4HBRA

Crystal structure of a putative periplasmic proteins (bacegg_01429) from bacteroides eggerthii dsm 20697 at 2.40 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
b'GGYAPDSVQIALKKMYPTAAGIAWSQDKAYYVADFVMNGFDTRVWFTPDAEWVMKQTDWETLDEVPAAVFNAFAASEFSDGVVQNVTWVQFPEWQPIVAIQVGKPNMQMKYQILFTPKGEVLRQQNITNAYNTLGASTFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative periplasmic protein
publication title Crystal structure of a putative periplasmic proteins (BACEGG_01429) from Bacteroides eggerthii DSM 20697 at 2.40 A resolution
rcsb
source organism Bacteroides eggerthii
molecule tags Structural genomics, unknown function
total genus 27
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.360 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4hbrA00
4HBRA 4IPBA 3U1WA 4FR9A 4K61A
chains in the Genus database with same CATH superfamily
5DRVA 1YI23 4WYKB 1BNGA 1RCLA 2C10A 3KSPA 3H51A 3Q1CA 3FG4A 5BXQA 3JUPA 1RSNA 4WWUC 2K54A 2UX0A 4MJDA 1W00A 4RBNA 1RGLA 5DREA 1EG9B 2P38A 3D79A 2XF3A 4NPBA 3WR2A 3CME3 2A15A 1MWTA 2I9WA 3N54B 1VQ93 3CU3A 1Q9EA 2YFIB 1NU3A 3X3XA 3CPW2 5STDA 1JZDA 3PCSA 1DMNA 1OH0A 2OTJ3 4GHOA 1D6UA 4EBGA 1K28A 4ORLA 1I2FA 3ECFA 3JUNA 5CLKA 1X1WA 2CKFB 2CX1A 3V92A 1YVSA 1O7HB 2CWTA 3DGNA 4GL6A 4FMDA 3ER7A 1IDPA 5ELJA 5AEUB 4TX4A 2CG1A 1G0TA 3EN8A 4N6OB 1BAOA 2K3DA 1QVG2 1BU4A 3G713 4R9KA 3AMOB 3SLUA 4N6TA 3WOEB 1U8CB 3KZTA 4XDVA 3GZXB 2Z7AA 1A90A 3TDGA 1JZOA 6GSPA 1RRHA 1AV4A 3EC9A 1RLSA 5EEOA 1ULJB 3G8ZA 2GU1A 4HAAA 4L8PA 3JUQA 1B3SA 4STDA 2W56B 1BIRA 1PU4A 3OX9A 1BSAA 2KF5A 2W04A 3D4AA 5IW9A 1GD3A 1DE3A 3HIGA 2BIRA 3BU4A 1BSDA 1RNBA 3OW22 1Q7Y4 3EF8A 3QK9A 4EYCA 3D5IA 4K61A 5FGOA 1BVIA 3VF1A 3I563 4JRFA 1JN5A 2CIUA 3CNMA 3DGOA 4R80A 1GMPA 1KD14 2V1LA 1OF5A 4CDLA 4BTWA 5AEWB 2P0MA 1RKYA 1K8A4 1RHLA 2ZDJA 2F4YA 3PS8A 3SOYA 3NBJA 1NO3A 2WOHA 3JUOA 2RSXA 3F14A 3FG3A 3DXOA 3ZG0A 3GZRA 1Q42A 3Q2PA 2OOVA 3CCS3 1FGOA 4RNYA 5D83A 1RGFA 1YHQ3 4HZ9B 2W0QA 1YGEA 1IT8A 2CX0A 1WMOA 1FYSA 2IUKA 3LXUX 2YX9A 1O7NB 1JB2A 1ZO2A 3N9HA 3S67A 1LNHA 3F8XA 2Y73A 2XFSA 3NBBA 5BVBA 7STDA 3IPTA 1C7HA 1OHPA 1QMAA 1OACA 1T2IA 1WMNA 1R4CA 2MF7A 3KCHA 5IERA 3J7Yd 3FF0A 2P09A 2RFRA 3DH2A 3T8UA 1OHSA 3BNDA 2F56A 3A5EA 1RGAA 4OK0A 3WODG 4LMIA 4R9LA 2HMOB 1BSEA 3EHCA 1W2ZA 3PGBA 2RCDA 5HGRA 1RGHA 2KAAA 2LQVA 1RGKA 3GRDA 8RNTA 2CWVA 1BRIA 4N6V0 3X3ZA 1F8NA 1CYUA 1QALA 1FUWA 1N9EA 3CPOA 4IT7A 1A2KA 2P0XA 2UUGC 4H3UA 1FUSA 1TRPA 4RZMA 2FGTA 3GWRA 5D81A 4AEQA 5CF1A 5CK6A 2IUJA 5IEPA 1AR0A 1IVVA 1JB4A 2W9PA 1ISKA 1TFOA 1I2EA 1BRKA 1CQSA 2L4VA 3FLJA 4CCVA 1D6ZA 2C4BA 3KE7A 1MNLA 4HYZA 4O8SA 1JN5B 3WMDA 4HZBB 3U97A 4LSOA 1JV2B 3FH1A 5IF6A 3X41A 2XSOB 1GOYA 1BSCA 2BU4A 3T8NA 5M1AA 1US1A 1EKMA 3KIIA 4OVMA 2IMJA 1WNHA 3B7CA 3D5GA 4ILFA 5CF2A 2QGUA 1KSIA 1LVNA 2W6JH 1RGCA 1TJDA 2LYXA 1JJ22 3DM8A 1CYVA 1JB5A 4FMBA 1CEWI 4RNTA 4X2HA 5AYRB 4WP5A 3FKAA 1EA2A 2F99A 2B24B 2OOVC 3F40A 3NHXA 1A67A 2JQ5A 3Q90A 2CWUA 3BNBA 2Q07A 1LOWA 2K0MA 4ZM8A 3WDGB 4K90B 2CFDA 3CCL3 4LGQA 2Z76A 2E2UA 1YVBI 2HMJB 3JVCA 2ZL8A 3K9MC 1WTHA 3DY5A 1IV9A 1SJWA 3EB8A 1B2UA 3KFQC 1LQMB 1B2XA 1N5PA 2Z6BA 4L7KA 5AIIA 1AQZA 1GOVA 3CCJ3 3CCM3 1IU7A 4BIRA 2HOHA 1FGTA 2WGOA 2O3OA 5KP3A 4HM3B 1ULIB 1B20A 4NREA 1RN4A 2PZVA 5FW5A 1VZZA 2CFLA 2HMKB 3LYGA 3CCE3 1BRSA 3HI7A 3Q3FA 1B27A 4EXRA 4MEIA 1YJW3 1N9JA 3E99A 4J5KA 1VQM3 3QRDA 1W02A 1I8VA 2O9UX 2XEPA 4HOHA 5EVHA 3CCU3 3LTAA 1ROVA 1MWRA 1TIJA 1TUHA 3D9RA 9RNTA 1MWSA 2UGIA 3FG1A 1NNVA 1K734 1RCKA 2KF6A 1M1XB 1QAFA 3BNEA 3EN1B 3NX0A 4LYLB 4R1KA 3S28A 4BL2A 1BNSA 3GZYB 3AHWA 4LEHA 5AYSC 2L1SA 3WA2X 1UUVB 1JKGA 1LNIA 1SIIA 1NWWA 4XBXA 4N6MA 4XBTA 3T0UA 1JBSA 2XGNA 3ROBA 2FXTA 1I0XA 2OTL3 1DMMA 1VQ63 4AKYA 1DVDA 1FA3A 1JBTA 4MMYB 2XFTA 3FZWA 5AIHA 1T2HA 5CXOA 3ZFZA 3RGAA 1LXEA 1EEJA 1RN1A 3F7XA 5IENA 2OCTA 1S5AA 1Z1SA 4PEJA 1MGRA 1GYBA 1SQWA 1FGQA 3NV0A 4HM7B 3CCV3 1GSPA 3BNCA 3LTDA 1ZX2A 2RGQA 1SPUA 4U13A 4HM0B 1MGWA 2F5WA 1MOLA 4KFDA 3SVAA 3I553 1Q7HA 3UB1A 4HJLB 3FGYA 1NB5I 1W6YA 2W03A 5BU4A 1T5YA 2CH9A 2IY2A 1DYUA 1Q864 1BANA 4HM8B 5LC6A 3S27A 3FCSB 3LH4A 1BOXA 3EJVA 3S29A 6RNTA 4GSPA 5IG3A 1I2GA 1W7CA 1A2PA 1JRQA 1NJI4 1IVWA 3MG3A 1W2B2 2E2TA 2SARA 3PYJA 3AGNA 1UUGB 1TU5A 2BT3A 1Q824 1IYYA 3HZPA 1BRNL 1V58A 3LTCA 3DGYA 1I3IA 2BNGA 1GD4A 4K1UA 3K7CA 2F86B 5RNTA 4R4KA 1E97A 5JBSA 1OPYA 2P05A 3NM7A 1GOUA 3SYUA 5ELUA 4N6UA 1CH0A 1R4YA 3SEDA 3B8LA 1B2SA 1UCKA 1T3BA 1RJOA 3ALAA 4G1MB 3BLZA 5IG5A 5M18A 1YNVX 1VQ73 3CC43 1SARA 1FUTA 1GY5A 3VGNA 4OUQA 4N6LA 4AKZA 4KZ1A 4BTXA 1VQP3 4XB5A 2GSPA 1VQK3 3NV0B 4HM4B 1TRQA 1N8QA 4I5QA 2D42A 4O02B 3MWZA 1TP6A 1UCJA 2KXGA 3EQQB 4KVHA 1B2MA 1IV7A 1UUWB 1LOVA 3WOFB 1RGGA 1E3RA 1UGHI 1IK3A 1OF5B 2HMNB 3EX9A 1WMPA 2YFLB 4L8OA 3MPHA 3DZLA 3IJEB 3KKGA 3AGOA 4XBYA 3F8HA 4CPKA 3CCR3 1AY7A 1ZS7A 3X42A 1GMRA 3CMA3 1V57A 2CHCA 1KC84 5JPUA 3H3HA 3X3YA 1IQYA 1BGSA 1HU9A 2JDIH 3EE1A 4FR9A 1LQGC 1VQ83 1EUIC 2GBWB 2QEX3 1N5HA 1C54A 1VQO3 1BNJA 1JNQA 3MYTA 3CD63 1FW7A 3MHEA 1B2ZA 6STDA 5KP4A 1IVXA 3OWYA 4FMCA 2XRXB 3X40A 1ZGXA 2HMMB 4K1VA 1A2VA 1BRJA 1RRLA 1AVLA 2W56A 5G2GA 1AVKA 1OGZA 4QWTA 5AIFA 1YIJ3 2H0IA 1V74A 2ZHXB 2FNQA 1BUQA 2CK3H 1IVUA 3MSOA 5EQLA 3S5CA 1TFKA 1ROAA 1STFI 3L0RA 2M7OA 3GAXA 1BRGA 1LOXA 3RNTA 3BIRA 4EV2A 4KT3B 2F98A 3FSDA 3SX1A 1Q814 1RNTA 3G6E3 1UCLA 1W6GA 1QVF2 1HYFA 1PYLA 1OGXA 2R41A 2W2CA 3MG2A 1S723 1GMQA 1O7GB 2IA7A 2Z77A 1X1XA 2Y74A 1IQXA 2RNTA 4N3VA 4HVNA 3SXXA 1VQN3 2H0HA 5IG0A 1HZ1A 3UL5A 5M19A 3JUMA 4FCJA 3DGMA 3NQZA 1BNIA 4WHAA 5G1KA 2BMRB 2ML5A 4BL3A 1DVCA 1L5GB 3LOYA 2KRTA 1VQL3 2E2VA 3URPA 3NBRA 3CC73 5AIGA 1BSBA 1GY7A 2BMQB 1I0VA 2CFWA 3HIIA 1BNFA 1YIT3 1UW1A 4KFEA 1OHOA 3ZG5A 1QJGA 1RTUA 2GU3A 1I70A 1RDSA 3GZBA 1OUNA 3WHOA 1GY6A 2SBLA 2YFJB 2INXA 3EBYA 3KSED 4IIAA 3V98A 1LOYA 3F7SA 1D6YA 1O7MB 2GBXB 3LT8A 3V99A 1UGIA 4Q53A 3U1WA 4FCZA 5BIRA 1VQ53 1I3FA 2WGQA 2QA43 2C11A 2OWPA 4MMZB 4HKVB 1UI7A 2XR8B 4O3VA 1NB3I 3OV4A 4DKIA 1W5ZA 1RN7A 4NHFA 1O7PB 1M1K4 1BUJA 1DETA 2GXFA 3M8CA 3MKIA 2HMLB 3A76A 3LT9A 1STDA 2AADA 7GSPA 4J8TA 5G1LA 2KCDA 2D1WA 3OWUA 2OQEA 1K9M4 4HBRA 1HKXA 3CXC2 3NQYA 1YGWA 3LTBA 1YJ93 2CC3A 1G96A 3OWSA 1K41A 2QIYA 3PCRA 3G0KA 2WO0A 1TTOA 1W01A 1VQQA 4X2OA 5IG4A 4EW5A 1N8R4 1JKGB 2MC8A 3NUVA 5JPPA 3VSYA 4EV5A 5I97A 4CJNA 1M9GA 3MG1A 1W4NA 1MWUA 3WA3A 3I0YA 1RGEA 3K5TA 4EC6A 2XSHB 3UL6A 3HOHA 1B21A 3PXMA 5LC7A 3RGRA 3O8YA 4WFOA 1Q40A 4N6NB 1OCVA 2H0GA 2XGLA 3UJMA 4BTYA 4J5GA 4J9AA 4KFFA 3CNXA 4WYKA 1DMQA 1KWIA 3K63A 8CHOA 4MMXB 2RBIA 3G4S3 1E3VA 4HM5B 2BO9B 2STDA 3OXAA 2CG0A 3NM2A 1FGMA 3NXJA 2KF3A 3N8BA 3EBTA 5GSPA 3CC23 1BNEA 3GSPA 1BRHA 1SIHA 2ML6A 3B4OA 4HM1B 3RDEA 1VQ43 3DGLA 1QAKA 3LZAA 3G16A 1W6CA 3CCQ3 2WOFA 2XH9A 2CW9A 1O7WB 2GEXA 1BNRA 5KP1A 3FF2A 3DMCA 4XDWA 3AHSA 5A0OB 4IPBA 7RNTA 5D82A 2AAEA 5IEOA 4JF8A 1IQ8A 3LMLA 4LZIA 1Y4KA 4H61A 2GEYA 2PNCA 2ZA4A 3D3LA 2BMOB 1LRAA 3UNLA 1FZUA 3KN4A 1ASKA 1KQS2 1WQLB 2OQEC 2F5MA 1IT7A 1X1UA 3AMOA 1U5OA 2KF4A 5TGNA 3BB9A 3F9SA 3PZWA 3IMAB 4FCMA 3SOAA 1PFPA 2W9QA 1FGRA 2CFGA 2IYJA 4HM2B 3B4PA 1X1YA 4BU4A 1GS3A 2CFKA 2B1XB 4GB5A 2J8XB 1G02A 1UI8A 3DUKA 5HOHA 4FMAA 1YJN3 3HX8A 3HK4A 1UDII 4I4KA 4O2HA 3K0ZA 1PY3A 2BHMA 4RNZA 5AI1A 1M904 1J2BA 1JBRA 4HM6B 1EQKA 1Q40B 1NDOB 1RMSA 1UCIA 3STDA 4XM4A 2R4IA
chains in the Genus database with same CATH topology
5DRVA 1YI23 4WYKB 2C10A 3KSPA 3H51A 3Q1CA 3FG4A 5BXQA 3JUPA 4WWUC 2K54A 2UX0A 4MJDA 1W00A 4RBNA 5DREA 1EG9B 2P38A 3CME3 2XF3A 2A15A 2I9WA 3N54B 1VQ93 3CU3A 3X3XA 2YFIB 1NU3A 3CPW2 5STDA 3PCSA 1DMNA 1OH0A 2OTJ3 4EBGA 1D6UA 1K28A 4ORLA 3ECFA 3JUNA 5CLKA 2CKFB 3V92A 1O7HB 2CWTA 3DGNA 4GL6A 4FMDA 3ER7A 1IDPA 5ELJA 5AEUB 4TX4A 2CG1A 3EN8A 4N6OB 1QVG2 3G713 4R9KA 3AMOB 3SLUA 4N6TA 3WOEB 1U8CB 3KZTA 4XDVA 3GZXB 2Z7AA 1A90A 3TDGA 1RRHA 1AV4A 3EC9A 5EEOA 1ULJB 3G8ZA 2GU1A 4L8PA 3JUQA 4STDA 2W56B 1PU4A 3OX9A 2W04A 5IW9A 1GD3A 3HIGA 3OW22 1Q7Y4 3EF8A 3QK9A 4EYCA 4K61A 5FGOA 3VF1A 3I563 4JRFA 1JN5A 2CIUA 3CNMA 3DGOA 4R80A 1KD14 2V1LA 1OF5A 4CDLA 4BTWA 5AEWB 2P0MA 1RKYA 1K8A4 2ZDJA 3PS8A 3SOYA 3NBJA 1NO3A 2WOHA 3JUOA 2RSXA 3F14A 3FG3A 3DXOA 3GZRA 1Q42A 3Q2PA 2OOVA 3CCS3 1FGOA 4RNYA 5D83A 1YHQ3 4HZ9B 2W0QA 1YGEA 1IT8A 1WMOA 3LXUX 2IUKA 2YX9A 1O7NB 1JB2A 1ZO2A 3N9HA 3S67A 1LNHA 3F8XA 2Y73A 2XFSA 3NBBA 5BVBA 7STDA 3IPTA 1C7HA 1OHPA 1QMAA 1OACA 1WMNA 2MF7A 1R4CA 5IG3A 5IERA 3J7Yd 3FF0A 2P09A 2RFRA 3T8UA 1OHSA 3BNDA 4OK0A 3WODG 4LMIA 4R9LA 2HMOB 3EHCA 1W2ZA 3PGBA 2RCDA 5HGRA 2LQVA 3GRDA 2CWVA 4N6V0 3X3ZA 1F8NA 1CYUA 1QALA 1FUWA 1N9EA 3CPOA 4IT7A 1A2KA 2P0XA 4H3UA 4RZMA 2FGTA 3GWRA 5D81A 4AEQA 5CF1A 5CK6A 2IUJA 5IEPA 1IVVA 1AR0A 1JB4A 2W9PA 1ISKA 1TFOA 1CQSA 2L4VA 3FLJA 4CCVA 1D6ZA 4O8SA 3KE7A 1MNLA 4HYZA 1JN5B 3WMDA 4HZBB 3U97A 4LSOA 1JV2B 3FH1A 5IF6A 3X41A 2XSOB 3T8NA 1US1A 1EKMA 3KIIA 4OVMA 2IMJA 1WNHA 3B7CA 5CF2A 2QGUA 1KSIA 1LVNA 2W6JH 2LYXA 1JJ22 3DM8A 1CYVA 1JB5A 4FMBA 1CEWI 4X2HA 5AYRB 4WP5A 3FKAA 1EA2A 2F99A 2B24B 2OOVC 3F40A 3NHXA 1A67A 2JQ5A 3Q90A 2CWUA 3BNBA 2Q07A 2K0MA 4ZM8A 3WDGB 4K90B 2CFDA 3CCL3 4LGQA 2Z76A 2E2UA 1YVBI 2HMJB 3JVCA 2ZL8A 3K9MC 1WTHA 3DY5A 1IV9A 1SJWA 3EB8A 3KFQC 5LC6A 2Z6BA 1N5PA 4L7KA 5AIIA 3CCM3 3CCJ3 1IU7A 1FGTA 2WGOA 2O3OA 5KP3A 4HM3B 1ULIB 4NREA 2PZVA 5FW5A 1VZZA 2CFLA 2HMKB 3LYGA 3CCE3 3HI7A 4EXRA 4MEIA 1YJW3 1N9JA 3E99A 1VQM3 3QRDA 1W02A 2O9UX 2XEPA 5EVHA 3CCU3 3CCV3 3LTAA 1ROVA 1TIJA 1TUHA 3D9RA 3FG1A 1K734 1M1XB 1QAFA 3BNEA 3EN1B 3NX0A 4R1KA 3S28A 3GZYB 4LEHA 5AYSC 3WA2X 1UUVB 1JKGA 1SIIA 1NWWA 4XBXA 4N6MA 4XBTA 3T0UA 2XGNA 3ROBA 2FXTA 2OTL3 1DMMA 1VQ63 4AKYA 1DVDA 1FA3A 4MMYB 2XFTA 3FZWA 5AIHA 5CXOA 3RGAA 1LXEA 3F7XA 5IENA 2OCTA 1S5AA 1Z1SA 4PEJA 1GYBA 1SQWA 1FGQA 3NV0A 4HM7B 3BNCA 3LTDA 1ZX2A 2RGQA 1SPUA 4U13A 4HM0B 1MOLA 4KFDA 3SVAA 3I553 3UB1A 4HJLB 3FGYA 1NB5I 1W6YA 2W03A 1T5YA 2CH9A 1DYUA 1Q864 4HM8B 3S27A 3FCSB 3LH4A 3EJVA 3S29A 1W7CA 1JRQA 1NJI4 1IVWA 3MG3A 1W2B2 2E2TA 3PYJA 1TU5A 2BT3A 1Q824 3HZPA 3LTCA 2BNGA 1GD4A 4K1UA 3K7CA 2F86B 4R4KA 1E97A 5JBSA 1OPYA 2P05A 3NM7A 5ELUA 4N6UA 3SEDA 3B8LA 4G1MB 1RJOA 3ALAA 3BLZA 5IG5A 1VQ73 3CC43 1GY5A 3VGNA 4OUQA 4N6LA 4AKZA 4KZ1A 4BTXA 1VQP3 4XB5A 1VQK3 3NV0B 4HM4B 1N8QA 2D42A 4O02B 3MWZA 1TP6A 2KXGA 3EQQB 4KVHA 1IV7A 1UUWB 3WOFB 1E3RA 1IK3A 1OF5B 2HMNB 3EX9A 1WMPA 2YFLB 4L8OA 3MPHA 3DZLA 3IJEB 3KKGA 4XBYA 3F8HA 3CCR3 3X42A 3CMA3 2CHCA 1KC84 5JPUA 3H3HA 3X3YA 1IQYA 1HU9A 2JDIH 3EE1A 4FR9A 1VQ83 2QEX3 2GBWB 1N5HA 1VQO3 1JNQA 3MYTA 3CD63 3MHEA 6STDA 5KP4A 1IVXA 3OWYA 4FMCA 2XRXB 3X40A 2HMMB 4K1VA 1A2VA 1RRLA 1AVLA 2W56A 5G2GA 1AVKA 1OGZA 4QWTA 5AIFA 1YIJ3 1BUQA 1V74A 2FNQA 2CK3H 1IVUA 3MSOA 5EQLA 3S5CA 1TFKA 1ROAA 1STFI 3L0RA 2M7OA 3GAXA 1LOXA 4EV2A 2F98A 3FSDA 3SX1A 1Q814 3G6E3 1W6GA 1QVF2 1OGXA 2W2CA 3MG2A 1S723 1O7GB 2IA7A 2Z77A 2Y74A 1IQXA 4N3VA 4HVNA 3SXXA 1VQN3 5IG0A 3UL5A 3JUMA 4FCJA 3DGMA 3NQZA 4WHAA 2BMRB 2ML5A 1DVCA 1L5GB 3LOYA 2KRTA 1VQL3 2E2VA 3NBRA 3CC73 5AIGA 2BMQB 1GY7A 2CFWA 3HIIA 1YIT3 1UW1A 4KFEA 1OHOA 1QJGA 2GU3A 3GZBA 1OUNA 1GY6A 2SBLA 2YFJB 2INXA 3EBYA 3KSED 4IIAA 3V98A 3F7SA 3V99A 1D6YA 1O7MB 2GBXB 3LT8A 4Q53A 3U1WA 4FCZA 1VQ53 2WGQA 2QA43 2C11A 2OWPA 4MMZB 4HKVB 1UI7A 2XR8B 4O3VA 1NB3I 3OV4A 1W5ZA 1RN7A 4NHFA 1O7PB 1M1K4 2GXFA 3M8CA 3MKIA 2HMLB 3A76A 3LT9A 1STDA 4J8TA 2KCDA 2D1WA 3OWUA 2OQEA 1K9M4 4HBRA 1HKXA 3CXC2 3NQYA 3LTBA 1YJ93 2CC3A 1G96A 3OWSA 1K41A 2QIYA 3PCRA 3G0KA 2WO0A 1W01A 4X2OA 5IG4A 1N8R4 1JKGB 2MC8A 3NUVA 5JPPA 3VSYA 4EV5A 5I97A 1M9GA 3MG1A 1W4NA 3WA3A 3I0YA 3K5TA 4EC6A 2XSHB 3UL6A 3PXMA 5LC7A 3RGRA 3O8YA 4WFOA 1Q40A 4N6NB 1OCVA 2XGLA 3UJMA 4BTYA 4J9AA 4KFFA 3CNXA 4WYKA 1DMQA 1KWIA 3K63A 8CHOA 4MMXB 3G4S3 1E3VA 4HM5B 2BO9B 2STDA 3OXAA 2CG0A 3NM2A 1FGMA 3NXJA 3N8BA 3EBTA 3CC23 3B4OA 1SIHA 2ML6A 4HM1B 3RDEA 1VQ43 3DGLA 1QAKA 3LZAA 3G16A 1W6CA 3CCQ3 2WOFA 2XH9A 2CW9A 1O7WB 2GEXA 5KP1A 3FF2A 3DMCA 4XDWA 5A0OB 4IPBA 5D82A 5IEOA 4JF8A 1IQ8A 3LMLA 4LZIA 1Y4KA 4H61A 2GEYA 2PNCA 3D3LA 2BMOB 3UNLA 3KN4A 1ASKA 1KQS2 1WQLB 2OQEC 1IT7A 3AMOA 1U5OA 5TGNA 3BB9A 3F9SA 3PZWA 3IMAB 4FCMA 3SOAA 1PFPA 2W9QA 1FGRA 2CFGA 4HM2B 3B4PA 1GS3A 2CFKA 2B1XB 4GB5A 3DUKA 1UI8A 4FMAA 1YJN3 3HX8A 3HK4A 4O2HA 4I4KA 1J2BA 3K0ZA 4RNZA 2BHMA 5AI1A 1M904 4HM6B 1EQKA 1Q40B 1NDOB 3STDA 4XM4A 2R4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBR A;  4IPB A;  3U1W A;  4FR9 A;  4K61 A; 
#chains in the Genus database with same CATH topology
 5DRV A;  1YI2 3;  4WYK B;  1BNG A;  1RCL A;  2C10 A;  3KSP A;  3H51 A;  3Q1C A;  3FG4 A;  5BXQ A;  3JUP A;  1RSN A;  4WWU C;  2K54 A;  2UX0 A;  4MJD A;  1W00 A;  4RBN A;  1RGL A;  5DRE A;  1EG9 B;  2P38 A;  3D79 A;  2XF3 A;  4NPB A;  3WR2 A;  3CME 3;  2A15 A;  1MWT A;  2I9W A;  3N54 B;  1VQ9 3;  3CU3 A;  1Q9E A;  2YFI B;  1NU3 A;  3X3X A;  3CPW 2;  5STD A;  1JZD A;  3PCS A;  1DMN A;  1OH0 A;  2OTJ 3;  4GHO A;  1D6U A;  4EBG A;  1K28 A;  4ORL A;  1I2F A;  3ECF A;  3JUN A;  5CLK A;  1X1W A;  2CKF B;  2CX1 A;  3V92 A;  1YVS A;  1O7H B;  2CWT A;  3DGN A;  4GL6 A;  4FMD A;  3ER7 A;  1IDP A;  5ELJ A;  5AEU B;  4TX4 A;  2CG1 A;  1G0T A;  3EN8 A;  4N6O B;  1BAO A;  2K3D A;  1QVG 2;  1BU4 A;  3G71 3;  4R9K A;  3AMO B;  3SLU A;  4N6T A;  3WOE B;  1U8C B;  3KZT A;  4XDV A;  3GZX B;  2Z7A A;  1A90 A;  3TDG A;  1JZO A;  6GSP A;  1RRH A;  1AV4 A;  3EC9 A;  1RLS A;  5EEO A;  1ULJ B;  3G8Z A;  2GU1 A;  4HAA A;  4L8P A;  3JUQ A;  1B3S A;  4STD A;  2W56 B;  1BIR A;  1PU4 A;  3OX9 A;  1BSA A;  2KF5 A;  2W04 A;  3D4A A;  5IW9 A;  1GD3 A;  1DE3 A;  3HIG A;  2BIR A;  3BU4 A;  1BSD A;  1RNB A;  3OW2 2;  1Q7Y 4;  3EF8 A;  3QK9 A;  4EYC A;  3D5I A;  4K61 A;  5FGO A;  1BVI A;  3VF1 A;  3I56 3;  4JRF A;  1JN5 A;  2CIU A;  3CNM A;  3DGO A;  4R80 A;  1GMP A;  1KD1 4;  2V1L A;  1OF5 A;  4CDL A;  4BTW A;  5AEW B;  2P0M A;  1RKY A;  1K8A 4;  1RHL A;  2ZDJ A;  2F4Y A;  3PS8 A;  3SOY A;  3NBJ A;  1NO3 A;  2WOH A;  3JUO A;  2RSX A;  3F14 A;  3FG3 A;  3DXO A;  3ZG0 A;  3GZR A;  1Q42 A;  3Q2P A;  2OOV A;  3CCS 3;  1FGO A;  4RNY A;  5D83 A;  1RGF A;  1YHQ 3;  4HZ9 B;  2W0Q A;  1YGE A;  1IT8 A;  2CX0 A;  1WMO A;  1FYS A;  2IUK A;  3LXU X;  2YX9 A;  1O7N B;  1JB2 A;  1ZO2 A;  3N9H A;  3S67 A;  1LNH A;  3F8X A;  2Y73 A;  2XFS A;  3NBB A;  5BVB A;  7STD A;  3IPT A;  1C7H A;  1OHP A;  1QMA A;  1OAC A;  1T2I A;  1WMN A;  1R4C A;  2MF7 A;  3KCH A;  5IER A;  3J7Y d;  3FF0 A;  2P09 A;  2RFR A;  3DH2 A;  3T8U A;  1OHS A;  3BND A;  2F56 A;  3A5E A;  1RGA A;  4OK0 A;  3WOD G;  4LMI A;  4R9L A;  2HMO B;  1BSE A;  3EHC A;  1W2Z A;  3PGB A;  2RCD A;  5HGR A;  1RGH A;  2KAA A;  2LQV A;  1RGK A;  3GRD A;  8RNT A;  2CWV A;  1BRI A;  4N6V 0;  3X3Z A;  1F8N A;  1CYU A;  1QAL A;  1FUW A;  1N9E A;  3CPO A;  4IT7 A;  1A2K A;  2P0X A;  2UUG C;  4H3U A;  1FUS A;  1TRP A;  4RZM A;  2FGT A;  3GWR A;  5D81 A;  4AEQ A;  5CF1 A;  5CK6 A;  2IUJ A;  5IEP A;  1AR0 A;  1IVV A;  1JB4 A;  2W9P A;  1ISK A;  1TFO A;  1I2E A;  1BRK A;  1CQS A;  2L4V A;  3FLJ A;  4CCV A;  1D6Z A;  2C4B A;  3KE7 A;  1MNL A;  4HYZ A;  4O8S A;  1JN5 B;  3WMD A;  4HZB B;  3U97 A;  4LSO A;  1JV2 B;  3FH1 A;  5IF6 A;  3X41 A;  2XSO B;  1GOY A;  1BSC A;  2BU4 A;  3T8N A;  5M1A A;  1US1 A;  1EKM A;  3KII A;  4OVM A;  2IMJ A;  1WNH A;  3B7C A;  3D5G A;  4ILF A;  5CF2 A;  2QGU A;  1KSI A;  1LVN A;  2W6J H;  1RGC A;  1TJD A;  2LYX A;  1JJ2 2;  3DM8 A;  1CYV A;  1JB5 A;  4FMB A;  1CEW I;  4RNT A;  4X2H A;  5AYR B;  4WP5 A;  3FKA A;  1EA2 A;  2F99 A;  2B24 B;  2OOV C;  3F40 A;  3NHX A;  1A67 A;  2JQ5 A;  3Q90 A;  2CWU A;  3BNB A;  2Q07 A;  1LOW A;  2K0M A;  4ZM8 A;  3WDG B;  4K90 B;  2CFD A;  3CCL 3;  4LGQ A;  2Z76 A;  2E2U A;  1YVB I;  2HMJ B;  3JVC A;  2ZL8 A;  3K9M C;  1WTH A;  3DY5 A;  1IV9 A;  1SJW A;  3EB8 A;  1B2U A;  3KFQ C;  1LQM B;  1B2X A;  1N5P A;  2Z6B A;  4L7K A;  5AII A;  1AQZ A;  1GOV A;  3CCJ 3;  3CCM 3;  1IU7 A;  4BIR A;  2HOH A;  1FGT A;  2WGO A;  2O3O A;  5KP3 A;  4HM3 B;  1ULI B;  1B20 A;  4NRE A;  1RN4 A;  2PZV A;  5FW5 A;  1VZZ A;  2CFL A;  2HMK B;  3LYG A;  3CCE 3;  1BRS A;  3HI7 A;  3Q3F A;  1B27 A;  4EXR A;  4MEI A;  1YJW 3;  1N9J A;  3E99 A;  4J5K A;  1VQM 3;  3QRD A;  1W02 A;  1I8V A;  2O9U X;  2XEP A;  4HOH A;  5EVH A;  3CCU 3;  3LTA A;  1ROV A;  1MWR A;  1TIJ A;  1TUH A;  3D9R A;  9RNT A;  1MWS A;  2UGI A;  3FG1 A;  1NNV A;  1K73 4;  1RCK A;  2KF6 A;  1M1X B;  1QAF A;  3BNE A;  3EN1 B;  3NX0 A;  4LYL B;  4R1K A;  3S28 A;  4BL2 A;  1BNS A;  3GZY B;  3AHW A;  4LEH A;  5AYS C;  2L1S A;  3WA2 X;  1UUV B;  1JKG A;  1LNI A;  1SII A;  1NWW A;  4XBX A;  4N6M A;  4XBT A;  3T0U A;  1JBS A;  2XGN A;  3ROB A;  2FXT A;  1I0X A;  2OTL 3;  1DMM A;  1VQ6 3;  4AKY A;  1DVD A;  1FA3 A;  1JBT A;  4MMY B;  2XFT A;  3FZW A;  5AIH A;  1T2H A;  5CXO A;  3ZFZ A;  3RGA A;  1LXE A;  1EEJ A;  1RN1 A;  3F7X A;  5IEN A;  2OCT A;  1S5A A;  1Z1S A;  4PEJ A;  1MGR A;  1GYB A;  1SQW A;  1FGQ A;  3NV0 A;  4HM7 B;  3CCV 3;  1GSP A;  3BNC A;  3LTD A;  1ZX2 A;  2RGQ A;  1SPU A;  4U13 A;  4HM0 B;  1MGW A;  2F5W A;  1MOL A;  4KFD A;  3SVA A;  3I55 3;  1Q7H A;  3UB1 A;  4HJL B;  3FGY A;  1NB5 I;  1W6Y A;  2W03 A;  5BU4 A;  1T5Y A;  2CH9 A;  2IY2 A;  1DYU A;  1Q86 4;  1BAN A;  4HM8 B;  5LC6 A;  3S27 A;  3FCS B;  3LH4 A;  1BOX A;  3EJV A;  3S29 A;  6RNT A;  4GSP A;  5IG3 A;  1I2G A;  1W7C A;  1A2P A;  1JRQ A;  1NJI 4;  1IVW A;  3MG3 A;  1W2B 2;  2E2T A;  2SAR A;  3PYJ A;  3AGN A;  1UUG B;  1TU5 A;  2BT3 A;  1Q82 4;  1IYY A;  3HZP A;  1BRN L;  1V58 A;  3LTC A;  3DGY A;  1I3I A;  2BNG A;  1GD4 A;  4K1U A;  3K7C A;  2F86 B;  5RNT A;  4R4K A;  1E97 A;  5JBS A;  1OPY A;  2P05 A;  3NM7 A;  1GOU A;  3SYU A;  5ELU A;  4N6U A;  1CH0 A;  1R4Y A;  3SED A;  3B8L A;  1B2S A;  1UCK A;  1T3B A;  1RJO A;  3ALA A;  4G1M B;  3BLZ A;  5IG5 A;  5M18 A;  1YNV X;  1VQ7 3;  3CC4 3;  1SAR A;  1FUT A;  1GY5 A;  3VGN A;  4OUQ A;  4N6L A;  4AKZ A;  4KZ1 A;  4BTX A;  1VQP 3;  4XB5 A;  2GSP A;  1VQK 3;  3NV0 B;  4HM4 B;  1TRQ A;  1N8Q A;  4I5Q A;  2D42 A;  4O02 B;  3MWZ A;  1TP6 A;  1UCJ A;  2KXG A;  3EQQ B;  4KVH A;  1B2M A;  1IV7 A;  1UUW B;  1LOV A;  3WOF B;  1RGG A;  1E3R A;  1UGH I;  1IK3 A;  1OF5 B;  2HMN B;  3EX9 A;  1WMP A;  2YFL B;  4L8O A;  3MPH A;  3DZL A;  3IJE B;  3KKG A;  3AGO A;  4XBY A;  3F8H A;  4CPK A;  3CCR 3;  1AY7 A;  1ZS7 A;  3X42 A;  1GMR A;  3CMA 3;  1V57 A;  2CHC A;  1KC8 4;  5JPU A;  3H3H A;  3X3Y A;  1IQY A;  1BGS A;  1HU9 A;  2JDI H;  3EE1 A;  4FR9 A;  1LQG C;  1VQ8 3;  1EUI C;  2GBW B;  2QEX 3;  1N5H A;  1C54 A;  1VQO 3;  1BNJ A;  1JNQ A;  3MYT A;  3CD6 3;  1FW7 A;  3MHE A;  1B2Z A;  6STD A;  5KP4 A;  1IVX A;  3OWY A;  4FMC A;  2XRX B;  3X40 A;  1ZGX A;  2HMM B;  4K1V A;  1A2V A;  1BRJ A;  1RRL A;  1AVL A;  2W56 A;  5G2G A;  1AVK A;  1OGZ A;  4QWT A;  5AIF A;  1YIJ 3;  2H0I A;  1V74 A;  2ZHX B;  2FNQ A;  1BUQ A;  2CK3 H;  1IVU A;  3MSO A;  5EQL A;  3S5C A;  1TFK A;  1ROA A;  1STF I;  3L0R A;  2M7O A;  3GAX A;  1BRG A;  1LOX A;  3RNT A;  3BIR A;  4EV2 A;  4KT3 B;  2F98 A;  3FSD A;  3SX1 A;  1Q81 4;  1RNT A;  3G6E 3;  1UCL A;  1W6G A;  1QVF 2;  1HYF A;  1PYL A;  1OGX A;  2R41 A;  2W2C A;  3MG2 A;  1S72 3;  1GMQ A;  1O7G B;  2IA7 A;  2Z77 A;  1X1X A;  2Y74 A;  1IQX A;  2RNT A;  4N3V A;  4HVN A;  3SXX A;  1VQN 3;  2H0H A;  5IG0 A;  1HZ1 A;  3UL5 A;  5M19 A;  3JUM A;  4FCJ A;  3DGM A;  3NQZ A;  1BNI A;  4WHA A;  5G1K A;  2BMR B;  2ML5 A;  4BL3 A;  1DVC A;  1L5G B;  3LOY A;  2KRT A;  1VQL 3;  2E2V A;  3URP A;  3NBR A;  3CC7 3;  5AIG A;  1BSB A;  1GY7 A;  2BMQ B;  1I0V A;  2CFW A;  3HII A;  1BNF A;  1YIT 3;  1UW1 A;  4KFE A;  1OHO A;  3ZG5 A;  1QJG A;  1RTU A;  2GU3 A;  1I70 A;  1RDS A;  3GZB A;  1OUN A;  3WHO A;  1GY6 A;  2SBL A;  2YFJ B;  2INX A;  3EBY A;  3KSE D;  4IIA A;  3V98 A;  1LOY A;  3F7S A;  1D6Y A;  1O7M B;  2GBX B;  3LT8 A;  3V99 A;  1UGI A;  4Q53 A;  3U1W A;  4FCZ A;  5BIR A;  1VQ5 3;  1I3F A;  2WGQ A;  2QA4 3;  2C11 A;  2OWP A;  4MMZ B;  4HKV B;  1UI7 A;  2XR8 B;  4O3V A;  1NB3 I;  3OV4 A;  4DKI A;  1W5Z A;  1RN7 A;  4NHF A;  1O7P B;  1M1K 4;  1BUJ A;  1DET A;  2GXF A;  3M8C A;  3MKI A;  2HML B;  3A76 A;  3LT9 A;  1STD A;  2AAD A;  7GSP A;  4J8T A;  5G1L A;  2KCD A;  2D1W A;  3OWU A;  2OQE A;  1K9M 4;  4HBR A;  1HKX A;  3CXC 2;  3NQY A;  1YGW A;  3LTB A;  1YJ9 3;  2CC3 A;  1G96 A;  3OWS A;  1K41 A;  2QIY A;  3PCR A;  3G0K A;  2WO0 A;  1TTO A;  1W01 A;  1VQQ A;  4X2O A;  5IG4 A;  4EW5 A;  1N8R 4;  1JKG B;  2MC8 A;  3NUV A;  5JPP A;  3VSY A;  4EV5 A;  5I97 A;  4CJN A;  1M9G A;  3MG1 A;  1W4N A;  1MWU A;  3WA3 A;  3I0Y A;  1RGE A;  3K5T A;  4EC6 A;  2XSH B;  3UL6 A;  3HOH A;  1B21 A;  3PXM A;  5LC7 A;  3RGR A;  3O8Y A;  4WFO A;  1Q40 A;  4N6N B;  1OCV A;  2H0G A;  2XGL A;  3UJM A;  4BTY A;  4J5G A;  4J9A A;  4KFF A;  3CNX A;  4WYK A;  1DMQ A;  1KWI A;  3K63 A;  8CHO A;  4MMX B;  2RBI A;  3G4S 3;  1E3V A;  4HM5 B;  2BO9 B;  2STD A;  3OXA A;  2CG0 A;  3NM2 A;  1FGM A;  3NXJ A;  2KF3 A;  3N8B A;  3EBT A;  5GSP A;  3CC2 3;  1BNE A;  3GSP A;  1BRH A;  1SIH A;  2ML6 A;  3B4O A;  4HM1 B;  3RDE A;  1VQ4 3;  3DGL A;  1QAK A;  3LZA A;  3G16 A;  1W6C A;  3CCQ 3;  2WOF A;  2XH9 A;  2CW9 A;  1O7W B;  2GEX A;  1BNR A;  5KP1 A;  3FF2 A;  3DMC A;  4XDW A;  3AHS A;  5A0O B;  4IPB A;  7RNT A;  5D82 A;  2AAE A;  5IEO A;  4JF8 A;  1IQ8 A;  3LML A;  4LZI A;  1Y4K A;  4H61 A;  2GEY A;  2PNC A;  2ZA4 A;  3D3L A;  2BMO B;  1LRA A;  3UNL A;  1FZU A;  3KN4 A;  1ASK A;  1KQS 2;  1WQL B;  2OQE C;  2F5M A;  1IT7 A;  1X1U A;  3AMO A;  1U5O A;  2KF4 A;  5TGN A;  3BB9 A;  3F9S A;  3PZW A;  3IMA B;  4FCM A;  3SOA A;  1PFP A;  2W9Q A;  1FGR A;  2CFG A;  2IYJ A;  4HM2 B;  3B4P A;  1X1Y A;  4BU4 A;  1GS3 A;  2CFK A;  2B1X B;  4GB5 A;  2J8X B;  1G02 A;  1UI8 A;  3DUK A;  5HOH A;  4FMA A;  1YJN 3;  3HX8 A;  3HK4 A;  1UDI I;  4I4K A;  4O2H A;  3K0Z A;  1PY3 A;  2BHM A;  4RNZ A;  5AI1 A;  1M90 4;  1J2B A;  1JBR A;  4HM6 B;  1EQK A;  1Q40 B;  1NDO B;  1RMS A;  1UCI A;  3STD A;  4XM4 A;  2R4I A; 
#chains in the Genus database with same CATH homology
 5DRV A;  1YI2 3;  4WYK B;  2C10 A;  3KSP A;  3H51 A;  3Q1C A;  3FG4 A;  5BXQ A;  3JUP A;  4WWU C;  2K54 A;  2UX0 A;  4MJD A;  1W00 A;  4RBN A;  5DRE A;  1EG9 B;  2P38 A;  3CME 3;  2XF3 A;  2A15 A;  2I9W A;  3N54 B;  1VQ9 3;  3CU3 A;  3X3X A;  2YFI B;  1NU3 A;  3CPW 2;  5STD A;  3PCS A;  1DMN A;  1OH0 A;  2OTJ 3;  4EBG A;  1D6U A;  1K28 A;  4ORL A;  3ECF A;  3JUN A;  5CLK A;  2CKF B;  3V92 A;  1O7H B;  2CWT A;  3DGN A;  4GL6 A;  4FMD A;  3ER7 A;  1IDP A;  5ELJ A;  5AEU B;  4TX4 A;  2CG1 A;  3EN8 A;  4N6O B;  1QVG 2;  3G71 3;  4R9K A;  3AMO B;  3SLU A;  4N6T A;  3WOE B;  1U8C B;  3KZT A;  4XDV A;  3GZX B;  2Z7A A;  1A90 A;  3TDG A;  1RRH A;  1AV4 A;  3EC9 A;  5EEO A;  1ULJ B;  3G8Z A;  2GU1 A;  4L8P A;  3JUQ A;  4STD A;  2W56 B;  1PU4 A;  3OX9 A;  2W04 A;  5IW9 A;  1GD3 A;  3HIG A;  3OW2 2;  1Q7Y 4;  3EF8 A;  3QK9 A;  4EYC A;  4K61 A;  5FGO A;  3VF1 A;  3I56 3;  4JRF A;  1JN5 A;  2CIU A;  3CNM A;  3DGO A;  4R80 A;  1KD1 4;  2V1L A;  1OF5 A;  4CDL A;  4BTW A;  5AEW B;  2P0M A;  1RKY A;  1K8A 4;  2ZDJ A;  3PS8 A;  3SOY A;  3NBJ A;  1NO3 A;  2WOH A;  3JUO A;  2RSX A;  3F14 A;  3FG3 A;  3DXO A;  3GZR A;  1Q42 A;  3Q2P A;  2OOV A;  3CCS 3;  1FGO A;  4RNY A;  5D83 A;  1YHQ 3;  4HZ9 B;  2W0Q A;  1YGE A;  1IT8 A;  1WMO A;  3LXU X;  2IUK A;  2YX9 A;  1O7N B;  1JB2 A;  1ZO2 A;  3N9H A;  3S67 A;  1LNH A;  3F8X A;  2Y73 A;  2XFS A;  3NBB A;  5BVB A;  7STD A;  3IPT A;  1C7H A;  1OHP A;  1QMA A;  1OAC A;  1WMN A;  2MF7 A;  1R4C A;  5IG3 A;  5IER A;  3J7Y d;  3FF0 A;  2P09 A;  2RFR A;  3T8U A;  1OHS A;  3BND A;  4OK0 A;  3WOD G;  4LMI A;  4R9L A;  2HMO B;  3EHC A;  1W2Z A;  3PGB A;  2RCD A;  5HGR A;  2LQV A;  3GRD A;  2CWV A;  4N6V 0;  3X3Z A;  1F8N A;  1CYU A;  1QAL A;  1FUW A;  1N9E A;  3CPO A;  4IT7 A;  1A2K A;  2P0X A;  4H3U A;  4RZM A;  2FGT A;  3GWR A;  5D81 A;  4AEQ A;  5CF1 A;  5CK6 A;  2IUJ A;  5IEP A;  1IVV A;  1AR0 A;  1JB4 A;  2W9P A;  1ISK A;  1TFO A;  1CQS A;  2L4V A;  3FLJ A;  4CCV A;  1D6Z A;  4O8S A;  3KE7 A;  1MNL A;  4HYZ A;  1JN5 B;  3WMD A;  4HZB B;  3U97 A;  4LSO A;  1JV2 B;  3FH1 A;  5IF6 A;  3X41 A;  2XSO B;  3T8N A;  1US1 A;  1EKM A;  3KII A;  4OVM A;  2IMJ A;  1WNH A;  3B7C A;  5CF2 A;  2QGU A;  1KSI A;  1LVN A;  2W6J H;  2LYX A;  1JJ2 2;  3DM8 A;  1CYV A;  1JB5 A;  4FMB A;  1CEW I;  4X2H A;  5AYR B;  4WP5 A;  3FKA A;  1EA2 A;  2F99 A;  2B24 B;  2OOV C;  3F40 A;  3NHX A;  1A67 A;  2JQ5 A;  3Q90 A;  2CWU A;  3BNB A;  2Q07 A;  2K0M A;  4ZM8 A;  3WDG B;  4K90 B;  2CFD A;  3CCL 3;  4LGQ A;  2Z76 A;  2E2U A;  1YVB I;  2HMJ B;  3JVC A;  2ZL8 A;  3K9M C;  1WTH A;  3DY5 A;  1IV9 A;  1SJW A;  3EB8 A;  3KFQ C;  5LC6 A;  2Z6B A;  1N5P A;  4L7K A;  5AII A;  3CCM 3;  3CCJ 3;  1IU7 A;  1FGT A;  2WGO A;  2O3O A;  5KP3 A;  4HM3 B;  1ULI B;  4NRE A;  2PZV A;  5FW5 A;  1VZZ A;  2CFL A;  2HMK B;  3LYG A;  3CCE 3;  3HI7 A;  4EXR A;  4MEI A;  1YJW 3;  1N9J A;  3E99 A;  1VQM 3;  3QRD A;  1W02 A;  2O9U X;  2XEP A;  5EVH A;  3CCU 3;  3CCV 3;  3LTA A;  1ROV A;  1TIJ A;  1TUH A;  3D9R A;  3FG1 A;  1K73 4;  1M1X B;  1QAF A;  3BNE A;  3EN1 B;  3NX0 A;  4R1K A;  3S28 A;  3GZY B;  4LEH A;  5AYS C;  3WA2 X;  1UUV B;  1JKG A;  1SII A;  1NWW A;  4XBX A;  4N6M A;  4XBT A;  3T0U A;  2XGN A;  3ROB A;  2FXT A;  2OTL 3;  1DMM A;  1VQ6 3;  4AKY A;  1DVD A;  1FA3 A;  4MMY B;  2XFT A;  3FZW A;  5AIH A;  5CXO A;  3RGA A;  1LXE A;  3F7X A;  5IEN A;  2OCT A;  1S5A A;  1Z1S A;  4PEJ A;  1GYB A;  1SQW A;  1FGQ A;  3NV0 A;  4HM7 B;  3BNC A;  3LTD A;  1ZX2 A;  2RGQ A;  1SPU A;  4U13 A;  4HM0 B;  1MOL A;  4KFD A;  3SVA A;  3I55 3;  3UB1 A;  4HJL B;  3FGY A;  1NB5 I;  1W6Y A;  2W03 A;  1T5Y A;  2CH9 A;  1DYU A;  1Q86 4;  4HM8 B;  3S27 A;  3FCS B;  3LH4 A;  3EJV A;  3S29 A;  1W7C A;  1JRQ A;  1NJI 4;  1IVW A;  3MG3 A;  1W2B 2;  2E2T A;  3PYJ A;  1TU5 A;  2BT3 A;  1Q82 4;  3HZP A;  3LTC A;  2BNG A;  1GD4 A;  4K1U A;  3K7C A;  2F86 B;  4R4K A;  1E97 A;  5JBS A;  1OPY A;  2P05 A;  3NM7 A;  5ELU A;  4N6U A;  3SED A;  3B8L A;  4G1M B;  1RJO A;  3ALA A;  3BLZ A;  5IG5 A;  1VQ7 3;  3CC4 3;  1GY5 A;  3VGN A;  4OUQ A;  4N6L A;  4AKZ A;  4KZ1 A;  4BTX A;  1VQP 3;  4XB5 A;  1VQK 3;  3NV0 B;  4HM4 B;  1N8Q A;  2D42 A;  4O02 B;  3MWZ A;  1TP6 A;  2KXG A;  3EQQ B;  4KVH A;  1IV7 A;  1UUW B;  3WOF B;  1E3R A;  1IK3 A;  1OF5 B;  2HMN B;  3EX9 A;  1WMP A;  2YFL B;  4L8O A;  3MPH A;  3DZL A;  3IJE B;  3KKG A;  4XBY A;  3F8H A;  3CCR 3;  3X42 A;  3CMA 3;  2CHC A;  1KC8 4;  5JPU A;  3H3H A;  3X3Y A;  1IQY A;  1HU9 A;  2JDI H;  3EE1 A;  4FR9 A;  1VQ8 3;  2QEX 3;  2GBW B;  1N5H A;  1VQO 3;  1JNQ A;  3MYT A;  3CD6 3;  3MHE A;  6STD A;  5KP4 A;  1IVX A;  3OWY A;  4FMC A;  2XRX B;  3X40 A;  2HMM B;  4K1V A;  1A2V A;  1RRL A;  1AVL A;  2W56 A;  5G2G A;  1AVK A;  1OGZ A;  4QWT A;  5AIF A;  1YIJ 3;  1BUQ A;  1V74 A;  2FNQ A;  2CK3 H;  1IVU A;  3MSO A;  5EQL A;  3S5C A;  1TFK A;  1ROA A;  1STF I;  3L0R A;  2M7O A;  3GAX A;  1LOX A;  4EV2 A;  2F98 A;  3FSD A;  3SX1 A;  1Q81 4;  3G6E 3;  1W6G A;  1QVF 2;  1OGX A;  2W2C A;  3MG2 A;  1S72 3;  1O7G B;  2IA7 A;  2Z77 A;  2Y74 A;  1IQX A;  4N3V A;  4HVN A;  3SXX A;  1VQN 3;  5IG0 A;  3UL5 A;  3JUM A;  4FCJ A;  3DGM A;  3NQZ A;  4WHA A;  2BMR B;  2ML5 A;  1DVC A;  1L5G B;  3LOY A;  2KRT A;  1VQL 3;  2E2V A;  3NBR A;  3CC7 3;  5AIG A;  2BMQ B;  1GY7 A;  2CFW A;  3HII A;  1YIT 3;  1UW1 A;  4KFE A;  1OHO A;  1QJG A;  2GU3 A;  3GZB A;  1OUN A;  1GY6 A;  2SBL A;  2YFJ B;  2INX A;  3EBY A;  3KSE D;  4IIA A;  3V98 A;  3F7S A;  3V99 A;  1D6Y A;  1O7M B;  2GBX B;  3LT8 A;  4Q53 A;  3U1W A;  4FCZ A;  1VQ5 3;  2WGQ A;  2QA4 3;  2C11 A;  2OWP A;  4MMZ B;  4HKV B;  1UI7 A;  2XR8 B;  4O3V A;  1NB3 I;  3OV4 A;  1W5Z A;  1RN7 A;  4NHF A;  1O7P B;  1M1K 4;  2GXF A;  3M8C A;  3MKI A;  2HML B;  3A76 A;  3LT9 A;  1STD A;  4J8T A;  2KCD A;  2D1W A;  3OWU A;  2OQE A;  1K9M 4;  4HBR A;  1HKX A;  3CXC 2;  3NQY A;  3LTB A;  1YJ9 3;  2CC3 A;  1G96 A;  3OWS A;  1K41 A;  2QIY A;  3PCR A;  3G0K A;  2WO0 A;  1W01 A;  4X2O A;  5IG4 A;  1N8R 4;  1JKG B;  2MC8 A;  3NUV A;  5JPP A;  3VSY A;  4EV5 A;  5I97 A;  1M9G A;  3MG1 A;  1W4N A;  3WA3 A;  3I0Y A;  3K5T A;  4EC6 A;  2XSH B;  3UL6 A;  3PXM A;  5LC7 A;  3RGR A;  3O8Y A;  4WFO A;  1Q40 A;  4N6N B;  1OCV A;  2XGL A;  3UJM A;  4BTY A;  4J9A A;  4KFF A;  3CNX A;  4WYK A;  1DMQ A;  1KWI A;  3K63 A;  8CHO A;  4MMX B;  3G4S 3;  1E3V A;  4HM5 B;  2BO9 B;  2STD A;  3OXA A;  2CG0 A;  3NM2 A;  1FGM A;  3NXJ A;  3N8B A;  3EBT A;  3CC2 3;  3B4O A;  1SIH A;  2ML6 A;  4HM1 B;  3RDE A;  1VQ4 3;  3DGL A;  1QAK A;  3LZA A;  3G16 A;  1W6C A;  3CCQ 3;  2WOF A;  2XH9 A;  2CW9 A;  1O7W B;  2GEX A;  5KP1 A;  3FF2 A;  3DMC A;  4XDW A;  5A0O B;  4IPB A;  5D82 A;  5IEO A;  4JF8 A;  1IQ8 A;  3LML A;  4LZI A;  1Y4K A;  4H61 A;  2GEY A;  2PNC A;  3D3L A;  2BMO B;  3UNL A;  3KN4 A;  1ASK A;  1KQS 2;  1WQL B;  2OQE C;  1IT7 A;  3AMO A;  1U5O A;  5TGN A;  3BB9 A;  3F9S A;  3PZW A;  3IMA B;  4FCM A;  3SOA A;  1PFP A;  2W9Q A;  1FGR A;  2CFG A;  4HM2 B;  3B4P A;  1GS3 A;  2CFK A;  2B1X B;  4GB5 A;  3DUK A;  1UI8 A;  4FMA A;  1YJN 3;  3HX8 A;  3HK4 A;  4O2H A;  4I4K A;  1J2B A;  3K0Z A;  4RNZ A;  2BHM A;  5AI1 A;  1M90 4;  4HM6 B;  1EQK A;  1Q40 B;  1NDO B;  3STD A;  4XM4 A;  2R4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...