3WMDA

Crystal structure of epoxide hydrolase monbi
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
144
structure length
144
Chain Sequence
b'MNEFARKKRALEHSRRINAGDLDAIIDLYAPDAVLEDPVGLPPVTGHDALRAHYEPLLAAHLREEAAEPVAGQDATHALIQISSVMDYLPVGPLYAERGWLKAPDAPGTARIHRTAMLVIRMDASGLIRHLKSYWGTSDLTVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable monensin biosynthesis isomerase
publication title Allosteric regulation of epoxide opening cascades by a pair of epoxide hydrolases in monensin biosynthesis
pubmed doi rcsb
source organism Streptomyces cinnamonensis
molecule tags Isomerase
total genus 41
structure length 144
sequence length 144
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3wmdA00
1NDOB 4STDA 4LMIA 3DZLA 3MKIA 4XBXA 3OWYA 1O7GB 2Z76A 2I9WA 5HGRA 2HMNB 3B8LA 3FLJA 2F98A 5STDA 2RGQA 3Q90A 2HMKB 1ISKA 5JPUA 2GEXA 4KVHA 1Q40A 4XBTA 5BXQA 1K41A 2HMMB 2INXA 1OHSA 4Q53A 3GWRA 4WWUC 3EHCA 3KE7A 3BB9A 5KP3A 3DXOA 2BNGA 5IEPA 1O7WB 1JKGB 3CNXA 4CDLA 3EQQB 3EJVA 3GZXB 5BVBA 5AIHA 3OWUA 4K1UA 4WYKA 5AIIA 5FW5A 3RGRA 3K7CA 4HM1B 3H3HA 5AEUB 3GZRA 2GBXB 1O7PB 4HVNA 3UNLA 3E99A 1DMNA 3NM2A 2Z7AA 4WP5A 5IERA 1OGZA 3NUVA 5AI1A 5IF6A 2YFJB 3EC9A 2QGUA 3HX8A 3OV4A 4GB5A 5D81A 3DMCA 4I4KA 3FF0A 3DUKA 1GY7A 5CXOA 3FKAA 1OUNA 1OF5B 2BMOB 1EG9B 4X2HA 3LZAA 3EX9A 4WYKB 5G2GA 2W2CA 3G16A 1TUHA 3CPOA 3HK4A 3SOAA 3F7SA 1OPYA 2XSOB 1ZX2A 3F14A 3EBYA 4HM4B 1DMMA 3OXAA 5AIFA 2HMOB 4U13A 4XDWA 4K1VA 1Z1SA 5TGNA 3EF8A 5AEWB 3VSYA 4FCJA 5IG0A 2Z77A 4XBYA 3NBRA 1CQSA 3F9SA 4HM3B 1ULJB 5CLKA 2A15A 5KP4A 3T8UA 3EN8A 1A2KA 5CF1A 3KKGA 4N3VA 3T8NA 3B4PA 3JUMA 3MG1A 4HZBB 3NV0B 4HM0B 3SEDA 1WQLB 2PZVA 3I0YA 5IG4A 4LGQA 3GZBA 2K54A 3EN1B 1ULIB 3B7CA 1NWWA 1OH0A 1O7MB 3NXJA 1W00A 3LYGA 1OHOA 4R9KA 4HM2B 1SJWA 4XB5A 3FH1A 2F99A 3G0KA 1U5OA 1Q42A 1NU3A 3G8ZA 8CHOA 3S5CA 1Q40B 4J9AA 5IENA 4LEHA 3BLZA 4XDVA 1DMQA 3FF2A 4HZ9B 1S5AA 4XM4A 3MYTA 4L8PA 3MG2A 1O7HB 2GXFA 1STDA 3FGYA 4HM5B 1C7HA 1TP6A 1W01A 5AIGA 1OHPA 1E97A 3H51A 3JUNA 3JUPA 5IG3A 2BMQB 2OWPA 3D9RA 4H3UA 4HM8B 1OGXA 5IG5A 3VGNA 2XSHB 1AR0A 1O7NB 5CK6A 3K0ZA 3KZTA 1GS3A 1JB5A 2UX0A 3FZWA 6STDA 2HMLB 3F7XA 1QMAA 1VZZA 1GY5A 2YFIB 2HMJB 2BMRB 5DRVA 2GEYA 3NHXA 3M8CA 3SOYA 4R9LA 5KP1A 4J8TA 1QJGA 1JN5A 4OUQA 2IMJA 3MSOA 3ER7A 3F8XA 1JKGA 3IPTA 4RZMA 4PEJA 3OWSA 2RFRA 2XRXB 1W02A 3RGAA 3ECFA 7STDA 1UUVB 1ASKA 4L7KA 3JUOA 4HJLB 3JUQA 1E3VA 2CKFB 2JQ5A 3OX9A 4HM6B 3WMDA 2R4IA 3FSDA 3DM8A 1JN5B 1W6YA 5IEOA 3CNMA 3CU3A 5D83A 3KSPA 3UJMA 3HZPA 1OCVA 1OF5A 4X2OA 2STDA 4FCMA 5EVHA 4ORLA 1GY6A 2XR8B 1E3RA 3GRDA 4MJDA 2F86B 3A76A 3STDA 2B1XB 1HKXA 4IIAA 1EA2A 4R1KA 3MG3A 4HKVB 4HM7B 3F8HA 1JB2A 3B4OA 2GBWB 4OVMA 4L8OA 3MHEA 3ROBA 5D82A 2B24B 3GZYB 5JPPA 5CF2A 2CHCA 1GYBA 1UUWB 2RCDA 3F40A 2QIYA 2YFLB 3EBTA 1IDPA 1BUQA 5DREA 1JB4A 1ZO2A 3NV0A
chains in the Genus database with same CATH superfamily
2RSXA 4BU4A 1BANA 3AGNA 1NDOB 1UCIA 4BIRA 1RDSA 4GHOA 4KT3B 4AKZA 4STDA 1VQ63 1Y4KA 2KAAA 4LMIA 4BL3A 5AYSC 3DZLA 2CFKA 1T5YA 3MKIA 3PZWA 4HOHA 4XBXA 3OWYA 1O7GB 4KFDA 1RLSA 1DYUA 2KRTA 1TIJA 2ZHXB 4O3VA 1WMNA 2D42A 2Z76A 1CYUA 2I9WA 1B2SA 3EE1A 3NBJA 5HGRA 1VQO3 1RGEA 2HMNB 3HOHA 5LC6A 3LT9A 3AGOA 3PGBA 3CPW2 1UGIA 1UDII 2YX9A 1IQYA 3B8LA 4NHFA 1BSBA 3FLJA 1D6YA 1LRAA 1UGHI 1RCKA 2F98A 2C10A 1NO3A 1FUTA 5STDA 3CD63 2RGQA 3HI7A 4FMCA 4HBRA 1VQK3 1FGOA 3Q90A 3G6E3 8RNTA 1UUGB 2HMKB 1K734 1UI8A 2FXTA 4N6NB 1W2B2 1LOXA 1NB5I 1ISKA 2JDIH 5JPUA 4R4KA 3S27A 2KF3A 2GEXA 4KVHA 1OACA 5HOHA 2CFLA 2QEX3 5LC7A 3Q2PA 1EUIC 1Q40A 4XBTA 1JBSA 5BXQA 1K41A 3HIIA 1VQN3 2HMMB 2INXA 1CYVA 1OHSA 1UI7A 5I97A 1B27A 3X42A 1RN4A 4Q53A 1FYSA 1RRLA 1BNJA 2CX1A 3GAXA 3D5IA 3GWRA 1W6GA 3K9MC 2W6JH 4WWUC 1RHLA 3EHCA 3KE7A 2XF3A 1B3SA 3N9HA 1RNTA 2AADA 3KSED 3BB9A 3X41A 4K61A 5KP3A 3DXOA 4FR9A 4O02B 2BNGA 3FG3A 1O7WB 2WGQA 1YVBI 1JKGB 4CJNA 2MF7A 3CNXA 4EW5A 5IEPA 4CDLA 3WA3A 3EQQB 2BU4A 3EJVA 3GZXB 4ILFA 3WODG 1G02A 5BVBA 1DETA 3CME3 5AIHA 3WOFB 3OWUA 3LTAA 4K1UA 1K8A4 3WOEB 1JBTA 4WYKA 5AIIA 5FW5A 3RGRA 3K7CA 4HM1B 1K28A 4EYCA 1PFPA 1BRJA 3GSPA 3H3HA 3HIGA 3KIIA 3MWZA 5AEUB 3GZRA 3K63A 4EC6A 2RNTA 4OK0A 1Q7HA 1X1YA 2GBXB 1O7PB 2M7OA 2R41A 4HVNA 1GSPA 3E99A 3UNLA 1YIT3 1DMNA 1STFI 1QAFA 4IPBA 1YNVX 3CCE3 4AEQA 5G1LA 3NM2A 1VQQA 1BNSA 2CIUA 2Z7AA 3QK9A 1R4CA 3LOYA 4N6MA 2KF6A 4WP5A 1OGZA 5IERA 2UGIA 1I2GA 3NUVA 5AI1A 1QVG2 3CCR3 5IF6A 2YFJB 3EC9A 2W9PA 7GSPA 4CPKA 2QGUA 3HX8A 3OV4A 2CX0A 4GB5A 1IT7A 5D81A 1IV7A 3DMCA 1GMPA 4I4KA 2KXGA 3DUKA 3FF0A 4EV2A 3I563 6GSPA 1OUNA 1GY7A 3AHSA 2WOHA 3FKAA 1NB3I 1US1A 3LMLA 5CXOA 4IT7A 1SPUA 1M1K4 9RNTA 5BU4A 5M1AA 3KN4A 1R4YA 1OF5B 2BMOB 1N5PA 1EG9B 2CC3A 2CFDA 1BAOA 3EX9A 3LT8A 3LZAA 3LH4A 4WYKB 4X2HA 5G2GA 2W0QA 2W2CA 1Q824 1N9EA 1FGRA 1RTUA 3WHOA 2XGLA 3G16A 1TUHA 2ZA4A 3CPOA 3HK4A 4LYLB 1WMPA 1BNGA 1U8CB 3N54B 3SOAA 1BRGA 1LNIA 4N6UA 3F7SA 4RBNA 1KSIA 1OPYA 2XSOB 3UL5A 1ZX2A 3PCRA 1S723 2OTJ3 3F14A 3CCV3 1Q814 3K5TA 4FCZA 3EBYA 2CFWA 2IA7A 1CEWI 2OQEA 3SYUA 5GSPA 1VQ53 4HM4B 1I2EA 5JBSA 6RNTA 1DMMA 3OXAA 5AIFA 1I70A 2HMOB 4U13A 4XDWA 2BHMA 4K1VA 1EQKA 2IYJA 3AHWA 1K9M4 1WNHA 1B2MA 1I2FA 3AMOA 4NPBA 1Z1SA 5TGNA 1BRNL 4MEIA 3EF8A 3CCM3 2CG1A 2XFTA 5AEWB 3VSYA 1W7CA 4FCJA 3LTCA 5IG0A 2Z77A 1BSCA 4XBYA 3SX1A 3NBRA 2H0IA 3ZG5A 1CQSA 2KF5A 3LTBA 1Q864 4N6OB 2W9QA 4N6LA 3X3XA 1TU5A 4O2HA 3FCSB 2OQEC 1SIIA 1JRQA 3S29A 1MGWA 2Y73A 3F9SA 2OTL3 1B2UA 2FNQA 2UUGC 4HM3B 1ULJB 2GU1A 5CLKA 2A15A 5FGOA 3DH2A 1N8R4 3X3ZA 3T8UA 5KP4A 1FGQA 3EN8A 1A2KA 1X1WA 3KKGA 4N3VA 3S67A 1N9JA 4GSPA 3T8NA 4AKYA 4BTXA 1YI23 1RGKA 3IMAB 3B4PA 3JUMA 3NQYA 1VQ83 3MG1A 3EB8A 4HZBB 1RN7A 1LQMB 4EBGA 1B2XA 4EV5A 1MWRA 3NV0B 2OOVA 1SARA 4HM0B 3SEDA 3DGYA 1D6ZA 1WQLB 2PZVA 3I0YA 1Q7Y4 1LOWA 5IG4A 4LGQA 1GMRA 1RN1A 4RNTA 2IUKA 3GZBA 2K54A 3CC43 4FMBA 2SBLA 2J8XB 3CXC2 3EN1B 1ULIB 1BIRA 3B7CA 1NWWA 1OH0A 4CCVA 2ZDJA 3RNTA 1O7MB 1TJDA 4KZ1A 2OCTA 4FMDA 1AY7A 1BVIA 3NXJA 3O8YA 2CG0A 1V58A 2QA43 1W00A 3LYGA 1YVSA 3TDGA 4R80A 5BIRA 1IYYA 1OHOA 2V1LA 4R9KA 2OOVC 1A2VA 1IVWA 3N8BA 4HM2B 3SXXA 4WHAA 4BL2A 1SJWA 4XB5A 1RGCA 2K0MA 2XEPA 1IU7A 1W2ZA 4TX4A 1KQS2 3FH1A 2F99A 2F5MA 3QRDA 3G0KA 1FZUA 3IJEB 4NREA 1DVCA 4RNZA 1U5OA 1Q42A 1EKMA 1GOYA 1NU3A 3G8ZA 5EQLA 8CHOA 2SARA 3LXUX 1RJOA 3S5CA 3J7Yd 1RGLA 4QWTA 4JRFA 1UCJA 1HYFA 3KFQC 4G1MB 1Q40B 1D6UA 1FUSA 1ROVA 2WOFA 4DKIA 1FUWA 1NNVA 1RGAA 4J9AA 2F56A 5EEOA 5IENA 4LEHA 3Q3FA 3UL6A 1I3IA 2O9UX 1UW1A 5G1KA 1GMQA 3BLZA 1B21A 1BGSA 4ZM8A 4XDVA 1SQWA 2IY2A 1UCLA 1DMQA 1BNEA 3FF2A 1F8NA 4HZ9B 1S5AA 1IQXA 4XM4A 5ELJA 3PS8A 2CK3H 3MYTA 4L8PA 3MG2A 3V98A 7RNTA 1O7HB 1RCLA 1BSDA 3V92A 2GXFA 2BT3A 1STDA 3FGYA 4HM5B 1C7HA 1TP6A 1W5ZA 1W01A 3FG1A 2BIRA 1LOVA 5AIGA 2FGTA 1JJ22 1OHPA 1E97A 3I553 1HU9A 3H51A 3BNCA 1YGEA 4K90B 1J2BA 2KCDA 1GOUA 1FA3A 3URPA 1G96A 3JUNA 1MNLA 3BIRA 3U97A 3JUPA 1RNBA 2D1WA 1LNHA 2O3OA 2L1SA 1CH0A 5IG3A 2BMQB 2BO9B 2OWPA 1MGRA 3D9RA 4H3UA 3CCQ3 3ZG0A 1YIJ3 4HM8B 4RNYA 1FGMA 1OGXA 3D79A 5IG5A 3VGNA 2XSHB 3ZFZA 2XGNA 3D3LA 1AR0A 1O7NB 5CK6A 1KWIA 3K0ZA 3KZTA 2C11A 1GS3A 1JZDA 1JB5A 2Z6BA 3MPHA 1UCKA 2CW9A 1T3BA 2UX0A 1M904 2IUJA 4KFEA 4BTWA 1NJI4 3BNBA 3FZWA 1IT8A 3CC23 1ZGXA 1MWUA 2PNCA 1BRKA 2HMLB 2ML5A 3ALAA 3BU4A 4HYZA 6STDA 2HOHA 4WFOA 1JZOA 3SLUA 1MWTA 2H0GA 4BTYA 3CCL3 4EXRA 1I0VA 1VQ43 3F7XA 1N5HA 1QMAA 1VZZA 1GY5A 2XH9A 2YFIB 1YHQ3 1VQM3 2E2UA 2W04A 2Y74A 1M9GA 3D5GA 2H0HA 2HMJB 1MOLA 1VQ73 2BMRB 2RBIA 1W4NA 5DRVA 5IW9A 1IK3A 2MC8A 2GEYA 3NHXA 3S28A 1M1XB 1VQL3 1FW7A 1V74A 4LSOA 3M8CA 2P38A 1KC84 1JV2B 2F4YA 3SOYA 1JNQA 3LTDA 2K3DA 1MWSA 4R9LA 1IQ8A 1HZ1A 1GD3A 4J8TA 3NM7A 1QJGA 5KP1A 5M19A 1YJ93 1JN5A 2CWTA 4OUQA 1V57A 1EEJA 2IMJA 3D4AA 3MSOA 3NQZA 4KFFA 3T0UA 3ER7A 2CFGA 2LYXA 3F8XA 1JKGA 1TTOA 3AMOB 3IPTA 4RZMA 4PEJA 3OWSA 1FGTA 1YGWA 2RFRA 1PY3A 1QVF2 3PXMA 2XRXB 1W02A 3X3YA 1RSNA 3RGAA 3ECFA 7STDA 1UUVB 1ASKA 4L7KA 2P05A 3JUOA 3JVCA 3G713 1X1UA 4HJLB 3JUQA 3WDGB 1E3VA 2CKFB 1C54A 1RGGA 4N6V0 2JQ5A 2CWUA 3WA2X 3Q1CA 4I5QA 1QALA 1LXEA 3OX9A 4HM6B 1KD14 1X1XA 4J5GA 3CMA3 1A2PA 4H61A 3CCU3 1VQP3 3WMDA 1AVKA 3UB1A 5AYRB 1I8VA 2R4IA 3FSDA 3DM8A 1WMOA 1BRHA 5ELUA 1JN5B 5CF1A 1BNFA 4FMAA 1BOXA 3L0RA 1W6YA 5IEOA 2P0MA 2E2TA 3DGNA 3FG4A 1YJW3 2XFSA 3DGMA 3CNMA 3NBBA 3CU3A 3PCSA 5D83A 3V99A 1IVUA 1BU4A 3KSPA 5A0OB 3UJMA 3DGOA 3HZPA 2ML6A 3CC73 1A90A 1OCVA 1ROAA 2WGOA 2LQVA 1T2HA 2WO0A 1OF5A 2L4VA 3X40A 4J5KA 2STDA 4X2OA 1JBRA 1WTHA 4FCMA 2W56A 4ORLA 5EVHA 1G0TA 1GD4A 1GY6A 1BUJA 2XR8B 1QAKA 2KF4A 1E3RA 4MMYB 1DE3A 1A67A 1AVLA 1DVDA 1RGFA 3WR2A 1TRPA 1PYLA 1Q9EA 3GRDA 1L5GB 4JF8A 4MJDA 1N8QA 2F86B 4GL6A 5RNTA 3A76A 3STDA 1T2IA 2B1XB 1HKXA 5M18A 4IIAA 2P0XA 1EA2A 1TFOA 1RRHA 4O8SA 1IVXA 4MMXB 4R1KA 3MG3A 1GOVA 1RMSA 1BNIA 1AV4A 4HKVB 4HM7B 3RDEA 3G4S3 3KCHA 3F8HA 3BNEA 1TFKA 3PYJA 1YJN3 1I3FA 1JB2A 3B4OA 2GBWB 1LQGC 2E2VA 4OVMA 1VQ93 3BNDA 4L8OA 3MHEA 2GSPA 1TRQA 3ROBA 1AQZA 5D82A 2B24B 2W56B 3GZYB 3NX0A 4MMZB 5JPPA 1B20A 1PU4A 5CF2A 1IVVA 3OW22 3CCJ3 2AAEA 1SIHA 2CHCA 4HAAA 2W03A 1GYBA 1UUWB 1BSEA 1LVNA 2RCDA 1LOYA 2C4BA 3F40A 1RKYA 2GU3A 1BSAA 1BNRA 2P09A 3U1WA 1ZS7A 2QIYA 4LZIA 1I0XA 1W6CA 1BRIA 2CH9A 2F5WA 1RGHA 2YFLB 3EBTA 3CCS3 1IDPA 2Q07A 3DGLA 3A5EA 1BUQA 3DY5A 5DREA 1JB4A 1BRSA 1IV9A 2ZL8A 3SVAA 1B2ZA 3VF1A 4N6TA 1ZO2A 2CWVA 3NV0A
chains in the Genus database with same CATH topology
2RSXA 1NDOB 4AKZA 4STDA 1VQ63 1Y4KA 4LMIA 5AYSC 3DZLA 2CFKA 1T5YA 3MKIA 3PZWA 4XBXA 3OWYA 1O7GB 4KFDA 1DYUA 2KRTA 1TIJA 4O3VA 1WMNA 2D42A 2Z76A 1CYUA 2I9WA 3NBJA 3EE1A 1VQO3 5HGRA 2HMNB 5LC6A 3LT9A 3PGBA 3CPW2 2YX9A 1IQYA 3B8LA 4NHFA 3FLJA 1D6YA 2F98A 2C10A 1NO3A 5STDA 3CD63 2RGQA 3HI7A 4FMCA 4HBRA 1VQK3 1FGOA 3Q90A 3G6E3 2HMKB 1K734 1UI8A 2FXTA 4N6NB 1W2B2 1LOXA 1NB5I 1ISKA 2JDIH 5JPUA 4R4KA 3S27A 2GEXA 4KVHA 1OACA 2CFLA 2QEX3 5LC7A 3Q2PA 1Q40A 4XBTA 5BXQA 1K41A 3HIIA 1VQN3 2HMMB 2INXA 1CYVA 1OHSA 1UI7A 5I97A 3X42A 4Q53A 1RRLA 3GAXA 3GWRA 1W6GA 3K9MC 2W6JH 4WWUC 3EHCA 3KE7A 2XF3A 3N9HA 3KSED 3BB9A 3X41A 4K61A 5KP3A 3DXOA 4FR9A 4O02B 2BNGA 3FG3A 1O7WB 2WGQA 1YVBI 1JKGB 5IEPA 2MF7A 3CNXA 3WA3A 4CDLA 3EQQB 3EJVA 3GZXB 3WODG 5BVBA 3CME3 5AIHA 3WOFB 3OWUA 3LTAA 4K1UA 1K8A4 3WOEB 4WYKA 5AIIA 5FW5A 3RGRA 3K7CA 4HM1B 1K28A 4EYCA 1PFPA 3H3HA 3HIGA 3KIIA 3MWZA 5AEUB 3GZRA 3K63A 4EC6A 4OK0A 2GBXB 1O7PB 2M7OA 4HVNA 3UNLA 1YIT3 3E99A 1DMNA 1STFI 1QAFA 4IPBA 3CCE3 4AEQA 3NM2A 2CIUA 3QK9A 2Z7AA 4N6MA 1R4CA 3LOYA 4WP5A 5IERA 1OGZA 3NUVA 5AI1A 1QVG2 3CCR3 5IF6A 2YFJB 3EC9A 2W9PA 2QGUA 3HX8A 3OV4A 4GB5A 1IT7A 5D81A 1IV7A 3DMCA 4I4KA 2KXGA 3DUKA 3FF0A 4EV2A 3I563 1OUNA 1GY7A 3FKAA 2WOHA 5CXOA 1NB3I 1US1A 3LMLA 1M1K4 4IT7A 1SPUA 3KN4A 1OF5B 2BMOB 1N5PA 1EG9B 2CC3A 2CFDA 3EX9A 3LT8A 3LZAA 4WYKB 3LH4A 4X2HA 5G2GA 2W0QA 2W2CA 1Q824 1N9EA 1FGRA 2XGLA 3G16A 1TUHA 3CPOA 3HK4A 1WMPA 1U8CB 3N54B 3SOAA 4N6UA 3F7SA 4RBNA 1KSIA 1OPYA 2XSOB 3UL5A 1ZX2A 3PCRA 1S723 2OTJ3 3F14A 3CCV3 1Q814 3K5TA 4FCZA 3EBYA 2CFWA 2IA7A 1CEWI 2OQEA 1VQ53 4HM4B 5JBSA 1DMMA 3OXAA 5AIFA 2HMOB 4U13A 4XDWA 2BHMA 4K1VA 1EQKA 1K9M4 1WNHA 3AMOA 1Z1SA 5TGNA 4MEIA 3EF8A 3CCM3 2CG1A 2XFTA 5AEWB 3VSYA 1W7CA 4FCJA 3LTCA 5IG0A 2Z77A 3SX1A 4XBYA 3NBRA 1CQSA 3LTBA 1Q864 4N6OB 2W9QA 4N6LA 3X3XA 1TU5A 4O2HA 3FCSB 2OQEC 1SIIA 1JRQA 3S29A 2Y73A 3F9SA 2OTL3 2FNQA 4HM3B 5FGOA 1ULJB 2GU1A 5CLKA 2A15A 1N8R4 3X3ZA 3T8UA 5KP4A 1FGQA 3EN8A 1A2KA 5CF1A 3KKGA 4N3VA 3S67A 1N9JA 3T8NA 4AKYA 4BTXA 1YI23 3IMAB 3B4PA 3JUMA 3NQYA 1VQ83 3MG1A 3EB8A 4HZBB 1RN7A 4EBGA 4EV5A 2OOVA 3NV0B 4HM0B 3SEDA 1D6ZA 1WQLB 2PZVA 3I0YA 1Q7Y4 5IG4A 4LGQA 2IUKA 3GZBA 2K54A 3CC43 4FMBA 2SBLA 3CXC2 3EN1B 1ULIB 3B7CA 1NWWA 1OH0A 4CCVA 2ZDJA 1O7MB 4KZ1A 2OCTA 4FMDA 3NXJA 3O8YA 2CG0A 2QA43 1W00A 3LYGA 3TDGA 4R80A 1OHOA 2V1LA 4R9KA 2OOVC 1A2VA 1IVWA 3N8BA 4HM2B 3SXXA 4WHAA 1SJWA 4XB5A 2K0MA 2XEPA 1IU7A 1W2ZA 4TX4A 1KQS2 3FH1A 2F99A 3QRDA 3G0KA 4RNZA 3IJEB 4NREA 1DVCA 1U5OA 1Q42A 1EKMA 1NU3A 5EQLA 3G8ZA 8CHOA 3LXUX 1RJOA 3S5CA 3J7Yd 4QWTA 4JRFA 3KFQC 4G1MB 1Q40B 1D6UA 1ROVA 2WOFA 1FUWA 4J9AA 5EEOA 5IENA 4LEHA 3UL6A 2O9UX 1UW1A 3BLZA 4ZM8A 4XDVA 1SQWA 1DMQA 3FF2A 1F8NA 4HZ9B 1S5AA 1IQXA 4XM4A 5ELJA 3PS8A 2CK3H 3MYTA 4L8PA 3MG2A 3V98A 1O7HB 3V92A 2GXFA 2BT3A 1STDA 3FGYA 4HM5B 1C7HA 1TP6A 1W5ZA 1W01A 3FG1A 5AIGA 1JJ22 2FGTA 1OHPA 1E97A 3I553 1HU9A 3H51A 3BNCA 1YGEA 4K90B 1J2BA 2KCDA 1FA3A 1G96A 3JUNA 1MNLA 3U97A 3JUPA 2D1WA 1LNHA 2O3OA 5IG3A 2BMQB 2BO9B 2OWPA 3D9RA 4H3UA 3CCQ3 1YIJ3 4HM8B 4RNYA 1FGMA 1OGXA 5IG5A 3VGNA 2XSHB 2XGNA 3D3LA 1AR0A 1O7NB 5CK6A 1KWIA 3K0ZA 3KZTA 2C11A 1GS3A 2Z6BA 1JB5A 3MPHA 2CW9A 2UX0A 1M904 2IUJA 4KFEA 4BTWA 1NJI4 3BNBA 3FZWA 1IT8A 3CC23 2PNCA 3ALAA 6STDA 2HMLB 2ML5A 4HYZA 4WFOA 3SLUA 4BTYA 3CCL3 4EXRA 1VQ43 3F7XA 1N5HA 1QMAA 1VZZA 1GY5A 2XH9A 2YFIB 1YHQ3 1VQM3 2E2UA 2W04A 2Y74A 1M9GA 2HMJB 1MOLA 1VQ73 2BMRB 1W4NA 5DRVA 5IW9A 1IK3A 2MC8A 2GEYA 3NHXA 3S28A 1M1XB 1VQL3 1V74A 4LSOA 3M8CA 2P38A 1KC84 1JV2B 3SOYA 1JNQA 3LTDA 4R9LA 1IQ8A 4J8TA 1GD3A 5KP1A 3NM7A 1QJGA 1YJ93 1JN5A 2CWTA 4OUQA 2IMJA 3MSOA 3NQZA 4KFFA 3T0UA 3ER7A 2CFGA 2LYXA 3F8XA 1JKGA 3AMOB 3IPTA 4RZMA 4PEJA 3OWSA 1FGTA 1QVF2 2RFRA 3PXMA 2XRXB 1W02A 3X3YA 3RGAA 3ECFA 7STDA 1UUVB 1ASKA 4L7KA 2P05A 3JUOA 3JVCA 3G713 4HJLB 3JUQA 3WDGB 1E3VA 2CKFB 4N6V0 2JQ5A 2CWUA 3WA2X 3Q1CA 1QALA 1LXEA 3OX9A 4HM6B 1KD14 3CMA3 4H61A 3CCU3 1VQP3 3WMDA 1AVKA 3UB1A 5AYRB 2R4IA 3FSDA 3DM8A 1WMOA 5ELUA 1JN5B 4FMAA 3L0RA 1W6YA 5IEOA 2P0MA 2E2TA 3DGNA 3FG4A 1YJW3 2XFSA 3DGMA 3CNMA 3NBBA 3CU3A 3PCSA 5D83A 3V99A 1IVUA 3KSPA 5A0OB 3UJMA 3DGOA 3HZPA 2ML6A 3CC73 1A90A 1OCVA 1ROAA 2WGOA 2LQVA 2WO0A 1OF5A 2L4VA 3X40A 4X2OA 2STDA 1WTHA 4FCMA 2W56A 4ORLA 5EVHA 1GD4A 1GY6A 2XR8B 1QAKA 4MMYB 1E3RA 1A67A 1AVLA 1DVDA 3GRDA 1L5GB 4JF8A 4MJDA 1N8QA 2F86B 4GL6A 3A76A 3STDA 2B1XB 1HKXA 4IIAA 2P0XA 1EA2A 1TFOA 1RRHA 4O8SA 1IVXA 4MMXB 4R1KA 3MG3A 1AV4A 4HKVB 4HM7B 3RDEA 3G4S3 3F8HA 3BNEA 1TFKA 3PYJA 1YJN3 1JB2A 3B4OA 2GBWB 2E2VA 4OVMA 1VQ93 3BNDA 4L8OA 3MHEA 3ROBA 5D82A 2B24B 2W56B 3GZYB 3NX0A 4MMZB 5JPPA 1PU4A 5CF2A 1IVVA 3OW22 3CCJ3 1SIHA 2CHCA 2W03A 1GYBA 1UUWB 1LVNA 2RCDA 1RKYA 3F40A 2GU3A 2P09A 3U1WA 2QIYA 4LZIA 1W6CA 2CH9A 2YFLB 3EBTA 3CCS3 1IDPA 2Q07A 3DGLA 1BUQA 3DY5A 5DREA 1JB4A 1IV9A 2ZL8A 3SVAA 3VF1A 4N6TA 1ZO2A 2CWVA 3NV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDO B;  4STD A;  4LMI A;  3DZL A;  3MKI A;  4XBX A;  3OWY A;  1O7G B;  2Z76 A;  2I9W A;  5HGR A;  2HMN B;  3B8L A;  3FLJ A;  2F98 A;  5STD A;  2RGQ A;  3Q90 A;  2HMK B;  1ISK A;  5JPU A;  2GEX A;  4KVH A;  1Q40 A;  4XBT A;  5BXQ A;  1K41 A;  2HMM B;  2INX A;  1OHS A;  4Q53 A;  3GWR A;  4WWU C;  3EHC A;  3KE7 A;  3BB9 A;  5KP3 A;  3DXO A;  2BNG A;  5IEP A;  1O7W B;  1JKG B;  3CNX A;  4CDL A;  3EQQ B;  3EJV A;  3GZX B;  5BVB A;  5AIH A;  3OWU A;  4K1U A;  4WYK A;  5AII A;  5FW5 A;  3RGR A;  3K7C A;  4HM1 B;  3H3H A;  5AEU B;  3GZR A;  2GBX B;  1O7P B;  4HVN A;  3UNL A;  3E99 A;  1DMN A;  3NM2 A;  2Z7A A;  4WP5 A;  5IER A;  1OGZ A;  3NUV A;  5AI1 A;  5IF6 A;  2YFJ B;  3EC9 A;  2QGU A;  3HX8 A;  3OV4 A;  4GB5 A;  5D81 A;  3DMC A;  4I4K A;  3FF0 A;  3DUK A;  1GY7 A;  5CXO A;  3FKA A;  1OUN A;  1OF5 B;  2BMO B;  1EG9 B;  4X2H A;  3LZA A;  3EX9 A;  4WYK B;  5G2G A;  2W2C A;  3G16 A;  1TUH A;  3CPO A;  3HK4 A;  3SOA A;  3F7S A;  1OPY A;  2XSO B;  1ZX2 A;  3F14 A;  3EBY A;  4HM4 B;  1DMM A;  3OXA A;  5AIF A;  2HMO B;  4U13 A;  4XDW A;  4K1V A;  1Z1S A;  5TGN A;  3EF8 A;  5AEW B;  3VSY A;  4FCJ A;  5IG0 A;  2Z77 A;  4XBY A;  3NBR A;  1CQS A;  3F9S A;  4HM3 B;  1ULJ B;  5CLK A;  2A15 A;  5KP4 A;  3T8U A;  3EN8 A;  1A2K A;  5CF1 A;  3KKG A;  4N3V A;  3T8N A;  3B4P A;  3JUM A;  3MG1 A;  4HZB B;  3NV0 B;  4HM0 B;  3SED A;  1WQL B;  2PZV A;  3I0Y A;  5IG4 A;  4LGQ A;  3GZB A;  2K54 A;  3EN1 B;  1ULI B;  3B7C A;  1NWW A;  1OH0 A;  1O7M B;  3NXJ A;  1W00 A;  3LYG A;  1OHO A;  4R9K A;  4HM2 B;  1SJW A;  4XB5 A;  3FH1 A;  2F99 A;  3G0K A;  1U5O A;  1Q42 A;  1NU3 A;  3G8Z A;  8CHO A;  3S5C A;  1Q40 B;  4J9A A;  5IEN A;  4LEH A;  3BLZ A;  4XDV A;  1DMQ A;  3FF2 A;  4HZ9 B;  1S5A A;  4XM4 A;  3MYT A;  4L8P A;  3MG2 A;  1O7H B;  2GXF A;  1STD A;  3FGY A;  4HM5 B;  1C7H A;  1TP6 A;  1W01 A;  5AIG A;  1OHP A;  1E97 A;  3H51 A;  3JUN A;  3JUP A;  5IG3 A;  2BMQ B;  2OWP A;  3D9R A;  4H3U A;  4HM8 B;  1OGX A;  5IG5 A;  3VGN A;  2XSH B;  1AR0 A;  1O7N B;  5CK6 A;  3K0Z A;  3KZT A;  1GS3 A;  1JB5 A;  2UX0 A;  3FZW A;  6STD A;  2HML B;  3F7X A;  1QMA A;  1VZZ A;  1GY5 A;  2YFI B;  2HMJ B;  2BMR B;  5DRV A;  2GEY A;  3NHX A;  3M8C A;  3SOY A;  4R9L A;  5KP1 A;  4J8T A;  1QJG A;  1JN5 A;  4OUQ A;  2IMJ A;  3MSO A;  3ER7 A;  3F8X A;  1JKG A;  3IPT A;  4RZM A;  4PEJ A;  3OWS A;  2RFR A;  2XRX B;  1W02 A;  3RGA A;  3ECF A;  7STD A;  1UUV B;  1ASK A;  4L7K A;  3JUO A;  4HJL B;  3JUQ A;  1E3V A;  2CKF B;  2JQ5 A;  3OX9 A;  4HM6 B;  3WMD A;  2R4I A;  3FSD A;  3DM8 A;  1JN5 B;  1W6Y A;  5IEO A;  3CNM A;  3CU3 A;  5D83 A;  3KSP A;  3UJM A;  3HZP A;  1OCV A;  1OF5 A;  4X2O A;  2STD A;  4FCM A;  5EVH A;  4ORL A;  1GY6 A;  2XR8 B;  1E3R A;  3GRD A;  4MJD A;  2F86 B;  3A76 A;  3STD A;  2B1X B;  1HKX A;  4IIA A;  1EA2 A;  4R1K A;  3MG3 A;  4HKV B;  4HM7 B;  3F8H A;  1JB2 A;  3B4O A;  2GBW B;  4OVM A;  4L8O A;  3MHE A;  3ROB A;  5D82 A;  2B24 B;  3GZY B;  5JPP A;  5CF2 A;  2CHC A;  1GYB A;  1UUW B;  2RCD A;  3F40 A;  2QIY A;  2YFL B;  3EBT A;  1IDP A;  1BUQ A;  5DRE A;  1JB4 A;  1ZO2 A;  3NV0 A; 
#chains in the Genus database with same CATH topology
 2RSX A;  4BU4 A;  1BAN A;  3AGN A;  1NDO B;  1UCI A;  4BIR A;  1RDS A;  4GHO A;  4KT3 B;  4AKZ A;  4STD A;  1VQ6 3;  1Y4K A;  2KAA A;  4LMI A;  4BL3 A;  5AYS C;  3DZL A;  2CFK A;  1T5Y A;  3MKI A;  3PZW A;  4HOH A;  4XBX A;  3OWY A;  1O7G B;  4KFD A;  1RLS A;  1DYU A;  2KRT A;  1TIJ A;  2ZHX B;  4O3V A;  1WMN A;  2D42 A;  2Z76 A;  1CYU A;  2I9W A;  1B2S A;  3EE1 A;  3NBJ A;  5HGR A;  1VQO 3;  1RGE A;  2HMN B;  3HOH A;  5LC6 A;  3LT9 A;  3AGO A;  3PGB A;  3CPW 2;  1UGI A;  1UDI I;  2YX9 A;  1IQY A;  3B8L A;  4NHF A;  1BSB A;  3FLJ A;  1D6Y A;  1LRA A;  1UGH I;  1RCK A;  2F98 A;  2C10 A;  1NO3 A;  1FUT A;  5STD A;  3CD6 3;  2RGQ A;  3HI7 A;  4FMC A;  4HBR A;  1VQK 3;  1FGO A;  3Q90 A;  3G6E 3;  8RNT A;  1UUG B;  2HMK B;  1K73 4;  1UI8 A;  2FXT A;  4N6N B;  1W2B 2;  1LOX A;  1NB5 I;  1ISK A;  2JDI H;  5JPU A;  4R4K A;  3S27 A;  2KF3 A;  2GEX A;  4KVH A;  1OAC A;  5HOH A;  2CFL A;  2QEX 3;  5LC7 A;  3Q2P A;  1EUI C;  1Q40 A;  4XBT A;  1JBS A;  5BXQ A;  1K41 A;  3HII A;  1VQN 3;  2HMM B;  2INX A;  1CYV A;  1OHS A;  1UI7 A;  5I97 A;  1B27 A;  3X42 A;  1RN4 A;  4Q53 A;  1FYS A;  1RRL A;  1BNJ A;  2CX1 A;  3GAX A;  3D5I A;  3GWR A;  1W6G A;  3K9M C;  2W6J H;  4WWU C;  1RHL A;  3EHC A;  3KE7 A;  2XF3 A;  1B3S A;  3N9H A;  1RNT A;  2AAD A;  3KSE D;  3BB9 A;  3X41 A;  4K61 A;  5KP3 A;  3DXO A;  4FR9 A;  4O02 B;  2BNG A;  3FG3 A;  1O7W B;  2WGQ A;  1YVB I;  1JKG B;  4CJN A;  2MF7 A;  3CNX A;  4EW5 A;  5IEP A;  4CDL A;  3WA3 A;  3EQQ B;  2BU4 A;  3EJV A;  3GZX B;  4ILF A;  3WOD G;  1G02 A;  5BVB A;  1DET A;  3CME 3;  5AIH A;  3WOF B;  3OWU A;  3LTA A;  4K1U A;  1K8A 4;  3WOE B;  1JBT A;  4WYK A;  5AII A;  5FW5 A;  3RGR A;  3K7C A;  4HM1 B;  1K28 A;  4EYC A;  1PFP A;  1BRJ A;  3GSP A;  3H3H A;  3HIG A;  3KII A;  3MWZ A;  5AEU B;  3GZR A;  3K63 A;  4EC6 A;  2RNT A;  4OK0 A;  1Q7H A;  1X1Y A;  2GBX B;  1O7P B;  2M7O A;  2R41 A;  4HVN A;  1GSP A;  3E99 A;  3UNL A;  1YIT 3;  1DMN A;  1STF I;  1QAF A;  4IPB A;  1YNV X;  3CCE 3;  4AEQ A;  5G1L A;  3NM2 A;  1VQQ A;  1BNS A;  2CIU A;  2Z7A A;  3QK9 A;  1R4C A;  3LOY A;  4N6M A;  2KF6 A;  4WP5 A;  1OGZ A;  5IER A;  2UGI A;  1I2G A;  3NUV A;  5AI1 A;  1QVG 2;  3CCR 3;  5IF6 A;  2YFJ B;  3EC9 A;  2W9P A;  7GSP A;  4CPK A;  2QGU A;  3HX8 A;  3OV4 A;  2CX0 A;  4GB5 A;  1IT7 A;  5D81 A;  1IV7 A;  3DMC A;  1GMP A;  4I4K A;  2KXG A;  3DUK A;  3FF0 A;  4EV2 A;  3I56 3;  6GSP A;  1OUN A;  1GY7 A;  3AHS A;  2WOH A;  3FKA A;  1NB3 I;  1US1 A;  3LML A;  5CXO A;  4IT7 A;  1SPU A;  1M1K 4;  9RNT A;  5BU4 A;  5M1A A;  3KN4 A;  1R4Y A;  1OF5 B;  2BMO B;  1N5P A;  1EG9 B;  2CC3 A;  2CFD A;  1BAO A;  3EX9 A;  3LT8 A;  3LZA A;  3LH4 A;  4WYK B;  4X2H A;  5G2G A;  2W0Q A;  2W2C A;  1Q82 4;  1N9E A;  1FGR A;  1RTU A;  3WHO A;  2XGL A;  3G16 A;  1TUH A;  2ZA4 A;  3CPO A;  3HK4 A;  4LYL B;  1WMP A;  1BNG A;  1U8C B;  3N54 B;  3SOA A;  1BRG A;  1LNI A;  4N6U A;  3F7S A;  4RBN A;  1KSI A;  1OPY A;  2XSO B;  3UL5 A;  1ZX2 A;  3PCR A;  1S72 3;  2OTJ 3;  3F14 A;  3CCV 3;  1Q81 4;  3K5T A;  4FCZ A;  3EBY A;  2CFW A;  2IA7 A;  1CEW I;  2OQE A;  3SYU A;  5GSP A;  1VQ5 3;  4HM4 B;  1I2E A;  5JBS A;  6RNT A;  1DMM A;  3OXA A;  5AIF A;  1I70 A;  2HMO B;  4U13 A;  4XDW A;  2BHM A;  4K1V A;  1EQK A;  2IYJ A;  3AHW A;  1K9M 4;  1WNH A;  1B2M A;  1I2F A;  3AMO A;  4NPB A;  1Z1S A;  5TGN A;  1BRN L;  4MEI A;  3EF8 A;  3CCM 3;  2CG1 A;  2XFT A;  5AEW B;  3VSY A;  1W7C A;  4FCJ A;  3LTC A;  5IG0 A;  2Z77 A;  1BSC A;  4XBY A;  3SX1 A;  3NBR A;  2H0I A;  3ZG5 A;  1CQS A;  2KF5 A;  3LTB A;  1Q86 4;  4N6O B;  2W9Q A;  4N6L A;  3X3X A;  1TU5 A;  4O2H A;  3FCS B;  2OQE C;  1SII A;  1JRQ A;  3S29 A;  1MGW A;  2Y73 A;  3F9S A;  2OTL 3;  1B2U A;  2FNQ A;  2UUG C;  4HM3 B;  1ULJ B;  2GU1 A;  5CLK A;  2A15 A;  5FGO A;  3DH2 A;  1N8R 4;  3X3Z A;  3T8U A;  5KP4 A;  1FGQ A;  3EN8 A;  1A2K A;  1X1W A;  3KKG A;  4N3V A;  3S67 A;  1N9J A;  4GSP A;  3T8N A;  4AKY A;  4BTX A;  1YI2 3;  1RGK A;  3IMA B;  3B4P A;  3JUM A;  3NQY A;  1VQ8 3;  3MG1 A;  3EB8 A;  4HZB B;  1RN7 A;  1LQM B;  4EBG A;  1B2X A;  4EV5 A;  1MWR A;  3NV0 B;  2OOV A;  1SAR A;  4HM0 B;  3SED A;  3DGY A;  1D6Z A;  1WQL B;  2PZV A;  3I0Y A;  1Q7Y 4;  1LOW A;  5IG4 A;  4LGQ A;  1GMR A;  1RN1 A;  4RNT A;  2IUK A;  3GZB A;  2K54 A;  3CC4 3;  4FMB A;  2SBL A;  2J8X B;  3CXC 2;  3EN1 B;  1ULI B;  1BIR A;  3B7C A;  1NWW A;  1OH0 A;  4CCV A;  2ZDJ A;  3RNT A;  1O7M B;  1TJD A;  4KZ1 A;  2OCT A;  4FMD A;  1AY7 A;  1BVI A;  3NXJ A;  3O8Y A;  2CG0 A;  1V58 A;  2QA4 3;  1W00 A;  3LYG A;  1YVS A;  3TDG A;  4R80 A;  5BIR A;  1IYY A;  1OHO A;  2V1L A;  4R9K A;  2OOV C;  1A2V A;  1IVW A;  3N8B A;  4HM2 B;  3SXX A;  4WHA A;  4BL2 A;  1SJW A;  4XB5 A;  1RGC A;  2K0M A;  2XEP A;  1IU7 A;  1W2Z A;  4TX4 A;  1KQS 2;  3FH1 A;  2F99 A;  2F5M A;  3QRD A;  3G0K A;  1FZU A;  3IJE B;  4NRE A;  1DVC A;  4RNZ A;  1U5O A;  1Q42 A;  1EKM A;  1GOY A;  1NU3 A;  3G8Z A;  5EQL A;  8CHO A;  2SAR A;  3LXU X;  1RJO A;  3S5C A;  3J7Y d;  1RGL A;  4QWT A;  4JRF A;  1UCJ A;  1HYF A;  3KFQ C;  4G1M B;  1Q40 B;  1D6U A;  1FUS A;  1ROV A;  2WOF A;  4DKI A;  1FUW A;  1NNV A;  1RGA A;  4J9A A;  2F56 A;  5EEO A;  5IEN A;  4LEH A;  3Q3F A;  3UL6 A;  1I3I A;  2O9U X;  1UW1 A;  5G1K A;  1GMQ A;  3BLZ A;  1B21 A;  1BGS A;  4ZM8 A;  4XDV A;  1SQW A;  2IY2 A;  1UCL A;  1DMQ A;  1BNE A;  3FF2 A;  1F8N A;  4HZ9 B;  1S5A A;  1IQX A;  4XM4 A;  5ELJ A;  3PS8 A;  2CK3 H;  3MYT A;  4L8P A;  3MG2 A;  3V98 A;  7RNT A;  1O7H B;  1RCL A;  1BSD A;  3V92 A;  2GXF A;  2BT3 A;  1STD A;  3FGY A;  4HM5 B;  1C7H A;  1TP6 A;  1W5Z A;  1W01 A;  3FG1 A;  2BIR A;  1LOV A;  5AIG A;  2FGT A;  1JJ2 2;  1OHP A;  1E97 A;  3I55 3;  1HU9 A;  3H51 A;  3BNC A;  1YGE A;  4K90 B;  1J2B A;  2KCD A;  1GOU A;  1FA3 A;  3URP A;  1G96 A;  3JUN A;  1MNL A;  3BIR A;  3U97 A;  3JUP A;  1RNB A;  2D1W A;  1LNH A;  2O3O A;  2L1S A;  1CH0 A;  5IG3 A;  2BMQ B;  2BO9 B;  2OWP A;  1MGR A;  3D9R A;  4H3U A;  3CCQ 3;  3ZG0 A;  1YIJ 3;  4HM8 B;  4RNY A;  1FGM A;  1OGX A;  3D79 A;  5IG5 A;  3VGN A;  2XSH B;  3ZFZ A;  2XGN A;  3D3L A;  1AR0 A;  1O7N B;  5CK6 A;  1KWI A;  3K0Z A;  3KZT A;  2C11 A;  1GS3 A;  1JZD A;  1JB5 A;  2Z6B A;  3MPH A;  1UCK A;  2CW9 A;  1T3B A;  2UX0 A;  1M90 4;  2IUJ A;  4KFE A;  4BTW A;  1NJI 4;  3BNB A;  3FZW A;  1IT8 A;  3CC2 3;  1ZGX A;  1MWU A;  2PNC A;  1BRK A;  2HML B;  2ML5 A;  3ALA A;  3BU4 A;  4HYZ A;  6STD A;  2HOH A;  4WFO A;  1JZO A;  3SLU A;  1MWT A;  2H0G A;  4BTY A;  3CCL 3;  4EXR A;  1I0V A;  1VQ4 3;  3F7X A;  1N5H A;  1QMA A;  1VZZ A;  1GY5 A;  2XH9 A;  2YFI B;  1YHQ 3;  1VQM 3;  2E2U A;  2W04 A;  2Y74 A;  1M9G A;  3D5G A;  2H0H A;  2HMJ B;  1MOL A;  1VQ7 3;  2BMR B;  2RBI A;  1W4N A;  5DRV A;  5IW9 A;  1IK3 A;  2MC8 A;  2GEY A;  3NHX A;  3S28 A;  1M1X B;  1VQL 3;  1FW7 A;  1V74 A;  4LSO A;  3M8C A;  2P38 A;  1KC8 4;  1JV2 B;  2F4Y A;  3SOY A;  1JNQ A;  3LTD A;  2K3D A;  1MWS A;  4R9L A;  1IQ8 A;  1HZ1 A;  1GD3 A;  4J8T A;  3NM7 A;  1QJG A;  5KP1 A;  5M19 A;  1YJ9 3;  1JN5 A;  2CWT A;  4OUQ A;  1V57 A;  1EEJ A;  2IMJ A;  3D4A A;  3MSO A;  3NQZ A;  4KFF A;  3T0U A;  3ER7 A;  2CFG A;  2LYX A;  3F8X A;  1JKG A;  1TTO A;  3AMO B;  3IPT A;  4RZM A;  4PEJ A;  3OWS A;  1FGT A;  1YGW A;  2RFR A;  1PY3 A;  1QVF 2;  3PXM A;  2XRX B;  1W02 A;  3X3Y A;  1RSN A;  3RGA A;  3ECF A;  7STD A;  1UUV B;  1ASK A;  4L7K A;  2P05 A;  3JUO A;  3JVC A;  3G71 3;  1X1U A;  4HJL B;  3JUQ A;  3WDG B;  1E3V A;  2CKF B;  1C54 A;  1RGG A;  4N6V 0;  2JQ5 A;  2CWU A;  3WA2 X;  3Q1C A;  4I5Q A;  1QAL A;  1LXE A;  3OX9 A;  4HM6 B;  1KD1 4;  1X1X A;  4J5G A;  3CMA 3;  1A2P A;  4H61 A;  3CCU 3;  1VQP 3;  3WMD A;  1AVK A;  3UB1 A;  5AYR B;  1I8V A;  2R4I A;  3FSD A;  3DM8 A;  1WMO A;  1BRH A;  5ELU A;  1JN5 B;  5CF1 A;  1BNF A;  4FMA A;  1BOX A;  3L0R A;  1W6Y A;  5IEO A;  2P0M A;  2E2T A;  3DGN A;  3FG4 A;  1YJW 3;  2XFS A;  3DGM A;  3CNM A;  3NBB A;  3CU3 A;  3PCS A;  5D83 A;  3V99 A;  1IVU A;  1BU4 A;  3KSP A;  5A0O B;  3UJM A;  3DGO A;  3HZP A;  2ML6 A;  3CC7 3;  1A90 A;  1OCV A;  1ROA A;  2WGO A;  2LQV A;  1T2H A;  2WO0 A;  1OF5 A;  2L4V A;  3X40 A;  4J5K A;  2STD A;  4X2O A;  1JBR A;  1WTH A;  4FCM A;  2W56 A;  4ORL A;  5EVH A;  1G0T A;  1GD4 A;  1GY6 A;  1BUJ A;  2XR8 B;  1QAK A;  2KF4 A;  1E3R A;  4MMY B;  1DE3 A;  1A67 A;  1AVL A;  1DVD A;  1RGF A;  3WR2 A;  1TRP A;  1PYL A;  1Q9E A;  3GRD A;  1L5G B;  4JF8 A;  4MJD A;  1N8Q A;  2F86 B;  4GL6 A;  5RNT A;  3A76 A;  3STD A;  1T2I A;  2B1X B;  1HKX A;  5M18 A;  4IIA A;  2P0X A;  1EA2 A;  1TFO A;  1RRH A;  4O8S A;  1IVX A;  4MMX B;  4R1K A;  3MG3 A;  1GOV A;  1RMS A;  1BNI A;  1AV4 A;  4HKV B;  4HM7 B;  3RDE A;  3G4S 3;  3KCH A;  3F8H A;  3BNE A;  1TFK A;  3PYJ A;  1YJN 3;  1I3F A;  1JB2 A;  3B4O A;  2GBW B;  1LQG C;  2E2V A;  4OVM A;  1VQ9 3;  3BND A;  4L8O A;  3MHE A;  2GSP A;  1TRQ A;  3ROB A;  1AQZ A;  5D82 A;  2B24 B;  2W56 B;  3GZY B;  3NX0 A;  4MMZ B;  5JPP A;  1B20 A;  1PU4 A;  5CF2 A;  1IVV A;  3OW2 2;  3CCJ 3;  2AAE A;  1SIH A;  2CHC A;  4HAA A;  2W03 A;  1GYB A;  1UUW B;  1BSE A;  1LVN A;  2RCD A;  1LOY A;  2C4B A;  3F40 A;  1RKY A;  2GU3 A;  1BSA A;  1BNR A;  2P09 A;  3U1W A;  1ZS7 A;  2QIY A;  4LZI A;  1I0X A;  1W6C A;  1BRI A;  2CH9 A;  2F5W A;  1RGH A;  2YFL B;  3EBT A;  3CCS 3;  1IDP A;  2Q07 A;  3DGL A;  3A5E A;  1BUQ A;  3DY5 A;  5DRE A;  1JB4 A;  1BRS A;  1IV9 A;  2ZL8 A;  3SVA A;  1B2Z A;  3VF1 A;  4N6T A;  1ZO2 A;  2CWV A;  3NV0 A; 
#chains in the Genus database with same CATH homology
 2RSX A;  1NDO B;  4AKZ A;  4STD A;  1VQ6 3;  1Y4K A;  4LMI A;  5AYS C;  3DZL A;  2CFK A;  1T5Y A;  3MKI A;  3PZW A;  4XBX A;  3OWY A;  1O7G B;  4KFD A;  1DYU A;  2KRT A;  1TIJ A;  4O3V A;  1WMN A;  2D42 A;  2Z76 A;  1CYU A;  2I9W A;  3NBJ A;  3EE1 A;  1VQO 3;  5HGR A;  2HMN B;  5LC6 A;  3LT9 A;  3PGB A;  3CPW 2;  2YX9 A;  1IQY A;  3B8L A;  4NHF A;  3FLJ A;  1D6Y A;  2F98 A;  2C10 A;  1NO3 A;  5STD A;  3CD6 3;  2RGQ A;  3HI7 A;  4FMC A;  4HBR A;  1VQK 3;  1FGO A;  3Q90 A;  3G6E 3;  2HMK B;  1K73 4;  1UI8 A;  2FXT A;  4N6N B;  1W2B 2;  1LOX A;  1NB5 I;  1ISK A;  2JDI H;  5JPU A;  4R4K A;  3S27 A;  2GEX A;  4KVH A;  1OAC A;  2CFL A;  2QEX 3;  5LC7 A;  3Q2P A;  1Q40 A;  4XBT A;  5BXQ A;  1K41 A;  3HII A;  1VQN 3;  2HMM B;  2INX A;  1CYV A;  1OHS A;  1UI7 A;  5I97 A;  3X42 A;  4Q53 A;  1RRL A;  3GAX A;  3GWR A;  1W6G A;  3K9M C;  2W6J H;  4WWU C;  3EHC A;  3KE7 A;  2XF3 A;  3N9H A;  3KSE D;  3BB9 A;  3X41 A;  4K61 A;  5KP3 A;  3DXO A;  4FR9 A;  4O02 B;  2BNG A;  3FG3 A;  1O7W B;  2WGQ A;  1YVB I;  1JKG B;  5IEP A;  2MF7 A;  3CNX A;  3WA3 A;  4CDL A;  3EQQ B;  3EJV A;  3GZX B;  3WOD G;  5BVB A;  3CME 3;  5AIH A;  3WOF B;  3OWU A;  3LTA A;  4K1U A;  1K8A 4;  3WOE B;  4WYK A;  5AII A;  5FW5 A;  3RGR A;  3K7C A;  4HM1 B;  1K28 A;  4EYC A;  1PFP A;  3H3H A;  3HIG A;  3KII A;  3MWZ A;  5AEU B;  3GZR A;  3K63 A;  4EC6 A;  4OK0 A;  2GBX B;  1O7P B;  2M7O A;  4HVN A;  3UNL A;  1YIT 3;  3E99 A;  1DMN A;  1STF I;  1QAF A;  4IPB A;  3CCE 3;  4AEQ A;  3NM2 A;  2CIU A;  3QK9 A;  2Z7A A;  4N6M A;  1R4C A;  3LOY A;  4WP5 A;  5IER A;  1OGZ A;  3NUV A;  5AI1 A;  1QVG 2;  3CCR 3;  5IF6 A;  2YFJ B;  3EC9 A;  2W9P A;  2QGU A;  3HX8 A;  3OV4 A;  4GB5 A;  1IT7 A;  5D81 A;  1IV7 A;  3DMC A;  4I4K A;  2KXG A;  3DUK A;  3FF0 A;  4EV2 A;  3I56 3;  1OUN A;  1GY7 A;  3FKA A;  2WOH A;  5CXO A;  1NB3 I;  1US1 A;  3LML A;  1M1K 4;  4IT7 A;  1SPU A;  3KN4 A;  1OF5 B;  2BMO B;  1N5P A;  1EG9 B;  2CC3 A;  2CFD A;  3EX9 A;  3LT8 A;  3LZA A;  4WYK B;  3LH4 A;  4X2H A;  5G2G A;  2W0Q A;  2W2C A;  1Q82 4;  1N9E A;  1FGR A;  2XGL A;  3G16 A;  1TUH A;  3CPO A;  3HK4 A;  1WMP A;  1U8C B;  3N54 B;  3SOA A;  4N6U A;  3F7S A;  4RBN A;  1KSI A;  1OPY A;  2XSO B;  3UL5 A;  1ZX2 A;  3PCR A;  1S72 3;  2OTJ 3;  3F14 A;  3CCV 3;  1Q81 4;  3K5T A;  4FCZ A;  3EBY A;  2CFW A;  2IA7 A;  1CEW I;  2OQE A;  1VQ5 3;  4HM4 B;  5JBS A;  1DMM A;  3OXA A;  5AIF A;  2HMO B;  4U13 A;  4XDW A;  2BHM A;  4K1V A;  1EQK A;  1K9M 4;  1WNH A;  3AMO A;  1Z1S A;  5TGN A;  4MEI A;  3EF8 A;  3CCM 3;  2CG1 A;  2XFT A;  5AEW B;  3VSY A;  1W7C A;  4FCJ A;  3LTC A;  5IG0 A;  2Z77 A;  3SX1 A;  4XBY A;  3NBR A;  1CQS A;  3LTB A;  1Q86 4;  4N6O B;  2W9Q A;  4N6L A;  3X3X A;  1TU5 A;  4O2H A;  3FCS B;  2OQE C;  1SII A;  1JRQ A;  3S29 A;  2Y73 A;  3F9S A;  2OTL 3;  2FNQ A;  4HM3 B;  5FGO A;  1ULJ B;  2GU1 A;  5CLK A;  2A15 A;  1N8R 4;  3X3Z A;  3T8U A;  5KP4 A;  1FGQ A;  3EN8 A;  1A2K A;  5CF1 A;  3KKG A;  4N3V A;  3S67 A;  1N9J A;  3T8N A;  4AKY A;  4BTX A;  1YI2 3;  3IMA B;  3B4P A;  3JUM A;  3NQY A;  1VQ8 3;  3MG1 A;  3EB8 A;  4HZB B;  1RN7 A;  4EBG A;  4EV5 A;  2OOV A;  3NV0 B;  4HM0 B;  3SED A;  1D6Z A;  1WQL B;  2PZV A;  3I0Y A;  1Q7Y 4;  5IG4 A;  4LGQ A;  2IUK A;  3GZB A;  2K54 A;  3CC4 3;  4FMB A;  2SBL A;  3CXC 2;  3EN1 B;  1ULI B;  3B7C A;  1NWW A;  1OH0 A;  4CCV A;  2ZDJ A;  1O7M B;  4KZ1 A;  2OCT A;  4FMD A;  3NXJ A;  3O8Y A;  2CG0 A;  2QA4 3;  1W00 A;  3LYG A;  3TDG A;  4R80 A;  1OHO A;  2V1L A;  4R9K A;  2OOV C;  1A2V A;  1IVW A;  3N8B A;  4HM2 B;  3SXX A;  4WHA A;  1SJW A;  4XB5 A;  2K0M A;  2XEP A;  1IU7 A;  1W2Z A;  4TX4 A;  1KQS 2;  3FH1 A;  2F99 A;  3QRD A;  3G0K A;  4RNZ A;  3IJE B;  4NRE A;  1DVC A;  1U5O A;  1Q42 A;  1EKM A;  1NU3 A;  5EQL A;  3G8Z A;  8CHO A;  3LXU X;  1RJO A;  3S5C A;  3J7Y d;  4QWT A;  4JRF A;  3KFQ C;  4G1M B;  1Q40 B;  1D6U A;  1ROV A;  2WOF A;  1FUW A;  4J9A A;  5EEO A;  5IEN A;  4LEH A;  3UL6 A;  2O9U X;  1UW1 A;  3BLZ A;  4ZM8 A;  4XDV A;  1SQW A;  1DMQ A;  3FF2 A;  1F8N A;  4HZ9 B;  1S5A A;  1IQX A;  4XM4 A;  5ELJ A;  3PS8 A;  2CK3 H;  3MYT A;  4L8P A;  3MG2 A;  3V98 A;  1O7H B;  3V92 A;  2GXF A;  2BT3 A;  1STD A;  3FGY A;  4HM5 B;  1C7H A;  1TP6 A;  1W5Z A;  1W01 A;  3FG1 A;  5AIG A;  1JJ2 2;  2FGT A;  1OHP A;  1E97 A;  3I55 3;  1HU9 A;  3H51 A;  3BNC A;  1YGE A;  4K90 B;  1J2B A;  2KCD A;  1FA3 A;  1G96 A;  3JUN A;  1MNL A;  3U97 A;  3JUP A;  2D1W A;  1LNH A;  2O3O A;  5IG3 A;  2BMQ B;  2BO9 B;  2OWP A;  3D9R A;  4H3U A;  3CCQ 3;  1YIJ 3;  4HM8 B;  4RNY A;  1FGM A;  1OGX A;  5IG5 A;  3VGN A;  2XSH B;  2XGN A;  3D3L A;  1AR0 A;  1O7N B;  5CK6 A;  1KWI A;  3K0Z A;  3KZT A;  2C11 A;  1GS3 A;  2Z6B A;  1JB5 A;  3MPH A;  2CW9 A;  2UX0 A;  1M90 4;  2IUJ A;  4KFE A;  4BTW A;  1NJI 4;  3BNB A;  3FZW A;  1IT8 A;  3CC2 3;  2PNC A;  3ALA A;  6STD A;  2HML B;  2ML5 A;  4HYZ A;  4WFO A;  3SLU A;  4BTY A;  3CCL 3;  4EXR A;  1VQ4 3;  3F7X A;  1N5H A;  1QMA A;  1VZZ A;  1GY5 A;  2XH9 A;  2YFI B;  1YHQ 3;  1VQM 3;  2E2U A;  2W04 A;  2Y74 A;  1M9G A;  2HMJ B;  1MOL A;  1VQ7 3;  2BMR B;  1W4N A;  5DRV A;  5IW9 A;  1IK3 A;  2MC8 A;  2GEY A;  3NHX A;  3S28 A;  1M1X B;  1VQL 3;  1V74 A;  4LSO A;  3M8C A;  2P38 A;  1KC8 4;  1JV2 B;  3SOY A;  1JNQ A;  3LTD A;  4R9L A;  1IQ8 A;  4J8T A;  1GD3 A;  5KP1 A;  3NM7 A;  1QJG A;  1YJ9 3;  1JN5 A;  2CWT A;  4OUQ A;  2IMJ A;  3MSO A;  3NQZ A;  4KFF A;  3T0U A;  3ER7 A;  2CFG A;  2LYX A;  3F8X A;  1JKG A;  3AMO B;  3IPT A;  4RZM A;  4PEJ A;  3OWS A;  1FGT A;  1QVF 2;  2RFR A;  3PXM A;  2XRX B;  1W02 A;  3X3Y A;  3RGA A;  3ECF A;  7STD A;  1UUV B;  1ASK A;  4L7K A;  2P05 A;  3JUO A;  3JVC A;  3G71 3;  4HJL B;  3JUQ A;  3WDG B;  1E3V A;  2CKF B;  4N6V 0;  2JQ5 A;  2CWU A;  3WA2 X;  3Q1C A;  1QAL A;  1LXE A;  3OX9 A;  4HM6 B;  1KD1 4;  3CMA 3;  4H61 A;  3CCU 3;  1VQP 3;  3WMD A;  1AVK A;  3UB1 A;  5AYR B;  2R4I A;  3FSD A;  3DM8 A;  1WMO A;  5ELU A;  1JN5 B;  4FMA A;  3L0R A;  1W6Y A;  5IEO A;  2P0M A;  2E2T A;  3DGN A;  3FG4 A;  1YJW 3;  2XFS A;  3DGM A;  3CNM A;  3NBB A;  3CU3 A;  3PCS A;  5D83 A;  3V99 A;  1IVU A;  3KSP A;  5A0O B;  3UJM A;  3DGO A;  3HZP A;  2ML6 A;  3CC7 3;  1A90 A;  1OCV A;  1ROA A;  2WGO A;  2LQV A;  2WO0 A;  1OF5 A;  2L4V A;  3X40 A;  4X2O A;  2STD A;  1WTH A;  4FCM A;  2W56 A;  4ORL A;  5EVH A;  1GD4 A;  1GY6 A;  2XR8 B;  1QAK A;  4MMY B;  1E3R A;  1A67 A;  1AVL A;  1DVD A;  3GRD A;  1L5G B;  4JF8 A;  4MJD A;  1N8Q A;  2F86 B;  4GL6 A;  3A76 A;  3STD A;  2B1X B;  1HKX A;  4IIA A;  2P0X A;  1EA2 A;  1TFO A;  1RRH A;  4O8S A;  1IVX A;  4MMX B;  4R1K A;  3MG3 A;  1AV4 A;  4HKV B;  4HM7 B;  3RDE A;  3G4S 3;  3F8H A;  3BNE A;  1TFK A;  3PYJ A;  1YJN 3;  1JB2 A;  3B4O A;  2GBW B;  2E2V A;  4OVM A;  1VQ9 3;  3BND A;  4L8O A;  3MHE A;  3ROB A;  5D82 A;  2B24 B;  2W56 B;  3GZY B;  3NX0 A;  4MMZ B;  5JPP A;  1PU4 A;  5CF2 A;  1IVV A;  3OW2 2;  3CCJ 3;  1SIH A;  2CHC A;  2W03 A;  1GYB A;  1UUW B;  1LVN A;  2RCD A;  1RKY A;  3F40 A;  2GU3 A;  2P09 A;  3U1W A;  2QIY A;  4LZI A;  1W6C A;  2CH9 A;  2YFL B;  3EBT A;  3CCS 3;  1IDP A;  2Q07 A;  3DGL A;  1BUQ A;  3DY5 A;  5DRE A;  1JB4 A;  1IV9 A;  2ZL8 A;  3SVA A;  3VF1 A;  4N6T A;  1ZO2 A;  2CWV A;  3NV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...