4HBRA

Crystal structure of a putative periplasmic proteins (bacegg_01429) from bacteroides eggerthii dsm 20697 at 2.40 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GGYAPDSVQIALKKMYPTAAGIAWSQDKAYYVADFVMNGFDTRVWFTPDAEWVMKQTDWETLDEVPAAVFNAFAASEFSDGVVQNVTWVQFPEWQPIVAIQVGKPNMQMKYQILFTPKGEVLRQQNITNAYNTLGASTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative periplasmic protein
publication title Crystal structure of a putative periplasmic proteins (BACEGG_01429) from Bacteroides eggerthii DSM 20697 at 2.40 A resolution
rcsb
source organism Bacteroides eggerthii
total genus 27
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hbrA00
4IPBA 3U1WA 4FR9A 4HBRA 4K61A
chains in the Genus database with same CATH superfamily
2XGLA 1R4CA 1VQ63 1WQLB 2E2VA 3FG4A 5EVHA 5FGOA 4EV5A 2D1WA 1BVIA 4MJDA 3DM8A 2XEPA 1G0TA 1HZ1A 3B7CA 2CKFB 4EV2A 6GSPA 3J7Yd 3DUKA 3F7XA 4GB5A 4KFFA 4N6OB 4XBTA 3IPTA 3STDA 3ALAA 1LOYA 2ZL8A 2YFLB 4RNYA 3V98A 1VQL3 1VQK3 2BO9B 3BLZA 1M904 1STFI 4IT7A 5AYRB 4HAAA 2ML6A 2W2CA 3N54B 3SVAA 1MOLA 2CFLA 1GMPA 2F86B 3H3HA 1B21A 5DREA 2OTL3 3D5GA 1MWUA 1A2KA 3MPHA 2P38A 1KC84 1DETA 2UUGC 4CPKA 1US1A 2BU4A 2XSHB 3KN4A 1RN7A 2OQEC 3LXUX 4XM4A 2CG0A 1AVKA 3FG3A 1G02A 2HMKB 4R80A 4HM4B 1Q42A 3BB9A 2CWUA 1RGEA 1LRAA 5D81A 3BNCA 1B2XA 1IV7A 1GOYA 1BSBA 1RN1A 2OOVC 4K1VA 4H61A 2LQVA 2PZVA 1EQKA 1BRKA 4XBXA 3X3YA 2XFSA 3AMOA 5AIIA 3NBJA 3SOYA 4EXRA 2IMJA 3AGNA 1E3VA 2F99A 3F9SA 4AEQA 1DVCA 2Y73A 5I97A 1B2SA 4WYKB 3PXMA 3G16A 4N6V0 3CD63 2AAEA 1TRQA 1X1UA 1JZDA 3FCSB 5LC7A 2HMMB 1UDII 2P09A 2I9WA 2YFIB 2CX0A 3D3LA 2CFWA 4HZ9B 1WMNA 1I70A 1KWIA 1DMMA 1BU4A 1OHSA 3IMAB 4HM1B 1GYBA 1PFPA 2A15A 3LT9A 1TFOA 1BUJA 3HIIA 1C54A 1LQMB 2HMNB 2CIUA 2HMJB 4EW5A 5M1AA 3X40A 1PU4A 1T5YA 2GEYA 3OV4A 3Q3FA 4HJLB 1AR0A 3F8XA 3G713 2Z6BA 4FR9A 1AVLA 1CEWI 3LTAA 5G2GA 3X3XA 4H3UA 3CCV3 2HMOB 1ROAA 2KRTA 3A5EA 3S28A 4GHOA 1L5GB 1M1XB 2J8XB 2UX0A 1IK3A 1MGRA 1K28A 5AIHA 1X1YA 3F40A 1QAFA 3ZFZA 3CCE3 4BIRA 1S5AA 2W56A 1W5ZA 2K3DA 3RGAA 2YFJB 1BAOA 4J5KA 3LTDA 1UCJA 1LNHA 2F5MA 7STDA 1K9M4 1UUWB 2C4BA 1Q7HA 1FZUA 3JVCA 5AIFA 1OHPA 2W9QA 1Q7Y4 1FYSA 4OVMA 3CPW2 2Z76A 3AMOB 3HK4A 5LC6A 3H51A 4BL3A 1UUGB 4DKIA 2CW9A 3FLJA 3CCJ3 2FGTA 1O7HB 4KT3B 3ECFA 2BMOB 4O8SA 1GMQA 3WA3A 1RTUA 3PS8A 4ILFA 5AIGA 2SBLA 1GSPA 4RZMA 3K7CA 3ROBA 4MMZB 1GS3A 5CF1A 4G1MB 4N6NB 2OTJ3 1O7MB 5IENA 1FW7A 2CG1A 4LGQA 1EG9B 1OPYA 3NV0A 3CNXA 4FMAA 3QRDA 1N9EA 1SJWA 3FGYA 1VZZA 4HM2B 3D5IA 1B20A 1W00A 1WTHA 1K734 4HBRA 4HM5B 1NDOB 3SOAA 1A2VA 2WOHA 4RBNA 1HKXA 3G8ZA 1WMOA 3BNBA 1W6GA 5IG3A 3ZG0A 5JPPA 3X3ZA 5AI1A 1X1WA 1TP6A 2QGUA 1RGLA 3F14A 1LOXA 1OACA 3KZTA 1I8VA 2O9UX 3MYTA 3RNTA 3VGNA 2XR8B 1BUQA 1VQ83 4K1UA 2KF6A 2RGQA 2W56B 1EKMA 1NWWA 3E99A 1X1XA 3KE7A 2XRXB 3MKIA 1JB4A 1T2IA 1NNVA 1O7GB 1B2UA 2R41A 4CCVA 4HM8B 1K41A 5IG4A 3HI7A 3DGNA 2HMLB 3DGMA 2W03A 3VF1A 3SX1A 2GEXA 3EN1B 5IF6A 1BANA 1IT7A 1IV9A 2CWVA 3V99A 3GZYB 1DMNA 2F4YA 1I2FA 1ULIB 3URPA 1G96A 4HM3B 1RCKA 1BRHA 1E3RA 4XDVA 3U97A 4R1KA 3BNEA 1MGWA 3FG1A 1KSIA 1BNFA 2F98A 2OCTA 3LMLA 3LOYA 3CC43 1DYUA 3LZAA 4LMIA 1ZO2A 1VQ93 4STDA 3RDEA 1B2MA 3WDGB 2BNGA 3WOEB 2GSPA 1JB2A 1DMQA 1TJDA 3NV0B 1RRHA 1YVSA 3CPOA 1N9JA 1W01A 2GU1A 1JBSA 5GSPA 1FGRA 3JUPA 3KIIA 1OGZA 2O3OA 3WR2A 1BRJA 3OW22 2RBIA 3V92A 2CX1A 2GXFA 6STDA 1UW1A 3GZBA 1RHLA 4HM0B 4LYLB 3Q2PA 4HKVB 3DZLA 4L8OA 1IVUA 4NREA 1Y4KA 4LEHA 2Z77A 1CH0A 3KSED 2CFDA 1IVWA 3OXAA 1MWTA 3PGBA 1U5OA 3EB8A 4J8TA 5KP1A 1J2BA 2D42A 2JQ5A 1JBTA 1Q814 2BMQB 3SYUA 1WNHA 3Q90A 1W2ZA 1MWSA 1FGTA 1LNIA 2CK3H 3LH4A 3QK9A 3CCL3 4O2HA 3CNMA 3ER7A 4MMYB 4NPBA 5FW5A 2BIRA 1IT8A 3U1WA 2GBWB 4XBYA 3K63A 5HOHA 1Q824 1VQ53 1R4YA 1AV4A 3B8LA 3UJMA 1GOVA 1OGXA 2XFTA 2BMRB 2KCDA 3EBYA 4HOHA 7GSPA 3CC73 4N6MA 3WHOA 1ULJB 1WMPA 2BT3A 4WWUC 3BNDA 3BU4A 1UI8A 2KAAA 1PY3A 1VQQA 3NHXA 3SEDA 1EA2A 1M9GA 3JUMA 3NBRA 1IDPA 1SIIA 1A67A 2HOHA 3RGRA 3G4S3 1V58A 4IIAA 2QEX3 4AKZA 3NUVA 4KVHA 4KZ1A 4WFOA 3SXXA 5RNTA 1BRIA 1UGIA 2STDA 1RGFA 2OQEA 2QA43 5TGNA 1O7NB 1VQN3 1RGKA 1GY6A 2JDIH 4K90B 1BSEA 3PZWA 4CDLA 1MWRA 1Q40A 4MMXB 1W4NA 3CXC2 1YHQ3 3DXOA 3FKAA 3LTCA 2OOVA 1I0VA 5HGRA 4R9KA 2KXGA 3D79A 4FCJA 4GSPA 5STDA 3T8UA 4FCZA 3L0RA 1YJN3 4WHAA 3NXJA 1YJ93 1UGHI 4Q53A 4HVNA 3S67A 3WMDA 1UCKA 2CFGA 2WGOA 4O3VA 1RMSA 1T2HA 4O02B 4BTWA 1W2B2 1LQGC 1SARA 2L1SA 3UB1A 3A76A 2CH9A 3UNLA 2F56A 1N8QA 3GZRA 4L7KA 1N5PA 2IUKA 3CU3A 4N3VA 1SIHA 5IEOA 3HX8A 3X41A 1ISKA 5A0OB 1RRLA 1EEJA 3MG1A 1OHOA 3OWSA 4JF8A 4OUQA 3WOFB 8RNTA 3AHSA 3CCS3 3NQYA 3EJVA 1BSAA 3HZPA 6RNTA 4X2OA 4N6LA 1BNJA 3EHCA 4MEIA 4BU4A 2AADA 1KD14 4HM6B 2ML5A 1LXEA 4FCMA 4CJNA 1IQYA 2WOFA 3F8HA 1BRNL 3DGYA 2FXTA 4LSOA 3O8YA 3I563 4FMCA 3CCM3 4WP5A 3OWYA 1TIJA 3MHEA 4EC6A 1DVDA 1D6YA 1RCLA 1BNRA 1MNLA 4EYCA 5G1LA 1D6UA 3DGLA 1B27A 1JJ22 3WA2X 1DE3A 4K61A 2FNQA 1RNTA 3PYJA 2W6JH 3DH2A 3GWRA 4I5QA 2M7OA 3GZXB 8CHOA 4BL2A 3JUOA 2YX9A 5EEOA 3GAXA 1RNBA 2E2TA 2MF7A 1RN4A 3S27A 1Q40B 4J5GA 3HIGA 1E97A 1CYVA 3EQQB 4FMDA 1VQO3 3KSPA 4NHFA 1YIJ3 1I0XA 1V74A 1U8CB 3S29A 2F5WA 2WGQA 1W7CA 1FUSA 1A90A 1ZX2A 1FGMA 3MSOA 4AKYA 5JPUA 1Q9EA 1RGGA 3K5TA 2MC8A 1ZS7A 3EX9A 1OH0A 1YVBI 2XF3A 3NBBA 1QMAA 4IPBA 3UL5A 1I3FA 1UCLA 1N5HA 3Q1CA 1W02A 3DGOA 3FH1A 4I4KA 5AEWB 1QJGA 2IY2A 1JRQA 3AGOA 2P0MA 3D4AA 7RNTA 4QWTA 1RSNA 4ORLA 1M1K4 2W9PA 1YI23 4FMBA 3KFQC 4EBGA 3EC9A 3DY5A 1W6YA 4BTXA 4ZM8A 3FZWA 4OK0A 1AQZA 1JKGA 2W0QA 2XGNA 3B4PA 1IU7A 2RSXA 4HYZA 1QAKA 3LTBA 3MG2A 5CXOA 1HU9A 5AEUB 2R4IA 1RLSA 2Y74A 2CWTA 5CLKA 3X42A 1BSDA 5M19A 2XH9A 1BRGA 1NB3I 2KF5A 2RCDA 2CC3A 4HZBB 3CCR3 1GY5A 1BSCA 1GY7A 3B4OA 1TTOA 1BNSA 2SARA 4PEJA 2Z7AA 1I2GA 2H0GA 3EE1A 1ASKA 3FF0A 1RKYA 1IVVA 4LZIA 2UGIA 3MWZA 1QALA 4TX4A 3SLUA 1KQS2 5D82A 4JRFA 3CCQ3 2C11A 1C7HA 5DRVA 3GSPA 2INXA 3NM2A 3I553 3I0YA 1IVXA 3WODG 3PCSA 1AY7A 3ZG5A 5BXQA 1UI7A 2QIYA 1FA3A 2IYJA 3T0UA 5CK6A 1NB5I 4XDWA 1GD4A 4N6UA 3KKGA 3HOHA 3OWUA 3VSYA 1BOXA 1I3IA 3F7SA 1V57A 3EBTA 2W04A 1GOUA 1IQXA 1FUWA 4HM7B 3CMA3 4U13A 1RDSA 3LYGA 5EQLA 2KF4A 5JBSA 2H0IA 3D9RA 3EN8A 3KCHA 1TUHA 1VQP3 2ZDJA 1B2ZA 1FGQA 1UCIA 5KP3A 3CC23 5G1KA 1JN5A 1PYLA 2KF3A 3BIRA 3G0KA 3NX0A 1VQM3 1OF5A 3K9MC 2IA7A 1YGEA 3AHWA 3S5CA 2GBXB 3JUNA 1SPUA 1JKGB 2XSOB 1YJW3 1STDA 2B24B 1D6ZA 1O7WB 3OX9A 1YGWA 5IG5A 1SQWA 3JUQA 1QVG2 3EF8A 1NJI4 1BNIA 1YIT3 2V1LA 1TRPA 3PCRA 1I2EA 1TFKA 1TU5A 1BIRA 1FGOA 1S723 1T3BA 1W6CA 2K54A 2P0XA 1HYFA 4GL6A 1FUTA 3N9HA 1BRSA 2E2UA 2RFRA 1IQ8A 5IG0A 1JZOA 2LYXA 2H0HA 1LOWA 5IERA 1LOVA 5BVBA 1N8R4 1K8A4 4R4KA 1BNGA 3NM7A 5ELUA 4X2HA 3DMCA 3TDGA 1QVF2 1IYYA 1EUIC 4KFDA 2PNCA 1F8NA 3N8BA 3IJEB 1RJOA 5D83A 1RGAA 3M8CA 3FF2A 4RNZA 1YNVX 2CHCA 1ZGXA 2ZHXB 4KFEA 1JB5A 4RNTA 5ELJA 5M18A 1BGSA 1GMRA 9RNTA 1JBRA 3GRDA 1CQSA 2IUJA 5BIRA 5CF2A 3LT8A 4XB5A 1O7PB 2BHMA 4R9LA 2RNTA 4L8PA 1CYUA 1ROVA 3FSDA 5IW9A 1NU3A 2GU3A 1A2PA 1OUNA 5KP4A 1JNQA 1Z1SA 1JN5B 1UUVB 1OCVA 1OF5B 3CME3 3MG3A 2WO0A 2B1XB 4J9AA 3UL6A 1RGHA 3T8NA 5BU4A 2L4VA 2CFKA 3K0ZA 5IEPA 1VQ73 1VQ43 2ZA4A 4BTYA 5AYSC 1GD3A 1RGCA 1B3SA 1BNEA 1LVNA 4WYKA 2C10A 1Q864 2OWPA 3CCU3 4N6TA 1NO3A 3NQZA 2K0MA 1JV2B 2P05A 3G6E3 2Q07A
chains in the Genus database with same CATH topology
2XGLA 1R4CA 1VQ63 1WQLB 2E2VA 3FG4A 5EVHA 5FGOA 4EV5A 2D1WA 4MJDA 3DM8A 2XEPA 3B7CA 2CKFB 4EV2A 3J7Yd 3DUKA 3F7XA 4GB5A 4KFFA 4N6OB 4XBTA 3IPTA 3STDA 3ALAA 2ZL8A 2YFLB 4RNYA 3V98A 1VQL3 1VQK3 2BO9B 3BLZA 1M904 1STFI 4IT7A 5AYRB 2ML6A 2W2CA 3N54B 3SVAA 1MOLA 2CFLA 2F86B 3H3HA 5DREA 2OTL3 1A2KA 3MPHA 2P38A 1KC84 1US1A 2XSHB 3KN4A 1RN7A 2OQEC 3LXUX 4XM4A 2CG0A 1AVKA 3FG3A 2HMKB 4R80A 4HM4B 1Q42A 3BB9A 2CWUA 5D81A 3BNCA 1IV7A 4K1VA 2OOVC 4H61A 2LQVA 2PZVA 1EQKA 4XBXA 3X3YA 2XFSA 3AMOA 5AIIA 3NBJA 3SOYA 4EXRA 2IMJA 1E3VA 2F99A 3F9SA 4AEQA 1DVCA 2Y73A 5I97A 4WYKB 3PXMA 3G16A 4N6V0 3CD63 3FCSB 5LC7A 2HMMB 2P09A 2I9WA 2YFIB 3D3LA 4HZ9B 2CFWA 1WMNA 1KWIA 1DMMA 1OHSA 3IMAB 4HM1B 1GYBA 1PFPA 2A15A 3LT9A 1TFOA 3HIIA 2HMNB 2CIUA 2HMJB 3X40A 1PU4A 1T5YA 2GEYA 3OV4A 4HJLB 3G713 1AR0A 3F8XA 2Z6BA 4FR9A 1AVLA 1CEWI 3LTAA 5G2GA 3X3XA 4H3UA 3CCV3 2HMOB 1ROAA 2KRTA 3S28A 1L5GB 1M1XB 2UX0A 1IK3A 1K28A 5AIHA 3F40A 1QAFA 3CCE3 1S5AA 2W56A 1W5ZA 3RGAA 2YFJB 3LTDA 1LNHA 1K9M4 7STDA 1UUWB 3JVCA 5AIFA 1OHPA 2W9QA 1Q7Y4 4OVMA 3CPW2 2Z76A 3AMOB 3HK4A 5LC6A 3H51A 2CW9A 3FLJA 3CCJ3 2FGTA 1O7HB 3ECFA 2BMOB 4O8SA 3WA3A 3PS8A 5AIGA 2SBLA 4RZMA 3K7CA 3ROBA 4MMZB 1GS3A 5CF1A 4G1MB 4N6NB 2OTJ3 1O7MB 5IENA 2CG1A 4LGQA 1EG9B 1OPYA 3NV0A 3CNXA 4FMAA 3QRDA 1N9EA 1SJWA 3FGYA 1VZZA 4HM2B 1K734 1W00A 1WTHA 4HBRA 4HM5B 1NDOB 3SOAA 1A2VA 2WOHA 4RBNA 1HKXA 3G8ZA 1WMOA 3BNBA 1W6GA 5IG3A 5JPPA 3X3ZA 5AI1A 1TP6A 2QGUA 3F14A 1LOXA 1OACA 3KZTA 2O9UX 3MYTA 3VGNA 2XR8B 1BUQA 1VQ83 4K1UA 2RGQA 2W56B 1EKMA 1NWWA 3E99A 3KE7A 2XRXB 3MKIA 1JB4A 1O7GB 4CCVA 4HM8B 1K41A 3HI7A 3DGNA 2HMLB 3DGMA 2W03A 3VF1A 3SX1A 2GEXA 3EN1B 5IF6A 1IT7A 1IV9A 2CWVA 3V99A 3GZYB 1DMNA 1ULIB 1G96A 4HM3B 1E3RA 4XDVA 3U97A 4R1KA 3BNEA 3FG1A 1KSIA 2OCTA 2F98A 3LMLA 3LOYA 3CC43 1DYUA 3LZAA 4LMIA 1ZO2A 1VQ93 4STDA 3RDEA 3WDGB 2BNGA 3WOEB 1JB2A 1DMQA 3NV0B 1RRHA 3CPOA 1N9JA 1W01A 2GU1A 1FGRA 3JUPA 3KIIA 1OGZA 2O3OA 3OW22 3V92A 2GXFA 6STDA 1UW1A 3GZBA 4HM0B 4NREA 5IG4A 3Q2PA 4HKVB 3DZLA 4L8OA 1IVUA 5JPUA 1Y4KA 4LEHA 2Z77A 3KSED 2CFDA 1IVWA 3OXAA 3PGBA 1U5OA 3EB8A 4J8TA 5KP1A 1J2BA 2D42A 2JQ5A 1Q814 2BMQB 1WNHA 3Q90A 1W2ZA 1FGTA 2CK3H 3LH4A 3QK9A 3CCL3 4O2HA 3CNMA 3ER7A 4MMYB 5FW5A 1IT8A 3U1WA 2GBWB 4XBYA 3K63A 1Q824 1VQ53 1AV4A 3B8LA 3UJMA 1OGXA 2XFTA 2BMRB 2KCDA 3EBYA 3CC73 4N6MA 1ULJB 1WMPA 2BT3A 4WWUC 3BNDA 1UI8A 3NHXA 3SEDA 1EA2A 1M9GA 3JUMA 3NBRA 1IDPA 1SIIA 1A67A 3RGRA 3G4S3 4IIAA 2QEX3 4AKZA 3NUVA 4KVHA 4KZ1A 4WFOA 3SXXA 2STDA 2OQEA 2QA43 5TGNA 1O7NB 1VQN3 1GY6A 2JDIH 4K90B 3PZWA 4CDLA 1Q40A 4MMXB 1YHQ3 1W4NA 3CXC2 3DXOA 3FKAA 3LTCA 2OOVA 5HGRA 4R9KA 2KXGA 4FCJA 5STDA 3T8UA 4FCZA 3L0RA 1YJN3 4WHAA 3NXJA 1YJ93 4Q53A 4HVNA 3S67A 3WMDA 2WGOA 2CFGA 4O3VA 4O02B 4BTWA 1W2B2 3UB1A 3A76A 2CH9A 3UNLA 1N8QA 3GZRA 4L7KA 1N5PA 2IUKA 3CU3A 4N3VA 1SIHA 5IEOA 3HX8A 3X41A 1ISKA 5A0OB 1RRLA 3MG1A 1OHOA 3OWSA 4JF8A 4OUQA 3WOFB 3CCS3 3NQYA 3EJVA 3HZPA 4X2OA 4N6LA 3EHCA 4MEIA 1KD14 4HM6B 2ML5A 1LXEA 4FCMA 1IQYA 2WOFA 3F8HA 4LSOA 2FXTA 3O8YA 3I563 4FMCA 3CCM3 4WP5A 3OWYA 1TIJA 3MHEA 4EC6A 1DVDA 1D6YA 1MNLA 4EYCA 1D6UA 3DGLA 1JJ22 3WA2X 4K61A 2FNQA 3PYJA 2W6JH 3GWRA 2M7OA 3GZXB 8CHOA 3JUOA 2YX9A 5EEOA 3GAXA 2MF7A 2E2TA 3S27A 1Q40B 3HIGA 1E97A 1CYVA 3EQQB 4FMDA 1VQO3 3KSPA 4NHFA 1YIJ3 1V74A 1U8CB 3S29A 2WGQA 1W7CA 1A90A 1ZX2A 1FGMA 3MSOA 4AKYA 3K5TA 2MC8A 3EX9A 1OH0A 1YVBI 2XF3A 3NBBA 1QMAA 4IPBA 3UL5A 1N5HA 3Q1CA 1W02A 3DGOA 3FH1A 4I4KA 5AEWB 1QJGA 1JRQA 2P0MA 4QWTA 4ORLA 1M1K4 2W9PA 1YI23 4FMBA 3KFQC 4EBGA 3EC9A 3DY5A 1W6YA 4BTXA 4ZM8A 3FZWA 4OK0A 1JKGA 2W0QA 3B4PA 2XGNA 4HYZA 1IU7A 2RSXA 1QAKA 3LTBA 3MG2A 5CXOA 1HU9A 5AEUB 2R4IA 5CLKA 2Y74A 2CWTA 3X42A 2XH9A 1NB3I 2RCDA 3CCR3 2CC3A 4HZBB 1GY5A 1GY7A 3B4OA 4PEJA 2Z7AA 1RKYA 3EE1A 1ASKA 3FF0A 1IVVA 4LZIA 3SLUA 3MWZA 1QALA 4TX4A 1KQS2 5D82A 4JRFA 3CCQ3 2C11A 1C7HA 5DRVA 3NM2A 2INXA 3I553 3I0YA 1IVXA 3WODG 3PCSA 5BXQA 1UI7A 2QIYA 1FA3A 3T0UA 5CK6A 1NB5I 4XDWA 1GD4A 4N6UA 3KKGA 3OWUA 3VSYA 3F7SA 3EBTA 2W04A 1IQXA 1FUWA 4HM7B 3CMA3 4U13A 3LYGA 5EQLA 5JBSA 3D9RA 3EN8A 1TUHA 1VQP3 2ZDJA 1FGQA 5KP3A 3CC23 1JN5A 3G0KA 1VQM3 3NX0A 1OF5A 3K9MC 2IA7A 1YGEA 3S5CA 2GBXB 3JUNA 1SPUA 1JKGB 2XSOB 1YJW3 1STDA 2B24B 1D6ZA 1O7WB 3OX9A 5IG5A 1SQWA 3JUQA 1QVG2 3EF8A 1NJI4 1YIT3 2V1LA 3PCRA 1TFKA 1TU5A 1FGOA 1S723 1W6CA 2K54A 2P0XA 4GL6A 3N9HA 2E2UA 2RFRA 1IQ8A 5IG0A 2LYXA 5IERA 1N8R4 5BVBA 1K8A4 4R4KA 3NM7A 5ELUA 4X2HA 3DMCA 3TDGA 1QVF2 4KFDA 2PNCA 1F8NA 3N8BA 3IJEB 1RJOA 5D83A 3M8CA 3FF2A 4RNZA 2CHCA 5ELJA 4KFEA 1JB5A 3GRDA 1CQSA 2IUJA 5CF2A 3LT8A 4XB5A 1O7PB 2BHMA 4R9LA 4L8PA 1CYUA 1ROVA 3FSDA 5IW9A 1NU3A 2GU3A 1OUNA 5KP4A 1JNQA 1Z1SA 1JN5B 1UUVB 1OCVA 1OF5B 3CME3 3MG3A 2WO0A 2B1XB 4J9AA 3UL6A 3T8NA 2L4VA 2CFKA 3K0ZA 5IEPA 1VQ73 1VQ43 4BTYA 5AYSC 1GD3A 1LVNA 4WYKA 2C10A 1Q864 2OWPA 3CCU3 4N6TA 1NO3A 3NQZA 2K0MA 1JV2B 2P05A 3G6E3 2Q07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPB A;  3U1W A;  4FR9 A;  4HBR A;  4K61 A; 
#chains in the Genus database with same CATH topology
 2XGL A;  1R4C A;  1VQ6 3;  1WQL B;  2E2V A;  3FG4 A;  5EVH A;  5FGO A;  4EV5 A;  2D1W A;  1BVI A;  4MJD A;  3DM8 A;  2XEP A;  1G0T A;  1HZ1 A;  3B7C A;  2CKF B;  4EV2 A;  6GSP A;  3J7Y d;  3DUK A;  3F7X A;  4GB5 A;  4KFF A;  4N6O B;  4XBT A;  3IPT A;  3STD A;  3ALA A;  1LOY A;  2ZL8 A;  2YFL B;  4RNY A;  3V98 A;  1VQL 3;  1VQK 3;  2BO9 B;  3BLZ A;  1M90 4;  1STF I;  4IT7 A;  5AYR B;  4HAA A;  2ML6 A;  2W2C A;  3N54 B;  3SVA A;  1MOL A;  2CFL A;  1GMP A;  2F86 B;  3H3H A;  1B21 A;  5DRE A;  2OTL 3;  3D5G A;  1MWU A;  1A2K A;  3MPH A;  2P38 A;  1KC8 4;  1DET A;  2UUG C;  4CPK A;  1US1 A;  2BU4 A;  2XSH B;  3KN4 A;  1RN7 A;  2OQE C;  3LXU X;  4XM4 A;  2CG0 A;  1AVK A;  3FG3 A;  1G02 A;  2HMK B;  4R80 A;  4HM4 B;  1Q42 A;  3BB9 A;  2CWU A;  1RGE A;  1LRA A;  5D81 A;  3BNC A;  1B2X A;  1IV7 A;  1GOY A;  1BSB A;  1RN1 A;  2OOV C;  4K1V A;  4H61 A;  2LQV A;  2PZV A;  1EQK A;  1BRK A;  4XBX A;  3X3Y A;  2XFS A;  3AMO A;  5AII A;  3NBJ A;  3SOY A;  4EXR A;  2IMJ A;  3AGN A;  1E3V A;  2F99 A;  3F9S A;  4AEQ A;  1DVC A;  2Y73 A;  5I97 A;  1B2S A;  4WYK B;  3PXM A;  3G16 A;  4N6V 0;  3CD6 3;  2AAE A;  1TRQ A;  1X1U A;  1JZD A;  3FCS B;  5LC7 A;  2HMM B;  1UDI I;  2P09 A;  2I9W A;  2YFI B;  2CX0 A;  3D3L A;  2CFW A;  4HZ9 B;  1WMN A;  1I70 A;  1KWI A;  1DMM A;  1BU4 A;  1OHS A;  3IMA B;  4HM1 B;  1GYB A;  1PFP A;  2A15 A;  3LT9 A;  1TFO A;  1BUJ A;  3HII A;  1C54 A;  1LQM B;  2HMN B;  2CIU A;  2HMJ B;  4EW5 A;  5M1A A;  3X40 A;  1PU4 A;  1T5Y A;  2GEY A;  3OV4 A;  3Q3F A;  4HJL B;  1AR0 A;  3F8X A;  3G71 3;  2Z6B A;  4FR9 A;  1AVL A;  1CEW I;  3LTA A;  5G2G A;  3X3X A;  4H3U A;  3CCV 3;  2HMO B;  1ROA A;  2KRT A;  3A5E A;  3S28 A;  4GHO A;  1L5G B;  1M1X B;  2J8X B;  2UX0 A;  1IK3 A;  1MGR A;  1K28 A;  5AIH A;  1X1Y A;  3F40 A;  1QAF A;  3ZFZ A;  3CCE 3;  4BIR A;  1S5A A;  2W56 A;  1W5Z A;  2K3D A;  3RGA A;  2YFJ B;  1BAO A;  4J5K A;  3LTD A;  1UCJ A;  1LNH A;  2F5M A;  7STD A;  1K9M 4;  1UUW B;  2C4B A;  1Q7H A;  1FZU A;  3JVC A;  5AIF A;  1OHP A;  2W9Q A;  1Q7Y 4;  1FYS A;  4OVM A;  3CPW 2;  2Z76 A;  3AMO B;  3HK4 A;  5LC6 A;  3H51 A;  4BL3 A;  1UUG B;  4DKI A;  2CW9 A;  3FLJ A;  3CCJ 3;  2FGT A;  1O7H B;  4KT3 B;  3ECF A;  2BMO B;  4O8S A;  1GMQ A;  3WA3 A;  1RTU A;  3PS8 A;  4ILF A;  5AIG A;  2SBL A;  1GSP A;  4RZM A;  3K7C A;  3ROB A;  4MMZ B;  1GS3 A;  5CF1 A;  4G1M B;  4N6N B;  2OTJ 3;  1O7M B;  5IEN A;  1FW7 A;  2CG1 A;  4LGQ A;  1EG9 B;  1OPY A;  3NV0 A;  3CNX A;  4FMA A;  3QRD A;  1N9E A;  1SJW A;  3FGY A;  1VZZ A;  4HM2 B;  3D5I A;  1B20 A;  1W00 A;  1WTH A;  1K73 4;  4HBR A;  4HM5 B;  1NDO B;  3SOA A;  1A2V A;  2WOH A;  4RBN A;  1HKX A;  3G8Z A;  1WMO A;  3BNB A;  1W6G A;  5IG3 A;  3ZG0 A;  5JPP A;  3X3Z A;  5AI1 A;  1X1W A;  1TP6 A;  2QGU A;  1RGL A;  3F14 A;  1LOX A;  1OAC A;  3KZT A;  1I8V A;  2O9U X;  3MYT A;  3RNT A;  3VGN A;  2XR8 B;  1BUQ A;  1VQ8 3;  4K1U A;  2KF6 A;  2RGQ A;  2W56 B;  1EKM A;  1NWW A;  3E99 A;  1X1X A;  3KE7 A;  2XRX B;  3MKI A;  1JB4 A;  1T2I A;  1NNV A;  1O7G B;  1B2U A;  2R41 A;  4CCV A;  4HM8 B;  1K41 A;  5IG4 A;  3HI7 A;  3DGN A;  2HML B;  3DGM A;  2W03 A;  3VF1 A;  3SX1 A;  2GEX A;  3EN1 B;  5IF6 A;  1BAN A;  1IT7 A;  1IV9 A;  2CWV A;  3V99 A;  3GZY B;  1DMN A;  2F4Y A;  1I2F A;  1ULI B;  3URP A;  1G96 A;  4HM3 B;  1RCK A;  1BRH A;  1E3R A;  4XDV A;  3U97 A;  4R1K A;  3BNE A;  1MGW A;  3FG1 A;  1KSI A;  1BNF A;  2F98 A;  2OCT A;  3LML A;  3LOY A;  3CC4 3;  1DYU A;  3LZA A;  4LMI A;  1ZO2 A;  1VQ9 3;  4STD A;  3RDE A;  1B2M A;  3WDG B;  2BNG A;  3WOE B;  2GSP A;  1JB2 A;  1DMQ A;  1TJD A;  3NV0 B;  1RRH A;  1YVS A;  3CPO A;  1N9J A;  1W01 A;  2GU1 A;  1JBS A;  5GSP A;  1FGR A;  3JUP A;  3KII A;  1OGZ A;  2O3O A;  3WR2 A;  1BRJ A;  3OW2 2;  2RBI A;  3V92 A;  2CX1 A;  2GXF A;  6STD A;  1UW1 A;  3GZB A;  1RHL A;  4HM0 B;  4LYL B;  3Q2P A;  4HKV B;  3DZL A;  4L8O A;  1IVU A;  4NRE A;  1Y4K A;  4LEH A;  2Z77 A;  1CH0 A;  3KSE D;  2CFD A;  1IVW A;  3OXA A;  1MWT A;  3PGB A;  1U5O A;  3EB8 A;  4J8T A;  5KP1 A;  1J2B A;  2D42 A;  2JQ5 A;  1JBT A;  1Q81 4;  2BMQ B;  3SYU A;  1WNH A;  3Q90 A;  1W2Z A;  1MWS A;  1FGT A;  1LNI A;  2CK3 H;  3LH4 A;  3QK9 A;  3CCL 3;  4O2H A;  3CNM A;  3ER7 A;  4MMY B;  4NPB A;  5FW5 A;  2BIR A;  1IT8 A;  3U1W A;  2GBW B;  4XBY A;  3K63 A;  5HOH A;  1Q82 4;  1VQ5 3;  1R4Y A;  1AV4 A;  3B8L A;  3UJM A;  1GOV A;  1OGX A;  2XFT A;  2BMR B;  2KCD A;  3EBY A;  4HOH A;  7GSP A;  3CC7 3;  4N6M A;  3WHO A;  1ULJ B;  1WMP A;  2BT3 A;  4WWU C;  3BND A;  3BU4 A;  1UI8 A;  2KAA A;  1PY3 A;  1VQQ A;  3NHX A;  3SED A;  1EA2 A;  1M9G A;  3JUM A;  3NBR A;  1IDP A;  1SII A;  1A67 A;  2HOH A;  3RGR A;  3G4S 3;  1V58 A;  4IIA A;  2QEX 3;  4AKZ A;  3NUV A;  4KVH A;  4KZ1 A;  4WFO A;  3SXX A;  5RNT A;  1BRI A;  1UGI A;  2STD A;  1RGF A;  2OQE A;  2QA4 3;  5TGN A;  1O7N B;  1VQN 3;  1RGK A;  1GY6 A;  2JDI H;  4K90 B;  1BSE A;  3PZW A;  4CDL A;  1MWR A;  1Q40 A;  4MMX B;  1W4N A;  3CXC 2;  1YHQ 3;  3DXO A;  3FKA A;  3LTC A;  2OOV A;  1I0V A;  5HGR A;  4R9K A;  2KXG A;  3D79 A;  4FCJ A;  4GSP A;  5STD A;  3T8U A;  4FCZ A;  3L0R A;  1YJN 3;  4WHA A;  3NXJ A;  1YJ9 3;  1UGH I;  4Q53 A;  4HVN A;  3S67 A;  3WMD A;  1UCK A;  2CFG A;  2WGO A;  4O3V A;  1RMS A;  1T2H A;  4O02 B;  4BTW A;  1W2B 2;  1LQG C;  1SAR A;  2L1S A;  3UB1 A;  3A76 A;  2CH9 A;  3UNL A;  2F56 A;  1N8Q A;  3GZR A;  4L7K A;  1N5P A;  2IUK A;  3CU3 A;  4N3V A;  1SIH A;  5IEO A;  3HX8 A;  3X41 A;  1ISK A;  5A0O B;  1RRL A;  1EEJ A;  3MG1 A;  1OHO A;  3OWS A;  4JF8 A;  4OUQ A;  3WOF B;  8RNT A;  3AHS A;  3CCS 3;  3NQY A;  3EJV A;  1BSA A;  3HZP A;  6RNT A;  4X2O A;  4N6L A;  1BNJ A;  3EHC A;  4MEI A;  4BU4 A;  2AAD A;  1KD1 4;  4HM6 B;  2ML5 A;  1LXE A;  4FCM A;  4CJN A;  1IQY A;  2WOF A;  3F8H A;  1BRN L;  3DGY A;  2FXT A;  4LSO A;  3O8Y A;  3I56 3;  4FMC A;  3CCM 3;  4WP5 A;  3OWY A;  1TIJ A;  3MHE A;  4EC6 A;  1DVD A;  1D6Y A;  1RCL A;  1BNR A;  1MNL A;  4EYC A;  5G1L A;  1D6U A;  3DGL A;  1B27 A;  1JJ2 2;  3WA2 X;  1DE3 A;  4K61 A;  2FNQ A;  1RNT A;  3PYJ A;  2W6J H;  3DH2 A;  3GWR A;  4I5Q A;  2M7O A;  3GZX B;  8CHO A;  4BL2 A;  3JUO A;  2YX9 A;  5EEO A;  3GAX A;  1RNB A;  2E2T A;  2MF7 A;  1RN4 A;  3S27 A;  1Q40 B;  4J5G A;  3HIG A;  1E97 A;  1CYV A;  3EQQ B;  4FMD A;  1VQO 3;  3KSP A;  4NHF A;  1YIJ 3;  1I0X A;  1V74 A;  1U8C B;  3S29 A;  2F5W A;  2WGQ A;  1W7C A;  1FUS A;  1A90 A;  1ZX2 A;  1FGM A;  3MSO A;  4AKY A;  5JPU A;  1Q9E A;  1RGG A;  3K5T A;  2MC8 A;  1ZS7 A;  3EX9 A;  1OH0 A;  1YVB I;  2XF3 A;  3NBB A;  1QMA A;  4IPB A;  3UL5 A;  1I3F A;  1UCL A;  1N5H A;  3Q1C A;  1W02 A;  3DGO A;  3FH1 A;  4I4K A;  5AEW B;  1QJG A;  2IY2 A;  1JRQ A;  3AGO A;  2P0M A;  3D4A A;  7RNT A;  4QWT A;  1RSN A;  4ORL A;  1M1K 4;  2W9P A;  1YI2 3;  4FMB A;  3KFQ C;  4EBG A;  3EC9 A;  3DY5 A;  1W6Y A;  4BTX A;  4ZM8 A;  3FZW A;  4OK0 A;  1AQZ A;  1JKG A;  2W0Q A;  2XGN A;  3B4P A;  1IU7 A;  2RSX A;  4HYZ A;  1QAK A;  3LTB A;  3MG2 A;  5CXO A;  1HU9 A;  5AEU B;  2R4I A;  1RLS A;  2Y74 A;  2CWT A;  5CLK A;  3X42 A;  1BSD A;  5M19 A;  2XH9 A;  1BRG A;  1NB3 I;  2KF5 A;  2RCD A;  2CC3 A;  4HZB B;  3CCR 3;  1GY5 A;  1BSC A;  1GY7 A;  3B4O A;  1TTO A;  1BNS A;  2SAR A;  4PEJ A;  2Z7A A;  1I2G A;  2H0G A;  3EE1 A;  1ASK A;  3FF0 A;  1RKY A;  1IVV A;  4LZI A;  2UGI A;  3MWZ A;  1QAL A;  4TX4 A;  3SLU A;  1KQS 2;  5D82 A;  4JRF A;  3CCQ 3;  2C11 A;  1C7H A;  5DRV A;  3GSP A;  2INX A;  3NM2 A;  3I55 3;  3I0Y A;  1IVX A;  3WOD G;  3PCS A;  1AY7 A;  3ZG5 A;  5BXQ A;  1UI7 A;  2QIY A;  1FA3 A;  2IYJ A;  3T0U A;  5CK6 A;  1NB5 I;  4XDW A;  1GD4 A;  4N6U A;  3KKG A;  3HOH A;  3OWU A;  3VSY A;  1BOX A;  1I3I A;  3F7S A;  1V57 A;  3EBT A;  2W04 A;  1GOU A;  1IQX A;  1FUW A;  4HM7 B;  3CMA 3;  4U13 A;  1RDS A;  3LYG A;  5EQL A;  2KF4 A;  5JBS A;  2H0I A;  3D9R A;  3EN8 A;  3KCH A;  1TUH A;  1VQP 3;  2ZDJ A;  1B2Z A;  1FGQ A;  1UCI A;  5KP3 A;  3CC2 3;  5G1K A;  1JN5 A;  1PYL A;  2KF3 A;  3BIR A;  3G0K A;  3NX0 A;  1VQM 3;  1OF5 A;  3K9M C;  2IA7 A;  1YGE A;  3AHW A;  3S5C A;  2GBX B;  3JUN A;  1SPU A;  1JKG B;  2XSO B;  1YJW 3;  1STD A;  2B24 B;  1D6Z A;  1O7W B;  3OX9 A;  1YGW A;  5IG5 A;  1SQW A;  3JUQ A;  1QVG 2;  3EF8 A;  1NJI 4;  1BNI A;  1YIT 3;  2V1L A;  1TRP A;  3PCR A;  1I2E A;  1TFK A;  1TU5 A;  1BIR A;  1FGO A;  1S72 3;  1T3B A;  1W6C A;  2K54 A;  2P0X A;  1HYF A;  4GL6 A;  1FUT A;  3N9H A;  1BRS A;  2E2U A;  2RFR A;  1IQ8 A;  5IG0 A;  1JZO A;  2LYX A;  2H0H A;  1LOW A;  5IER A;  1LOV A;  5BVB A;  1N8R 4;  1K8A 4;  4R4K A;  1BNG A;  3NM7 A;  5ELU A;  4X2H A;  3DMC A;  3TDG A;  1QVF 2;  1IYY A;  1EUI C;  4KFD A;  2PNC A;  1F8N A;  3N8B A;  3IJE B;  1RJO A;  5D83 A;  1RGA A;  3M8C A;  3FF2 A;  4RNZ A;  1YNV X;  2CHC A;  1ZGX A;  2ZHX B;  4KFE A;  1JB5 A;  4RNT A;  5ELJ A;  5M18 A;  1BGS A;  1GMR A;  9RNT A;  1JBR A;  3GRD A;  1CQS A;  2IUJ A;  5BIR A;  5CF2 A;  3LT8 A;  4XB5 A;  1O7P B;  2BHM A;  4R9L A;  2RNT A;  4L8P A;  1CYU A;  1ROV A;  3FSD A;  5IW9 A;  1NU3 A;  2GU3 A;  1A2P A;  1OUN A;  5KP4 A;  1JNQ A;  1Z1S A;  1JN5 B;  1UUV B;  1OCV A;  1OF5 B;  3CME 3;  3MG3 A;  2WO0 A;  2B1X B;  4J9A A;  3UL6 A;  1RGH A;  3T8N A;  5BU4 A;  2L4V A;  2CFK A;  3K0Z A;  5IEP A;  1VQ7 3;  1VQ4 3;  2ZA4 A;  4BTY A;  5AYS C;  1GD3 A;  1RGC A;  1B3S A;  1BNE A;  1LVN A;  4WYK A;  2C10 A;  1Q86 4;  2OWP A;  3CCU 3;  4N6T A;  1NO3 A;  3NQZ A;  2K0M A;  1JV2 B;  2P05 A;  3G6E 3;  2Q07 A; 
#chains in the Genus database with same CATH homology
 2XGL A;  1R4C A;  1VQ6 3;  1WQL B;  2E2V A;  3FG4 A;  5EVH A;  5FGO A;  4EV5 A;  2D1W A;  4MJD A;  3DM8 A;  2XEP A;  3B7C A;  2CKF B;  4EV2 A;  3J7Y d;  3DUK A;  3F7X A;  4GB5 A;  4KFF A;  4N6O B;  4XBT A;  3IPT A;  3STD A;  3ALA A;  2ZL8 A;  2YFL B;  4RNY A;  3V98 A;  1VQL 3;  1VQK 3;  2BO9 B;  3BLZ A;  1M90 4;  1STF I;  4IT7 A;  5AYR B;  2ML6 A;  2W2C A;  3N54 B;  3SVA A;  1MOL A;  2CFL A;  2F86 B;  3H3H A;  5DRE A;  2OTL 3;  1A2K A;  3MPH A;  2P38 A;  1KC8 4;  1US1 A;  2XSH B;  3KN4 A;  1RN7 A;  2OQE C;  3LXU X;  4XM4 A;  2CG0 A;  1AVK A;  3FG3 A;  2HMK B;  4R80 A;  4HM4 B;  1Q42 A;  3BB9 A;  2CWU A;  5D81 A;  3BNC A;  1IV7 A;  4K1V A;  2OOV C;  4H61 A;  2LQV A;  2PZV A;  1EQK A;  4XBX A;  3X3Y A;  2XFS A;  3AMO A;  5AII A;  3NBJ A;  3SOY A;  4EXR A;  2IMJ A;  1E3V A;  2F99 A;  3F9S A;  4AEQ A;  1DVC A;  2Y73 A;  5I97 A;  4WYK B;  3PXM A;  3G16 A;  4N6V 0;  3CD6 3;  3FCS B;  5LC7 A;  2HMM B;  2P09 A;  2I9W A;  2YFI B;  3D3L A;  4HZ9 B;  2CFW A;  1WMN A;  1KWI A;  1DMM A;  1OHS A;  3IMA B;  4HM1 B;  1GYB A;  1PFP A;  2A15 A;  3LT9 A;  1TFO A;  3HII A;  2HMN B;  2CIU A;  2HMJ B;  3X40 A;  1PU4 A;  1T5Y A;  2GEY A;  3OV4 A;  4HJL B;  3G71 3;  1AR0 A;  3F8X A;  2Z6B A;  4FR9 A;  1AVL A;  1CEW I;  3LTA A;  5G2G A;  3X3X A;  4H3U A;  3CCV 3;  2HMO B;  1ROA A;  2KRT A;  3S28 A;  1L5G B;  1M1X B;  2UX0 A;  1IK3 A;  1K28 A;  5AIH A;  3F40 A;  1QAF A;  3CCE 3;  1S5A A;  2W56 A;  1W5Z A;  3RGA A;  2YFJ B;  3LTD A;  1LNH A;  1K9M 4;  7STD A;  1UUW B;  3JVC A;  5AIF A;  1OHP A;  2W9Q A;  1Q7Y 4;  4OVM A;  3CPW 2;  2Z76 A;  3AMO B;  3HK4 A;  5LC6 A;  3H51 A;  2CW9 A;  3FLJ A;  3CCJ 3;  2FGT A;  1O7H B;  3ECF A;  2BMO B;  4O8S A;  3WA3 A;  3PS8 A;  5AIG A;  2SBL A;  4RZM A;  3K7C A;  3ROB A;  4MMZ B;  1GS3 A;  5CF1 A;  4G1M B;  4N6N B;  2OTJ 3;  1O7M B;  5IEN A;  2CG1 A;  4LGQ A;  1EG9 B;  1OPY A;  3NV0 A;  3CNX A;  4FMA A;  3QRD A;  1N9E A;  1SJW A;  3FGY A;  1VZZ A;  4HM2 B;  1K73 4;  1W00 A;  1WTH A;  4HBR A;  4HM5 B;  1NDO B;  3SOA A;  1A2V A;  2WOH A;  4RBN A;  1HKX A;  3G8Z A;  1WMO A;  3BNB A;  1W6G A;  5IG3 A;  5JPP A;  3X3Z A;  5AI1 A;  1TP6 A;  2QGU A;  3F14 A;  1LOX A;  1OAC A;  3KZT A;  2O9U X;  3MYT A;  3VGN A;  2XR8 B;  1BUQ A;  1VQ8 3;  4K1U A;  2RGQ A;  2W56 B;  1EKM A;  1NWW A;  3E99 A;  3KE7 A;  2XRX B;  3MKI A;  1JB4 A;  1O7G B;  4CCV A;  4HM8 B;  1K41 A;  3HI7 A;  3DGN A;  2HML B;  3DGM A;  2W03 A;  3VF1 A;  3SX1 A;  2GEX A;  3EN1 B;  5IF6 A;  1IT7 A;  1IV9 A;  2CWV A;  3V99 A;  3GZY B;  1DMN A;  1ULI B;  1G96 A;  4HM3 B;  1E3R A;  4XDV A;  3U97 A;  4R1K A;  3BNE A;  3FG1 A;  1KSI A;  2OCT A;  2F98 A;  3LML A;  3LOY A;  3CC4 3;  1DYU A;  3LZA A;  4LMI A;  1ZO2 A;  1VQ9 3;  4STD A;  3RDE A;  3WDG B;  2BNG A;  3WOE B;  1JB2 A;  1DMQ A;  3NV0 B;  1RRH A;  3CPO A;  1N9J A;  1W01 A;  2GU1 A;  1FGR A;  3JUP A;  3KII A;  1OGZ A;  2O3O A;  3OW2 2;  3V92 A;  2GXF A;  6STD A;  1UW1 A;  3GZB A;  4HM0 B;  4NRE A;  5IG4 A;  3Q2P A;  4HKV B;  3DZL A;  4L8O A;  1IVU A;  5JPU A;  1Y4K A;  4LEH A;  2Z77 A;  3KSE D;  2CFD A;  1IVW A;  3OXA A;  3PGB A;  1U5O A;  3EB8 A;  4J8T A;  5KP1 A;  1J2B A;  2D42 A;  2JQ5 A;  1Q81 4;  2BMQ B;  1WNH A;  3Q90 A;  1W2Z A;  1FGT A;  2CK3 H;  3LH4 A;  3QK9 A;  3CCL 3;  4O2H A;  3CNM A;  3ER7 A;  4MMY B;  5FW5 A;  1IT8 A;  3U1W A;  2GBW B;  4XBY A;  3K63 A;  1Q82 4;  1VQ5 3;  1AV4 A;  3B8L A;  3UJM A;  1OGX A;  2XFT A;  2BMR B;  2KCD A;  3EBY A;  3CC7 3;  4N6M A;  1ULJ B;  1WMP A;  2BT3 A;  4WWU C;  3BND A;  1UI8 A;  3NHX A;  3SED A;  1EA2 A;  1M9G A;  3JUM A;  3NBR A;  1IDP A;  1SII A;  1A67 A;  3RGR A;  3G4S 3;  4IIA A;  2QEX 3;  4AKZ A;  3NUV A;  4KVH A;  4KZ1 A;  4WFO A;  3SXX A;  2STD A;  2OQE A;  2QA4 3;  5TGN A;  1O7N B;  1VQN 3;  1GY6 A;  2JDI H;  4K90 B;  3PZW A;  4CDL A;  1Q40 A;  4MMX B;  1YHQ 3;  1W4N A;  3CXC 2;  3DXO A;  3FKA A;  3LTC A;  2OOV A;  5HGR A;  4R9K A;  2KXG A;  4FCJ A;  5STD A;  3T8U A;  4FCZ A;  3L0R A;  1YJN 3;  4WHA A;  3NXJ A;  1YJ9 3;  4Q53 A;  4HVN A;  3S67 A;  3WMD A;  2WGO A;  2CFG A;  4O3V A;  4O02 B;  4BTW A;  1W2B 2;  3UB1 A;  3A76 A;  2CH9 A;  3UNL A;  1N8Q A;  3GZR A;  4L7K A;  1N5P A;  2IUK A;  3CU3 A;  4N3V A;  1SIH A;  5IEO A;  3HX8 A;  3X41 A;  1ISK A;  5A0O B;  1RRL A;  3MG1 A;  1OHO A;  3OWS A;  4JF8 A;  4OUQ A;  3WOF B;  3CCS 3;  3NQY A;  3EJV A;  3HZP A;  4X2O A;  4N6L A;  3EHC A;  4MEI A;  1KD1 4;  4HM6 B;  2ML5 A;  1LXE A;  4FCM A;  1IQY A;  2WOF A;  3F8H A;  4LSO A;  2FXT A;  3O8Y A;  3I56 3;  4FMC A;  3CCM 3;  4WP5 A;  3OWY A;  1TIJ A;  3MHE A;  4EC6 A;  1DVD A;  1D6Y A;  1MNL A;  4EYC A;  1D6U A;  3DGL A;  1JJ2 2;  3WA2 X;  4K61 A;  2FNQ A;  3PYJ A;  2W6J H;  3GWR A;  2M7O A;  3GZX B;  8CHO A;  3JUO A;  2YX9 A;  5EEO A;  3GAX A;  2MF7 A;  2E2T A;  3S27 A;  1Q40 B;  3HIG A;  1E97 A;  1CYV A;  3EQQ B;  4FMD A;  1VQO 3;  3KSP A;  4NHF A;  1YIJ 3;  1V74 A;  1U8C B;  3S29 A;  2WGQ A;  1W7C A;  1A90 A;  1ZX2 A;  1FGM A;  3MSO A;  4AKY A;  3K5T A;  2MC8 A;  3EX9 A;  1OH0 A;  1YVB I;  2XF3 A;  3NBB A;  1QMA A;  4IPB A;  3UL5 A;  1N5H A;  3Q1C A;  1W02 A;  3DGO A;  3FH1 A;  4I4K A;  5AEW B;  1QJG A;  1JRQ A;  2P0M A;  4QWT A;  4ORL A;  1M1K 4;  2W9P A;  1YI2 3;  4FMB A;  3KFQ C;  4EBG A;  3EC9 A;  3DY5 A;  1W6Y A;  4BTX A;  4ZM8 A;  3FZW A;  4OK0 A;  1JKG A;  2W0Q A;  3B4P A;  2XGN A;  4HYZ A;  1IU7 A;  2RSX A;  1QAK A;  3LTB A;  3MG2 A;  5CXO A;  1HU9 A;  5AEU B;  2R4I A;  5CLK A;  2Y74 A;  2CWT A;  3X42 A;  2XH9 A;  1NB3 I;  2RCD A;  3CCR 3;  2CC3 A;  4HZB B;  1GY5 A;  1GY7 A;  3B4O A;  4PEJ A;  2Z7A A;  1RKY A;  3EE1 A;  1ASK A;  3FF0 A;  1IVV A;  4LZI A;  3SLU A;  3MWZ A;  1QAL A;  4TX4 A;  1KQS 2;  5D82 A;  4JRF A;  3CCQ 3;  2C11 A;  1C7H A;  5DRV A;  3NM2 A;  2INX A;  3I55 3;  3I0Y A;  1IVX A;  3WOD G;  3PCS A;  5BXQ A;  1UI7 A;  2QIY A;  1FA3 A;  3T0U A;  5CK6 A;  1NB5 I;  4XDW A;  1GD4 A;  4N6U A;  3KKG A;  3OWU A;  3VSY A;  3F7S A;  3EBT A;  2W04 A;  1IQX A;  1FUW A;  4HM7 B;  3CMA 3;  4U13 A;  3LYG A;  5EQL A;  5JBS A;  3D9R A;  3EN8 A;  1TUH A;  1VQP 3;  2ZDJ A;  1FGQ A;  5KP3 A;  3CC2 3;  1JN5 A;  3G0K A;  1VQM 3;  3NX0 A;  1OF5 A;  3K9M C;  2IA7 A;  1YGE A;  3S5C A;  2GBX B;  3JUN A;  1SPU A;  1JKG B;  2XSO B;  1YJW 3;  1STD A;  2B24 B;  1D6Z A;  1O7W B;  3OX9 A;  5IG5 A;  1SQW A;  3JUQ A;  1QVG 2;  3EF8 A;  1NJI 4;  1YIT 3;  2V1L A;  3PCR A;  1TFK A;  1TU5 A;  1FGO A;  1S72 3;  1W6C A;  2K54 A;  2P0X A;  4GL6 A;  3N9H A;  2E2U A;  2RFR A;  1IQ8 A;  5IG0 A;  2LYX A;  5IER A;  1N8R 4;  5BVB A;  1K8A 4;  4R4K A;  3NM7 A;  5ELU A;  4X2H A;  3DMC A;  3TDG A;  1QVF 2;  4KFD A;  2PNC A;  1F8N A;  3N8B A;  3IJE B;  1RJO A;  5D83 A;  3M8C A;  3FF2 A;  4RNZ A;  2CHC A;  5ELJ A;  4KFE A;  1JB5 A;  3GRD A;  1CQS A;  2IUJ A;  5CF2 A;  3LT8 A;  4XB5 A;  1O7P B;  2BHM A;  4R9L A;  4L8P A;  1CYU A;  1ROV A;  3FSD A;  5IW9 A;  1NU3 A;  2GU3 A;  1OUN A;  5KP4 A;  1JNQ A;  1Z1S A;  1JN5 B;  1UUV B;  1OCV A;  1OF5 B;  3CME 3;  3MG3 A;  2WO0 A;  2B1X B;  4J9A A;  3UL6 A;  3T8N A;  2L4V A;  2CFK A;  3K0Z A;  5IEP A;  1VQ7 3;  1VQ4 3;  4BTY A;  5AYS C;  1GD3 A;  1LVN A;  4WYK A;  2C10 A;  1Q86 4;  2OWP A;  3CCU 3;  4N6T A;  1NO3 A;  3NQZ A;  2K0M A;  1JV2 B;  2P05 A;  3G6E 3;  2Q07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...