3WMDA

Crystal structure of epoxide hydrolase monbi
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
144
Chain Sequence
MNEFARKKRALEHSRRINAGDLDAIIDLYAPDAVLEDPVGLPPVTGHDALRAHYEPLLAAHLREEAAEPVAGQDATHALIQISSVMDYLPVGPLYAERGWLKAPDAPGTARIHRTAMLVIRMDASGLIRHLKSYWGTSDLTVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Probable monensin biosynthesis isomerase
publication title Allosteric regulation of epoxide opening cascades by a pair of epoxide hydrolases in monensin biosynthesis
pubmed doi rcsb
source organism Streptomyces cinnamonensis
total genus 41
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wmdA00
3NBRA 1E97A 3FF2A 3BB9A 2QIYA 5IEOA 3JUOA 3FH1A 1S5AA 2K54A 3EQQB 3EN8A 1JB4A 4CDLA 5D83A 1IDPA 1O7NB 1QMAA 2W2CA 4LEHA 4HM2B 4RZMA 1DMNA 5DRVA 3FSDA 3KE7A 1W00A 1W01A 1OH0A 3VGNA 1U5OA 4XDVA 3FZWA 3JUNA 4HZ9B 2QGUA 3EJVA 3OXAA 1ULJB 3UNLA 1NWWA 1Q40A 1OHSA 3A76A 3T8UA 1TP6A 2BMOB 3K0ZA 4I4KA 5AIIA 1E3VA 3T8NA 2B24B 5CF1A 3GZXB 1OHPA 1O7HB 5DREA 5D82A 2YFJB 4HKVB 3CU3A 2UX0A 3F14A 3F8HA 1OPYA 3NUVA 1ZO2A 1DMQA 4OUQA 3OWYA 1JKGB 3STDA 5AIHA 4MJDA 8CHOA 4HM8B 4WWUC 1OF5B 4HM4B 1UUVB 3LYGA 3NM2A 5TGNA 2JQ5A 3ECFA 3NV0B 3S5CA 5CF2A 3OX9A 5CXOA 5D81A 5G2GA 4FCMA 2OWPA 2YFIB 2IMJA 4LGQA 1JB5A 2HMOB 2RGQA 5IG3A 1ASKA 3IPTA 2CKFB 3H3HA 1JB2A 4HM5B 5KP3A 1STDA 2F98A 3HK4A 3MHEA 4HM7B 1EG9B 1ULIB 4L7KA 2RFRA 4HM0B 5IF6A 1A2KA 5AEWB 5JPUA 1DMMA 3JUMA 2HMNB 2XSHB 3HZPA 1OGZA 5IERA 3WMDA 3B4OA 5JPPA 3D9RA 4N3VA 4HZBB 1OCVA 1JKGA 3GRDA 3F8XA 4HVNA 3FF0A 5KP4A 5FW5A 1EA2A 1OF5A 4HJLB 1TUHA 3DXOA 3NHXA 4R9KA 3DM8A 3SOAA 2F99A 3MKIA 3OWSA 3NV0A 3FLJA 3MG3A 1JN5B 5IG5A 1C7HA 5BXQA 3DMCA 3F9SA 3FKAA 3GZYB 2I9WA 1ZX2A 1GY7A 4XB5A 4R1KA 1SJWA 3SEDA 1AR0A 2A15A 3NXJA 4XM4A 2Z76A 3JUQA 3K7CA 2HMJB 4L8PA 3EC9A 4STDA 1NU3A 3GWRA 3CNXA 5IG4A 3EN1B 3EBTA 5AIFA 2BMQB 3E99A 1OUNA 3EHCA 4H3UA 3JUPA 4IIAA 3DUKA 3UJMA 2STDA 2YFLB 1GY6A 2B1XB 1BUQA 1GYBA 4WP5A 5IG0A 3OWUA 5CLKA 1O7GB 2GEXA 3MYTA 3Q90A 3KSPA 1K41A 4Q53A 1O7MB 3EF8A 3CNMA 2HMMB 4XBTA 3RGRA 4WYKB 3B4PA 1HKXA 4KVHA 3ROBA 4HM3B 1OGXA 2GBXB 4HM6B 2CHCA 1GY5A 2F86B 4K1VA 4X2HA 3VSYA 3OV4A 2BNGA 1NDOB 4OVMA 3BLZA 2BMRB 2GXFA 3FGYA 3GZBA 3M8CA 3HX8A 4L8OA 5STDA 1GS3A 2XRXB 3H51A 3G0KA 1Z1SA 2GBWB 5IENA 2HMKB 3I0YA 5BVBA 1W02A 2Z77A 3CPOA 2GEYA 3LZAA 1E3RA 5KP1A 4XBXA 3F40A 3GZRA 7STDA 3KKGA 3MG2A 3G16A 4HM1B 2RCDA 4XBYA 5EVHA 3EX9A 2XR8B 3MSOA 6STDA 5HGRA 3F7SA 3DZLA 3SOYA 3MG1A 5CK6A 4WYKA 1VZZA 4X2OA 5AEUB 4R9LA 1UUWB 2XSOB 1Q42A 3B7CA 2PZVA 1O7WB 2HMLB 3B8LA 4PEJA 4LMIA 4J8TA 3KZTA 2Z7AA 1W6YA 4XDWA 3F7XA 3RGAA 2INXA 3ER7A 1WQLB 2R4IA 1Q40B 3EBYA 3G8ZA 5AIGA 4U13A 1JN5A 4FCJA 5IEPA 4GB5A 4J9AA 1O7PB 4ORLA 1OHOA 1CQSA 5AI1A 4K1UA 1ISKA 1QJGA
chains in the Genus database with same CATH superfamily
3NBRA 1AVKA 1E97A 3FCSB 3FF2A 4EV2A 3BB9A 2QIYA 5IEOA 3JUOA 1UCIA 3FH1A 4BL3A 1S5AA 2K54A 3EQQB 3EN8A 3NQZA 4R80A 2OTL3 1FGOA 1GSPA 2AADA 1NJI4 3KFQC 1UUGB 1JB4A 4CDLA 5D83A 3I553 1Q864 1JBTA 1IDPA 1BOXA 2ML6A 3LXUX 1O7NB 1QMAA 2W2CA 3O8YA 4LEHA 3L0RA 4HM2B 1U8CB 4RZMA 1NNVA 2UGIA 2CG0A 1DMNA 1VQ53 5DRVA 3FSDA 3KE7A 1W00A 1W01A 5G1LA 1OH0A 3D79A 5A0OB 4JF8A 1W7CA 3AGOA 3VGNA 1DETA 4O8SA 1RKYA 1U5OA 3WA3A 3FZWA 4HZ9B 3JUNA 4XDVA 2QGUA 4BL2A 1V57A 1QAFA 3EJVA 1LOVA 1SARA 3OXAA 1ULJB 2P05A 1B2SA 4J5GA 3UNLA 1NWWA 1A67A 1LXEA 1Q40A 1OHSA 1B2UA 3A76A 2CK3H 3LH4A 1D6UA 2XH9A 2BO9B 1I70A 3NM7A 3T8UA 1TP6A 1MOLA 1YVBI 1BIRA 1FUSA 1UGHI 2BMOB 3K0ZA 4I4KA 5AIIA 3CME3 1AV4A 1E3VA 3PGBA 4N6OB 1IT8A 1VQ83 1W2ZA 4KFEA 2B24B 3T8NA 3GZXB 1OHPA 3QK9A 5CF1A 2P0MA 1QVG2 1O7HB 5DREA 4BTXA 1JNQA 1EKMA 4FR9A 1IVUA 1TRQA 3LTBA 5D82A 2OOVC 2ZHXB 3LT9A 2YFJB 1BRJA 1IQYA 2ZA4A 2MC8A 4HKVB 4MEIA 1RGAA 3CU3A 1RGGA 2WGOA 4KZ1A 1B2ZA 2UX0A 3F14A 3Q1CA 3F8HA 1L5GB 3CCL3 1K734 1OPYA 1FA3A 3NUVA 1IQ8A 1ZO2A 2R41A 3UL6A 1ROVA 1DMQA 1RGKA 4OUQA 1T3BA 1DE3A 3CCQ3 4ILFA 4RNZA 3DH2A 1WMPA 3OWYA 1RTUA 1M9GA 2QEX3 2K3DA 2WOFA 1BANA 3G6E3 3VF1A 1JKGB 3OW22 2LQVA 3STDA 5AIHA 3BNBA 1F8NA 4WHAA 4EXRA 3CD63 4MJDA 4CCVA 8CHOA 1YJ93 4HM8B 1N8QA 3FG1A 1JZDA 4WWUC 1OF5B 2H0HA 3DGNA 1DVDA 4HM4B 1QAKA 1UUVB 2C11A 1VQO3 1YGWA 4LZIA 4MMYB 2KCDA 3LYGA 2W0QA 3NM2A 5TGNA 3ZFZA 2JQ5A 3ECFA 3NV0B 1GOVA 3S5CA 3T0UA 1JBRA 1SIIA 2ZDJA 5AYSC 5LC6A 5CF2A 1N8R4 1FUTA 2BT3A 3BNCA 3BU4A 3OX9A 1YVSA 5CXOA 2J8XB 2W03A 2CC3A 3WDGB 2H0GA 1BSEA 4HYZA 5D81A 5GSPA 1YHQ3 1BSBA 3SXXA 4EV5A 1CEWI 1BNFA 1JBSA 5G2GA 4O2HA 4FCZA 1I8VA 4FCMA 1JJ22 1EQKA 1UGIA 2ML5A 2W56B 2WGQA 2OWPA 1YJN3 2FXTA 2YFIB 1KWIA 1RGEA 2IMJA 2CFWA 2KF4A 3NX0A 2E2UA 4LGQA 1JB5A 2HMOB 1V74A 2RGQA 5IG3A 3PS8A 1ASKA 2RBIA 2W9QA 3IPTA 2CKFB 3H3HA 1JB2A 1TRPA 3V98A 1LOWA 1G96A 3SVAA 4HM5B 5KP3A 1STDA 3IJEB 2F98A 5ELUA 3HK4A 1R4CA 1NB3I 3MHEA 1BGSA 5G1KA 1YIJ3 3NQYA 3K63A 4HM7B 1EG9B 3X3ZA 1ULIB 4L7KA 1BVIA 2IY2A 2RFRA 4HM0B 2K0MA 1YNVX 2RSXA 5IF6A 2CFDA 1A2KA 1V58A 5AEWB 2CWTA 1N9EA 1R4YA 5JPUA 1DMMA 3CCV3 3D5GA 3JUMA 2HMNB 4HOHA 2Y74A 2XSHB 3RNTA 4IPBA 1KQS2 2IA7A 3HZPA 4IT7A 1RJOA 1OGZA 1W6CA 5IERA 1FGRA 3WR2A 1RNBA 1B20A 1UI8A 2XEPA 3WMDA 3B4OA 5JPPA 3D9RA 4N3VA 2Z6BA 4HZBB 1RN4A 1OCVA 4R4KA 2XF3A 1JKGA 3D3LA 3GRDA 1RGHA 1IV7A 1RN7A 2CX0A 5LC7A 3CCM3 3F8XA 4HVNA 1LNHA 1DYUA 3FF0A 4H61A 4N6TA 3WHOA 5KP4A 6RNTA 5FW5A 1I2GA 1EA2A 1A2VA 1OF5A 1US1A 1RMSA 2L1SA 1Q9EA 2C4BA 4HJLB 4LSOA 1TUHA 3CCE3 4NHFA 3DXOA 1B2XA 1K28A 1LNIA 1I0XA 1IYYA 2UUGC 3EB8A 5ELJA 3PXMA 2LYXA 3CC23 3NHXA 1RSNA 2WOHA 3DM8A 4R9KA 4FMCA 3S27A 3FG3A 3SOAA 1BNGA 3WODG 2F4YA 1MWTA 1BNJA 1IT7A 2F99A 1G0TA 3MKIA 4HAAA 3OWSA 3NV0A 3FLJA 9RNTA 3MG3A 3PCRA 1JN5B 1YIT3 5IG5A 3G4S3 2CIUA 2OTJ3 1C7HA 1ROAA 3DMCA 5BXQA 1FZUA 1PY3A 3D5IA 1DVCA 1BNIA 3K9MC 3HIIA 1TFOA 2H0IA 1NB5I 3F9SA 1FGTA 3FKAA 1BRSA 1BSDA 3GZYB 2L4VA 5I97A 3AMOA 2W56A 2I9WA 3Q3FA 1ZX2A 1GY7A 3DGOA 4XB5A 4R1KA 1SJWA 3SEDA 3I563 3KCHA 1K8A4 3CXC2 1AR0A 2A15A 3NXJA 1RRHA 1LVNA 3LTCA 4XM4A 3LOYA 1T2HA 4EC6A 5M19A 2RNTA 2Z76A 1IU7A 2KF3A 3JUQA 3K7CA 4N6NB 2HMJB 2JDIH 3CMA3 3ALAA 4L8PA 1RDSA 3EC9A 3WOEB 6GSPA 1JZOA 1SQWA 2KF5A 1RLSA 4O02B 4STDA 1CYVA 4KFFA 1I2EA 1NU3A 3LT8A 1LOYA 3GWRA 3ZG0A 1HZ1A 3CNXA 3N8BA 1BNSA 2OCTA 1UCKA 5IG4A 2C10A 2F5WA 3NBJA 1M1K4 1N9JA 3EN1B 1QVF2 3EBTA 1BRKA 5AIFA 4JRFA 2OQEA 3QRDA 1WNHA 2BMQB 4OK0A 3E99A 1OUNA 2P0XA 3EHCA 3N9HA 3HI7A 1T2IA 3JUPA 4H3UA 8RNTA 1B27A 1G02A 1GD3A 4IIAA 4CPKA 1FGMA 4MMZB 1B2MA 2BIRA 1KSIA 3DUKA 3Q2PA 3UJMA 1IVWA 2STDA 2YFLB 3MPHA 3J7Yd 1HYFA 2BU4A 1GY6A 2B1XB 1BUQA 1GYBA 2KXGA 1LQGC 2CW9A 2KF6A 4DKIA 1TJDA 5JBSA 2XGLA 3KIIA 1ZGXA 1UW1A 4N6UA 4WP5A 1MWSA 1UDII 1N5PA 3LTAA 5IG0A 1LQMB 1W5ZA 3OWUA 1VQ43 1YI23 5CLKA 1WMOA 1YGEA 1W4NA 1WMNA 2W04A 2CFKA 3PCSA 4BIRA 3WA2X 3DGLA 1O7GB 3BIRA 2GEXA 3MWZA 2F56A 1SPUA 3MYTA 3X42A 1J2BA 3Q90A 3KSPA 1RNTA 1Q814 1K41A 2SARA 2AAEA 4Q53A 1O7MB 1TFKA 3BNDA 3EF8A 4LYLB 3SX1A 4K61A 1RHLA 3CNMA 1RRLA 2HMMB 3S28A 4XBTA 1D6ZA 4KFDA 4WYKB 3RGRA 3PZWA 3B4PA 3SLUA 1EUIC 1IV9A 2IUKA 1HKXA 1LOXA 2XFSA 1VQ93 4KVHA 3ROBA 4WFOA 3HOHA 4HM3B 1N5HA 3V99A 1OGXA 2GBXB 4FMDA 4HM6B 2CHCA 1GY5A 2D42A 5EEOA 1I3FA 2F86B 1BUJA 1X1XA 2P09A 1UCLA 4K1VA 5EQLA 4TX4A 4X2HA 3VSYA 1OACA 1JV2B 3ZG5A 3CCU3 1Y4KA 1B3SA 3AHWA 1WTHA 3OV4A 4N6MA 2BNGA 1NDOB 4OVMA 3BLZA 4HBRA 1W6GA 4CJNA 1UCJA 2BMRB 2GXFA 1FGQA 1ZS7A 3FGYA 3FG4A 4GHOA 1FW7A 2M7OA 1PFPA 3G713 3GZBA 3M8CA 3HX8A 1AQZA 4L8OA 2GU3A 5STDA 4AKYA 1GS3A 1RGFA 2WO0A 2XRXB 1RCLA 3H51A 1MWUA 1GMPA 1GOUA 3G0KA 3N54B 2Q07A 1KD14 2F5MA 3X41A 1IQXA 1RGCA 1M1XB 1Z1SA 2XFTA 3A5EA 2GBWB 1CYUA 5IENA 3K5TA 1MGWA 3WOFB 1W2B2 2E2VA 1RN1A 4O3VA 4EBGA 2HMKB 3U1WA 2CH9A 1PYLA 2OOVA 3I0YA 1AY7A 1W02A 5BVBA 1TTOA 3DGMA 4G1MB 2W9PA 1IVVA 4GSPA 1MNLA 4KT3B 3D4AA 2Z77A 3CPOA 1B21A 1BSCA 2CFLA 2GEYA 4GL6A 3LZAA 4NREA 1S723 1E3RA 1VQN3 1K9M4 5KP1A 3CCJ3 1MWRA 3PYJA 3SYUA 4RBNA 2ZL8A 3GAXA 3NBBA 4XBXA 5HOHA 1BRHA 3F40A 3U97A 1FYSA 2O9UX 3GZRA 7STDA 1FUWA 2O3OA 1I0VA 3KKGA 3MG2A 1X1YA 3G16A 4HM1B 4K90B 2IYJA 2W6JH 1VQM3 1M904 2RCDA 4XBYA 5EVHA 3EX9A 2XR8B 3MSOA 4EW5A 1VQL3 1BRGA 6STDA 2YX9A 3KN4A 4RNYA 5HGRA 1D6YA 3F7SA 1VQ73 1GD4A 3DZLA 3SOYA 3MG1A 5FGOA 3CPW2 1TU5A 3IMAB 2IUJA 5CK6A 3CC73 1STFI 3V92A 1X1UA 4WYKA 1GOYA 2CWUA 3S67A 3KSED 4BTWA 1VZZA 1PU4A 2BHMA 2CFGA 1VQQA 1YJW3 3HIGA 4X2OA 2V1LA 4FMBA 2CX1A 2CG1A 5AEUB 1A90A 2GU1A 5M18A 1HU9A 4R9LA 3CCS3 1A2PA 3AHSA 1UUWB 4RNTA 4J5KA 3BNEA 1BAOA 2SBLA 1BNEA 2XSOB 1IK3A 1Q42A 3B7CA 3LMLA 3CC43 1X1WA 5BIRA 1GMRA 1KC84 1MGRA 2PZVA 3S29A 4EYCA 1RGLA 1O7WB 3AGNA 4I5QA 4AEQA 5BU4A 1Q824 1BSAA 2HMLB 3B8LA 3DY5A 4N6V0 4PEJA 4LMIA 4J8TA 3GSPA 1C54A 1LRAA 7RNTA 3X40A 3KZTA 2Z7AA 1TIJA 1W6YA 2HOHA 4ZM8A 2PNCA 1I2FA 2KAAA 4XDWA 3F7XA 3RGAA 2INXA 5M1AA 4BTYA 3CCR3 3ER7A 2QA43 1VQ63 2P38A 5AYRB 1EEJA 3TDGA 1WQLB 2R4IA 4MMXB 1BNRA 1Q40B 3EBYA 1BRNL 3RDEA 3G8ZA 3JVCA 1Q7Y4 5RNTA 3X3YA 4FMAA 1AVLA 1SIHA 1Q7HA 1VQK3 4NPBA 1JRQA 1QALA 2FNQA 1CH0A 4U13A 5AIGA 1UI7A 3URPA 1JN5A 7GSPA 2XGNA 1RCKA 2OQEC 4FCJA 4N6LA 2E2TA 3DGYA 5IEPA 2Y73A 4GB5A 4J9AA 5IW9A 1O7PB 2FGTA 4ORLA 4QWTA 1VQP3 1OHOA 2D1WA 1CQSA 5AI1A 1BRIA 1BU4A 2MF7A 4K1UA 3UL5A 3AMOB 3EE1A 1ISKA 1NO3A 3X3XA 3LTDA 1T5YA 4AKZA 3UB1A 1GMQA 4BU4A 1QJGA 2KRTA 2GSPA 1IVXA 2CWVA 1I3IA
chains in the Genus database with same CATH topology
3NBRA 1AVKA 1E97A 3FCSB 3FF2A 4EV2A 3BB9A 2QIYA 5IEOA 3JUOA 3FH1A 1S5AA 2K54A 3EQQB 3EN8A 3NQZA 4R80A 2OTL3 1FGOA 1NJI4 3KFQC 1JB4A 4CDLA 5D83A 3I553 1Q864 1IDPA 2ML6A 3LXUX 1O7NB 1QMAA 2W2CA 3O8YA 4LEHA 3L0RA 4HM2B 1U8CB 4RZMA 2CG0A 1DMNA 1VQ53 5DRVA 3FSDA 3KE7A 1W00A 1W01A 5A0OB 1OH0A 4JF8A 1W7CA 3VGNA 4O8SA 1RKYA 1U5OA 3WA3A 3FZWA 4HZ9B 3JUNA 4XDVA 2QGUA 1QAFA 3EJVA 3OXAA 1ULJB 2P05A 3UNLA 1NWWA 1LXEA 1Q40A 1OHSA 3A76A 2CK3H 3LH4A 1D6UA 2XH9A 2BO9B 3NM7A 3T8UA 1TP6A 1MOLA 1YVBI 2BMOB 3K0ZA 4I4KA 5AIIA 1AV4A 1E3VA 3PGBA 4N6OB 1IT8A 1VQ83 1W2ZA 4KFEA 2B24B 3T8NA 3GZXB 1OHPA 3QK9A 5CF1A 2P0MA 1QVG2 1O7HB 5DREA 4BTXA 1JNQA 1EKMA 4FR9A 1IVUA 3LTBA 5D82A 2OOVC 3LT9A 2YFJB 1IQYA 2MC8A 4HKVB 4MEIA 3CU3A 2WGOA 4KZ1A 2UX0A 3F14A 3Q1CA 3F8HA 1L5GB 3CCL3 1K734 1OPYA 1FA3A 3NUVA 1IQ8A 1ZO2A 3UL6A 1ROVA 1DMQA 4OUQA 3CCQ3 4RNZA 3OWYA 1WMPA 2QEX3 1M9GA 2WOFA 3G6E3 3VF1A 1JKGB 3OW22 2LQVA 3STDA 5AIHA 3BNBA 1F8NA 4WHAA 4EXRA 3CD63 4MJDA 4CCVA 8CHOA 1YJ93 4HM8B 1N8QA 3FG1A 4WWUC 1OF5B 3DGNA 1DVDA 4HM4B 1QAKA 1UUVB 2C11A 1VQO3 4LZIA 4MMYB 2KCDA 3LYGA 2W0QA 3NM2A 5TGNA 2JQ5A 3ECFA 3NV0B 3S5CA 3T0UA 1SIIA 2ZDJA 5AYSC 5LC6A 5CF2A 1N8R4 2BT3A 3BNCA 3OX9A 5CXOA 2W03A 2CC3A 3WDGB 5D81A 4HYZA 1YHQ3 3SXXA 4EV5A 1CEWI 5G2GA 4O2HA 4FCZA 4FCMA 1JJ22 1EQKA 2ML5A 2W56B 2WGQA 2OWPA 1YJN3 2FXTA 2YFIB 1KWIA 2IMJA 2CFWA 3NX0A 2E2UA 4LGQA 1JB5A 2HMOB 1V74A 2RGQA 5IG3A 3PS8A 1ASKA 2W9QA 3IPTA 2CKFB 3H3HA 1JB2A 3V98A 1G96A 3SVAA 4HM5B 5KP3A 1STDA 3IJEB 2F98A 5ELUA 3HK4A 1R4CA 1NB3I 3MHEA 1YIJ3 3NQYA 3K63A 4HM7B 1EG9B 3X3ZA 1ULIB 4L7KA 2RFRA 4HM0B 2K0MA 2RSXA 5IF6A 2CFDA 1A2KA 5AEWB 2CWTA 1N9EA 5JPUA 1DMMA 3CCV3 3JUMA 2HMNB 2Y74A 2XSHB 4IPBA 1KQS2 2IA7A 3HZPA 4IT7A 1RJOA 1OGZA 1W6CA 5IERA 1FGRA 1UI8A 3WMDA 2XEPA 3B4OA 5JPPA 3D9RA 4N3VA 2Z6BA 4HZBB 1OCVA 4R4KA 2XF3A 1JKGA 3D3LA 3GRDA 1IV7A 1RN7A 3CCM3 5LC7A 3F8XA 4HVNA 1LNHA 1DYUA 3FF0A 4H61A 4N6TA 5KP4A 3CME3 5FW5A 1EA2A 1A2VA 1OF5A 1US1A 4HJLB 4LSOA 1TUHA 3CCE3 4NHFA 3DXOA 1K28A 3EB8A 5ELJA 3PXMA 2LYXA 3CC23 3NHXA 4R9KA 2WOHA 3DM8A 4FMCA 3S27A 3FG3A 3SOAA 3WODG 2F99A 1IT7A 3MKIA 3OWSA 3NV0A 3FLJA 3MG3A 3PCRA 1JN5B 1YIT3 5IG5A 3G4S3 2CIUA 2OTJ3 1C7HA 1ROAA 3DMCA 5BXQA 1DVCA 3K9MC 1NB5I 3HIIA 1TFOA 3F9SA 1FGTA 3FKAA 3GZYB 2L4VA 5I97A 3AMOA 2W56A 2I9WA 1ZX2A 1GY7A 3DGOA 4XB5A 4R1KA 1SJWA 3SEDA 3I563 1K8A4 3CXC2 1AR0A 2A15A 3NXJA 1RRHA 1LVNA 3LTCA 4XM4A 3LOYA 4EC6A 2Z76A 1IU7A 4N6NB 3JUQA 3K7CA 3CMA3 2HMJB 2JDIH 3ALAA 4L8PA 3EC9A 3WOEB 1SQWA 4O02B 4STDA 1CYVA 4KFFA 1NU3A 3LT8A 3GWRA 3CNXA 3N8BA 2OCTA 5IG4A 2C10A 3NBJA 1M1K4 1N9JA 3EN1B 1QVF2 3EBTA 5AIFA 4JRFA 2OQEA 3QRDA 1WNHA 2BMQB 4OK0A 3E99A 1OUNA 2P0XA 3EHCA 3N9HA 3HI7A 4H3UA 3JUPA 4IIAA 1GD3A 1FGMA 4MMZB 1KSIA 3DUKA 3Q2PA 3UJMA 1IVWA 2STDA 2YFLB 3MPHA 3J7Yd 1GY6A 2B1XB 1BUQA 1GYBA 2KXGA 2CW9A 5JBSA 2XGLA 3KIIA 4WP5A 1UW1A 4N6UA 5IG0A 3LTAA 1N5PA 1W5ZA 3OWUA 1VQ43 1YI23 5CLKA 1WMOA 1YGEA 1W4NA 1WMNA 2W04A 2CFKA 3PCSA 3WA2X 3DGLA 1O7GB 3MWZA 2GEXA 1SPUA 3MYTA 3X42A 1J2BA 3Q90A 3KSPA 1Q814 1K41A 4Q53A 1O7MB 1TFKA 3BNDA 3EF8A 3SX1A 4K61A 3CNMA 1RRLA 2HMMB 3S28A 4XBTA 1D6ZA 4KFDA 4WYKB 3RGRA 3PZWA 3B4PA 3SLUA 1IV9A 2IUKA 1HKXA 1LOXA 2XFSA 1VQ93 4KVHA 3ROBA 4WFOA 4HM3B 3V99A 1N5HA 1OGXA 2GBXB 4FMDA 4HM6B 2CHCA 1GY5A 2D42A 5EEOA 2F86B 2P09A 4K1VA 5EQLA 4TX4A 4X2HA 3VSYA 1OACA 1JV2B 3CCU3 1Y4KA 1WTHA 3OV4A 4N6MA 2BNGA 1NDOB 4OVMA 3BLZA 4HBRA 1W6GA 2BMRB 2GXFA 1FGQA 3FG4A 3FGYA 2M7OA 1PFPA 3G713 3GZBA 3M8CA 3HX8A 4L8OA 5STDA 2GU3A 4AKYA 1GS3A 2WO0A 2XRXB 3H51A 3G0KA 3N54B 1KD14 2Q07A 3X41A 1IQXA 1Z1SA 1M1XB 2XFTA 2GBWB 1CYUA 5IENA 3K5TA 3WOFB 1W2B2 2E2VA 4O3VA 4EBGA 2HMKB 3U1WA 2CH9A 2OOVA 3I0YA 5BVBA 1W02A 3DGMA 4G1MB 2W9PA 1IVVA 1MNLA 2Z77A 3CPOA 2GEYA 4GL6A 2CFLA 3LZAA 4NREA 1S723 1E3RA 1VQN3 1K9M4 5KP1A 3CCJ3 3PYJA 4RBNA 2ZL8A 3GAXA 3NBBA 4XBXA 3F40A 3U97A 2O9UX 3GZRA 7STDA 1FUWA 2O3OA 3KKGA 3MG2A 3G16A 4HM1B 4K90B 1VQM3 2W6JH 1M904 2RCDA 4XBYA 5EVHA 3EX9A 2XR8B 3MSOA 1VQL3 6STDA 2YX9A 3KN4A 4RNYA 5HGRA 1D6YA 3F7SA 1VQ73 1GD4A 3DZLA 3SOYA 3MG1A 5FGOA 3CPW2 1TU5A 3IMAB 2IUJA 5CK6A 3CC73 1STFI 3V92A 4WYKA 2CWUA 3S67A 3KSED 4BTWA 1VZZA 1PU4A 2BHMA 2CFGA 1YJW3 3HIGA 4X2OA 2V1LA 4FMBA 2CG1A 5AEUB 1A90A 2GU1A 1HU9A 4R9LA 3CCS3 1UUWB 3BNEA 2SBLA 2XSOB 1IK3A 3CC43 1Q42A 3B7CA 3LMLA 1KC84 3S29A 2PZVA 4EYCA 1O7WB 4AEQA 1Q824 2HMLB 3B8LA 3DY5A 4N6V0 4PEJA 4LMIA 4J8TA 3X40A 3KZTA 2Z7AA 1TIJA 1W6YA 4ZM8A 2PNCA 3CCR3 4BTYA 4XDWA 3F7XA 3RGAA 2INXA 1VQ63 1A67A 3ER7A 2QA43 2P38A 5AYRB 3TDGA 1WQLB 2R4IA 4MMXB 1Q40B 3EBYA 3RDEA 3G8ZA 3JVCA 1Q7Y4 3X3YA 4FMAA 1AVLA 1SIHA 1VQK3 1JRQA 1QALA 2FNQA 5AIGA 4U13A 1UI7A 1JN5A 2XGNA 2OQEC 4FCJA 4N6LA 2E2TA 5IEPA 2Y73A 4GB5A 4J9AA 5IW9A 1O7PB 2FGTA 4ORLA 4QWTA 1VQP3 1OHOA 2D1WA 1CQSA 5AI1A 2MF7A 4K1UA 3UL5A 3AMOB 3EE1A 1ISKA 1NO3A 3X3XA 3LTDA 1T5YA 4AKZA 3UB1A 1QJGA 2KRTA 1IVXA 2CWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  1E97 A;  3FF2 A;  3BB9 A;  2QIY A;  5IEO A;  3JUO A;  3FH1 A;  1S5A A;  2K54 A;  3EQQ B;  3EN8 A;  1JB4 A;  4CDL A;  5D83 A;  1IDP A;  1O7N B;  1QMA A;  2W2C A;  4LEH A;  4HM2 B;  4RZM A;  1DMN A;  5DRV A;  3FSD A;  3KE7 A;  1W00 A;  1W01 A;  1OH0 A;  3VGN A;  1U5O A;  4XDV A;  3FZW A;  3JUN A;  4HZ9 B;  2QGU A;  3EJV A;  3OXA A;  1ULJ B;  3UNL A;  1NWW A;  1Q40 A;  1OHS A;  3A76 A;  3T8U A;  1TP6 A;  2BMO B;  3K0Z A;  4I4K A;  5AII A;  1E3V A;  3T8N A;  2B24 B;  5CF1 A;  3GZX B;  1OHP A;  1O7H B;  5DRE A;  5D82 A;  2YFJ B;  4HKV B;  3CU3 A;  2UX0 A;  3F14 A;  3F8H A;  1OPY A;  3NUV A;  1ZO2 A;  1DMQ A;  4OUQ A;  3OWY A;  1JKG B;  3STD A;  5AIH A;  4MJD A;  8CHO A;  4HM8 B;  4WWU C;  1OF5 B;  4HM4 B;  1UUV B;  3LYG A;  3NM2 A;  5TGN A;  2JQ5 A;  3ECF A;  3NV0 B;  3S5C A;  5CF2 A;  3OX9 A;  5CXO A;  5D81 A;  5G2G A;  4FCM A;  2OWP A;  2YFI B;  2IMJ A;  4LGQ A;  1JB5 A;  2HMO B;  2RGQ A;  5IG3 A;  1ASK A;  3IPT A;  2CKF B;  3H3H A;  1JB2 A;  4HM5 B;  5KP3 A;  1STD A;  2F98 A;  3HK4 A;  3MHE A;  4HM7 B;  1EG9 B;  1ULI B;  4L7K A;  2RFR A;  4HM0 B;  5IF6 A;  1A2K A;  5AEW B;  5JPU A;  1DMM A;  3JUM A;  2HMN B;  2XSH B;  3HZP A;  1OGZ A;  5IER A;  3WMD A;  3B4O A;  5JPP A;  3D9R A;  4N3V A;  4HZB B;  1OCV A;  1JKG A;  3GRD A;  3F8X A;  4HVN A;  3FF0 A;  5KP4 A;  5FW5 A;  1EA2 A;  1OF5 A;  4HJL B;  1TUH A;  3DXO A;  3NHX A;  4R9K A;  3DM8 A;  3SOA A;  2F99 A;  3MKI A;  3OWS A;  3NV0 A;  3FLJ A;  3MG3 A;  1JN5 B;  5IG5 A;  1C7H A;  5BXQ A;  3DMC A;  3F9S A;  3FKA A;  3GZY B;  2I9W A;  1ZX2 A;  1GY7 A;  4XB5 A;  4R1K A;  1SJW A;  3SED A;  1AR0 A;  2A15 A;  3NXJ A;  4XM4 A;  2Z76 A;  3JUQ A;  3K7C A;  2HMJ B;  4L8P A;  3EC9 A;  4STD A;  1NU3 A;  3GWR A;  3CNX A;  5IG4 A;  3EN1 B;  3EBT A;  5AIF A;  2BMQ B;  3E99 A;  1OUN A;  3EHC A;  4H3U A;  3JUP A;  4IIA A;  3DUK A;  3UJM A;  2STD A;  2YFL B;  1GY6 A;  2B1X B;  1BUQ A;  1GYB A;  4WP5 A;  5IG0 A;  3OWU A;  5CLK A;  1O7G B;  2GEX A;  3MYT A;  3Q90 A;  3KSP A;  1K41 A;  4Q53 A;  1O7M B;  3EF8 A;  3CNM A;  2HMM B;  4XBT A;  3RGR A;  4WYK B;  3B4P A;  1HKX A;  4KVH A;  3ROB A;  4HM3 B;  1OGX A;  2GBX B;  4HM6 B;  2CHC A;  1GY5 A;  2F86 B;  4K1V A;  4X2H A;  3VSY A;  3OV4 A;  2BNG A;  1NDO B;  4OVM A;  3BLZ A;  2BMR B;  2GXF A;  3FGY A;  3GZB A;  3M8C A;  3HX8 A;  4L8O A;  5STD A;  1GS3 A;  2XRX B;  3H51 A;  3G0K A;  1Z1S A;  2GBW B;  5IEN A;  2HMK B;  3I0Y A;  5BVB A;  1W02 A;  2Z77 A;  3CPO A;  2GEY A;  3LZA A;  1E3R A;  5KP1 A;  4XBX A;  3F40 A;  3GZR A;  7STD A;  3KKG A;  3MG2 A;  3G16 A;  4HM1 B;  2RCD A;  4XBY A;  5EVH A;  3EX9 A;  2XR8 B;  3MSO A;  6STD A;  5HGR A;  3F7S A;  3DZL A;  3SOY A;  3MG1 A;  5CK6 A;  4WYK A;  1VZZ A;  4X2O A;  5AEU B;  4R9L A;  1UUW B;  2XSO B;  1Q42 A;  3B7C A;  2PZV A;  1O7W B;  2HML B;  3B8L A;  4PEJ A;  4LMI A;  4J8T A;  3KZT A;  2Z7A A;  1W6Y A;  4XDW A;  3F7X A;  3RGA A;  2INX A;  3ER7 A;  1WQL B;  2R4I A;  1Q40 B;  3EBY A;  3G8Z A;  5AIG A;  4U13 A;  1JN5 A;  4FCJ A;  5IEP A;  4GB5 A;  4J9A A;  1O7P B;  4ORL A;  1OHO A;  1CQS A;  5AI1 A;  4K1U A;  1ISK A;  1QJG A; 
#chains in the Genus database with same CATH topology
 3NBR A;  1AVK A;  1E97 A;  3FCS B;  3FF2 A;  4EV2 A;  3BB9 A;  2QIY A;  5IEO A;  3JUO A;  1UCI A;  3FH1 A;  4BL3 A;  1S5A A;  2K54 A;  3EQQ B;  3EN8 A;  3NQZ A;  4R80 A;  2OTL 3;  1FGO A;  1GSP A;  2AAD A;  1NJI 4;  3KFQ C;  1UUG B;  1JB4 A;  4CDL A;  5D83 A;  3I55 3;  1Q86 4;  1JBT A;  1IDP A;  1BOX A;  2ML6 A;  3LXU X;  1O7N B;  1QMA A;  2W2C A;  3O8Y A;  4LEH A;  3L0R A;  4HM2 B;  1U8C B;  4RZM A;  1NNV A;  2UGI A;  2CG0 A;  1DMN A;  1VQ5 3;  5DRV A;  3FSD A;  3KE7 A;  1W00 A;  1W01 A;  5G1L A;  1OH0 A;  3D79 A;  5A0O B;  4JF8 A;  1W7C A;  3AGO A;  3VGN A;  1DET A;  4O8S A;  1RKY A;  1U5O A;  3WA3 A;  3FZW A;  4HZ9 B;  3JUN A;  4XDV A;  2QGU A;  4BL2 A;  1V57 A;  1QAF A;  3EJV A;  1LOV A;  1SAR A;  3OXA A;  1ULJ B;  2P05 A;  1B2S A;  4J5G A;  3UNL A;  1NWW A;  1A67 A;  1LXE A;  1Q40 A;  1OHS A;  1B2U A;  3A76 A;  2CK3 H;  3LH4 A;  1D6U A;  2XH9 A;  2BO9 B;  1I70 A;  3NM7 A;  3T8U A;  1TP6 A;  1MOL A;  1YVB I;  1BIR A;  1FUS A;  1UGH I;  2BMO B;  3K0Z A;  4I4K A;  5AII A;  3CME 3;  1AV4 A;  1E3V A;  3PGB A;  4N6O B;  1IT8 A;  1VQ8 3;  1W2Z A;  4KFE A;  2B24 B;  3T8N A;  3GZX B;  1OHP A;  3QK9 A;  5CF1 A;  2P0M A;  1QVG 2;  1O7H B;  5DRE A;  4BTX A;  1JNQ A;  1EKM A;  4FR9 A;  1IVU A;  1TRQ A;  3LTB A;  5D82 A;  2OOV C;  2ZHX B;  3LT9 A;  2YFJ B;  1BRJ A;  1IQY A;  2ZA4 A;  2MC8 A;  4HKV B;  4MEI A;  1RGA A;  3CU3 A;  1RGG A;  2WGO A;  4KZ1 A;  1B2Z A;  2UX0 A;  3F14 A;  3Q1C A;  3F8H A;  1L5G B;  3CCL 3;  1K73 4;  1OPY A;  1FA3 A;  3NUV A;  1IQ8 A;  1ZO2 A;  2R41 A;  3UL6 A;  1ROV A;  1DMQ A;  1RGK A;  4OUQ A;  1T3B A;  1DE3 A;  3CCQ 3;  4ILF A;  4RNZ A;  3DH2 A;  1WMP A;  3OWY A;  1RTU A;  1M9G A;  2QEX 3;  2K3D A;  2WOF A;  1BAN A;  3G6E 3;  3VF1 A;  1JKG B;  3OW2 2;  2LQV A;  3STD A;  5AIH A;  3BNB A;  1F8N A;  4WHA A;  4EXR A;  3CD6 3;  4MJD A;  4CCV A;  8CHO A;  1YJ9 3;  4HM8 B;  1N8Q A;  3FG1 A;  1JZD A;  4WWU C;  1OF5 B;  2H0H A;  3DGN A;  1DVD A;  4HM4 B;  1QAK A;  1UUV B;  2C11 A;  1VQO 3;  1YGW A;  4LZI A;  4MMY B;  2KCD A;  3LYG A;  2W0Q A;  3NM2 A;  5TGN A;  3ZFZ A;  2JQ5 A;  3ECF A;  3NV0 B;  1GOV A;  3S5C A;  3T0U A;  1JBR A;  1SII A;  2ZDJ A;  5AYS C;  5LC6 A;  5CF2 A;  1N8R 4;  1FUT A;  2BT3 A;  3BNC A;  3BU4 A;  3OX9 A;  1YVS A;  5CXO A;  2J8X B;  2W03 A;  2CC3 A;  3WDG B;  2H0G A;  1BSE A;  4HYZ A;  5D81 A;  5GSP A;  1YHQ 3;  1BSB A;  3SXX A;  4EV5 A;  1CEW I;  1BNF A;  1JBS A;  5G2G A;  4O2H A;  4FCZ A;  1I8V A;  4FCM A;  1JJ2 2;  1EQK A;  1UGI A;  2ML5 A;  2W56 B;  2WGQ A;  2OWP A;  1YJN 3;  2FXT A;  2YFI B;  1KWI A;  1RGE A;  2IMJ A;  2CFW A;  2KF4 A;  3NX0 A;  2E2U A;  4LGQ A;  1JB5 A;  2HMO B;  1V74 A;  2RGQ A;  5IG3 A;  3PS8 A;  1ASK A;  2RBI A;  2W9Q A;  3IPT A;  2CKF B;  3H3H A;  1JB2 A;  1TRP A;  3V98 A;  1LOW A;  1G96 A;  3SVA A;  4HM5 B;  5KP3 A;  1STD A;  3IJE B;  2F98 A;  5ELU A;  3HK4 A;  1R4C A;  1NB3 I;  3MHE A;  1BGS A;  5G1K A;  1YIJ 3;  3NQY A;  3K63 A;  4HM7 B;  1EG9 B;  3X3Z A;  1ULI B;  4L7K A;  1BVI A;  2IY2 A;  2RFR A;  4HM0 B;  2K0M A;  1YNV X;  2RSX A;  5IF6 A;  2CFD A;  1A2K A;  1V58 A;  5AEW B;  2CWT A;  1N9E A;  1R4Y A;  5JPU A;  1DMM A;  3CCV 3;  3D5G A;  3JUM A;  2HMN B;  4HOH A;  2Y74 A;  2XSH B;  3RNT A;  4IPB A;  1KQS 2;  2IA7 A;  3HZP A;  4IT7 A;  1RJO A;  1OGZ A;  1W6C A;  5IER A;  1FGR A;  3WR2 A;  1RNB A;  1B20 A;  1UI8 A;  2XEP A;  3WMD A;  3B4O A;  5JPP A;  3D9R A;  4N3V A;  2Z6B A;  4HZB B;  1RN4 A;  1OCV A;  4R4K A;  2XF3 A;  1JKG A;  3D3L A;  3GRD A;  1RGH A;  1IV7 A;  1RN7 A;  2CX0 A;  5LC7 A;  3CCM 3;  3F8X A;  4HVN A;  1LNH A;  1DYU A;  3FF0 A;  4H61 A;  4N6T A;  3WHO A;  5KP4 A;  6RNT A;  5FW5 A;  1I2G A;  1EA2 A;  1A2V A;  1OF5 A;  1US1 A;  1RMS A;  2L1S A;  1Q9E A;  2C4B A;  4HJL B;  4LSO A;  1TUH A;  3CCE 3;  4NHF A;  3DXO A;  1B2X A;  1K28 A;  1LNI A;  1I0X A;  1IYY A;  2UUG C;  3EB8 A;  5ELJ A;  3PXM A;  2LYX A;  3CC2 3;  3NHX A;  1RSN A;  2WOH A;  3DM8 A;  4R9K A;  4FMC A;  3S27 A;  3FG3 A;  3SOA A;  1BNG A;  3WOD G;  2F4Y A;  1MWT A;  1BNJ A;  1IT7 A;  2F99 A;  1G0T A;  3MKI A;  4HAA A;  3OWS A;  3NV0 A;  3FLJ A;  9RNT A;  3MG3 A;  3PCR A;  1JN5 B;  1YIT 3;  5IG5 A;  3G4S 3;  2CIU A;  2OTJ 3;  1C7H A;  1ROA A;  3DMC A;  5BXQ A;  1FZU A;  1PY3 A;  3D5I A;  1DVC A;  1BNI A;  3K9M C;  3HII A;  1TFO A;  2H0I A;  1NB5 I;  3F9S A;  1FGT A;  3FKA A;  1BRS A;  1BSD A;  3GZY B;  2L4V A;  5I97 A;  3AMO A;  2W56 A;  2I9W A;  3Q3F A;  1ZX2 A;  1GY7 A;  3DGO A;  4XB5 A;  4R1K A;  1SJW A;  3SED A;  3I56 3;  3KCH A;  1K8A 4;  3CXC 2;  1AR0 A;  2A15 A;  3NXJ A;  1RRH A;  1LVN A;  3LTC A;  4XM4 A;  3LOY A;  1T2H A;  4EC6 A;  5M19 A;  2RNT A;  2Z76 A;  1IU7 A;  2KF3 A;  3JUQ A;  3K7C A;  4N6N B;  2HMJ B;  2JDI H;  3CMA 3;  3ALA A;  4L8P A;  1RDS A;  3EC9 A;  3WOE B;  6GSP A;  1JZO A;  1SQW A;  2KF5 A;  1RLS A;  4O02 B;  4STD A;  1CYV A;  4KFF A;  1I2E A;  1NU3 A;  3LT8 A;  1LOY A;  3GWR A;  3ZG0 A;  1HZ1 A;  3CNX A;  3N8B A;  1BNS A;  2OCT A;  1UCK A;  5IG4 A;  2C10 A;  2F5W A;  3NBJ A;  1M1K 4;  1N9J A;  3EN1 B;  1QVF 2;  3EBT A;  1BRK A;  5AIF A;  4JRF A;  2OQE A;  3QRD A;  1WNH A;  2BMQ B;  4OK0 A;  3E99 A;  1OUN A;  2P0X A;  3EHC A;  3N9H A;  3HI7 A;  1T2I A;  3JUP A;  4H3U A;  8RNT A;  1B27 A;  1G02 A;  1GD3 A;  4IIA A;  4CPK A;  1FGM A;  4MMZ B;  1B2M A;  2BIR A;  1KSI A;  3DUK A;  3Q2P A;  3UJM A;  1IVW A;  2STD A;  2YFL B;  3MPH A;  3J7Y d;  1HYF A;  2BU4 A;  1GY6 A;  2B1X B;  1BUQ A;  1GYB A;  2KXG A;  1LQG C;  2CW9 A;  2KF6 A;  4DKI A;  1TJD A;  5JBS A;  2XGL A;  3KII A;  1ZGX A;  1UW1 A;  4N6U A;  4WP5 A;  1MWS A;  1UDI I;  1N5P A;  3LTA A;  5IG0 A;  1LQM B;  1W5Z A;  3OWU A;  1VQ4 3;  1YI2 3;  5CLK A;  1WMO A;  1YGE A;  1W4N A;  1WMN A;  2W04 A;  2CFK A;  3PCS A;  4BIR A;  3WA2 X;  3DGL A;  1O7G B;  3BIR A;  2GEX A;  3MWZ A;  2F56 A;  1SPU A;  3MYT A;  3X42 A;  1J2B A;  3Q90 A;  3KSP A;  1RNT A;  1Q81 4;  1K41 A;  2SAR A;  2AAE A;  4Q53 A;  1O7M B;  1TFK A;  3BND A;  3EF8 A;  4LYL B;  3SX1 A;  4K61 A;  1RHL A;  3CNM A;  1RRL A;  2HMM B;  3S28 A;  4XBT A;  1D6Z A;  4KFD A;  4WYK B;  3RGR A;  3PZW A;  3B4P A;  3SLU A;  1EUI C;  1IV9 A;  2IUK A;  1HKX A;  1LOX A;  2XFS A;  1VQ9 3;  4KVH A;  3ROB A;  4WFO A;  3HOH A;  4HM3 B;  1N5H A;  3V99 A;  1OGX A;  2GBX B;  4FMD A;  4HM6 B;  2CHC A;  1GY5 A;  2D42 A;  5EEO A;  1I3F A;  2F86 B;  1BUJ A;  1X1X A;  2P09 A;  1UCL A;  4K1V A;  5EQL A;  4TX4 A;  4X2H A;  3VSY A;  1OAC A;  1JV2 B;  3ZG5 A;  3CCU 3;  1Y4K A;  1B3S A;  3AHW A;  1WTH A;  3OV4 A;  4N6M A;  2BNG A;  1NDO B;  4OVM A;  3BLZ A;  4HBR A;  1W6G A;  4CJN A;  1UCJ A;  2BMR B;  2GXF A;  1FGQ A;  1ZS7 A;  3FGY A;  3FG4 A;  4GHO A;  1FW7 A;  2M7O A;  1PFP A;  3G71 3;  3GZB A;  3M8C A;  3HX8 A;  1AQZ A;  4L8O A;  2GU3 A;  5STD A;  4AKY A;  1GS3 A;  1RGF A;  2WO0 A;  2XRX B;  1RCL A;  3H51 A;  1MWU A;  1GMP A;  1GOU A;  3G0K A;  3N54 B;  2Q07 A;  1KD1 4;  2F5M A;  3X41 A;  1IQX A;  1RGC A;  1M1X B;  1Z1S A;  2XFT A;  3A5E A;  2GBW B;  1CYU A;  5IEN A;  3K5T A;  1MGW A;  3WOF B;  1W2B 2;  2E2V A;  1RN1 A;  4O3V A;  4EBG A;  2HMK B;  3U1W A;  2CH9 A;  1PYL A;  2OOV A;  3I0Y A;  1AY7 A;  1W02 A;  5BVB A;  1TTO A;  3DGM A;  4G1M B;  2W9P A;  1IVV A;  4GSP A;  1MNL A;  4KT3 B;  3D4A A;  2Z77 A;  3CPO A;  1B21 A;  1BSC A;  2CFL A;  2GEY A;  4GL6 A;  3LZA A;  4NRE A;  1S72 3;  1E3R A;  1VQN 3;  1K9M 4;  5KP1 A;  3CCJ 3;  1MWR A;  3PYJ A;  3SYU A;  4RBN A;  2ZL8 A;  3GAX A;  3NBB A;  4XBX A;  5HOH A;  1BRH A;  3F40 A;  3U97 A;  1FYS A;  2O9U X;  3GZR A;  7STD A;  1FUW A;  2O3O A;  1I0V A;  3KKG A;  3MG2 A;  1X1Y A;  3G16 A;  4HM1 B;  4K90 B;  2IYJ A;  2W6J H;  1VQM 3;  1M90 4;  2RCD A;  4XBY A;  5EVH A;  3EX9 A;  2XR8 B;  3MSO A;  4EW5 A;  1VQL 3;  1BRG A;  6STD A;  2YX9 A;  3KN4 A;  4RNY A;  5HGR A;  1D6Y A;  3F7S A;  1VQ7 3;  1GD4 A;  3DZL A;  3SOY A;  3MG1 A;  5FGO A;  3CPW 2;  1TU5 A;  3IMA B;  2IUJ A;  5CK6 A;  3CC7 3;  1STF I;  3V92 A;  1X1U A;  4WYK A;  1GOY A;  2CWU A;  3S67 A;  3KSE D;  4BTW A;  1VZZ A;  1PU4 A;  2BHM A;  2CFG A;  1VQQ A;  1YJW 3;  3HIG A;  4X2O A;  2V1L A;  4FMB A;  2CX1 A;  2CG1 A;  5AEU B;  1A90 A;  2GU1 A;  5M18 A;  1HU9 A;  4R9L A;  3CCS 3;  1A2P A;  3AHS A;  1UUW B;  4RNT A;  4J5K A;  3BNE A;  1BAO A;  2SBL A;  1BNE A;  2XSO B;  1IK3 A;  1Q42 A;  3B7C A;  3LML A;  3CC4 3;  1X1W A;  5BIR A;  1GMR A;  1KC8 4;  1MGR A;  2PZV A;  3S29 A;  4EYC A;  1RGL A;  1O7W B;  3AGN A;  4I5Q A;  4AEQ A;  5BU4 A;  1Q82 4;  1BSA A;  2HML B;  3B8L A;  3DY5 A;  4N6V 0;  4PEJ A;  4LMI A;  4J8T A;  3GSP A;  1C54 A;  1LRA A;  7RNT A;  3X40 A;  3KZT A;  2Z7A A;  1TIJ A;  1W6Y A;  2HOH A;  4ZM8 A;  2PNC A;  1I2F A;  2KAA A;  4XDW A;  3F7X A;  3RGA A;  2INX A;  5M1A A;  4BTY A;  3CCR 3;  3ER7 A;  2QA4 3;  1VQ6 3;  2P38 A;  5AYR B;  1EEJ A;  3TDG A;  1WQL B;  2R4I A;  4MMX B;  1BNR A;  1Q40 B;  3EBY A;  1BRN L;  3RDE A;  3G8Z A;  3JVC A;  1Q7Y 4;  5RNT A;  3X3Y A;  4FMA A;  1AVL A;  1SIH A;  1Q7H A;  1VQK 3;  4NPB A;  1JRQ A;  1QAL A;  2FNQ A;  1CH0 A;  4U13 A;  5AIG A;  1UI7 A;  3URP A;  1JN5 A;  7GSP A;  2XGN A;  1RCK A;  2OQE C;  4FCJ A;  4N6L A;  2E2T A;  3DGY A;  5IEP A;  2Y73 A;  4GB5 A;  4J9A A;  5IW9 A;  1O7P B;  2FGT A;  4ORL A;  4QWT A;  1VQP 3;  1OHO A;  2D1W A;  1CQS A;  5AI1 A;  1BRI A;  1BU4 A;  2MF7 A;  4K1U A;  3UL5 A;  3AMO B;  3EE1 A;  1ISK A;  1NO3 A;  3X3X A;  3LTD A;  1T5Y A;  4AKZ A;  3UB1 A;  1GMQ A;  4BU4 A;  1QJG A;  2KRT A;  2GSP A;  1IVX A;  2CWV A;  1I3I A; 
#chains in the Genus database with same CATH homology
 3NBR A;  1AVK A;  1E97 A;  3FCS B;  3FF2 A;  4EV2 A;  3BB9 A;  2QIY A;  5IEO A;  3JUO A;  3FH1 A;  1S5A A;  2K54 A;  3EQQ B;  3EN8 A;  3NQZ A;  4R80 A;  2OTL 3;  1FGO A;  1NJI 4;  3KFQ C;  1JB4 A;  4CDL A;  5D83 A;  3I55 3;  1Q86 4;  1IDP A;  2ML6 A;  3LXU X;  1O7N B;  1QMA A;  2W2C A;  3O8Y A;  4LEH A;  3L0R A;  4HM2 B;  1U8C B;  4RZM A;  2CG0 A;  1DMN A;  1VQ5 3;  5DRV A;  3FSD A;  3KE7 A;  1W00 A;  1W01 A;  5A0O B;  1OH0 A;  4JF8 A;  1W7C A;  3VGN A;  4O8S A;  1RKY A;  1U5O A;  3WA3 A;  3FZW A;  4HZ9 B;  3JUN A;  4XDV A;  2QGU A;  1QAF A;  3EJV A;  3OXA A;  1ULJ B;  2P05 A;  3UNL A;  1NWW A;  1LXE A;  1Q40 A;  1OHS A;  3A76 A;  2CK3 H;  3LH4 A;  1D6U A;  2XH9 A;  2BO9 B;  3NM7 A;  3T8U A;  1TP6 A;  1MOL A;  1YVB I;  2BMO B;  3K0Z A;  4I4K A;  5AII A;  1AV4 A;  1E3V A;  3PGB A;  4N6O B;  1IT8 A;  1VQ8 3;  1W2Z A;  4KFE A;  2B24 B;  3T8N A;  3GZX B;  1OHP A;  3QK9 A;  5CF1 A;  2P0M A;  1QVG 2;  1O7H B;  5DRE A;  4BTX A;  1JNQ A;  1EKM A;  4FR9 A;  1IVU A;  3LTB A;  5D82 A;  2OOV C;  3LT9 A;  2YFJ B;  1IQY A;  2MC8 A;  4HKV B;  4MEI A;  3CU3 A;  2WGO A;  4KZ1 A;  2UX0 A;  3F14 A;  3Q1C A;  3F8H A;  1L5G B;  3CCL 3;  1K73 4;  1OPY A;  1FA3 A;  3NUV A;  1IQ8 A;  1ZO2 A;  3UL6 A;  1ROV A;  1DMQ A;  4OUQ A;  3CCQ 3;  4RNZ A;  3OWY A;  1WMP A;  2QEX 3;  1M9G A;  2WOF A;  3G6E 3;  3VF1 A;  1JKG B;  3OW2 2;  2LQV A;  3STD A;  5AIH A;  3BNB A;  1F8N A;  4WHA A;  4EXR A;  3CD6 3;  4MJD A;  4CCV A;  8CHO A;  1YJ9 3;  4HM8 B;  1N8Q A;  3FG1 A;  4WWU C;  1OF5 B;  3DGN A;  1DVD A;  4HM4 B;  1QAK A;  1UUV B;  2C11 A;  1VQO 3;  4LZI A;  4MMY B;  2KCD A;  3LYG A;  2W0Q A;  3NM2 A;  5TGN A;  2JQ5 A;  3ECF A;  3NV0 B;  3S5C A;  3T0U A;  1SII A;  2ZDJ A;  5AYS C;  5LC6 A;  5CF2 A;  1N8R 4;  2BT3 A;  3BNC A;  3OX9 A;  5CXO A;  2W03 A;  2CC3 A;  3WDG B;  5D81 A;  4HYZ A;  1YHQ 3;  3SXX A;  4EV5 A;  1CEW I;  5G2G A;  4O2H A;  4FCZ A;  4FCM A;  1JJ2 2;  1EQK A;  2ML5 A;  2W56 B;  2WGQ A;  2OWP A;  1YJN 3;  2FXT A;  2YFI B;  1KWI A;  2IMJ A;  2CFW A;  3NX0 A;  2E2U A;  4LGQ A;  1JB5 A;  2HMO B;  1V74 A;  2RGQ A;  5IG3 A;  3PS8 A;  1ASK A;  2W9Q A;  3IPT A;  2CKF B;  3H3H A;  1JB2 A;  3V98 A;  1G96 A;  3SVA A;  4HM5 B;  5KP3 A;  1STD A;  3IJE B;  2F98 A;  5ELU A;  3HK4 A;  1R4C A;  1NB3 I;  3MHE A;  1YIJ 3;  3NQY A;  3K63 A;  4HM7 B;  1EG9 B;  3X3Z A;  1ULI B;  4L7K A;  2RFR A;  4HM0 B;  2K0M A;  2RSX A;  5IF6 A;  2CFD A;  1A2K A;  5AEW B;  2CWT A;  1N9E A;  5JPU A;  1DMM A;  3CCV 3;  3JUM A;  2HMN B;  2Y74 A;  2XSH B;  4IPB A;  1KQS 2;  2IA7 A;  3HZP A;  4IT7 A;  1RJO A;  1OGZ A;  1W6C A;  5IER A;  1FGR A;  1UI8 A;  3WMD A;  2XEP A;  3B4O A;  5JPP A;  3D9R A;  4N3V A;  2Z6B A;  4HZB B;  1OCV A;  4R4K A;  2XF3 A;  1JKG A;  3D3L A;  3GRD A;  1IV7 A;  1RN7 A;  3CCM 3;  5LC7 A;  3F8X A;  4HVN A;  1LNH A;  1DYU A;  3FF0 A;  4H61 A;  4N6T A;  5KP4 A;  3CME 3;  5FW5 A;  1EA2 A;  1A2V A;  1OF5 A;  1US1 A;  4HJL B;  4LSO A;  1TUH A;  3CCE 3;  4NHF A;  3DXO A;  1K28 A;  3EB8 A;  5ELJ A;  3PXM A;  2LYX A;  3CC2 3;  3NHX A;  4R9K A;  2WOH A;  3DM8 A;  4FMC A;  3S27 A;  3FG3 A;  3SOA A;  3WOD G;  2F99 A;  1IT7 A;  3MKI A;  3OWS A;  3NV0 A;  3FLJ A;  3MG3 A;  3PCR A;  1JN5 B;  1YIT 3;  5IG5 A;  3G4S 3;  2CIU A;  2OTJ 3;  1C7H A;  1ROA A;  3DMC A;  5BXQ A;  1DVC A;  3K9M C;  1NB5 I;  3HII A;  1TFO A;  3F9S A;  1FGT A;  3FKA A;  3GZY B;  2L4V A;  5I97 A;  3AMO A;  2W56 A;  2I9W A;  1ZX2 A;  1GY7 A;  3DGO A;  4XB5 A;  4R1K A;  1SJW A;  3SED A;  3I56 3;  1K8A 4;  3CXC 2;  1AR0 A;  2A15 A;  3NXJ A;  1RRH A;  1LVN A;  3LTC A;  4XM4 A;  3LOY A;  4EC6 A;  2Z76 A;  1IU7 A;  4N6N B;  3JUQ A;  3K7C A;  3CMA 3;  2HMJ B;  2JDI H;  3ALA A;  4L8P A;  3EC9 A;  3WOE B;  1SQW A;  4O02 B;  4STD A;  1CYV A;  4KFF A;  1NU3 A;  3LT8 A;  3GWR A;  3CNX A;  3N8B A;  2OCT A;  5IG4 A;  2C10 A;  3NBJ A;  1M1K 4;  1N9J A;  3EN1 B;  1QVF 2;  3EBT A;  5AIF A;  4JRF A;  2OQE A;  3QRD A;  1WNH A;  2BMQ B;  4OK0 A;  3E99 A;  1OUN A;  2P0X A;  3EHC A;  3N9H A;  3HI7 A;  4H3U A;  3JUP A;  4IIA A;  1GD3 A;  1FGM A;  4MMZ B;  1KSI A;  3DUK A;  3Q2P A;  3UJM A;  1IVW A;  2STD A;  2YFL B;  3MPH A;  3J7Y d;  1GY6 A;  2B1X B;  1BUQ A;  1GYB A;  2KXG A;  2CW9 A;  5JBS A;  2XGL A;  3KII A;  4WP5 A;  1UW1 A;  4N6U A;  5IG0 A;  3LTA A;  1N5P A;  1W5Z A;  3OWU A;  1VQ4 3;  1YI2 3;  5CLK A;  1WMO A;  1YGE A;  1W4N A;  1WMN A;  2W04 A;  2CFK A;  3PCS A;  3WA2 X;  3DGL A;  1O7G B;  3MWZ A;  2GEX A;  1SPU A;  3MYT A;  3X42 A;  1J2B A;  3Q90 A;  3KSP A;  1Q81 4;  1K41 A;  4Q53 A;  1O7M B;  1TFK A;  3BND A;  3EF8 A;  3SX1 A;  4K61 A;  3CNM A;  1RRL A;  2HMM B;  3S28 A;  4XBT A;  1D6Z A;  4KFD A;  4WYK B;  3RGR A;  3PZW A;  3B4P A;  3SLU A;  1IV9 A;  2IUK A;  1HKX A;  1LOX A;  2XFS A;  1VQ9 3;  4KVH A;  3ROB A;  4WFO A;  4HM3 B;  3V99 A;  1N5H A;  1OGX A;  2GBX B;  4FMD A;  4HM6 B;  2CHC A;  1GY5 A;  2D42 A;  5EEO A;  2F86 B;  2P09 A;  4K1V A;  5EQL A;  4TX4 A;  4X2H A;  3VSY A;  1OAC A;  1JV2 B;  3CCU 3;  1Y4K A;  1WTH A;  3OV4 A;  4N6M A;  2BNG A;  1NDO B;  4OVM A;  3BLZ A;  4HBR A;  1W6G A;  2BMR B;  2GXF A;  1FGQ A;  3FG4 A;  3FGY A;  2M7O A;  1PFP A;  3G71 3;  3GZB A;  3M8C A;  3HX8 A;  4L8O A;  5STD A;  2GU3 A;  4AKY A;  1GS3 A;  2WO0 A;  2XRX B;  3H51 A;  3G0K A;  3N54 B;  1KD1 4;  2Q07 A;  3X41 A;  1IQX A;  1Z1S A;  1M1X B;  2XFT A;  2GBW B;  1CYU A;  5IEN A;  3K5T A;  3WOF B;  1W2B 2;  2E2V A;  4O3V A;  4EBG A;  2HMK B;  3U1W A;  2CH9 A;  2OOV A;  3I0Y A;  5BVB A;  1W02 A;  3DGM A;  4G1M B;  2W9P A;  1IVV A;  1MNL A;  2Z77 A;  3CPO A;  2GEY A;  4GL6 A;  2CFL A;  3LZA A;  4NRE A;  1S72 3;  1E3R A;  1VQN 3;  1K9M 4;  5KP1 A;  3CCJ 3;  3PYJ A;  4RBN A;  2ZL8 A;  3GAX A;  3NBB A;  4XBX A;  3F40 A;  3U97 A;  2O9U X;  3GZR A;  7STD A;  1FUW A;  2O3O A;  3KKG A;  3MG2 A;  3G16 A;  4HM1 B;  4K90 B;  1VQM 3;  2W6J H;  1M90 4;  2RCD A;  4XBY A;  5EVH A;  3EX9 A;  2XR8 B;  3MSO A;  1VQL 3;  6STD A;  2YX9 A;  3KN4 A;  4RNY A;  5HGR A;  1D6Y A;  3F7S A;  1VQ7 3;  1GD4 A;  3DZL A;  3SOY A;  3MG1 A;  5FGO A;  3CPW 2;  1TU5 A;  3IMA B;  2IUJ A;  5CK6 A;  3CC7 3;  1STF I;  3V92 A;  4WYK A;  2CWU A;  3S67 A;  3KSE D;  4BTW A;  1VZZ A;  1PU4 A;  2BHM A;  2CFG A;  1YJW 3;  3HIG A;  4X2O A;  2V1L A;  4FMB A;  2CG1 A;  5AEU B;  1A90 A;  2GU1 A;  1HU9 A;  4R9L A;  3CCS 3;  1UUW B;  3BNE A;  2SBL A;  2XSO B;  1IK3 A;  3CC4 3;  1Q42 A;  3B7C A;  3LML A;  1KC8 4;  3S29 A;  2PZV A;  4EYC A;  1O7W B;  4AEQ A;  1Q82 4;  2HML B;  3B8L A;  3DY5 A;  4N6V 0;  4PEJ A;  4LMI A;  4J8T A;  3X40 A;  3KZT A;  2Z7A A;  1TIJ A;  1W6Y A;  4ZM8 A;  2PNC A;  3CCR 3;  4BTY A;  4XDW A;  3F7X A;  3RGA A;  2INX A;  1VQ6 3;  1A67 A;  3ER7 A;  2QA4 3;  2P38 A;  5AYR B;  3TDG A;  1WQL B;  2R4I A;  4MMX B;  1Q40 B;  3EBY A;  3RDE A;  3G8Z A;  3JVC A;  1Q7Y 4;  3X3Y A;  4FMA A;  1AVL A;  1SIH A;  1VQK 3;  1JRQ A;  1QAL A;  2FNQ A;  5AIG A;  4U13 A;  1UI7 A;  1JN5 A;  2XGN A;  2OQE C;  4FCJ A;  4N6L A;  2E2T A;  5IEP A;  2Y73 A;  4GB5 A;  4J9A A;  5IW9 A;  1O7P B;  2FGT A;  4ORL A;  4QWT A;  1VQP 3;  1OHO A;  2D1W A;  1CQS A;  5AI1 A;  2MF7 A;  4K1U A;  3UL5 A;  3AMO B;  3EE1 A;  1ISK A;  1NO3 A;  3X3X A;  3LTD A;  1T5Y A;  4AKZ A;  3UB1 A;  1QJG A;  2KRT A;  1IVX A;  2CWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...