 3NV0B 4CDLA 5D81A 1C7HA 3F7SA 2RGQA 4PEJA 3UNLA 3EBTA 4WYKB 1DMNA 2INXA 3NV0A 4GB5A 4R9LA 3VGNA 5CK6A 5AEUB 5IG5A 5HGRA 5KP1A 2XSHB 3B4PA 4WYKA 3GRDA 5AEWB 3SOYA 1W00A 3S5CA 4WP5A 4LMIA 1JB2A 5AIHA 3BB9A 5TGNA 2GEYA 2HMJB 5IEPA 1ZX2A 1AR0A 1Z1SA 3FZWA 5IERA 4HM1B 5JPUA 3MG1A 1TP6A 1U5OA 3HZPA 1JN5B 3FF0A 5AIIA 3DUKA 5IF6A 3OXAA 3CNMA 3STDA 1ULIB 2BNGA 3DXOA 3G16A 1OHPA 1JKGA 2BMQB 3LZAA 3MG3A 4HKVB 3F7XA 4HM3B 4OVMA 4XDVA 1O7PB 3JUQA 5IG0A 1OHSA 3IPTA 3NXJA 3T8UA 2JQ5A 1DMQA 5EVHA 5KP4A 4HM7B 1K41A 3F9SA 3FSDA 3FGYA 3HX8A 1STDA 3JUNA 5IG3A 3NBRA 3OWYA 5JPPA 3B4OA 6STDA 2GXFA 2YFLB 1Q42A 2IMJA 3KKGA 3DMCA 3FF2A 4HM6B 2GEXA 5AI1A 1BUQA 3JUPA 2F86B 4HM2B 1OCVA 5IEOA 3CU3A 3RGAA 3RGRA 2QIYA 3EHCA 4HM8B 4L8OA 1Q40B 2XR8B 1E3VA 4XBXA 1GS3A 3E99A 3SOAA 2CHCA 5IG4A 1E97A 4STDA 1W02A 4R9KA 4MJDA 1Q40A 2BMOB 3F40A 1EG9B 2HMMB 2XRXB 4XDWA 2YFIB 1TUHA 1NDOB 3F8HA 1OHOA 1OGXA 1OUNA 2HMOB 3MYTA 2YFJB 4R1KA 5FW5A 5DRVA 1O7MB 4KVHA 3KZTA 3OWSA 3SEDA 1GYBA 1OF5A 3EX9A 4HZBB 1ZO2A 1W01A
chains in the Genus database with same CATH superfamily
3O8YA 2E2TA 3MWZA 2C10A 5HOHA 1A67A 2KXGA 1YNVX 2W04A 4HM4B 2CIUA 3LT9A 3M8CA 3MPHA 1A2VA 1VQM3 3CCM3 3TDGA 3CD63 3FG4A 4X2HA 1OGZA 2XH9A 2OQEA 1RRHA 3V98A 3EN1B 2AAEA 8CHOA 2OWPA 3CCJ3 3J7Yd 3HIIA 1RHLA 1EKMA 3Q2PA 5AIGA 3G713 3WMDA 1Q814 2Z76A 2CWTA 2Y74A 4FMAA 4IIAA 4NPBA 1VQO3 4X2OA 1D6YA 3DZLA 5BU4A 1QVF2 2OTJ3 1UUWB 2QGUA 2RNTA 2UX0A 3CC43 4N6MA 4XBYA 1FYSA 3GZRA 4AEQA 3EF8A 1TJDA 5D82A 2F56A 3D4AA 4HVNA 1RJOA 4MMZB 2W2CA 1R4YA 1UI7A 4RNZA 2CWUA 3LH4A 1B2SA 4N6OB 1O7NB 1HKXA 1EQKA 3NBBA 3FKAA 3NQZA 2W03A 2F4YA 1O7WB 1I3FA 2BO9B 1ASKA 4BL2A 1T2HA 3G4S3 1IT8A 1M1K4 1JNQA 3WOFB 1V74A 1VQ43 2Z7AA 1IDPA 1ULJB 1BANA 2C11A 2Q07A 4OUQA 1RMSA 2CWVA 3D9RA 5IENA 4FCMA 1T5YA 3AGNA 1IYYA 2XGLA 3BLZA 3GZBA 1IU7A 1DETA 3DH2A 4N3VA 4Q53A 1RRLA 3ROBA 1OH0A 1PFPA 3S29A 5M18A 1RN4A 5CLKA 5CF2A 2W6JH 3FLJA 4J5GA 4EXRA 3X41A 1UCIA 2CH9A 1RGAA 4K90B 1HZ1A 3EBTA 4RBNA 4J5KA 4WYKB 3NV0A 5M19A 3VGNA 5CK6A 5IG5A 1L5GB 1GMQA 3D79A 3B4PA 1S723 1BNFA 3GRDA 1YGEA 1WMPA 1YI23 4WFOA 2GEYA 3CME3 3PGBA 1RNTA 1RGGA 1Z1SA 1AVLA 3LTCA 1RN1A 5IF6A 1GSPA 3BIRA 4O3VA 2BNGA 1OHPA 1JKGA 4XDVA 2BU4A 4K61A 1OHSA 3IPTA 4G1MB 2K0MA 1UCJA 1VQQA 3FGYA 3UL6A 5I97A 3KSED 1R4CA 1LXEA 5IG3A 5JPPA 1RLSA 2YFLB 1Q42A 1V57A 1KD14 1BNRA 2GEXA 1BRIA 3LXUX 2WOFA 1G02A 1OCVA 2KF4A 2RSXA 2CHCA 1BU4A 1FGRA 1A90A 4STDA 2KF5A 3S67A 2W0QA 1TUHA 1VQL3 1OHOA 1OGXA 1UI8A 4R1KA 4N6V0 2ZDJA 5DRVA 2XEPA 1ROVA 1JBRA 1GYBA 3X3ZA 1OF5A 1ZS7A 3EX9A 1Q864 5BXQA 1RGCA 3CNXA 3MSOA 1QVG2 1B21A 1CQSA 1OF5B 3N54B 4BU4A 1UCLA 3LYGA 3Q1CA 4K1VA 2PNCA 4HAAA 4R80A 1K9M4 2GBXB 2CFGA 3WDGB 1JZOA 3T0UA 1Q824 2RBIA 3NM2A 3WHOA 1C54A 1KC84 5AYSC 3U1WA 2GSPA 4H61A 3G0KA 1B2XA 3MHEA 4HM5B 1BSCA 3X40A 3WODG 3HOHA 3GZXB 4HJLB 1MWTA 4HBRA 1RCLA 1SARA 1EA2A 1MGRA 2ZA4A 3DY5A 1IT7A 3K7CA 4H3UA 1DVDA 1BNJA 2HMKB 1BSDA 2Z77A 2L1SA 1FGQA 1O7GB 2IY2A 2P0MA 4I4KA 5IW9A 3FG1A 1N8R4 2XSOB 1O7HB 2F5MA 3U97A 1GMRA 5BIRA 2ML6A 3OX9A 3EC9A 3PCSA 4MMXB 1CH0A 4BTXA 2R41A 3OWUA 3K63A 2BMRB 1YJ93 5D83A 2KRTA 3AMOB 3T8NA 1FA3A 1WNHA 3DGNA 2CX0A 4LGQA 4N6TA 2E2VA 3RNTA 2CW9A 2UUGC 1BIRA 3Q90A 1YJN3 1W6GA 2RCDA 1RNBA 1WMNA 1NWWA 3I0YA 3GAXA 3KFQC 5G1LA 3LTDA 2F99A 3BNBA 1NO3A 1FGMA 3F14A 4XBTA 5BVBA 3H51A 1LQMB 1M904 1STFI 2PZVA 1UCKA 2OOVC 1RN7A 4LZIA 3D5IA 2GBWB 4J8TA 4ZM8A 4U13A 1GOUA 3WA3A 1B20A 1RCKA 3F8XA 4BL3A 1AV4A 1AY7A 1RGHA 1LQGC 2P05A 2RGQA 2YX9A 1CEWI 2WOHA 4KFFA 5G1KA 5GSPA 5LC7A 5EQLA 4GB5A 3A5EA 1YGWA 5KP1A 2XSHB 3CCL3 1K734 4N6NB 5FGOA 3SOYA 1BRKA 1W00A 1Q7Y4 1IVUA 1JB2A 5AIHA 5TGNA 2HMJB 5IEPA 1NNVA 3SX1A 1ZX2A 1AR0A 3FZWA 5IERA 2L4VA 5JPUA 1I2FA 1B3SA 1TP6A 2CC3A 3FF0A 3NM7A 1IV9A 3DXOA 3G16A 4OVMA 4MMYB 3SYUA 1KWIA 1FW7A 1I3IA 1BVIA 1PYLA 1SIHA 1YVBI 2JQ5A 2OCTA 3PXMA 2OOVA 2O9UX 5KP4A 3FSDA 1NB5I 3JUNA 1STDA 3D5GA 3SVAA 2GU3A 3ALAA 2KF6A 1FZUA 1WTHA 2BT3A 3B4OA 4N6UA 6STDA 4DKIA 2IMJA 3KKGA 1NB3I 3FF2A 1LNHA 1IQXA 2LQVA 1UGHI 3UL5A 4HM2B 2WO0A 3CU3A 2QIYA 4L8OA 1Q40B 3GSPA 3E99A 5IG4A 1E97A 1CYUA 1LOYA 1RTUA 4R9KA 3FG3A 1Q40A 9RNTA 1BRGA 1K28A 1IVWA 1JJ22 3AHSA 3F8HA 4JRFA 3MYTA 4O02B 4BIRA 2YFJB 3CMA3 1K8A4 1MNLA 3PS8A 1B2ZA 1GD4A 4KVHA 3LMLA 2H0HA 3SEDA 4AKYA 1BRJA 3CCR3 1X1UA 1ZO2A 1MWRA 1W01A 3NBRA 1B2UA 3PYJA 3IMAB 2K3DA 4EV5A 2AADA 5AYRB 2R4IA 3NX0A 4NREA 1IVXA 2E2UA 1G0TA 1LNIA 4GHOA 4RZMA 1SJWA 2H0IA 3FCSB 1V58A 2W9QA 3NHXA 3K0ZA 1SQWA 2B24B 2Z6BA 3KSPA 5CXOA 3UJMA 1UUVB 1U8CB 1UDII 3AHWA 1JN5A 3PZWA 1EUIC 2HMLB 1JRQA 1GMPA 4GL6A 3ZG5A 1ISKA 1QJGA 2J8XB 3EN8A 1OACA 3K9MC 1YHQ3 3BNCA 3IJEB 3LTBA 2Y73A 1LOXA 4EYCA 1DE3A 1DVCA 3AGOA 2IUKA 1BRSA 5RNTA 1TFOA 3KN4A 2C4BA 7RNTA 2O3OA 3KCHA 3NUVA 3H3HA 1ROAA 4HZ9B 4FCJA 1LOWA 2P38A 1GY6A 2UGIA 1JKGB 1QMAA 5IG0A 2STDA 3X3YA 4XM4A 2RFRA 2IA7A 3JUOA 3HK4A 1BRNL 3MKIA 1S5AA 2LYXA 4KFEA 3BNDA 4L8PA 1AVKA 4L7KA 1GY5A 4NHFA 5KP3A 1YIT3 3B8LA 3JVCA 1G96A 2CFKA 1JBSA 4MEIA 1MWSA 1W5ZA 4XB5A 4LEHA 3CCE3 1RDSA 1UUGB 1GY7A 3NQYA 4N6LA 1LRAA 1W6YA 1TU5A 4R4KA 1BAOA 1OPYA 4ILFA 3S28A 2SARA 3CPW2 1I8VA 2JDIH 1EEJA 3DGLA 1M9GA 1D6UA 1QAKA 1IQYA 3DGOA 3NV0B 4CDLA 5ELUA 5D81A 1W2ZA 1FUWA 1C7HA 3F7SA 4PEJA 3I553 3BNEA 4O8SA 1MGWA 3UNLA 1FGTA 4R9LA 5AEUB 1I70A 4WYKA 1DYUA 3PCRA 1RGEA 1Q7HA 4HOHA 1MOLA 1VQ93 3X42A 4HM1B 2OTL3 3S27A 5AIIA 1U5OA 1I0VA 2ZL8A 3HZPA 3DUKA 3OXAA 3CNMA 3STDA 1SIIA 1ULIB 4EBGA 3MG3A 2KCDA 2BMQB 3X3XA 1ZGXA 3F7XA 1HU9A 1FUSA 1PY3A 2MC8A 3NXJA 3T8UA 1DMQA 2BIRA 1MWUA 1I0XA 2FXTA 5EVHA 1K41A 4CJNA 1VQ83 2H0GA 5JBSA 5EEOA 1LOVA 3OWYA 2GXFA 1IV7A 3DMCA 4HM6B 2QA43 5AI1A 3RDEA 1BUQA 3JUPA 1CYVA 3RGAA 1QALA 5IEOA 3EHCA 3V92A 4EW5A 1N9EA 1HYFA 2XR8B 3SOAA 4XBXA 5M1AA 1W02A 4MJDA 4FMDA 3F40A 1EG9B 2HMMB 2XRXB 1VQ73 2OQEC 2YFIB 1I2GA 3ZG0A 1NDOB 1YJW3 3WOEB 4EC6A 3LTAA 5FW5A 3CCS3 1GOYA 1WMOA 1KQS2 1N9JA 2MF7A 5LC6A 1BNIA 1X1WA 1T2IA 4HZBB 2HOHA 2IUJA 1BNSA 3B7CA 4IT7A 4WHAA 3LOYA 3EE1A 1D6ZA 1NU3A 1PU4A 3QRDA 1W6CA 1BNGA 1TTOA 3KE7A 4J9AA 4TX4A 1VQN3 7STDA 3D3LA 3K5TA 3ER7A 1WQLB 1RGKA 3L0RA 3MG2A 4JF8A 1BGSA 2D42A 1RSNA 3SLUA 3EQQB 3OV4A 1IVVA 3BU4A 3CPOA 4LYLB 4CPKA 3CCU3 3NBJA 5STDA 1BSAA 4BTYA 1A2KA 3DM8A 1X1XA 1BSBA 2CFLA 3EJVA 3FH1A 1FGOA 3GZYB 3VSYA 1B2MA 1BOXA 2CK3H 5G2GA 1YIJ3 4HM0B 1J2BA 1X1YA 3KIIA 2FGTA 1LVNA 3LT8A 3UB1A 1VQ53 1W2B2 3CC73 5AIFA 4RNTA 1M1XB 2FNQA 1BNEA 1N8QA 3AMOA 1BUJA 2F98A 1RGFA 3GWRA 4FCZA 4FR9A 4AKZA 3EBYA 4WWUC 1TFKA 1JB4A 4LSOA 5CF1A 2CFWA 4FMCA 3JUMA 1DMMA 3A76A 2XF3A 1N5PA 1JZDA 2I9WA 1TRPA 2CKFB 1TRQA 6RNTA 3HIGA 4O2HA 2K54A 2W56A 4ORLA 5DREA 1UGIA 3ECFA 4GSPA 5ELJA 6GSPA 2A15A 1VZZA 3OW22 2B1XB 1W7CA 2HMNB 4K1UA 3N9HA 3ZFZA 2IYJA 1JBTA 3G8ZA 3WR2A 4CCVA 4EV2A 1E3RA 1JB5A 3QK9A 2ML5A 3SXXA 1N5HA 4RNYA 3WA2X 2V1LA 1W4NA 2CG1A 2GU1A 2W9PA 4IPBA 1DMNA 2INXA 4QWTA 8RNTA 1FUTA 1Q9EA 5HGRA 5A0OB 2ZHXB 2QEX3 2WGOA 2XFSA 7GSPA 4HYZA 1RKYA 5AEWB 2P0XA 2KF3A 3S5CA 4WP5A 4LMIA 2CX1A 3BB9A 3I563 1AQZA 2CFDA 3DGYA 4I5QA 3URPA 1T3BA 3MG1A 3N8BA 3G6E3 1JN5B 3CCQ3 1A2PA 1BRHA 2P09A 4FMBA 3CXC2 2BHMA 3EB8A 3DGMA 4HKVB 3LZAA 1B27A 4HM3B 1NJI4 1BSEA 1KSIA 3JUQA 2F5WA 3HI7A 2M7OA 4KT3B 1QAFA 2XFTA 2KAAA 4HM7B 4KFDA 3F9SA 3HX8A 1RGLA 3CCV3 2W56B 2F86B 3RGRA 2SBLA 1GOVA 4HM8B 1GD3A 1E3VA 1VQK3 1GS3A 1VQP3 1JV2B 1I2EA 2BMOB 1IK3A 1UW1A 1TIJA 3Q3FA 4XDWA 1F8NA 4KZ1A 1YVSA 4BTWA 1OUNA 1Y4KA 3VF1A 2HMOB 2WGQA 1IQ8A 1SPUA 4OK0A 1VQ63 1O7MB 3KZTA 2CG0A 2D1WA 1US1A 2XGNA 3OWSA 3CC23 3V99A 1O7PB
chains in the Genus database with same CATH topology
3O8YA 2E2TA 3MWZA 2C10A 1A67A 2KXGA 2W04A 4HM4B 2CIUA 3LT9A 3M8CA 3MPHA 1A2VA 1VQM3 3CCM3 3TDGA 3CD63 3FG4A 4X2HA 1OGZA 2XH9A 2OQEA 1RRHA 3V98A 3EN1B 8CHOA 2OWPA 3CCJ3 3J7Yd 3HIIA 1EKMA 3Q2PA 5AIGA 3G713 3WMDA 1Q814 2Z76A 2CWTA 2Y74A 4FMAA 4IIAA 1VQO3 4X2OA 1D6YA 3DZLA 1QVF2 2OTJ3 1UUWB 2QGUA 3CC43 2UX0A 4N6MA 4XBYA 3GZRA 4AEQA 3EF8A 5D82A 4HVNA 1RJOA 4MMZB 2W2CA 1UI7A 4RNZA 2CWUA 3LH4A 4N6OB 1O7NB 1HKXA 1EQKA 3NBBA 3FKAA 3NQZA 2W03A 1O7WB 2BO9B 1ASKA 3G4S3 1IT8A 1M1K4 1JNQA 3WOFB 1V74A 1VQ43 2Z7AA 1IDPA 1ULJB 2Q07A 2C11A 4OUQA 2CWVA 3D9RA 5IENA 4FCMA 1T5YA 2XGLA 3BLZA 3GZBA 1IU7A 4N3VA 4Q53A 1RRLA 3ROBA 1OH0A 1PFPA 3S29A 5CLKA 5CF2A 2W6JH 3FLJA 4EXRA 2CH9A 4K90B 3EBTA 4RBNA 4WYKB 3NV0A 3VGNA 5CK6A 5IG5A 1L5GB 3B4PA 1S723 3GRDA 1YGEA 1WMPA 1YI23 4WFOA 2GEYA 3CME3 3PGBA 1Z1SA 1AVLA 3LTCA 5IF6A 4O3VA 2BNGA 1OHPA 1JKGA 4XDVA 4K61A 1OHSA 3IPTA 4G1MB 2K0MA 3FGYA 3UL6A 5I97A 3KSED 1R4CA 1LXEA 5IG3A 5JPPA 2YFLB 1Q42A 1KD14 2GEXA 3LXUX 2WOFA 1OCVA 2RSXA 2CHCA 1FGRA 1A90A 4STDA 3S67A 2W0QA 1TUHA 1VQL3 1OHOA 1OGXA 1UI8A 4R1KA 4N6V0 2ZDJA 5DRVA 2XEPA 1ROVA 1GYBA 3X3ZA 1OF5A 3EX9A 1Q864 5BXQA 3MSOA 3CNXA 1QVG2 1CQSA 3N54B 1OF5B 3LYGA 3Q1CA 4K1VA 2PNCA 4R80A 1K9M4 2GBXB 2CFGA 3WDGB 3T0UA 1Q824 3NM2A 1KC84 5AYSC 3U1WA 4H61A 3G0KA 3X40A 3MHEA 4HM5B 3WODG 4HJLB 3GZXB 4HBRA 1EA2A 3K7CA 3DY5A 1IT7A 4H3UA 1DVDA 2HMKB 2Z77A 1FGQA 1O7GB 2P0MA 4I4KA 5IW9A 3FG1A 1N8R4 2XSOB 1O7HB 3U97A 2ML6A 3OX9A 3EC9A 3PCSA 4MMXB 4BTXA 3OWUA 3K63A 2BMRB 1YJ93 5D83A 2KRTA 3AMOB 3T8NA 1FA3A 1WNHA 3DGNA 4LGQA 4N6TA 2E2VA 1YJN3 2CW9A 3Q90A 1W6GA 2RCDA 1WMNA 1NWWA 3I0YA 3GAXA 3KFQC 3LTDA 2F99A 3BNBA 1NO3A 1FGMA 3F14A 4XBTA 5BVBA 3H51A 1M904 1STFI 2PZVA 2OOVC 1RN7A 4LZIA 4J8TA 2GBWB 4ZM8A 4U13A 3WA3A 3F8XA 1AV4A 2RGQA 2P05A 2YX9A 4KFFA 1CEWI 2WOHA 5LC7A 5EQLA 4GB5A 5KP1A 2XSHB 3CCL3 1K734 4N6NB 5FGOA 3SOYA 1W00A 1Q7Y4 1IVUA 1JB2A 5AIHA 5TGNA 2HMJB 5IEPA 3SX1A 1ZX2A 1AR0A 3FZWA 5IERA 2L4VA 5JPUA 1TP6A 2CC3A 3FF0A 3NM7A 1IV9A 3DXOA 3G16A 4OVMA 4MMYB 1KWIA 1SIHA 3X41A 3PXMA 1YVBI 2JQ5A 2OCTA 2OOVA 5KP4A 1NB5I 2O9UX 3FSDA 3JUNA 1STDA 3SVAA 2GU3A 3ALAA 1WTHA 2BT3A 3B4OA 4N6UA 6STDA 2IMJA 3KKGA 1NB3I 3FF2A 1LNHA 1IQXA 2LQVA 3UL5A 4HM2B 2WO0A 3CU3A 2QIYA 4L8OA 1Q40B 3E99A 5IG4A 1E97A 1CYUA 4R9KA 3FG3A 1Q40A 1K28A 1IVWA 1JJ22 3F8HA 4JRFA 3MYTA 4O02B 2YFJB 3CMA3 1K8A4 1MNLA 3PS8A 4KVHA 1GD4A 3LMLA 3SEDA 4AKYA 3CCR3 1ZO2A 1W01A 3NBRA 3PYJA 3IMAB 4EV5A 5AYRB 2R4IA 3NX0A 4NREA 1IVXA 2E2UA 4RZMA 1SJWA 3FCSB 2W9QA 3NHXA 3K0ZA 1SQWA 2B24B 2Z6BA 3KSPA 5CXOA 3UJMA 1UUVB 1U8CB 1JN5A 3PZWA 2HMLB 1JRQA 4GL6A 1ISKA 1QJGA 3EN8A 1OACA 3K9MC 1YHQ3 3BNCA 3IJEB 3LTBA 2Y73A 1LOXA 4EYCA 1DVCA 2IUKA 1TFOA 3KN4A 2O3OA 3NUVA 3H3HA 1ROAA 4HZ9B 4FCJA 2P38A 1GY6A 1JKGB 1QMAA 5IG0A 2STDA 3X3YA 4XM4A 2RFRA 2IA7A 3JUOA 3HK4A 3MKIA 1S5AA 2LYXA 4KFEA 3BNDA 4L8PA 1AVKA 4L7KA 1GY5A 4NHFA 5KP3A 1YIT3 3B8LA 3JVCA 1G96A 2CFKA 4MEIA 1W5ZA 4XB5A 4LEHA 3CCE3 1GY7A 3NQYA 4N6LA 1W6YA 1TU5A 4R4KA 1OPYA 3S28A 3CPW2 2JDIH 3DGLA 1M9GA 1D6UA 1QAKA 1IQYA 3DGOA 3NV0B 4CDLA 5ELUA 5D81A 1W2ZA 1FUWA 1C7HA 3F7SA 4PEJA 3I553 3BNEA 4O8SA 3UNLA 1FGTA 4R9LA 5AEUB 4WYKA 1DYUA 3PCRA 1MOLA 1VQ93 3X42A 4HM1B 2OTL3 3S27A 5AIIA 1U5OA 2ZL8A 3HZPA 3DUKA 3OXAA 3CNMA 3STDA 1SIIA 1ULIB 4EBGA 3MG3A 2KCDA 2BMQB 3X3XA 3F7XA 1HU9A 2MC8A 3NXJA 3T8UA 1DMQA 2FXTA 5EVHA 1VQ83 1K41A 5JBSA 5EEOA 3OWYA 2GXFA 1IV7A 3DMCA 4HM6B 2QA43 5AI1A 3RDEA 1BUQA 3JUPA 1CYVA 3RGAA 1QALA 5IEOA 3EHCA 3V92A 1N9EA 2XR8B 3SOAA 4XBXA 1W02A 4MJDA 4FMDA 3F40A 1EG9B 2HMMB 2XRXB 1VQ73 2OQEC 2YFIB 1NDOB 1YJW3 3WOEB 4EC6A 3LTAA 5FW5A 3CCS3 1WMOA 1KQS2 1N9JA 2MF7A 5LC6A 4HZBB 2IUJA 4IT7A 3B7CA 4WHAA 3LOYA 3EE1A 1D6ZA 1NU3A 1PU4A 3QRDA 1W6CA 3KE7A 4TX4A 4J9AA 1VQN3 7STDA 3D3LA 3K5TA 3ER7A 1WQLB 3L0RA 3MG2A 4JF8A 2D42A 3SLUA 3EQQB 3OV4A 1IVVA 3CCU3 3CPOA 3NBJA 5STDA 4BTYA 1A2KA 3DM8A 3EJVA 3VSYA 2CFLA 3FH1A 1FGOA 3GZYB 2CK3H 5G2GA 1YIJ3 4HM0B 1J2BA 3KIIA 2FGTA 1LVNA 3LT8A 3UB1A 1VQ53 1W2B2 3CC73 5AIFA 1M1XB 2FNQA 1N8QA 3AMOA 2F98A 3GWRA 4FR9A 4FCZA 4AKZA 3EBYA 4WWUC 1TFKA 1JB4A 4LSOA 5CF1A 2CFWA 4FMCA 3JUMA 1DMMA 3A76A 2XF3A 1N5PA 2I9WA 2CKFB 3HIGA 4O2HA 2K54A 2W56A 4ORLA 5DREA 3ECFA 5ELJA 2A15A 1VZZA 3OW22 2B1XB 1W7CA 2HMNB 4K1UA 3N9HA 3G8ZA 4CCVA 4EV2A 1JB5A 1E3RA 3QK9A 2ML5A 3SXXA 1N5HA 4RNYA 3WA2X 2V1LA 1W4NA 2CG1A 2GU1A 2W9PA 4IPBA 1DMNA 2INXA 4QWTA 5HGRA 5A0OB 2QEX3 2WGOA 2XFSA 4HYZA 1RKYA 5AEWB 2P0XA 3S5CA 4WP5A 4LMIA 3BB9A 3I563 2CFDA 3CCQ3 3MG1A 3N8BA 3G6E3 1JN5B 2P09A 4FMBA 3CXC2 2BHMA 3EB8A 3DGMA 4HKVB 3LZAA 4HM3B 1NJI4 1KSIA 3JUQA 3HI7A 2M7OA 1QAFA 2XFTA 4HM7B 4KFDA 3F9SA 3HX8A 3CCV3 2W56B 2F86B 3RGRA 2SBLA 4HM8B 1GD3A 1E3VA 1VQK3 1GS3A 1VQP3 1JV2B 2BMOB 1IK3A 1UW1A 1TIJA 4XDWA 1F8NA 4KZ1A 4BTWA 1OUNA 1Y4KA 3VF1A 2HMOB 2WGQA 1IQ8A 1SPUA 4OK0A 1VQ63 1O7MB 3KZTA 2CG0A 2D1WA 1US1A 2XGNA 3OWSA 3CC23 3V99A 1O7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7C A;  5BXQ A;  3MSO A;  3CNX A;  2R4I A;  1NU3 A;  1CQS A;  1OF5 B;  3LYG A;  3KE7 A;  4J9A A;  4HM4 B;  1SJW A;  4K1V A;  4RZM A;  7STD A;  2GBX B;  1WQL B;  3ER7 A;  3K0Z A;  3M8C A;  2B24 B;  3NHX A;  3KSP A;  3MG2 A;  5CXO A;  1UUV B;  3UJM A;  4X2H A;  1OGZ A;  1JN5 A;  3EN1 B;  3NM2 A;  2HML B;  3EQQ B;  3OV4 A;  8CHO A;  3CPO A;  2OWP A;  5STD A;  1QJG A;  1ISK A;  5AIG A;  1A2K A;  3DM8 A;  3EJV A;  3VSY A;  3G0K A;  3FH1 A;  3EN8 A;  2Z76 A;  3GZY B;  3MHE A;  4HM5 B;  3WMD A;  4HJL B;  3GZX B;  4IIA A;  4X2O A;  3DZL A;  5G2G A;  1UUW B;  2QGU A;  4HM0 B;  2UX0 A;  1EA2 A;  3K7C A;  4H3U A;  4XBY A;  3GZR A;  2HMK B;  3EF8 A;  2Z77 A;  5D82 A;  1O7G B;  4I4K A;  4HVN A;  5AIF A;  2W2C A;  2XSO B;  1O7H B;  3NUV A;  3H3H A;  3OX9 A;  3EC9 A;  4HZ9 B;  4FCJ A;  1GY6 A;  1O7N B;  1JKG B;  1HKX A;  1QMA A;  2F98 A;  3FKA A;  2BMR B;  2STD A;  3GWR A;  3OWU A;  4XM4 A;  2RFR A;  5D83 A;  3T8N A;  3JUO A;  1O7W B;  3HK4 A;  3EBY A;  3MKI A;  4WWU C;  1ASK A;  1S5A A;  1JB4 A;  5CF1 A;  4L8P A;  4LGQ A;  4L7K A;  1GY5 A;  5KP3 A;  3JUM A;  1DMM A;  3A76 A;  3Q90 A;  2RCD A;  3B8L A;  2I9W A;  1NWW A;  2Z7A A;  3I0Y A;  2CKF B;  1IDP A;  1ULJ B;  4XB5 A;  4OUQ A;  4LEH A;  2K54 A;  4ORL A;  2F99 A;  3D9R A;  5DRE A;  4FCM A;  5IEN A;  1GY7 A;  3ECF A;  3BLZ A;  3GZB A;  2A15 A;  4XBT A;  1VZZ A;  3F14 A;  4N3V A;  5BVB A;  1W6Y A;  3H51 A;  4Q53 A;  3ROB A;  1OH0 A;  2PZV A;  2B1X B;  2HMN B;  1OPY A;  4K1U A;  4J8T A;  2GBW B;  5CLK A;  3G8Z A;  5CF2 A;  4U13 A;  3FLJ A;  1JB5 A;  1E3R A;  3F8X A;  3NV0 B;  4CDL A;  5D81 A;  1C7H A;  3F7S A;  2RGQ A;  4PEJ A;  3UNL A;  3EBT A;  4WYK B;  1DMN A;  2INX A;  3NV0 A;  4GB5 A;  4R9L A;  3VGN A;  5CK6 A;  5AEU B;  5IG5 A;  5HGR A;  5KP1 A;  2XSH B;  3B4P A;  4WYK A;  3GRD A;  5AEW B;  3SOY A;  1W00 A;  3S5C A;  4WP5 A;  4LMI A;  1JB2 A;  5AIH A;  3BB9 A;  5TGN A;  2GEY A;  2HMJ B;  5IEP A;  1ZX2 A;  1AR0 A;  1Z1S A;  3FZW A;  5IER A;  4HM1 B;  5JPU A;  3MG1 A;  1TP6 A;  1U5O A;  3HZP A;  1JN5 B;  3FF0 A;  5AII A;  3DUK A;  5IF6 A;  3OXA A;  3CNM A;  3STD A;  1ULI B;  2BNG A;  3DXO A;  3G16 A;  1OHP A;  1JKG A;  2BMQ B;  3LZA A;  3MG3 A;  4HKV B;  3F7X A;  4HM3 B;  4OVM A;  4XDV A;  1O7P B;  3JUQ A;  5IG0 A;  1OHS A;  3IPT A;  3NXJ A;  3T8U A;  2JQ5 A;  1DMQ A;  5EVH A;  5KP4 A;  4HM7 B;  1K41 A;  3F9S A;  3FSD A;  3FGY A;  3HX8 A;  1STD A;  3JUN A;  5IG3 A;  3NBR A;  3OWY A;  5JPP A;  3B4O A;  6STD A;  2GXF A;  2YFL B;  1Q42 A;  2IMJ A;  3KKG A;  3DMC A;  3FF2 A;  4HM6 B;  2GEX A;  5AI1 A;  1BUQ A;  3JUP A;  2F86 B;  4HM2 B;  1OCV A;  5IEO A;  3CU3 A;  3RGA A;  3RGR A;  2QIY A;  3EHC A;  4HM8 B;  4L8O A;  1Q40 B;  2XR8 B;  1E3V A;  4XBX A;  1GS3 A;  3E99 A;  3SOA A;  2CHC A;  5IG4 A;  1E97 A;  4STD A;  1W02 A;  4R9K A;  4MJD A;  1Q40 A;  2BMO B;  3F40 A;  1EG9 B;  2HMM B;  2XRX B;  4XDW A;  2YFI B;  1TUH A;  1NDO B;  3F8H A;  1OHO A;  1OGX A;  1OUN A;  2HMO B;  3MYT A;  2YFJ B;  4R1K A;  5FW5 A;  5DRV A;  1O7M B;  4KVH A;  3KZT A;  3OWS A;  3SED A;  1GYB A;  1OF5 A;  3EX9 A;  4HZB B;  1ZO2 A;  1W01 A; 
#chains in the Genus database with same CATH topology
 3O8Y A;  2E2T A;  3MWZ A;  2C10 A;  5HOH A;  1A67 A;  2KXG A;  1YNV X;  2W04 A;  4HM4 B;  2CIU A;  3LT9 A;  3M8C A;  3MPH A;  1A2V A;  1VQM 3;  3CCM 3;  3TDG A;  3CD6 3;  3FG4 A;  4X2H A;  1OGZ A;  2XH9 A;  2OQE A;  1RRH A;  3V98 A;  3EN1 B;  2AAE A;  8CHO A;  2OWP A;  3CCJ 3;  3J7Y d;  3HII A;  1RHL A;  1EKM A;  3Q2P A;  5AIG A;  3G71 3;  3WMD A;  1Q81 4;  2Z76 A;  2CWT A;  2Y74 A;  4FMA A;  4IIA A;  4NPB A;  1VQO 3;  4X2O A;  1D6Y A;  3DZL A;  5BU4 A;  1QVF 2;  2OTJ 3;  1UUW B;  2QGU A;  2RNT A;  2UX0 A;  3CC4 3;  4N6M A;  4XBY A;  1FYS A;  3GZR A;  4AEQ A;  3EF8 A;  1TJD A;  5D82 A;  2F56 A;  3D4A A;  4HVN A;  1RJO A;  4MMZ B;  2W2C A;  1R4Y A;  1UI7 A;  4RNZ A;  2CWU A;  3LH4 A;  1B2S A;  4N6O B;  1O7N B;  1HKX A;  1EQK A;  3NBB A;  3FKA A;  3NQZ A;  2W03 A;  2F4Y A;  1O7W B;  1I3F A;  2BO9 B;  1ASK A;  4BL2 A;  1T2H A;  3G4S 3;  1IT8 A;  1M1K 4;  1JNQ A;  3WOF B;  1V74 A;  1VQ4 3;  2Z7A A;  1IDP A;  1ULJ B;  1BAN A;  2C11 A;  2Q07 A;  4OUQ A;  1RMS A;  2CWV A;  3D9R A;  5IEN A;  4FCM A;  1T5Y A;  3AGN A;  1IYY A;  2XGL A;  3BLZ A;  3GZB A;  1IU7 A;  1DET A;  3DH2 A;  4N3V A;  4Q53 A;  1RRL A;  3ROB A;  1OH0 A;  1PFP A;  3S29 A;  5M18 A;  1RN4 A;  5CLK A;  5CF2 A;  2W6J H;  3FLJ A;  4J5G A;  4EXR A;  3X41 A;  1UCI A;  2CH9 A;  1RGA A;  4K90 B;  1HZ1 A;  3EBT A;  4RBN A;  4J5K A;  4WYK B;  3NV0 A;  5M19 A;  3VGN A;  5CK6 A;  5IG5 A;  1L5G B;  1GMQ A;  3D79 A;  3B4P A;  1S72 3;  1BNF A;  3GRD A;  1YGE A;  1WMP A;  1YI2 3;  4WFO A;  2GEY A;  3CME 3;  3PGB A;  1RNT A;  1RGG A;  1Z1S A;  1AVL A;  3LTC A;  1RN1 A;  5IF6 A;  1GSP A;  3BIR A;  4O3V A;  2BNG A;  1OHP A;  1JKG A;  4XDV A;  2BU4 A;  4K61 A;  1OHS A;  3IPT A;  4G1M B;  2K0M A;  1UCJ A;  1VQQ A;  3FGY A;  3UL6 A;  5I97 A;  3KSE D;  1R4C A;  1LXE A;  5IG3 A;  5JPP A;  1RLS A;  2YFL B;  1Q42 A;  1V57 A;  1KD1 4;  1BNR A;  2GEX A;  1BRI A;  3LXU X;  2WOF A;  1G02 A;  1OCV A;  2KF4 A;  2RSX A;  2CHC A;  1BU4 A;  1FGR A;  1A90 A;  4STD A;  2KF5 A;  3S67 A;  2W0Q A;  1TUH A;  1VQL 3;  1OHO A;  1OGX A;  1UI8 A;  4R1K A;  4N6V 0;  2ZDJ A;  5DRV A;  2XEP A;  1ROV A;  1JBR A;  1GYB A;  3X3Z A;  1OF5 A;  1ZS7 A;  3EX9 A;  1Q86 4;  5BXQ A;  1RGC A;  3CNX A;  3MSO A;  1QVG 2;  1B21 A;  1CQS A;  1OF5 B;  3N54 B;  4BU4 A;  1UCL A;  3LYG A;  3Q1C A;  4K1V A;  2PNC A;  4HAA A;  4R80 A;  1K9M 4;  2GBX B;  2CFG A;  3WDG B;  1JZO A;  3T0U A;  1Q82 4;  2RBI A;  3NM2 A;  3WHO A;  1C54 A;  1KC8 4;  5AYS C;  3U1W A;  2GSP A;  4H61 A;  3G0K A;  1B2X A;  3MHE A;  4HM5 B;  1BSC A;  3X40 A;  3WOD G;  3HOH A;  3GZX B;  4HJL B;  1MWT A;  4HBR A;  1RCL A;  1SAR A;  1EA2 A;  1MGR A;  2ZA4 A;  3DY5 A;  1IT7 A;  3K7C A;  4H3U A;  1DVD A;  1BNJ A;  2HMK B;  1BSD A;  2Z77 A;  2L1S A;  1FGQ A;  1O7G B;  2IY2 A;  2P0M A;  4I4K A;  5IW9 A;  3FG1 A;  1N8R 4;  2XSO B;  1O7H B;  2F5M A;  3U97 A;  1GMR A;  5BIR A;  2ML6 A;  3OX9 A;  3EC9 A;  3PCS A;  4MMX B;  1CH0 A;  4BTX A;  2R41 A;  3OWU A;  3K63 A;  2BMR B;  1YJ9 3;  5D83 A;  2KRT A;  3AMO B;  3T8N A;  1FA3 A;  1WNH A;  3DGN A;  2CX0 A;  4LGQ A;  4N6T A;  2E2V A;  3RNT A;  2CW9 A;  2UUG C;  1BIR A;  3Q90 A;  1YJN 3;  1W6G A;  2RCD A;  1RNB A;  1WMN A;  1NWW A;  3I0Y A;  3GAX A;  3KFQ C;  5G1L A;  3LTD A;  2F99 A;  3BNB A;  1NO3 A;  1FGM A;  3F14 A;  4XBT A;  5BVB A;  3H51 A;  1LQM B;  1M90 4;  1STF I;  2PZV A;  1UCK A;  2OOV C;  1RN7 A;  4LZI A;  3D5I A;  2GBW B;  4J8T A;  4ZM8 A;  4U13 A;  1GOU A;  3WA3 A;  1B20 A;  1RCK A;  3F8X A;  4BL3 A;  1AV4 A;  1AY7 A;  1RGH A;  1LQG C;  2P05 A;  2RGQ A;  2YX9 A;  1CEW I;  2WOH A;  4KFF A;  5G1K A;  5GSP A;  5LC7 A;  5EQL A;  4GB5 A;  3A5E A;  1YGW A;  5KP1 A;  2XSH B;  3CCL 3;  1K73 4;  4N6N B;  5FGO A;  3SOY A;  1BRK A;  1W00 A;  1Q7Y 4;  1IVU A;  1JB2 A;  5AIH A;  5TGN A;  2HMJ B;  5IEP A;  1NNV A;  3SX1 A;  1ZX2 A;  1AR0 A;  3FZW A;  5IER A;  2L4V A;  5JPU A;  1I2F A;  1B3S A;  1TP6 A;  2CC3 A;  3FF0 A;  3NM7 A;  1IV9 A;  3DXO A;  3G16 A;  4OVM A;  4MMY B;  3SYU A;  1KWI A;  1FW7 A;  1I3I A;  1BVI A;  1PYL A;  1SIH A;  1YVB I;  2JQ5 A;  2OCT A;  3PXM A;  2OOV A;  2O9U X;  5KP4 A;  3FSD A;  1NB5 I;  3JUN A;  1STD A;  3D5G A;  3SVA A;  2GU3 A;  3ALA A;  2KF6 A;  1FZU A;  1WTH A;  2BT3 A;  3B4O A;  4N6U A;  6STD A;  4DKI A;  2IMJ A;  3KKG A;  1NB3 I;  3FF2 A;  1LNH A;  1IQX A;  2LQV A;  1UGH I;  3UL5 A;  4HM2 B;  2WO0 A;  3CU3 A;  2QIY A;  4L8O A;  1Q40 B;  3GSP A;  3E99 A;  5IG4 A;  1E97 A;  1CYU A;  1LOY A;  1RTU A;  4R9K A;  3FG3 A;  1Q40 A;  9RNT A;  1BRG A;  1K28 A;  1IVW A;  1JJ2 2;  3AHS A;  3F8H A;  4JRF A;  3MYT A;  4O02 B;  4BIR A;  2YFJ B;  3CMA 3;  1K8A 4;  1MNL A;  3PS8 A;  1B2Z A;  1GD4 A;  4KVH A;  3LML A;  2H0H A;  3SED A;  4AKY A;  1BRJ A;  3CCR 3;  1X1U A;  1ZO2 A;  1MWR A;  1W01 A;  3NBR A;  1B2U A;  3PYJ A;  3IMA B;  2K3D A;  4EV5 A;  2AAD A;  5AYR B;  2R4I A;  3NX0 A;  4NRE A;  1IVX A;  2E2U A;  1G0T A;  1LNI A;  4GHO A;  4RZM A;  1SJW A;  2H0I A;  3FCS B;  1V58 A;  2W9Q A;  3NHX A;  3K0Z A;  1SQW A;  2B24 B;  2Z6B A;  3KSP A;  5CXO A;  3UJM A;  1UUV B;  1U8C B;  1UDI I;  3AHW A;  1JN5 A;  3PZW A;  1EUI C;  2HML B;  1JRQ A;  1GMP A;  4GL6 A;  3ZG5 A;  1ISK A;  1QJG A;  2J8X B;  3EN8 A;  1OAC A;  3K9M C;  1YHQ 3;  3BNC A;  3IJE B;  3LTB A;  2Y73 A;  1LOX A;  4EYC A;  1DE3 A;  1DVC A;  3AGO A;  2IUK A;  1BRS A;  5RNT A;  1TFO A;  3KN4 A;  2C4B A;  7RNT A;  2O3O A;  3KCH A;  3NUV A;  3H3H A;  1ROA A;  4HZ9 B;  4FCJ A;  1LOW A;  2P38 A;  1GY6 A;  2UGI A;  1JKG B;  1QMA A;  5IG0 A;  2STD A;  3X3Y A;  4XM4 A;  2RFR A;  2IA7 A;  3JUO A;  3HK4 A;  1BRN L;  3MKI A;  1S5A A;  2LYX A;  4KFE A;  3BND A;  4L8P A;  1AVK A;  4L7K A;  1GY5 A;  4NHF A;  5KP3 A;  1YIT 3;  3B8L A;  3JVC A;  1G96 A;  2CFK A;  1JBS A;  4MEI A;  1MWS A;  1W5Z A;  4XB5 A;  4LEH A;  3CCE 3;  1RDS A;  1UUG B;  1GY7 A;  3NQY A;  4N6L A;  1LRA A;  1W6Y A;  1TU5 A;  4R4K A;  1BAO A;  1OPY A;  4ILF A;  3S28 A;  2SAR A;  3CPW 2;  1I8V A;  2JDI H;  1EEJ A;  3DGL A;  1M9G A;  1D6U A;  1QAK A;  1IQY A;  3DGO A;  3NV0 B;  4CDL A;  5ELU A;  5D81 A;  1W2Z A;  1FUW A;  1C7H A;  3F7S A;  4PEJ A;  3I55 3;  3BNE A;  4O8S A;  1MGW A;  3UNL A;  1FGT A;  4R9L A;  5AEU B;  1I70 A;  4WYK A;  1DYU A;  3PCR A;  1RGE A;  1Q7H A;  4HOH A;  1MOL A;  1VQ9 3;  3X42 A;  4HM1 B;  2OTL 3;  3S27 A;  5AII A;  1U5O A;  1I0V A;  2ZL8 A;  3HZP A;  3DUK A;  3OXA A;  3CNM A;  3STD A;  1SII A;  1ULI B;  4EBG A;  3MG3 A;  2KCD A;  2BMQ B;  3X3X A;  1ZGX A;  3F7X A;  1HU9 A;  1FUS A;  1PY3 A;  2MC8 A;  3NXJ A;  3T8U A;  1DMQ A;  2BIR A;  1MWU A;  1I0X A;  2FXT A;  5EVH A;  1K41 A;  4CJN A;  1VQ8 3;  2H0G A;  5JBS A;  5EEO A;  1LOV A;  3OWY A;  2GXF A;  1IV7 A;  3DMC A;  4HM6 B;  2QA4 3;  5AI1 A;  3RDE A;  1BUQ A;  3JUP A;  1CYV A;  3RGA A;  1QAL A;  5IEO A;  3EHC A;  3V92 A;  4EW5 A;  1N9E A;  1HYF A;  2XR8 B;  3SOA A;  4XBX A;  5M1A A;  1W02 A;  4MJD A;  4FMD A;  3F40 A;  1EG9 B;  2HMM B;  2XRX B;  1VQ7 3;  2OQE C;  2YFI B;  1I2G A;  3ZG0 A;  1NDO B;  1YJW 3;  3WOE B;  4EC6 A;  3LTA A;  5FW5 A;  3CCS 3;  1GOY A;  1WMO A;  1KQS 2;  1N9J A;  2MF7 A;  5LC6 A;  1BNI A;  1X1W A;  1T2I A;  4HZB B;  2HOH A;  2IUJ A;  1BNS A;  3B7C A;  4IT7 A;  4WHA A;  3LOY A;  3EE1 A;  1D6Z A;  1NU3 A;  1PU4 A;  3QRD A;  1W6C A;  1BNG A;  1TTO A;  3KE7 A;  4J9A A;  4TX4 A;  1VQN 3;  7STD A;  3D3L A;  3K5T A;  3ER7 A;  1WQL B;  1RGK A;  3L0R A;  3MG2 A;  4JF8 A;  1BGS A;  2D42 A;  1RSN A;  3SLU A;  3EQQ B;  3OV4 A;  1IVV A;  3BU4 A;  3CPO A;  4LYL B;  4CPK A;  3CCU 3;  3NBJ A;  5STD A;  1BSA A;  4BTY A;  1A2K A;  3DM8 A;  1X1X A;  1BSB A;  2CFL A;  3EJV A;  3FH1 A;  1FGO A;  3GZY B;  3VSY A;  1B2M A;  1BOX A;  2CK3 H;  5G2G A;  1YIJ 3;  4HM0 B;  1J2B A;  1X1Y A;  3KII A;  2FGT A;  1LVN A;  3LT8 A;  3UB1 A;  1VQ5 3;  1W2B 2;  3CC7 3;  5AIF A;  4RNT A;  1M1X B;  2FNQ A;  1BNE A;  1N8Q A;  3AMO A;  1BUJ A;  2F98 A;  1RGF A;  3GWR A;  4FCZ A;  4FR9 A;  4AKZ A;  3EBY A;  4WWU C;  1TFK A;  1JB4 A;  4LSO A;  5CF1 A;  2CFW A;  4FMC A;  3JUM A;  1DMM A;  3A76 A;  2XF3 A;  1N5P A;  1JZD A;  2I9W A;  1TRP A;  2CKF B;  1TRQ A;  6RNT A;  3HIG A;  4O2H A;  2K54 A;  2W56 A;  4ORL A;  5DRE A;  1UGI A;  3ECF A;  4GSP A;  5ELJ A;  6GSP A;  2A15 A;  1VZZ A;  3OW2 2;  2B1X B;  1W7C A;  2HMN B;  4K1U A;  3N9H A;  3ZFZ A;  2IYJ A;  1JBT A;  3G8Z A;  3WR2 A;  4CCV A;  4EV2 A;  1E3R A;  1JB5 A;  3QK9 A;  2ML5 A;  3SXX A;  1N5H A;  4RNY A;  3WA2 X;  2V1L A;  1W4N A;  2CG1 A;  2GU1 A;  2W9P A;  4IPB A;  1DMN A;  2INX A;  4QWT A;  8RNT A;  1FUT A;  1Q9E A;  5HGR A;  5A0O B;  2ZHX B;  2QEX 3;  2WGO A;  2XFS A;  7GSP A;  4HYZ A;  1RKY A;  5AEW B;  2P0X A;  2KF3 A;  3S5C A;  4WP5 A;  4LMI A;  2CX1 A;  3BB9 A;  3I56 3;  1AQZ A;  2CFD A;  3DGY A;  4I5Q A;  3URP A;  1T3B A;  3MG1 A;  3N8B A;  3G6E 3;  1JN5 B;  3CCQ 3;  1A2P A;  1BRH A;  2P09 A;  4FMB A;  3CXC 2;  2BHM A;  3EB8 A;  3DGM A;  4HKV B;  3LZA A;  1B27 A;  4HM3 B;  1NJI 4;  1BSE A;  1KSI A;  3JUQ A;  2F5W A;  3HI7 A;  2M7O A;  4KT3 B;  1QAF A;  2XFT A;  2KAA A;  4HM7 B;  4KFD A;  3F9S A;  3HX8 A;  1RGL A;  3CCV 3;  2W56 B;  2F86 B;  3RGR A;  2SBL A;  1GOV A;  4HM8 B;  1GD3 A;  1E3V A;  1VQK 3;  1GS3 A;  1VQP 3;  1JV2 B;  1I2E A;  2BMO B;  1IK3 A;  1UW1 A;  1TIJ A;  3Q3F A;  4XDW A;  1F8N A;  4KZ1 A;  1YVS A;  4BTW A;  1OUN A;  1Y4K A;  3VF1 A;  2HMO B;  2WGQ A;  1IQ8 A;  1SPU A;  4OK0 A;  1VQ6 3;  1O7M B;  3KZT A;  2CG0 A;  2D1W A;  1US1 A;  2XGN A;  3OWS A;  3CC2 3;  3V99 A;  1O7P B; 
#chains in the Genus database with same CATH homology
 3O8Y A;  2E2T A;  3MWZ A;  2C10 A;  1A67 A;  2KXG A;  2W04 A;  4HM4 B;  2CIU A;  3LT9 A;  3M8C A;  3MPH A;  1A2V A;  1VQM 3;  3CCM 3;  3TDG A;  3CD6 3;  3FG4 A;  4X2H A;  1OGZ A;  2XH9 A;  2OQE A;  1RRH A;  3V98 A;  3EN1 B;  8CHO A;  2OWP A;  3CCJ 3;  3J7Y d;  3HII A;  1EKM A;  3Q2P A;  5AIG A;  3G71 3;  3WMD A;  1Q81 4;  2Z76 A;  2CWT A;  2Y74 A;  4FMA A;  4IIA A;  1VQO 3;  4X2O A;  1D6Y A;  3DZL A;  1QVF 2;  2OTJ 3;  1UUW B;  2QGU A;  3CC4 3;  2UX0 A;  4N6M A;  4XBY A;  3GZR A;  4AEQ A;  3EF8 A;  5D82 A;  4HVN A;  1RJO A;  4MMZ B;  2W2C A;  1UI7 A;  4RNZ A;  2CWU A;  3LH4 A;  4N6O B;  1O7N B;  1HKX A;  1EQK A;  3NBB A;  3FKA A;  3NQZ A;  2W03 A;  1O7W B;  2BO9 B;  1ASK A;  3G4S 3;  1IT8 A;  1M1K 4;  1JNQ A;  3WOF B;  1V74 A;  1VQ4 3;  2Z7A A;  1IDP A;  1ULJ B;  2Q07 A;  2C11 A;  4OUQ A;  2CWV A;  3D9R A;  5IEN A;  4FCM A;  1T5Y A;  2XGL A;  3BLZ A;  3GZB A;  1IU7 A;  4N3V A;  4Q53 A;  1RRL A;  3ROB A;  1OH0 A;  1PFP A;  3S29 A;  5CLK A;  5CF2 A;  2W6J H;  3FLJ A;  4EXR A;  2CH9 A;  4K90 B;  3EBT A;  4RBN A;  4WYK B;  3NV0 A;  3VGN A;  5CK6 A;  5IG5 A;  1L5G B;  3B4P A;  1S72 3;  3GRD A;  1YGE A;  1WMP A;  1YI2 3;  4WFO A;  2GEY A;  3CME 3;  3PGB A;  1Z1S A;  1AVL A;  3LTC A;  5IF6 A;  4O3V A;  2BNG A;  1OHP A;  1JKG A;  4XDV A;  4K61 A;  1OHS A;  3IPT A;  4G1M B;  2K0M A;  3FGY A;  3UL6 A;  5I97 A;  3KSE D;  1R4C A;  1LXE A;  5IG3 A;  5JPP A;  2YFL B;  1Q42 A;  1KD1 4;  2GEX A;  3LXU X;  2WOF A;  1OCV A;  2RSX A;  2CHC A;  1FGR A;  1A90 A;  4STD A;  3S67 A;  2W0Q A;  1TUH A;  1VQL 3;  1OHO A;  1OGX A;  1UI8 A;  4R1K A;  4N6V 0;  2ZDJ A;  5DRV A;  2XEP A;  1ROV A;  1GYB A;  3X3Z A;  1OF5 A;  3EX9 A;  1Q86 4;  5BXQ A;  3MSO A;  3CNX A;  1QVG 2;  1CQS A;  3N54 B;  1OF5 B;  3LYG A;  3Q1C A;  4K1V A;  2PNC A;  4R80 A;  1K9M 4;  2GBX B;  2CFG A;  3WDG B;  3T0U A;  1Q82 4;  3NM2 A;  1KC8 4;  5AYS C;  3U1W A;  4H61 A;  3G0K A;  3X40 A;  3MHE A;  4HM5 B;  3WOD G;  4HJL B;  3GZX B;  4HBR A;  1EA2 A;  3K7C A;  3DY5 A;  1IT7 A;  4H3U A;  1DVD A;  2HMK B;  2Z77 A;  1FGQ A;  1O7G B;  2P0M A;  4I4K A;  5IW9 A;  3FG1 A;  1N8R 4;  2XSO B;  1O7H B;  3U97 A;  2ML6 A;  3OX9 A;  3EC9 A;  3PCS A;  4MMX B;  4BTX A;  3OWU A;  3K63 A;  2BMR B;  1YJ9 3;  5D83 A;  2KRT A;  3AMO B;  3T8N A;  1FA3 A;  1WNH A;  3DGN A;  4LGQ A;  4N6T A;  2E2V A;  1YJN 3;  2CW9 A;  3Q90 A;  1W6G A;  2RCD A;  1WMN A;  1NWW A;  3I0Y A;  3GAX A;  3KFQ C;  3LTD A;  2F99 A;  3BNB A;  1NO3 A;  1FGM A;  3F14 A;  4XBT A;  5BVB A;  3H51 A;  1M90 4;  1STF I;  2PZV A;  2OOV C;  1RN7 A;  4LZI A;  4J8T A;  2GBW B;  4ZM8 A;  4U13 A;  3WA3 A;  3F8X A;  1AV4 A;  2RGQ A;  2P05 A;  2YX9 A;  4KFF A;  1CEW I;  2WOH A;  5LC7 A;  5EQL A;  4GB5 A;  5KP1 A;  2XSH B;  3CCL 3;  1K73 4;  4N6N B;  5FGO A;  3SOY A;  1W00 A;  1Q7Y 4;  1IVU A;  1JB2 A;  5AIH A;  5TGN A;  2HMJ B;  5IEP A;  3SX1 A;  1ZX2 A;  1AR0 A;  3FZW A;  5IER A;  2L4V A;  5JPU A;  1TP6 A;  2CC3 A;  3FF0 A;  3NM7 A;  1IV9 A;  3DXO A;  3G16 A;  4OVM A;  4MMY B;  1KWI A;  1SIH A;  3X41 A;  3PXM A;  1YVB I;  2JQ5 A;  2OCT A;  2OOV A;  5KP4 A;  1NB5 I;  2O9U X;  3FSD A;  3JUN A;  1STD A;  3SVA A;  2GU3 A;  3ALA A;  1WTH A;  2BT3 A;  3B4O A;  4N6U A;  6STD A;  2IMJ A;  3KKG A;  1NB3 I;  3FF2 A;  1LNH A;  1IQX A;  2LQV A;  3UL5 A;  4HM2 B;  2WO0 A;  3CU3 A;  2QIY A;  4L8O A;  1Q40 B;  3E99 A;  5IG4 A;  1E97 A;  1CYU A;  4R9K A;  3FG3 A;  1Q40 A;  1K28 A;  1IVW A;  1JJ2 2;  3F8H A;  4JRF A;  3MYT A;  4O02 B;  2YFJ B;  3CMA 3;  1K8A 4;  1MNL A;  3PS8 A;  4KVH A;  1GD4 A;  3LML A;  3SED A;  4AKY A;  3CCR 3;  1ZO2 A;  1W01 A;  3NBR A;  3PYJ A;  3IMA B;  4EV5 A;  5AYR B;  2R4I A;  3NX0 A;  4NRE A;  1IVX A;  2E2U A;  4RZM A;  1SJW A;  3FCS B;  2W9Q A;  3NHX A;  3K0Z A;  1SQW A;  2B24 B;  2Z6B A;  3KSP A;  5CXO A;  3UJM A;  1UUV B;  1U8C B;  1JN5 A;  3PZW A;  2HML B;  1JRQ A;  4GL6 A;  1ISK A;  1QJG A;  3EN8 A;  1OAC A;  3K9M C;  1YHQ 3;  3BNC A;  3IJE B;  3LTB A;  2Y73 A;  1LOX A;  4EYC A;  1DVC A;  2IUK A;  1TFO A;  3KN4 A;  2O3O A;  3NUV A;  3H3H A;  1ROA A;  4HZ9 B;  4FCJ A;  2P38 A;  1GY6 A;  1JKG B;  1QMA A;  5IG0 A;  2STD A;  3X3Y A;  4XM4 A;  2RFR A;  2IA7 A;  3JUO A;  3HK4 A;  3MKI A;  1S5A A;  2LYX A;  4KFE A;  3BND A;  4L8P A;  1AVK A;  4L7K A;  1GY5 A;  4NHF A;  5KP3 A;  1YIT 3;  3B8L A;  3JVC A;  1G96 A;  2CFK A;  4MEI A;  1W5Z A;  4XB5 A;  4LEH A;  3CCE 3;  1GY7 A;  3NQY A;  4N6L A;  1W6Y A;  1TU5 A;  4R4K A;  1OPY A;  3S28 A;  3CPW 2;  2JDI H;  3DGL A;  1M9G A;  1D6U A;  1QAK A;  1IQY A;  3DGO A;  3NV0 B;  4CDL A;  5ELU A;  5D81 A;  1W2Z A;  1FUW A;  1C7H A;  3F7S A;  4PEJ A;  3I55 3;  3BNE A;  4O8S A;  3UNL A;  1FGT A;  4R9L A;  5AEU B;  4WYK A;  1DYU A;  3PCR A;  1MOL A;  1VQ9 3;  3X42 A;  4HM1 B;  2OTL 3;  3S27 A;  5AII A;  1U5O A;  2ZL8 A;  3HZP A;  3DUK A;  3OXA A;  3CNM A;  3STD A;  1SII A;  1ULI B;  4EBG A;  3MG3 A;  2KCD A;  2BMQ B;  3X3X A;  3F7X A;  1HU9 A;  2MC8 A;  3NXJ A;  3T8U A;  1DMQ A;  2FXT A;  5EVH A;  1VQ8 3;  1K41 A;  5JBS A;  5EEO A;  3OWY A;  2GXF A;  1IV7 A;  3DMC A;  4HM6 B;  2QA4 3;  5AI1 A;  3RDE A;  1BUQ A;  3JUP A;  1CYV A;  3RGA A;  1QAL A;  5IEO A;  3EHC A;  3V92 A;  1N9E A;  2XR8 B;  3SOA A;  4XBX A;  1W02 A;  4MJD A;  4FMD A;  3F40 A;  1EG9 B;  2HMM B;  2XRX B;  1VQ7 3;  2OQE C;  2YFI B;  1NDO B;  1YJW 3;  3WOE B;  4EC6 A;  3LTA A;  5FW5 A;  3CCS 3;  1WMO A;  1KQS 2;  1N9J A;  2MF7 A;  5LC6 A;  4HZB B;  2IUJ A;  4IT7 A;  3B7C A;  4WHA A;  3LOY A;  3EE1 A;  1D6Z A;  1NU3 A;  1PU4 A;  3QRD A;  1W6C A;  3KE7 A;  4TX4 A;  4J9A A;  1VQN 3;  7STD A;  3D3L A;  3K5T A;  3ER7 A;  1WQL B;  3L0R A;  3MG2 A;  4JF8 A;  2D42 A;  3SLU A;  3EQQ B;  3OV4 A;  1IVV A;  3CCU 3;  3CPO A;  3NBJ A;  5STD A;  4BTY A;  1A2K A;  3DM8 A;  3EJV A;  3VSY A;  2CFL A;  3FH1 A;  1FGO A;  3GZY B;  2CK3 H;  5G2G A;  1YIJ 3;  4HM0 B;  1J2B A;  3KII A;  2FGT A;  1LVN A;  3LT8 A;  3UB1 A;  1VQ5 3;  1W2B 2;  3CC7 3;  5AIF A;  1M1X B;  2FNQ A;  1N8Q A;  3AMO A;  2F98 A;  3GWR A;  4FR9 A;  4FCZ A;  4AKZ A;  3EBY A;  4WWU C;  1TFK A;  1JB4 A;  4LSO A;  5CF1 A;  2CFW A;  4FMC A;  3JUM A;  1DMM A;  3A76 A;  2XF3 A;  1N5P A;  2I9W A;  2CKF B;  3HIG A;  4O2H A;  2K54 A;  2W56 A;  4ORL A;  5DRE A;  3ECF A;  5ELJ A;  2A15 A;  1VZZ A;  3OW2 2;  2B1X B;  1W7C A;  2HMN B;  4K1U A;  3N9H A;  3G8Z A;  4CCV A;  4EV2 A;  1JB5 A;  1E3R A;  3QK9 A;  2ML5 A;  3SXX A;  1N5H A;  4RNY A;  3WA2 X;  2V1L A;  1W4N A;  2CG1 A;  2GU1 A;  2W9P A;  4IPB A;  1DMN A;  2INX A;  4QWT A;  5HGR A;  5A0O B;  2QEX 3;  2WGO A;  2XFS A;  4HYZ A;  1RKY A;  5AEW B;  2P0X A;  3S5C A;  4WP5 A;  4LMI A;  3BB9 A;  3I56 3;  2CFD A;  3CCQ 3;  3MG1 A;  3N8B A;  3G6E 3;  1JN5 B;  2P09 A;  4FMB A;  3CXC 2;  2BHM A;  3EB8 A;  3DGM A;  4HKV B;  3LZA A;  4HM3 B;  1NJI 4;  1KSI A;  3JUQ A;  3HI7 A;  2M7O A;  1QAF A;  2XFT A;  4HM7 B;  4KFD A;  3F9S A;  3HX8 A;  3CCV 3;  2W56 B;  2F86 B;  3RGR A;  2SBL A;  4HM8 B;  1GD3 A;  1E3V A;  1VQK 3;  1GS3 A;  1VQP 3;  1JV2 B;  2BMO B;  1IK3 A;  1UW1 A;  1TIJ A;  4XDW A;  1F8N A;  4KZ1 A;  4BTW A;  1OUN A;  1Y4K A;  3VF1 A;  2HMO B;  2WGQ A;  1IQ8 A;  1SPU A;  4OK0 A;  1VQ6 3;  1O7M B;  3KZT A;  2CG0 A;  2D1W A;  1US1 A;  2XGN A;  3OWS A;  3CC2 3;  3V99 A;  1O7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...