4HBRA

Crystal structure of a putative periplasmic proteins (bacegg_01429) from bacteroides eggerthii dsm 20697 at 2.40 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
GGYAPDSVQIALKKMYPTAAGIAWSQDKAYYVADFVMNGFDTRVWFTPDAEWVMKQTDWETLDEVPAAVFNAFAASEFSDGVVQNVTWVQFPEWQPIVAIQVGKPNMQMKYQILFTPKGEVLRQQNITNAYNTLGASTFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative periplasmic protein
publication title Crystal structure of a putative periplasmic proteins (BACEGG_01429) from Bacteroides eggerthii DSM 20697 at 2.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Structural genomics, unknown function
total genus 27
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hbrA00
4K61A 3U1WA 4FR9A 4HBRA 4IPBA
chains in the Genus database with same CATH superfamily
5IW9A 1VQ83 3D5IA 1IV9A 3AMOB 1JBRA 4EXRA 2I9WA 1W01A 1GOUA 1OGZA 4HM4B 1RGGA 4HYZA 1N8R4 1PY3A 2JQ5A 1KQS2 1STDA 2W9PA 1K28A 3ROBA 5CXOA 3SX1A 2WOHA 5ELJA 2KF3A 5AEWB 3F8HA 1L5GB 4WFOA 3UNLA 1AVLA 1RNTA 1FUTA 1Z1SA 2H0HA 1LOVA 3KFQC 2WGQA 4HM7B 1VQ93 1GMQA 1IVVA 3FF0A 1US1A 2ZDJA 3B7CA 2HMNB 3SEDA 1JKGA 2BO9B 4O2HA 1IK3A 2GU3A 6GSPA 4R9KA 2P0MA 2INXA 1Q42A 2IA7A 4FMDA 5CLKA 2OOVA 2P38A 4N6UA 4RNYA 3H3HA 3VSYA 3MPHA 2WGOA 5IF6A 3WHOA 3G8ZA 1DMNA 1B20A 4GSPA 2F56A 2KRTA 1QJGA 4N6NB 1W6YA 4L7KA 2XFTA 3LXUX 3EJVA 2BT3A 3KIIA 1GD3A 2GBXB 3CU3A 1Q814 1NDOB 3LMLA 1BSCA 3B4OA 1N9JA 3F40A 3ALAA 2GEYA 3I0YA 2E2VA 2PNCA 2QGUA 1IDPA 2W56A 3JUNA 4FMCA 1O7GB 2SBLA 4XB5A 3U97A 1EQKA 4XDWA 1IT7A 1QMAA 3AMOA 5HGRA 5IEOA 1FA3A 3N8BA 3CC73 3CC43 1W6GA 2L1SA 1LOWA 4N6LA 1DE3A 5IERA 3STDA 1BIRA 3UL5A 3VF1A 4ORLA 1N9EA 1GY7A 1D6ZA 1NO3A 3PCRA 1K41A 2CFDA 3AGOA 3NXJA 1RJOA 3BNBA 2W2CA 4GL6A 2P05A 5AYSC 2OTL3 1AVKA 1BNSA 2ML6A 4G1MB 1BSEA 4XBXA 4JRFA 2AAEA 2UUGC 2GU1A 4KFEA 2E2TA 1PFPA 1RNBA 1E3VA 1A2KA 2F4YA 5DREA 1A90A 5IENA 3N9HA 1BNJA 2BU4A 1RN4A 1TFOA 2O3OA 1JN5B 1WMOA 1ULJB 2CWVA 3K5TA 4LGQA 1BUQA 7STDA 3SOAA 2W03A 1OHSA 4WHAA 1VQM3 1BANA 3FLJA 4RNTA 4LSOA 1BRKA 4IPBA 1TIJA 1I70A 1UUVB 1SIHA 5AIGA 3GZBA 1IVWA 2B1XB 3DMCA 5LC6A 5AIHA 3UB1A 1HYFA 3OWYA 1I2GA 2CFLA 2ZL8A 1IT8A 3NQYA 3EBTA 3S5CA 1DMQA 4H3UA 4CJNA 3ZFZA 1BAOA 1BRGA 1W00A 2BNGA 5CF1A 1PYLA 1BNIA 1RDSA 3PGBA 1IV7A 3SOYA 3CCE3 1I0XA 1GY5A 1UGHI 3X42A 2WO0A 3MKIA 3JVCA 1I2EA 4BTYA 3CCR3 2FNQA 3I563 1VQ53 3CNMA 1FUSA 2CWTA 4MMZB 3EN8A 1X1YA 2CG0A 4EW5A 5AIIA 4HM6B 4O02B 1EG9B 1YJN3 1RGFA 1Y4KA 4O8SA 4EYCA 4AKZA 3DXOA 1TU5A 4ILFA 3JUQA 1VQK3 4RZMA 3EHCA 4FCZA 3DUKA 1NWWA 1QVG2 3LYGA 3Q3FA 1LQGC 3DM8A 3DGOA 1E97A 1DMMA 3BNCA 3WA3A 4KT3B 2MC8A 1N5HA 1ZO2A 3FH1A 1W2B2 1S5AA 3S28A 2W04A 1JN5A 2RNTA 1IQ8A 4L8PA 5KP4A 1O7PB 1V58A 1X1XA 3CD63 1MWRA 2V1LA 2LYXA 7GSPA 1Q7Y4 2HMLB 1VQO3 5G1KA 1IYYA 1EA2A 3DGLA 4JF8A 5TGNA 3X3XA 1O7HB 4K61A 4OVMA 3X3YA 1C54A 1FYSA 5G2GA 1D6YA 2YFIB 3EBYA 4N3VA 2K0MA 3K0ZA 3D3LA 3NQZA 1V74A 2RCDA 1LQMB 2F5MA 3KCHA 5DRVA 1JRQA 1JV2B 1NB5I 7RNTA 1UUWB 2PZVA 5EEOA 1JZOA 3T8NA 3GSPA 1BUJA 1PU4A 2K54A 6STDA 1FGRA 3A5EA 2BHMA 1BGSA 6RNTA 4HZBB 3CNXA 1BU4A 2W6JH 3TDGA 1VQ43 4K1VA 3V99A 1BNFA 1TP6A 2C11A 1RN7A 1W4NA 1O7WB 3X40A 3CME3 5AIFA 4BU4A 5D82A 2KF5A 2IY2A 4OK0A 3F9SA 4U13A 5LC7A 3T0UA 1SJWA 1HKXA 2Z7AA 1K9M4 1F8NA 1RMSA 5G1LA 2QEX3 1I3IA 1ASKA 2XEPA 2XSHB 1BRHA 4N6TA 5M1AA 2IUJA 5BIRA 2KCDA 1TUHA 2BIRA 1MWSA 3PCSA 3D5GA 4BIRA 1JB5A 1SPUA 1YVBI 2XFSA 1YGWA 4O3VA 1B2MA 1RGHA 3GZYB 5M18A 2F99A 4EBGA 1K734 4HM0B 2CX0A 2L4VA 3X3ZA 1YI23 3FKAA 5AYRB 1T3BA 1GS3A 3ER7A 4CDLA 1FZUA 1TTOA 5M19A 3F14A 1M904 1VQN3 1FW7A 3G713 1GOVA 2SARA 1G0TA 3FG4A 4KZ1A 5BVBA 3M8CA 8CHOA 3IJEB 8RNTA 3OWSA 3MHEA 5RNTA 4GHOA 1BRNL 1OACA 3KE7A 1AR0A 4CPKA 2KAAA 1T2HA 3RGAA 3BNEA 1QVF2 2CFKA 2XSOB 1UCJA 3JUOA 4HM2B 4RNZA 1KD14 3MSOA 3PXMA 3BB9A 5KP3A 3I553 2Z76A 1VZZA 1DETA 2QIYA 2AADA 2GXFA 3BIRA 3CCV3 1YIJ3 3OW22 3G6E3 3WMDA 2KF6A 5IG4A 2C10A 5JPUA 2XF3A 4I4KA 3DGMA 5JPPA 5A0OB 4HVNA 3EB8A 1V57A 1BSAA 1LOXA 3K63A 4HM1B 1JBSA 2LQVA 1EUIC 1M1XB 3GRDA 1UCLA 1W2ZA 1RGEA 3X41A 1G02A 2XR8B 1CYVA 3SLUA 1ROAA 2UX0A 5BU4A 3D9RA 1I3FA 2GEXA 3S27A 1MGRA 4BL2A 5JBSA 4HBRA 3V92A 1WMPA 4X2OA 3HZPA 1B2SA 2M7OA 5FW5A 1RRLA 2D1WA 1VQL3 3G0KA 1A2VA 1MOLA 4MMYB 5CK6A 5CF2A 4R80A 3DZLA 1IQXA 1KWIA 3FZWA 3KKGA 1K8A4 2CC3A 4MEIA 1VQ73 1WTHA 2RSXA 5IG0A 3UL6A 1R4CA 3OXAA 1LVNA 3V98A 1RGLA 2F5WA 2FGTA 1LOYA 2W0QA 3GAXA 3LZAA 4EC6A 3Q1CA 1X1WA 4RBNA 2YFLB 1IQYA 1GYBA 1J2BA 1Q40B 2B24B 3LT8A 1OGXA 3B8LA 1EKMA 1RN1A 1NB3I 1BNEA 3WR2A 4FCJA 1BOXA 4HAAA 4IT7A 4NHFA 3H51A 5HOHA 1YJW3 3DGNA 1BNGA 1QAKA 2F86B 3RDEA 2R4IA 3HX8A 4XDVA 2ML5A 3KSPA 4FMBA 3J7Yd 1UCKA 2F98A 1UGIA 3SVAA 1Q9EA 4FMAA 3F8XA 1RCLA 1MWTA 2H0IA 2RGQA 3B4PA 4XBTA 4CCVA 2HMKB 5EQLA 1LNHA 1M1K4 1TFKA 2XH9A 4WWUC 1FGMA 3OWUA 4LYLB 5ELUA 3WODG 3MYTA 1LXEA 3WOEB 2K3DA 1FUWA 1UI7A 2HMJB 1I2FA 3NM7A 1HU9A 4X2HA 1YIT3 3MWZA 1N5PA 4K90B 4MJDA 3UJMA 3ZG5A 1BNRA 3AHSA 5AI1A 1QAFA 2C4BA 4FR9A 4MMXB 1LNIA 3NM2A 2CKFB 2Q07A 2XGNA 4N6OB 4HM8B 1T2IA 2ZHXB 4J5GA 1GMRA 3GZRA 1ISKA 1T5YA 1AV4A 1M9GA 4AKYA 1D6UA 3FGYA 4IIAA 1BRJA 3MG2A 3LTCA 3E99A 3QK9A 3URPA 3ECFA 1B2UA 4NREA 3EF8A 1YJ93 1Q40A 4HKVB 4R1KA 1BRSA 3HI7A 1KSIA 3PS8A 1UDII 4N6V0 4NPBA 3G4S3 3NX0A 3CCS3 1IU7A 2P09A 1O7MB 2GSPA 2UGIA 1W5ZA 3MG3A 3U1WA 4HM3B 2Y73A 1Q824 1O7NB 3HIIA 1OF5B 3KN4A 3LOYA 2BMQB 3Q90A 3DGYA 1JB4A 1SIIA 3BNDA 3OV4A 3CCJ3 1TRQA 3FSDA 3PZWA 3WOFB 1AQZA 1RLSA 1CQSA 3DY5A 1CEWI 1IVUA 3D4AA 1OHPA 3BLZA 1B27A 4DKIA 1HZ1A 1UUGB 2IYJA 3T8UA 1W6CA 3CXC2 4STDA 1TJDA 1ZX2A 3IPTA 4LZIA 1RCKA 3VGNA 1YNVX 1AY7A 4L8OA 4QWTA 3NV0B 3CPW2 3A76A 3DH2A 4J5KA 2QA43 5FGOA 2STDA 1MNLA 2D42A 1GD4A 3FCSB 1OPYA 3FG3A 4BL3A 1DVDA 1RGAA 3O8YA 2Z6BA 1JNQA 1YHQ3 3WDGB 3RNTA 5IG3A 3CCQ3 3HOHA 3CMA3 1CH0A 2WOFA 1CYUA 2A15A 1OHOA 3L0RA 2OTJ3 1SQWA 2CX1A 2CFGA 1VQP3 1NNVA 4AEQA 3S29A 3CCL3 5IG5A 1A67A 3KZTA 1EEJA 1VQQA 3N54B 3PYJA 1WNHA 9RNTA 2RBIA 5IEPA 1U5OA 2E2UA 2W9QA 2HMMB 2YFJB 4KFFA 3LTBA 3NBRA 4XBYA 4EV5A 1BRIA 3NHXA 1S723 3GWRA 3HIGA 3NUVA 4WP5A 2OQEA 2CH9A 3CPOA 3LH4A 1OF5A 2Z77A 1B2XA 4OUQA 4H61A 4HOHA 4FCMA 1RHLA 2CW9A 1G96A 1SARA 1FGOA 2GBWB 1RGKA 2FXTA 1X1UA 4HJLB 3SXXA 3HK4A 4LMIA 1E3RA 2XRXB 3EC9A 4I5QA 2XGLA 1STFI 1BVIA 3F7XA 2CWUA 2IUKA 3NV0A 1ULIB 4J8TA 1JZDA 2KXGA 5D83A 1BSDA 1NJI4 1GMPA 1WMNA 2J8XB 5D81A 1RKYA 3G16A 3FF2A 4WYKB 1OCVA 1R4YA 1WQLB 3LT9A 3ZG0A 1DVCA 1TRPA 4BTXA 1GY6A 1UI8A 2R41A 3AGNA 3GZXB 5BXQA 2YX9A 1JBTA 1DYUA 3EQQB 1N8QA 2CFWA 2MF7A 3SYUA 1GOYA 2OCTA 5KP1A 3CC23 2BMRB 4K1UA 1I8VA 2P0XA 3Q2PA 1IVXA 3JUMA 3LTDA 4KVHA 2O9UX 1GSPA 1OH0A 4TX4A 3EX9A 1YGEA 1I0VA 3K7CA 3BU4A 3WA2X 5I97A 4PEJA 2OOVC 3MG1A 1OUNA 3D79A 2HOHA 3KSED 4Q53A 1B3SA 1ROVA 1Q864 1ZGXA 2JDIH 3NBJA 3NBBA 1W7CA 4HZ9B 1JB2A 2CK3H 1A2PA 1JKGB 4HM5B 4N6MA 5AEUB 2HMOB 2OWPA 1RSNA 3CCM3 1QALA 2CIUA 1W02A 1FGQA 1MWUA 1RGCA 5GSPA 1VQ63 3K9MC 1JJ22 1RTUA 3RGRA 3IMAB 1Q7HA 3OX9A 1MGWA 1B2ZA 4R9LA 1UW1A 4EV2A 3EN1B 1NU3A 1BSBA 4LEHA 4R4KA 3EE1A 2H0GA 4XM4A 3S67A 1KC84 1C7HA 3CCU3 3LTAA 2CHCA 1RRHA 3QRDA 4BTWA 5STDA 1LRAA 3JUPA 2IMJA 2ZA4A 4WYKA 5EVHA 2OQEC 1FGTA 2KF4A 1B21A 4KFDA 3F7SA 2CG1A 4GB5A 3FG1A 2Y74A 1UCIA 4ZM8A 2BMOB 2W56B 4J9AA 1U8CB 1YVSA 2RFRA 1ZS7A 3AHWA
chains in the Genus database with same CATH topology
5IW9A 1VQ83 1IV9A 3AMOB 4EXRA 2I9WA 1W01A 4HM4B 1OGZA 1N8R4 4HYZA 2JQ5A 1KQS2 1STDA 2W9PA 1K28A 3ROBA 5CXOA 3SX1A 2WOHA 5ELJA 5AEWB 3F8HA 1L5GB 4WFOA 3UNLA 1AVLA 1Z1SA 1VQ93 3KFQC 2WGQA 4HM7B 1IVVA 3FF0A 1US1A 2ZDJA 3B7CA 2HMNB 3SEDA 1JKGA 2BO9B 4O2HA 1IK3A 2GU3A 4R9KA 2P0MA 2INXA 1Q42A 2IA7A 4FMDA 5CLKA 2OOVA 2P38A 4N6UA 4RNYA 3H3HA 3VSYA 3MPHA 2WGOA 5IF6A 3G8ZA 1DMNA 2KRTA 1QJGA 4N6NB 1W6YA 4L7KA 3LXUX 3EJVA 2BT3A 3KIIA 1GD3A 2GBXB 3CU3A 1Q814 1NDOB 3LMLA 3B4OA 1N9JA 3F40A 3ALAA 2GEYA 3I0YA 2E2VA 2PNCA 2QGUA 1IDPA 2W56A 3JUNA 4FMCA 1O7GB 2SBLA 4XB5A 3U97A 1EQKA 4XDWA 1IT7A 1QMAA 3AMOA 5HGRA 5IEOA 1FA3A 3N8BA 3CC73 3CC43 1W6GA 4N6LA 5IERA 3STDA 3VF1A 3UL5A 4ORLA 1N9EA 1GY7A 1D6ZA 1NO3A 3PCRA 1K41A 2CFDA 3NXJA 1RJOA 3BNBA 2W2CA 4GL6A 2P05A 5AYSC 2OTL3 1AVKA 2ML6A 4G1MB 4XBXA 4JRFA 2GU1A 4KFEA 2E2TA 1PFPA 1E3VA 1A2KA 5DREA 1A90A 3N9HA 3K5TA 2O3OA 1W2B2 1TFOA 1JN5B 1WMOA 1ULJB 2CWVA 4LGQA 1BUQA 7STDA 3SOAA 2W03A 1OHSA 4WHAA 1VQM3 3FLJA 4LSOA 4IPBA 1TIJA 1UUVB 1SIHA 5AIGA 3GZBA 1IVWA 2B1XB 3DMCA 5LC6A 5AIHA 3UB1A 3OWYA 2CFLA 2ZL8A 1IT8A 3NQYA 3EBTA 3S5CA 1DMQA 4H3UA 1W00A 2BNGA 5CF1A 3PGBA 1IV7A 3SOYA 3CCE3 1GY5A 3X42A 2WO0A 3MKIA 3JVCA 4BTYA 3CCR3 2FNQA 3I563 1VQ53 3CNMA 2CWTA 4MMZB 3EN8A 2CG0A 5AIIA 4HM6B 4O02B 1EG9B 1YJN3 1Y4KA 4O8SA 1TU5A 4EYCA 4AKZA 3DXOA 3JUQA 1VQK3 4RZMA 3EHCA 4FCZA 3DUKA 1NWWA 1QVG2 3LYGA 3DM8A 3DGOA 1E97A 1DMMA 3BNCA 3WA3A 2MC8A 1N5HA 1ZO2A 3FH1A 1S5AA 3S28A 2W04A 1JN5A 1IQ8A 4L8PA 5KP4A 1O7PB 3CD63 1Q7Y4 2V1LA 2LYXA 2HMLB 1VQO3 1EA2A 3DGLA 4JF8A 5TGNA 3X3XA 1O7HB 4K61A 4OVMA 3X3YA 5G2GA 1D6YA 2YFIB 3EBYA 4N3VA 2K0MA 3K0ZA 3D3LA 3NQZA 1V74A 2RCDA 5DRVA 1JRQA 1JV2B 1NB5I 1UUWB 2PZVA 5EEOA 3T8NA 1PU4A 2K54A 6STDA 1FGRA 2BHMA 4HZBB 3CNXA 1VQ43 2W6JH 3TDGA 4K1VA 3V99A 1TP6A 2C11A 1RN7A 1W4NA 1O7WB 3X40A 3CME3 5AIFA 5D82A 4OK0A 3F9SA 4U13A 5LC7A 3T0UA 1SJWA 1HKXA 2Z7AA 1K9M4 1F8NA 2QEX3 2XEPA 1ASKA 2XSHB 4N6TA 2IUJA 2KCDA 1TUHA 3PCSA 1JB5A 1SPUA 1YVBI 2XFSA 4O3VA 3GZYB 2F99A 4EBGA 1K734 4HM0B 2L4VA 3X3ZA 1YI23 3FKAA 5AYRB 1GS3A 3ER7A 4CDLA 1VQN3 1M904 3F14A 3G713 3FG4A 4KZ1A 5BVBA 3M8CA 8CHOA 3IJEB 3OWSA 3MHEA 1OACA 3KE7A 1AR0A 3RGAA 3BNEA 1QVF2 2CFKA 2XSOB 3JUOA 4HM2B 4RNZA 1KD14 3MSOA 3PXMA 3BB9A 5KP3A 3I553 2Z76A 1VZZA 2QIYA 2GXFA 3CCV3 1YIJ3 3OW22 3G6E3 3WMDA 5IG4A 2C10A 5JPUA 2XF3A 4I4KA 3DGMA 5JPPA 5A0OB 4HVNA 3EB8A 1LOXA 3K63A 4HM1B 2LQVA 1M1XB 3GRDA 1W2ZA 3X41A 3SLUA 2XR8B 1CYVA 1ROAA 2UX0A 3D9RA 2GEXA 3S27A 5JBSA 4HBRA 3V92A 1WMPA 4X2OA 3HZPA 2M7OA 5FW5A 1RRLA 2D1WA 1VQL3 3G0KA 1A2VA 1MOLA 4MMYB 5CK6A 5CF2A 4R80A 3DZLA 1IQXA 1KWIA 3FZWA 3KKGA 1K8A4 2CC3A 4MEIA 1VQ73 1WTHA 2RSXA 5IG0A 3UL6A 1R4CA 3OXAA 1LVNA 3V98A 2FGTA 2W0QA 3GAXA 3LZAA 4EC6A 3Q1CA 4RBNA 2YFLB 1IQYA 1GYBA 1J2BA 1Q40B 2B24B 3LT8A 1OGXA 3B8LA 1EKMA 1NB3I 4FCJA 4IT7A 4NHFA 3H51A 1YJW3 3DGNA 1QAKA 2F86B 3RDEA 2R4IA 3HX8A 4XDVA 2ML5A 3KSPA 4FMBA 3J7Yd 2F98A 3SVAA 4FMAA 3F8XA 2RGQA 3B4PA 4XBTA 4CCVA 2HMKB 5EQLA 1LNHA 1M1K4 1TFKA 2XH9A 4WWUC 1FGMA 3OWUA 5ELUA 3WODG 3MYTA 1LXEA 3WOEB 1FUWA 1UI7A 2HMJB 3NM7A 1YIT3 1HU9A 4X2HA 3MWZA 1N5PA 4K90B 4MJDA 3UJMA 5AI1A 1QAFA 4MMXB 4FR9A 3NM2A 2CKFB 2Q07A 2XGNA 4N6OB 4HM8B 3GZRA 1ISKA 1T5YA 1AV4A 1M9GA 4AKYA 1D6UA 3FGYA 4IIAA 3MG2A 3LTCA 3E99A 3QK9A 3ECFA 4NREA 3EF8A 1YJ93 1Q40A 4HKVB 4R1KA 3HI7A 3G4S3 1KSIA 3PS8A 4N6V0 3NX0A 3CCS3 1IU7A 2P09A 1O7MB 1W5ZA 3MG3A 3U1WA 4HM3B 2Y73A 1Q824 1O7NB 3HIIA 1OF5B 3KN4A 3LOYA 2BMQB 3Q90A 1JB4A 1SIIA 3BNDA 3OV4A 3CCJ3 3FSDA 3PZWA 3WOFB 1CQSA 3DY5A 1CEWI 1IVUA 1OHPA 3BLZA 3T8UA 1W6CA 3CXC2 4STDA 1ZX2A 3IPTA 4LZIA 3VGNA 4L8OA 4QWTA 3NV0B 3CPW2 3A76A 2QA43 5FGOA 2STDA 1MNLA 2D42A 1GD4A 3FCSB 1OPYA 3FG3A 1DVDA 3O8YA 2Z6BA 1JNQA 1YHQ3 3WDGB 5IG3A 3CCQ3 3CMA3 2WOFA 1CYUA 2A15A 1OHOA 3L0RA 2OTJ3 1SQWA 2CFGA 1VQP3 4AEQA 3S29A 3CCL3 5IG5A 1A67A 3KZTA 3N54B 3PYJA 1WNHA 5IEPA 1U5OA 2E2UA 2W9QA 2HMMB 2YFJB 2RFRA 3LTBA 3NBRA 4KFFA 4XBYA 3NHXA 4EV5A 1S723 3GWRA 3HIGA 3NUVA 4WP5A 2OQEA 2CH9A 3CPOA 3LH4A 1OF5A 2Z77A 4OUQA 4H61A 4FCMA 2CW9A 1G96A 1FGOA 2GBWB 2FXTA 4HJLB 3SXXA 3HK4A 4LMIA 1E3RA 2XRXB 3EC9A 2XGLA 1STFI 3F7XA 2CWUA 2IUKA 3NV0A 1ULIB 4J8TA 2KXGA 5D83A 1NJI4 1WMNA 5D81A 1RKYA 3G16A 3FF2A 4WYKB 1OCVA 1WQLB 3LT9A 1DVCA 4BTXA 1GY6A 1UI8A 3GZXB 5BXQA 2YX9A 1DYUA 3EQQB 1N8QA 2CFWA 2MF7A 2OCTA 5KP1A 3CC23 2BMRB 4K1UA 2P0XA 3Q2PA 1IVXA 3JUMA 3LTDA 4KVHA 2O9UX 4TX4A 1OH0A 3EX9A 1YGEA 3K7CA 3WA2X 5I97A 4PEJA 2OOVC 3MG1A 1OUNA 3KSED 4Q53A 1Q864 1ROVA 2JDIH 3NBJA 3NBBA 1W7CA 4HZ9B 1JB2A 2CK3H 4N6MA 1JKGB 4HM5B 5AEUB 5IENA 2HMOB 2OWPA 3CCM3 1QALA 2CIUA 1W02A 1FGQA 1VQ63 3K9MC 1JJ22 3RGRA 3IMAB 3OX9A 1UW1A 4EV2A 3EN1B 1NU3A 4LEHA 4R4KA 3EE1A 4XM4A 3S67A 1KC84 1C7HA 3CCU3 3LTAA 2CHCA 1RRHA 3QRDA 4BTWA 5STDA 3JUPA 2IMJA 4WYKA 5EVHA 2OQEC 1FGTA 4KFDA 3F7SA 2CG1A 4GB5A 3FG1A 2Y74A 4ZM8A 2BMOB 2W56B 4J9AA 1U8CB 4R9LA 2XFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K61 A;  3U1W A;  4FR9 A;  4HBR A;  4IPB A; 
#chains in the Genus database with same CATH topology
 5IW9 A;  1VQ8 3;  3D5I A;  1IV9 A;  3AMO B;  1JBR A;  4EXR A;  2I9W A;  1W01 A;  1GOU A;  1OGZ A;  4HM4 B;  1RGG A;  4HYZ A;  1N8R 4;  1PY3 A;  2JQ5 A;  1KQS 2;  1STD A;  2W9P A;  1K28 A;  3ROB A;  5CXO A;  3SX1 A;  2WOH A;  5ELJ A;  2KF3 A;  5AEW B;  3F8H A;  1L5G B;  4WFO A;  3UNL A;  1AVL A;  1RNT A;  1FUT A;  1Z1S A;  2H0H A;  1LOV A;  3KFQ C;  2WGQ A;  4HM7 B;  1VQ9 3;  1GMQ A;  1IVV A;  3FF0 A;  1US1 A;  2ZDJ A;  3B7C A;  2HMN B;  3SED A;  1JKG A;  2BO9 B;  4O2H A;  1IK3 A;  2GU3 A;  6GSP A;  4R9K A;  2P0M A;  2INX A;  1Q42 A;  2IA7 A;  4FMD A;  5CLK A;  2OOV A;  2P38 A;  4N6U A;  4RNY A;  3H3H A;  3VSY A;  3MPH A;  2WGO A;  5IF6 A;  3WHO A;  3G8Z A;  1DMN A;  1B20 A;  4GSP A;  2F56 A;  2KRT A;  1QJG A;  4N6N B;  1W6Y A;  4L7K A;  2XFT A;  3LXU X;  3EJV A;  2BT3 A;  3KII A;  1GD3 A;  2GBX B;  3CU3 A;  1Q81 4;  1NDO B;  3LML A;  1BSC A;  3B4O A;  1N9J A;  3F40 A;  3ALA A;  2GEY A;  3I0Y A;  2E2V A;  2PNC A;  2QGU A;  1IDP A;  2W56 A;  3JUN A;  4FMC A;  1O7G B;  2SBL A;  4XB5 A;  3U97 A;  1EQK A;  4XDW A;  1IT7 A;  1QMA A;  3AMO A;  5HGR A;  5IEO A;  1FA3 A;  3N8B A;  3CC7 3;  3CC4 3;  1W6G A;  2L1S A;  1LOW A;  4N6L A;  1DE3 A;  5IER A;  3STD A;  1BIR A;  3UL5 A;  3VF1 A;  4ORL A;  1N9E A;  1GY7 A;  1D6Z A;  1NO3 A;  3PCR A;  1K41 A;  2CFD A;  3AGO A;  3NXJ A;  1RJO A;  3BNB A;  2W2C A;  4GL6 A;  2P05 A;  5AYS C;  2OTL 3;  1AVK A;  1BNS A;  2ML6 A;  4G1M B;  1BSE A;  4XBX A;  4JRF A;  2AAE A;  2UUG C;  2GU1 A;  4KFE A;  2E2T A;  1PFP A;  1RNB A;  1E3V A;  1A2K A;  2F4Y A;  5DRE A;  1A90 A;  5IEN A;  3N9H A;  1BNJ A;  2BU4 A;  1RN4 A;  1TFO A;  2O3O A;  1JN5 B;  1WMO A;  1ULJ B;  2CWV A;  3K5T A;  4LGQ A;  1BUQ A;  7STD A;  3SOA A;  2W03 A;  1OHS A;  4WHA A;  1VQM 3;  1BAN A;  3FLJ A;  4RNT A;  4LSO A;  1BRK A;  4IPB A;  1TIJ A;  1I70 A;  1UUV B;  1SIH A;  5AIG A;  3GZB A;  1IVW A;  2B1X B;  3DMC A;  5LC6 A;  5AIH A;  3UB1 A;  1HYF A;  3OWY A;  1I2G A;  2CFL A;  2ZL8 A;  1IT8 A;  3NQY A;  3EBT A;  3S5C A;  1DMQ A;  4H3U A;  4CJN A;  3ZFZ A;  1BAO A;  1BRG A;  1W00 A;  2BNG A;  5CF1 A;  1PYL A;  1BNI A;  1RDS A;  3PGB A;  1IV7 A;  3SOY A;  3CCE 3;  1I0X A;  1GY5 A;  1UGH I;  3X42 A;  2WO0 A;  3MKI A;  3JVC A;  1I2E A;  4BTY A;  3CCR 3;  2FNQ A;  3I56 3;  1VQ5 3;  3CNM A;  1FUS A;  2CWT A;  4MMZ B;  3EN8 A;  1X1Y A;  2CG0 A;  4EW5 A;  5AII A;  4HM6 B;  4O02 B;  1EG9 B;  1YJN 3;  1RGF A;  1Y4K A;  4O8S A;  4EYC A;  4AKZ A;  3DXO A;  1TU5 A;  4ILF A;  3JUQ A;  1VQK 3;  4RZM A;  3EHC A;  4FCZ A;  3DUK A;  1NWW A;  1QVG 2;  3LYG A;  3Q3F A;  1LQG C;  3DM8 A;  3DGO A;  1E97 A;  1DMM A;  3BNC A;  3WA3 A;  4KT3 B;  2MC8 A;  1N5H A;  1ZO2 A;  3FH1 A;  1W2B 2;  1S5A A;  3S28 A;  2W04 A;  1JN5 A;  2RNT A;  1IQ8 A;  4L8P A;  5KP4 A;  1O7P B;  1V58 A;  1X1X A;  3CD6 3;  1MWR A;  2V1L A;  2LYX A;  7GSP A;  1Q7Y 4;  2HML B;  1VQO 3;  5G1K A;  1IYY A;  1EA2 A;  3DGL A;  4JF8 A;  5TGN A;  3X3X A;  1O7H B;  4K61 A;  4OVM A;  3X3Y A;  1C54 A;  1FYS A;  5G2G A;  1D6Y A;  2YFI B;  3EBY A;  4N3V A;  2K0M A;  3K0Z A;  3D3L A;  3NQZ A;  1V74 A;  2RCD A;  1LQM B;  2F5M A;  3KCH A;  5DRV A;  1JRQ A;  1JV2 B;  1NB5 I;  7RNT A;  1UUW B;  2PZV A;  5EEO A;  1JZO A;  3T8N A;  3GSP A;  1BUJ A;  1PU4 A;  2K54 A;  6STD A;  1FGR A;  3A5E A;  2BHM A;  1BGS A;  6RNT A;  4HZB B;  3CNX A;  1BU4 A;  2W6J H;  3TDG A;  1VQ4 3;  4K1V A;  3V99 A;  1BNF A;  1TP6 A;  2C11 A;  1RN7 A;  1W4N A;  1O7W B;  3X40 A;  3CME 3;  5AIF A;  4BU4 A;  5D82 A;  2KF5 A;  2IY2 A;  4OK0 A;  3F9S A;  4U13 A;  5LC7 A;  3T0U A;  1SJW A;  1HKX A;  2Z7A A;  1K9M 4;  1F8N A;  1RMS A;  5G1L A;  2QEX 3;  1I3I A;  1ASK A;  2XEP A;  2XSH B;  1BRH A;  4N6T A;  5M1A A;  2IUJ A;  5BIR A;  2KCD A;  1TUH A;  2BIR A;  1MWS A;  3PCS A;  3D5G A;  4BIR A;  1JB5 A;  1SPU A;  1YVB I;  2XFS A;  1YGW A;  4O3V A;  1B2M A;  1RGH A;  3GZY B;  5M18 A;  2F99 A;  4EBG A;  1K73 4;  4HM0 B;  2CX0 A;  2L4V A;  3X3Z A;  1YI2 3;  3FKA A;  5AYR B;  1T3B A;  1GS3 A;  3ER7 A;  4CDL A;  1FZU A;  1TTO A;  5M19 A;  3F14 A;  1M90 4;  1VQN 3;  1FW7 A;  3G71 3;  1GOV A;  2SAR A;  1G0T A;  3FG4 A;  4KZ1 A;  5BVB A;  3M8C A;  8CHO A;  3IJE B;  8RNT A;  3OWS A;  3MHE A;  5RNT A;  4GHO A;  1BRN L;  1OAC A;  3KE7 A;  1AR0 A;  4CPK A;  2KAA A;  1T2H A;  3RGA A;  3BNE A;  1QVF 2;  2CFK A;  2XSO B;  1UCJ A;  3JUO A;  4HM2 B;  4RNZ A;  1KD1 4;  3MSO A;  3PXM A;  3BB9 A;  5KP3 A;  3I55 3;  2Z76 A;  1VZZ A;  1DET A;  2QIY A;  2AAD A;  2GXF A;  3BIR A;  3CCV 3;  1YIJ 3;  3OW2 2;  3G6E 3;  3WMD A;  2KF6 A;  5IG4 A;  2C10 A;  5JPU A;  2XF3 A;  4I4K A;  3DGM A;  5JPP A;  5A0O B;  4HVN A;  3EB8 A;  1V57 A;  1BSA A;  1LOX A;  3K63 A;  4HM1 B;  1JBS A;  2LQV A;  1EUI C;  1M1X B;  3GRD A;  1UCL A;  1W2Z A;  1RGE A;  3X41 A;  1G02 A;  2XR8 B;  1CYV A;  3SLU A;  1ROA A;  2UX0 A;  5BU4 A;  3D9R A;  1I3F A;  2GEX A;  3S27 A;  1MGR A;  4BL2 A;  5JBS A;  4HBR A;  3V92 A;  1WMP A;  4X2O A;  3HZP A;  1B2S A;  2M7O A;  5FW5 A;  1RRL A;  2D1W A;  1VQL 3;  3G0K A;  1A2V A;  1MOL A;  4MMY B;  5CK6 A;  5CF2 A;  4R80 A;  3DZL A;  1IQX A;  1KWI A;  3FZW A;  3KKG A;  1K8A 4;  2CC3 A;  4MEI A;  1VQ7 3;  1WTH A;  2RSX A;  5IG0 A;  3UL6 A;  1R4C A;  3OXA A;  1LVN A;  3V98 A;  1RGL A;  2F5W A;  2FGT A;  1LOY A;  2W0Q A;  3GAX A;  3LZA A;  4EC6 A;  3Q1C A;  1X1W A;  4RBN A;  2YFL B;  1IQY A;  1GYB A;  1J2B A;  1Q40 B;  2B24 B;  3LT8 A;  1OGX A;  3B8L A;  1EKM A;  1RN1 A;  1NB3 I;  1BNE A;  3WR2 A;  4FCJ A;  1BOX A;  4HAA A;  4IT7 A;  4NHF A;  3H51 A;  5HOH A;  1YJW 3;  3DGN A;  1BNG A;  1QAK A;  2F86 B;  3RDE A;  2R4I A;  3HX8 A;  4XDV A;  2ML5 A;  3KSP A;  4FMB A;  3J7Y d;  1UCK A;  2F98 A;  1UGI A;  3SVA A;  1Q9E A;  4FMA A;  3F8X A;  1RCL A;  1MWT A;  2H0I A;  2RGQ A;  3B4P A;  4XBT A;  4CCV A;  2HMK B;  5EQL A;  1LNH A;  1M1K 4;  1TFK A;  2XH9 A;  4WWU C;  1FGM A;  3OWU A;  4LYL B;  5ELU A;  3WOD G;  3MYT A;  1LXE A;  3WOE B;  2K3D A;  1FUW A;  1UI7 A;  2HMJ B;  1I2F A;  3NM7 A;  1HU9 A;  4X2H A;  1YIT 3;  3MWZ A;  1N5P A;  4K90 B;  4MJD A;  3UJM A;  3ZG5 A;  1BNR A;  3AHS A;  5AI1 A;  1QAF A;  2C4B A;  4FR9 A;  4MMX B;  1LNI A;  3NM2 A;  2CKF B;  2Q07 A;  2XGN A;  4N6O B;  4HM8 B;  1T2I A;  2ZHX B;  4J5G A;  1GMR A;  3GZR A;  1ISK A;  1T5Y A;  1AV4 A;  1M9G A;  4AKY A;  1D6U A;  3FGY A;  4IIA A;  1BRJ A;  3MG2 A;  3LTC A;  3E99 A;  3QK9 A;  3URP A;  3ECF A;  1B2U A;  4NRE A;  3EF8 A;  1YJ9 3;  1Q40 A;  4HKV B;  4R1K A;  1BRS A;  3HI7 A;  1KSI A;  3PS8 A;  1UDI I;  4N6V 0;  4NPB A;  3G4S 3;  3NX0 A;  3CCS 3;  1IU7 A;  2P09 A;  1O7M B;  2GSP A;  2UGI A;  1W5Z A;  3MG3 A;  3U1W A;  4HM3 B;  2Y73 A;  1Q82 4;  1O7N B;  3HII A;  1OF5 B;  3KN4 A;  3LOY A;  2BMQ B;  3Q90 A;  3DGY A;  1JB4 A;  1SII A;  3BND A;  3OV4 A;  3CCJ 3;  1TRQ A;  3FSD A;  3PZW A;  3WOF B;  1AQZ A;  1RLS A;  1CQS A;  3DY5 A;  1CEW I;  1IVU A;  3D4A A;  1OHP A;  3BLZ A;  1B27 A;  4DKI A;  1HZ1 A;  1UUG B;  2IYJ A;  3T8U A;  1W6C A;  3CXC 2;  4STD A;  1TJD A;  1ZX2 A;  3IPT A;  4LZI A;  1RCK A;  3VGN A;  1YNV X;  1AY7 A;  4L8O A;  4QWT A;  3NV0 B;  3CPW 2;  3A76 A;  3DH2 A;  4J5K A;  2QA4 3;  5FGO A;  2STD A;  1MNL A;  2D42 A;  1GD4 A;  3FCS B;  1OPY A;  3FG3 A;  4BL3 A;  1DVD A;  1RGA A;  3O8Y A;  2Z6B A;  1JNQ A;  1YHQ 3;  3WDG B;  3RNT A;  5IG3 A;  3CCQ 3;  3HOH A;  3CMA 3;  1CH0 A;  2WOF A;  1CYU A;  2A15 A;  1OHO A;  3L0R A;  2OTJ 3;  1SQW A;  2CX1 A;  2CFG A;  1VQP 3;  1NNV A;  4AEQ A;  3S29 A;  3CCL 3;  5IG5 A;  1A67 A;  3KZT A;  1EEJ A;  1VQQ A;  3N54 B;  3PYJ A;  1WNH A;  9RNT A;  2RBI A;  5IEP A;  1U5O A;  2E2U A;  2W9Q A;  2HMM B;  2YFJ B;  4KFF A;  3LTB A;  3NBR A;  4XBY A;  4EV5 A;  1BRI A;  3NHX A;  1S72 3;  3GWR A;  3HIG A;  3NUV A;  4WP5 A;  2OQE A;  2CH9 A;  3CPO A;  3LH4 A;  1OF5 A;  2Z77 A;  1B2X A;  4OUQ A;  4H61 A;  4HOH A;  4FCM A;  1RHL A;  2CW9 A;  1G96 A;  1SAR A;  1FGO A;  2GBW B;  1RGK A;  2FXT A;  1X1U A;  4HJL B;  3SXX A;  3HK4 A;  4LMI A;  1E3R A;  2XRX B;  3EC9 A;  4I5Q A;  2XGL A;  1STF I;  1BVI A;  3F7X A;  2CWU A;  2IUK A;  3NV0 A;  1ULI B;  4J8T A;  1JZD A;  2KXG A;  5D83 A;  1BSD A;  1NJI 4;  1GMP A;  1WMN A;  2J8X B;  5D81 A;  1RKY A;  3G16 A;  3FF2 A;  4WYK B;  1OCV A;  1R4Y A;  1WQL B;  3LT9 A;  3ZG0 A;  1DVC A;  1TRP A;  4BTX A;  1GY6 A;  1UI8 A;  2R41 A;  3AGN A;  3GZX B;  5BXQ A;  2YX9 A;  1JBT A;  1DYU A;  3EQQ B;  1N8Q A;  2CFW A;  2MF7 A;  3SYU A;  1GOY A;  2OCT A;  5KP1 A;  3CC2 3;  2BMR B;  4K1U A;  1I8V A;  2P0X A;  3Q2P A;  1IVX A;  3JUM A;  3LTD A;  4KVH A;  2O9U X;  1GSP A;  1OH0 A;  4TX4 A;  3EX9 A;  1YGE A;  1I0V A;  3K7C A;  3BU4 A;  3WA2 X;  5I97 A;  4PEJ A;  2OOV C;  3MG1 A;  1OUN A;  3D79 A;  2HOH A;  3KSE D;  4Q53 A;  1B3S A;  1ROV A;  1Q86 4;  1ZGX A;  2JDI H;  3NBJ A;  3NBB A;  1W7C A;  4HZ9 B;  1JB2 A;  2CK3 H;  1A2P A;  1JKG B;  4HM5 B;  4N6M A;  5AEU B;  2HMO B;  2OWP A;  1RSN A;  3CCM 3;  1QAL A;  2CIU A;  1W02 A;  1FGQ A;  1MWU A;  1RGC A;  5GSP A;  1VQ6 3;  3K9M C;  1JJ2 2;  1RTU A;  3RGR A;  3IMA B;  1Q7H A;  3OX9 A;  1MGW A;  1B2Z A;  4R9L A;  1UW1 A;  4EV2 A;  3EN1 B;  1NU3 A;  1BSB A;  4LEH A;  4R4K A;  3EE1 A;  2H0G A;  4XM4 A;  3S67 A;  1KC8 4;  1C7H A;  3CCU 3;  3LTA A;  2CHC A;  1RRH A;  3QRD A;  4BTW A;  5STD A;  1LRA A;  3JUP A;  2IMJ A;  2ZA4 A;  4WYK A;  5EVH A;  2OQE C;  1FGT A;  2KF4 A;  1B21 A;  4KFD A;  3F7S A;  2CG1 A;  4GB5 A;  3FG1 A;  2Y74 A;  1UCI A;  4ZM8 A;  2BMO B;  2W56 B;  4J9A A;  1U8C B;  1YVS A;  2RFR A;  1ZS7 A;  3AHW A; 
#chains in the Genus database with same CATH homology
 5IW9 A;  1VQ8 3;  1IV9 A;  3AMO B;  4EXR A;  2I9W A;  1W01 A;  4HM4 B;  1OGZ A;  1N8R 4;  4HYZ A;  2JQ5 A;  1KQS 2;  1STD A;  2W9P A;  1K28 A;  3ROB A;  5CXO A;  3SX1 A;  2WOH A;  5ELJ A;  5AEW B;  3F8H A;  1L5G B;  4WFO A;  3UNL A;  1AVL A;  1Z1S A;  1VQ9 3;  3KFQ C;  2WGQ A;  4HM7 B;  1IVV A;  3FF0 A;  1US1 A;  2ZDJ A;  3B7C A;  2HMN B;  3SED A;  1JKG A;  2BO9 B;  4O2H A;  1IK3 A;  2GU3 A;  4R9K A;  2P0M A;  2INX A;  1Q42 A;  2IA7 A;  4FMD A;  5CLK A;  2OOV A;  2P38 A;  4N6U A;  4RNY A;  3H3H A;  3VSY A;  3MPH A;  2WGO A;  5IF6 A;  3G8Z A;  1DMN A;  2KRT A;  1QJG A;  4N6N B;  1W6Y A;  4L7K A;  3LXU X;  3EJV A;  2BT3 A;  3KII A;  1GD3 A;  2GBX B;  3CU3 A;  1Q81 4;  1NDO B;  3LML A;  3B4O A;  1N9J A;  3F40 A;  3ALA A;  2GEY A;  3I0Y A;  2E2V A;  2PNC A;  2QGU A;  1IDP A;  2W56 A;  3JUN A;  4FMC A;  1O7G B;  2SBL A;  4XB5 A;  3U97 A;  1EQK A;  4XDW A;  1IT7 A;  1QMA A;  3AMO A;  5HGR A;  5IEO A;  1FA3 A;  3N8B A;  3CC7 3;  3CC4 3;  1W6G A;  4N6L A;  5IER A;  3STD A;  3VF1 A;  3UL5 A;  4ORL A;  1N9E A;  1GY7 A;  1D6Z A;  1NO3 A;  3PCR A;  1K41 A;  2CFD A;  3NXJ A;  1RJO A;  3BNB A;  2W2C A;  4GL6 A;  2P05 A;  5AYS C;  2OTL 3;  1AVK A;  2ML6 A;  4G1M B;  4XBX A;  4JRF A;  2GU1 A;  4KFE A;  2E2T A;  1PFP A;  1E3V A;  1A2K A;  5DRE A;  1A90 A;  3N9H A;  3K5T A;  2O3O A;  1W2B 2;  1TFO A;  1JN5 B;  1WMO A;  1ULJ B;  2CWV A;  4LGQ A;  1BUQ A;  7STD A;  3SOA A;  2W03 A;  1OHS A;  4WHA A;  1VQM 3;  3FLJ A;  4LSO A;  4IPB A;  1TIJ A;  1UUV B;  1SIH A;  5AIG A;  3GZB A;  1IVW A;  2B1X B;  3DMC A;  5LC6 A;  5AIH A;  3UB1 A;  3OWY A;  2CFL A;  2ZL8 A;  1IT8 A;  3NQY A;  3EBT A;  3S5C A;  1DMQ A;  4H3U A;  1W00 A;  2BNG A;  5CF1 A;  3PGB A;  1IV7 A;  3SOY A;  3CCE 3;  1GY5 A;  3X42 A;  2WO0 A;  3MKI A;  3JVC A;  4BTY A;  3CCR 3;  2FNQ A;  3I56 3;  1VQ5 3;  3CNM A;  2CWT A;  4MMZ B;  3EN8 A;  2CG0 A;  5AII A;  4HM6 B;  4O02 B;  1EG9 B;  1YJN 3;  1Y4K A;  4O8S A;  1TU5 A;  4EYC A;  4AKZ A;  3DXO A;  3JUQ A;  1VQK 3;  4RZM A;  3EHC A;  4FCZ A;  3DUK A;  1NWW A;  1QVG 2;  3LYG A;  3DM8 A;  3DGO A;  1E97 A;  1DMM A;  3BNC A;  3WA3 A;  2MC8 A;  1N5H A;  1ZO2 A;  3FH1 A;  1S5A A;  3S28 A;  2W04 A;  1JN5 A;  1IQ8 A;  4L8P A;  5KP4 A;  1O7P B;  3CD6 3;  1Q7Y 4;  2V1L A;  2LYX A;  2HML B;  1VQO 3;  1EA2 A;  3DGL A;  4JF8 A;  5TGN A;  3X3X A;  1O7H B;  4K61 A;  4OVM A;  3X3Y A;  5G2G A;  1D6Y A;  2YFI B;  3EBY A;  4N3V A;  2K0M A;  3K0Z A;  3D3L A;  3NQZ A;  1V74 A;  2RCD A;  5DRV A;  1JRQ A;  1JV2 B;  1NB5 I;  1UUW B;  2PZV A;  5EEO A;  3T8N A;  1PU4 A;  2K54 A;  6STD A;  1FGR A;  2BHM A;  4HZB B;  3CNX A;  1VQ4 3;  2W6J H;  3TDG A;  4K1V A;  3V99 A;  1TP6 A;  2C11 A;  1RN7 A;  1W4N A;  1O7W B;  3X40 A;  3CME 3;  5AIF A;  5D82 A;  4OK0 A;  3F9S A;  4U13 A;  5LC7 A;  3T0U A;  1SJW A;  1HKX A;  2Z7A A;  1K9M 4;  1F8N A;  2QEX 3;  2XEP A;  1ASK A;  2XSH B;  4N6T A;  2IUJ A;  2KCD A;  1TUH A;  3PCS A;  1JB5 A;  1SPU A;  1YVB I;  2XFS A;  4O3V A;  3GZY B;  2F99 A;  4EBG A;  1K73 4;  4HM0 B;  2L4V A;  3X3Z A;  1YI2 3;  3FKA A;  5AYR B;  1GS3 A;  3ER7 A;  4CDL A;  1VQN 3;  1M90 4;  3F14 A;  3G71 3;  3FG4 A;  4KZ1 A;  5BVB A;  3M8C A;  8CHO A;  3IJE B;  3OWS A;  3MHE A;  1OAC A;  3KE7 A;  1AR0 A;  3RGA A;  3BNE A;  1QVF 2;  2CFK A;  2XSO B;  3JUO A;  4HM2 B;  4RNZ A;  1KD1 4;  3MSO A;  3PXM A;  3BB9 A;  5KP3 A;  3I55 3;  2Z76 A;  1VZZ A;  2QIY A;  2GXF A;  3CCV 3;  1YIJ 3;  3OW2 2;  3G6E 3;  3WMD A;  5IG4 A;  2C10 A;  5JPU A;  2XF3 A;  4I4K A;  3DGM A;  5JPP A;  5A0O B;  4HVN A;  3EB8 A;  1LOX A;  3K63 A;  4HM1 B;  2LQV A;  1M1X B;  3GRD A;  1W2Z A;  3X41 A;  3SLU A;  2XR8 B;  1CYV A;  1ROA A;  2UX0 A;  3D9R A;  2GEX A;  3S27 A;  5JBS A;  4HBR A;  3V92 A;  1WMP A;  4X2O A;  3HZP A;  2M7O A;  5FW5 A;  1RRL A;  2D1W A;  1VQL 3;  3G0K A;  1A2V A;  1MOL A;  4MMY B;  5CK6 A;  5CF2 A;  4R80 A;  3DZL A;  1IQX A;  1KWI A;  3FZW A;  3KKG A;  1K8A 4;  2CC3 A;  4MEI A;  1VQ7 3;  1WTH A;  2RSX A;  5IG0 A;  3UL6 A;  1R4C A;  3OXA A;  1LVN A;  3V98 A;  2FGT A;  2W0Q A;  3GAX A;  3LZA A;  4EC6 A;  3Q1C A;  4RBN A;  2YFL B;  1IQY A;  1GYB A;  1J2B A;  1Q40 B;  2B24 B;  3LT8 A;  1OGX A;  3B8L A;  1EKM A;  1NB3 I;  4FCJ A;  4IT7 A;  4NHF A;  3H51 A;  1YJW 3;  3DGN A;  1QAK A;  2F86 B;  3RDE A;  2R4I A;  3HX8 A;  4XDV A;  2ML5 A;  3KSP A;  4FMB A;  3J7Y d;  2F98 A;  3SVA A;  4FMA A;  3F8X A;  2RGQ A;  3B4P A;  4XBT A;  4CCV A;  2HMK B;  5EQL A;  1LNH A;  1M1K 4;  1TFK A;  2XH9 A;  4WWU C;  1FGM A;  3OWU A;  5ELU A;  3WOD G;  3MYT A;  1LXE A;  3WOE B;  1FUW A;  1UI7 A;  2HMJ B;  3NM7 A;  1YIT 3;  1HU9 A;  4X2H A;  3MWZ A;  1N5P A;  4K90 B;  4MJD A;  3UJM A;  5AI1 A;  1QAF A;  4MMX B;  4FR9 A;  3NM2 A;  2CKF B;  2Q07 A;  2XGN A;  4N6O B;  4HM8 B;  3GZR A;  1ISK A;  1T5Y A;  1AV4 A;  1M9G A;  4AKY A;  1D6U A;  3FGY A;  4IIA A;  3MG2 A;  3LTC A;  3E99 A;  3QK9 A;  3ECF A;  4NRE A;  3EF8 A;  1YJ9 3;  1Q40 A;  4HKV B;  4R1K A;  3HI7 A;  3G4S 3;  1KSI A;  3PS8 A;  4N6V 0;  3NX0 A;  3CCS 3;  1IU7 A;  2P09 A;  1O7M B;  1W5Z A;  3MG3 A;  3U1W A;  4HM3 B;  2Y73 A;  1Q82 4;  1O7N B;  3HII A;  1OF5 B;  3KN4 A;  3LOY A;  2BMQ B;  3Q90 A;  1JB4 A;  1SII A;  3BND A;  3OV4 A;  3CCJ 3;  3FSD A;  3PZW A;  3WOF B;  1CQS A;  3DY5 A;  1CEW I;  1IVU A;  1OHP A;  3BLZ A;  3T8U A;  1W6C A;  3CXC 2;  4STD A;  1ZX2 A;  3IPT A;  4LZI A;  3VGN A;  4L8O A;  4QWT A;  3NV0 B;  3CPW 2;  3A76 A;  2QA4 3;  5FGO A;  2STD A;  1MNL A;  2D42 A;  1GD4 A;  3FCS B;  1OPY A;  3FG3 A;  1DVD A;  3O8Y A;  2Z6B A;  1JNQ A;  1YHQ 3;  3WDG B;  5IG3 A;  3CCQ 3;  3CMA 3;  2WOF A;  1CYU A;  2A15 A;  1OHO A;  3L0R A;  2OTJ 3;  1SQW A;  2CFG A;  1VQP 3;  4AEQ A;  3S29 A;  3CCL 3;  5IG5 A;  1A67 A;  3KZT A;  3N54 B;  3PYJ A;  1WNH A;  5IEP A;  1U5O A;  2E2U A;  2W9Q A;  2HMM B;  2YFJ B;  2RFR A;  3LTB A;  3NBR A;  4KFF A;  4XBY A;  3NHX A;  4EV5 A;  1S72 3;  3GWR A;  3HIG A;  3NUV A;  4WP5 A;  2OQE A;  2CH9 A;  3CPO A;  3LH4 A;  1OF5 A;  2Z77 A;  4OUQ A;  4H61 A;  4FCM A;  2CW9 A;  1G96 A;  1FGO A;  2GBW B;  2FXT A;  4HJL B;  3SXX A;  3HK4 A;  4LMI A;  1E3R A;  2XRX B;  3EC9 A;  2XGL A;  1STF I;  3F7X A;  2CWU A;  2IUK A;  3NV0 A;  1ULI B;  4J8T A;  2KXG A;  5D83 A;  1NJI 4;  1WMN A;  5D81 A;  1RKY A;  3G16 A;  3FF2 A;  4WYK B;  1OCV A;  1WQL B;  3LT9 A;  1DVC A;  4BTX A;  1GY6 A;  1UI8 A;  3GZX B;  5BXQ A;  2YX9 A;  1DYU A;  3EQQ B;  1N8Q A;  2CFW A;  2MF7 A;  2OCT A;  5KP1 A;  3CC2 3;  2BMR B;  4K1U A;  2P0X A;  3Q2P A;  1IVX A;  3JUM A;  3LTD A;  4KVH A;  2O9U X;  4TX4 A;  1OH0 A;  3EX9 A;  1YGE A;  3K7C A;  3WA2 X;  5I97 A;  4PEJ A;  2OOV C;  3MG1 A;  1OUN A;  3KSE D;  4Q53 A;  1Q86 4;  1ROV A;  2JDI H;  3NBJ A;  3NBB A;  1W7C A;  4HZ9 B;  1JB2 A;  2CK3 H;  4N6M A;  1JKG B;  4HM5 B;  5AEU B;  5IEN A;  2HMO B;  2OWP A;  3CCM 3;  1QAL A;  2CIU A;  1W02 A;  1FGQ A;  1VQ6 3;  3K9M C;  1JJ2 2;  3RGR A;  3IMA B;  3OX9 A;  1UW1 A;  4EV2 A;  3EN1 B;  1NU3 A;  4LEH A;  4R4K A;  3EE1 A;  4XM4 A;  3S67 A;  1KC8 4;  1C7H A;  3CCU 3;  3LTA A;  2CHC A;  1RRH A;  3QRD A;  4BTW A;  5STD A;  3JUP A;  2IMJ A;  4WYK A;  5EVH A;  2OQE C;  1FGT A;  4KFD A;  3F7S A;  2CG1 A;  4GB5 A;  3FG1 A;  2Y74 A;  4ZM8 A;  2BMO B;  2W56 B;  4J9A A;  1U8C B;  4R9L A;  2XFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...