1JB2A

Crystal structure of ntf2 m84e mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISEVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb2A00
2YFLB 4R9LA 3EN8A 3GWRA 1BUQA 1GY5A 2B24B 3MSOA 1E3RA 1EA2A 1O7WB 3HK4A 5IEPA 2F86B 3OWSA 3RGAA 5D81A 3JUPA 4OUQA 4HM0B 2UX0A 4HZBB 1K41A 3BLZA 2GEXA 3EBTA 3HX8A 3SOYA 3FF2A 3DUKA 1W00A 5D82A 3OX9A 4CDLA 4XBTA 2INXA 4OVMA 4U13A 1C7HA 2RFRA 3F8HA 4STDA 3JUMA 3MYTA 1OHOA 3M8CA 4HVNA 3NM2A 2K54A 4K1VA 2HMJB 2RCDA 1IDPA 1ISKA 1OF5A 5IG4A 3KE7A 5AIGA 5BXQA 2BMOB 5IEOA 3OWYA 2QGUA 3MG3A 1HKXA 1QMAA 1CQSA 3G0KA 1OF5B 4PEJA 4FCMA 1QJGA 5KP3A 3I0YA 1GY7A 2IMJA 4HKVB 5TGNA 3F14A 3B4OA 3VSYA 1OHPA 1NU3A 1OHSA 4HM1B 3T8NA 4HM3B 3GZYB 1W02A 3NUVA 3JUNA 1GY6A 4X2HA 3GZRA 2HMNB 3Q90A 1Z1SA 3ECFA 5JPPA 1W6YA 3D9RA 4H3UA 2OWPA 1UUWB 3GZBA 3MG2A 4J9AA 1GYBA 1JN5A 8CHOA 3NV0A 7STDA 3NXJA 1UUVB 1NDOB 4WYKA 3SEDA 2Z7AA 2F99A 3F8XA 2F98A 5CXOA 1E3VA 3OV4A 1O7PB 5IERA 3NV0B 3CPOA 4Q53A 4GB5A 2B1XB 3DZLA 3ROBA 2YFIB 5AIHA 3FSDA 4HM2B 3B7CA 1DMNA 4L7KA 2XSOB 4HM4B 3T8UA 3A76A 3K0ZA 3MG1A 3FH1A 1O7MB 1JB4A 2GXFA 1U5OA 3FGYA 3LYGA 5AEUB 4K1UA 4RZMA 3EHCA 3KSPA 3E99A 5IG0A 5AIFA 1SJWA 5AI1A 4N3VA 3OWUA 1DMMA 3UNLA 3EC9A 4HZ9B 2XRXB 3CU3A 3HZPA 5KP4A 5IG3A 5D83A 4FCJA 3GRDA 4KVHA 3JUOA 1TUHA 3F7XA 2XSHB 4XBXA 2I9WA 1Q40A 3B8LA 1A2KA 3IPTA 2W2CA 1W01A 3FZWA 4IIAA 1NWWA 2HMLB 4I4KA 5CF2A 4HJLB 5CK6A 3DM8A 2Z77A 4WP5A 2Z76A 1JB5A 2GBXB 5IF6A 2GBWB 3FF0A 3KZTA 1DMQA 1OPYA 5IENA 2JQ5A 2GEYA 2CHCA 1ULIB 1JN5B 4LMIA 3EQQB 1ASKA 4WYKB 2BMQB 2BMRB 5BVBA 1ZO2A 2XR8B 1O7GB 3EBYA 1TP6A 1ZX2A 2HMMB 1OGXA 1GS3A 1S5AA 1WQLB 1ULJB 4ORLA 3G16A 4XM4A 2HMOB 1VZZA 4HM6B 3MKIA 1Q42A 4HM5B 3VGNA 5STDA 3CNXA 4J8TA 4X2OA 3DMCA 3G8ZA 5G2GA 5HGRA 3FLJA 5IG5A 2HMKB 5AIIA 2R4IA 4LGQA 1O7NB 3RGRA 1O7HB 1OUNA 2A15A 4R1KA 4L8OA 1EG9B 4MJDA 3EN1B 3BB9A 3KKGA 4HM7B 3JUQA 4XDVA 1STDA 3OXAA 3S5CA 4XB5A 3MHEA 3EJVA 1Q40B 3H51A 5KP1A 2QIYA 1OCVA 5AEWB 1JB2A 4L8PA 3NHXA 2BNGA 3EF8A 2CKFB 5DRVA 5DREA 4XDWA 1OH0A 3CNMA 3SOAA 5JPUA 3LZAA 6STDA 5CLKA 3DXOA 2STDA 3F40A 2RGQA 3F9SA 4HM8B 3UJMA 3STDA 4R9KA 1OGZA 3FKAA 5CF1A 1JKGA 2YFJB 3B4PA 3NBRA 3K7CA 3GZXB 1JKGB 5FW5A 1E97A 3EX9A 3H3HA 4XBYA 3WMDA 1AR0A 4WWUC 5EVHA 2PZVA 3ER7A 4LEHA 3F7SA
chains in the Genus database with same CATH superfamily
1I2GA 2YFLB 4LYLB 2XGLA 2Y74A 4R9LA 3EN8A 1B2UA 3GWRA 3S27A 2D42A 1GY5A 1BUQA 2B24B 3MSOA 3V99A 1GOVA 4NHFA 1E3RA 1HYFA 1BNFA 1YGEA 1EA2A 1O7WB 2E2TA 3N54B 1UI7A 3AGOA 4IT7A 3PGBA 3HK4A 3S28A 1KD14 1YI23 5BIRA 1IT7A 3N9HA 3QRDA 4LZIA 3V92A 5IEPA 1IVXA 2F86B 1RLSA 3OWSA 3RGAA 1JBTA 1RGLA 1W5ZA 3HI7A 5D81A 3JUPA 4OUQA 2CK3H 1TTOA 1JNQA 4HM0B 2PNCA 2UX0A 4HZBB 3UB1A 1VQ83 2CWTA 1IVVA 1RGFA 1BUJA 1Q814 1K41A 3BLZA 1LVNA 2GEXA 3EBTA 1RMSA 3HX8A 2IY2A 3SOYA 3FF2A 1EUIC 1KSIA 1NNVA 1IVUA 2K0MA 3TDGA 1SPUA 3DUKA 1Q7Y4 4KT3B 1W00A 5D82A 4N6NB 2CFKA 1JBSA 3OX9A 3X3XA 4CDLA 4EBGA 1I70A 5LC7A 1W2ZA 2WO0A 4R80A 4FCZA 4XBTA 1GMPA 3AHWA 2INXA 1FUSA 3WR2A 1BSEA 1US1A 3MWZA 4OVMA 3S67A 1BRNL 1PYLA 1FUWA 4U13A 1BSAA 1C7HA 1RHLA 4FMCA 2RFRA 3F8HA 4STDA 3LMLA 5G1LA 1TIJA 3JUMA 2Q07A 1A67A 1RKYA 1V74A 3MYTA 2BO9B 1OHOA 2W9QA 3M8CA 4HVNA 1RGAA 2K54A 3NM2A 4K1VA 2UUGC 5EQLA 2CIUA 2HMJB 2P0XA 3EB8A 1BNIA 4FMDA 1RN4A 2RCDA 2CG1A 1GOYA 1IDPA 1ISKA 1IU7A 1OF5A 5IG4A 3KE7A 5AIGA 1BIRA 4N6TA 5BXQA 3WODG 5AYRB 1RNBA 1IYYA 2BMOB 2CH9A 5IEOA 3RDEA 5A0OB 1MWUA 2QGUA 3MG3A 1HKXA 2JDIH 3OWYA 4CCVA 1QMAA 4GL6A 1CQSA 7RNTA 3G0KA 1OF5B 1K9M4 1HZ1A 2XH9A 2Y73A 2XFTA 4FCMA 4PEJA 1DVDA 3I553 1QJGA 1ZGXA 5KP3A 1NB3I 3DGNA 2P09A 3I0YA 1GY7A 3LH4A 2IMJA 3KFQC 4HKVB 1G02A 5TGNA 3F14A 3WDGB 2SBLA 1BNJA 3B4OA 3VSYA 1OHPA 1TFKA 3CME3 1NU3A 2O3OA 1K8A4 1OHSA 2WOHA 3BNBA 4KZ1A 4HM1B 3T8NA 1JBRA 3CCU3 1X1XA 5FGOA 4HM3B 1YNVX 1ZS7A 3GZYB 1YIJ3 1TRQA 3AGNA 1UGIA 3HIGA 3WOFB 1WMNA 1A2VA 1W02A 3NUVA 3AHSA 1GY6A 2IA7A 3JUNA 3NM7A 2W0QA 4X2HA 1WMPA 4O3VA 1JZOA 1FUTA 3GZRA 1I3IA 2CFWA 2HMNB 3LTDA 4LSOA 3Q90A 1YJ93 1Z1SA 3X3ZA 1KWIA 1DETA 2OQEC 3ECFA 5JPPA 2KF4A 3CCR3 1W6YA 4FMAA 3LOYA 4MMYB 3D9RA 3V98A 1B20A 2W6JH 2OWPA 4H3UA 2BU4A 1UDII 1UUWB 3GZBA 3MG2A 4IPBA 2H0IA 3D4AA 3FG3A 5LC6A 4J9AA 1GYBA 3DGYA 1T5YA 1YVSA 1JN5A 4NPBA 1JZDA 1PFPA 2ML6A 3LT8A 1QAFA 3CC23 3D5GA 1FZUA 3NV0A 4NREA 4BU4A 8CHOA 2CG0A 3CD63 7STDA 3NXJA 3CCV3 1UUVB 4KFDA 1NDOB 3UL6A 4WYKA 3SEDA 4CPKA 2Z7AA 2F99A 3F8XA 3FCSB 4K90B 2F98A 5CXOA 1E3VA 1X1UA 3D5IA 3OV4A 1O7PB 2P38A 1N9EA 3NV0B 3FG4A 5IERA 3CPOA 4Q53A 1R4YA 1C54A 3AMOA 4GB5A 1A2PA 2B1XB 1B2SA 3DZLA 2W56A 2F5WA 1GD4A 3ROBA 2XEPA 2YFIB 2FXTA 2ZL8A 2IUKA 3U97A 1M904 5AIHA 2L4VA 2E2VA 3A5EA 3WOEB 4RNYA 1FYSA 3FSDA 1CYVA 1MWSA 3AMOB 1B3SA 1F8NA 1M9GA 3B7CA 4HM2B 4JF8A 1W4NA 1DMNA 1FA3A 3UL5A 4L7KA 2XSOB 3IMAB 3SYUA 1FGRA 1RGGA 4HM4B 4N6LA 1X1YA 3T8UA 1TJDA 1VQP3 1I2EA 1IV7A 1RJOA 3A76A 3K0ZA 3MG1A 3DGLA 3Q3FA 1ROAA 3FH1A 1O7MB 1WTHA 1JB4A 2HOHA 3X41A 1BRHA 3URPA 2GXFA 1NO3A 2CWVA 2KCDA 1U5OA 7GSPA 1YJW3 1J2BA 1N5PA 2F5MA 3FGYA 4KFFA 3LYGA 1AQZA 3CC43 5AEUB 4K1UA 4RZMA 4AEQA 3CMA3 2O9UX 3EHCA 3KSPA 4BL3A 2QA43 2W03A 1YIT3 2L1SA 2KF3A 1RRHA 2CX0A 3E99A 3PYJA 5IG0A 3WA2X 5JBSA 5AIFA 6GSPA 2CFDA 2OTJ3 1SJWA 5AI1A 4N3VA 2AADA 3OWUA 1DMMA 3UNLA 1BVIA 3EC9A 1IQXA 4HZ9B 1DYUA 1B21A 4R4KA 2XRXB 3CU3A 2ZA4A 3HZPA 2J8XB 3SVAA 3DGOA 1K28A 2IUJA 3WA3A 3IJEB 3PS8A 9RNTA 1BNEA 1UCKA 3BNEA 5KP4A 4RNTA 5IG3A 1PU4A 5D83A 2KF6A 4FCJA 5EEOA 3GRDA 1MWTA 2KAAA 1N8QA 1I8VA 3JVCA 4N6UA 3CCJ3 1M1K4 3U1WA 4AKYA 4EC6A 4KVHA 3JUOA 3G4S3 1I0VA 1TUHA 3F7XA 1RGKA 4GSPA 4RBNA 2XSHB 1QAKA 2CFLA 2P05A 3KCHA 2RSXA 4G1MB 4XBXA 8RNTA 1BSDA 2I9WA 3CCE3 1RTUA 1GOUA 2LQVA 3D79A 1Q40A 1UUGB 2D1WA 1EEJA 3B8LA 1A2KA 4TX4A 3IPTA 4GHOA 1VQN3 2W2CA 3Q1CA 1VQ53 1W01A 4N6OB 1K734 1B2MA 3T0UA 3BNCA 3VF1A 3FZWA 1QVG2 4IIAA 4J5KA 1TFOA 2RNTA 2IYJA 4H61A 3N8BA 1BRKA 4K61A 1NWWA 2WOFA 4JRFA 2HMLB 1HU9A 2YX9A 1GD3A 1A90A 1FW7A 3ZG0A 1B27A 4I4KA 1VQK3 2BIRA 3K5TA 1YGWA 3DH2A 5HOHA 5RNTA 1LNHA 1NB5I 1LOWA 5CF2A 4HJLB 4N6MA 5CK6A 2XGNA 2ML5A 2WGOA 3DM8A 5IW9A 2Z77A 1LQGC 1RNTA 4WP5A 2GU3A 2Z76A 3NX0A 2OOVC 3DGMA 2SARA 2GU1A 1VQ73 1JB5A 2GSPA 1KQS2 1NJI4 1LNIA 2GBXB 3DY5A 3GSPA 3L0RA 6RNTA 4J5GA 1RGHA 2CX1A 5IF6A 4BTYA 1D6ZA 1L5GB 2GBWB 5G1KA 1VQ43 1TU5A 3FF0A 1VQ93 1BNSA 2K3DA 1YJN3 3KZTA 1DMQA 1OPYA 1BOXA 1IV9A 4RNZA 5IENA 1Q864 2V1LA 2JQ5A 1QALA 1T2IA 2ZHXB 2GEYA 5GSPA 2CHCA 1ULIB 2XF3A 1JN5B 4LMIA 2E2UA 1TRPA 4N6V0 2OQEA 2QEX3 3CCQ3 2OOVA 1LOVA 3EQQB 2H0GA 4EYCA 2UGIA 1W6GA 1IVWA 1ASKA 4MEIA 4WYKB 4DKIA 1UI8A 1B2ZA 4MMZB 2BMQB 2BMRB 5BVBA 1MOLA 2KXGA 1ROVA 4BTXA 1N8R4 1ZO2A 2XR8B 1JV2B 1O7GB 1SQWA 2LYXA 3EBYA 3KSED 3ZFZA 1TP6A 1ZX2A 2W56B 3LXUX 1AY7A 1RGCA 2HMMB 1LOYA 1OGXA 3PCSA 1GS3A 3PCRA 4ILFA 1S5AA 4WHAA 3S29A 1AVLA 2AAEA 1EKMA 1WQLB 1T3BA 1VQQA 1V57A 1MGWA 2F56A 3LTCA 1DVCA 1ULJB 2CC3A 2CW9A 2BT3A 2HMOB 3G16A 1VZZA 4HM6B 4ORLA 4XM4A 5AYSC 3X40A 3CXC2 1I0XA 3K9MC 3MKIA 1Q42A 2M7OA 3PZWA 4O2HA 4O8SA 4HM5B 3Q2PA 1AVKA 2F4YA 3X42A 3VGNA 1VQO3 2Z6BA 1BANA 2CWUA 1MWRA 1RGEA 3BNDA 1I2FA 4BL2A 1MNLA 1SIIA 1Q9EA 1Y4KA 1BRGA 1BRIA 1V58A 2MC8A 3CNXA 4WFOA 1I3FA 4FMBA 3HIIA 1LXEA 4J8TA 5STDA 2C4BA 4HAAA 4X2OA 1FGOA 4EV2A 1IT8A 1M1XB 3DMCA 3G8ZA 1VQ63 1BNGA 5G2GA 1RN7A 2OTL3 1D6YA 1QVF2 1GSPA 5HGRA 3FLJA 1T2HA 5IG5A 2HMKB 1UCIA 3BU4A 3O8YA 5AIIA 3ZG5A 1WMOA 4BTWA 4HOHA 1STFI 4KFEA 2R4IA 3D3LA 2XFSA 1WNHA 5M19A 1UGHI 4LGQA 1LQMB 1JRQA 1O7NB 4FR9A 1KC84 3RGRA 1CH0A 1W7CA 2CFGA 4HYZA 3NBBA 1BNRA 1O7HB 1OUNA 5M18A 3LTAA 4ZM8A 2A15A 4R1KA 4L8OA 1W2B2 1YHQ3 1RN1A 1SARA 1EG9B 3J7Yd 4MJDA 4HBRA 2KF5A 4CJNA 3OW22 4AKZA 3EN1B 3BB9A 3KKGA 1YVBI 5ELUA 1BRSA 1RRLA 4HM7B 1Q824 1BU4A 1R4CA 3JUQA 3CPW2 3HOHA 1LRAA 1W6CA 2RBIA 4XDVA 1STDA 3OXAA 3S5CA 4XB5A 1IK3A 1CYUA 3MHEA 3EJVA 4EXRA 1LOXA 3WHOA 2FNQA 2C11A 1Q40B 3H51A 5KP1A 2QIYA 1OCVA 2W04A 1U8CB 1OACA 2P0MA 5M1AA 1S723 1MGRA 1JB2A 5AEWB 3SXXA 1N9JA 4L8PA 3NHXA 5ELJA 5BU4A 3FG1A 3NQZA 1D6UA 1UW1A 2BNGA 3EF8A 2CKFB 1IQYA 5DRVA 2MF7A 5DREA 1PY3A 4EW5A 4XDWA 3X3YA 1OH0A 3CNMA 3SOAA 3G6E3 5JPUA 3LZAA 3QK9A 2C10A 6STDA 3CCS3 3NBJA 1G96A 5CLKA 1FGMA 1RDSA 4BIRA 3DXOA 1BSCA 2R41A 3NQYA 3CCM3 2STDA 3LT9A 4I5QA 1BGSA 3RNTA 3F40A 1DE3A 1VQM3 4QWTA 2RGQA 1FGQA 3F9SA 4HM8B 4EV5A 3UJMA 3K63A 3STDA 4R9KA 1OGZA 1JJ22 1X1WA 1GMRA 1EQKA 3KN4A 3FKAA 5CF1A 4OK0A 3KIIA 1JKGA 2BHMA 2H0HA 2YFJB 2OCTA 1B2XA 1AV4A 5I97A 1IQ8A 3B4PA 3NBRA 1BRJA 3K7CA 3SX1A 3GZXB 3LTBA 1BAOA 1JKGB 1BSBA 1FGTA 5FW5A 1RCKA 1E97A 3ALAA 4MMXB 3SLUA 3EX9A 1SIHA 3GAXA 2WGQA 3H3HA 4O02B 3I563 1UCLA 3MPHA 1GMQA 1CEWI 1RCLA 4XBYA 3CC73 3WMDA 3G713 3BIRA 1Q7HA 2W9PA 1AR0A 2ZDJA 3EE1A 1G0TA 3PXMA 4WWUC 5EVHA 3CCL3 1RSNA 2PZVA 2FGTA 1VQL3 1N5HA 3ER7A 4LEHA 1UCJA 3F7SA 2KRTA
chains in the Genus database with same CATH topology
2YFLB 4R9LA 2XGLA 2Y74A 3EN8A 3GWRA 3S27A 2D42A 1GY5A 1BUQA 2B24B 3MSOA 3V99A 4NHFA 1E3RA 1YGEA 3N54B 1EA2A 1O7WB 2E2TA 1UI7A 4IT7A 3PGBA 3HK4A 3S28A 1KD14 1YI23 1IT7A 3N9HA 3QRDA 4LZIA 3V92A 5IEPA 1IVXA 2F86B 3OWSA 3RGAA 1W5ZA 3HI7A 5D81A 3JUPA 4OUQA 2CK3H 4HM0B 1JNQA 2PNCA 2UX0A 4HZBB 3UB1A 1VQ83 2CWTA 1IVVA 1Q814 1K41A 3BLZA 1LVNA 2GEXA 3EBTA 3HX8A 3SOYA 3FF2A 1KSIA 1IVUA 2K0MA 3TDGA 1SPUA 3DUKA 1Q7Y4 1W00A 5D82A 4N6NB 2CFKA 3OX9A 3X3XA 4CDLA 4EBGA 5LC7A 1W2ZA 2WO0A 4R80A 4FCZA 4XBTA 2INXA 1US1A 3MWZA 4OVMA 3S67A 1FUWA 4U13A 1C7HA 4FMCA 2RFRA 3F8HA 4STDA 3LMLA 1TIJA 3JUMA 2Q07A 1A67A 1RKYA 1V74A 3MYTA 2BO9B 1OHOA 2W9QA 3M8CA 4HVNA 3NM2A 2K54A 4K1VA 5EQLA 2CIUA 2HMJB 2P0XA 3EB8A 4FMDA 2RCDA 2CG1A 1IDPA 1ISKA 1IU7A 1OF5A 5IG4A 3KE7A 5AIGA 4N6TA 5BXQA 3WODG 5AYRB 2BMOB 2CH9A 5IEOA 3RDEA 5A0OB 3OWYA 2QGUA 3MG3A 1HKXA 2JDIH 4CCVA 1QMAA 4GL6A 1CQSA 3G0KA 1OF5B 1K9M4 2XH9A 2Y73A 2XFTA 4FCMA 4PEJA 1DVDA 3I553 1QJGA 5KP3A 1NB3I 3DGNA 2P09A 3I0YA 1GY7A 3LH4A 2IMJA 3KFQC 4HKVB 3WDGB 5TGNA 3F14A 2SBLA 3B4OA 3VSYA 1OHPA 1TFKA 3CME3 1NU3A 2O3OA 1K8A4 1OHSA 2WOHA 3BNBA 4KZ1A 4HM1B 3T8NA 3CCU3 5FGOA 4HM3B 3GZYB 1YIJ3 3WOFB 3HIGA 1A2VA 1W02A 1WMNA 3NUVA 2IA7A 1GY6A 3JUNA 3NM7A 2W0QA 4X2HA 1WMPA 4O3VA 3GZRA 2CFWA 2HMNB 3LTDA 4LSOA 3Q90A 1YJ93 1Z1SA 3X3ZA 1KWIA 2OQEC 3ECFA 5JPPA 3CCR3 1W6YA 4FMAA 3LOYA 4MMYB 3D9RA 3V98A 2W6JH 2OWPA 4H3UA 1UUWB 3GZBA 3MG2A 4IPBA 5LC6A 3FG3A 4J9AA 1GYBA 1T5YA 1JN5A 3CC23 1PFPA 2ML6A 3LT8A 1QAFA 8CHOA 3NV0A 4NREA 3CD63 2CG0A 7STDA 3NXJA 3CCV3 1UUVB 4KFDA 1NDOB 3UL6A 4WYKA 3SEDA 2Z7AA 2F99A 3F8XA 3FCSB 4K90B 2F98A 5CXOA 1E3VA 3OV4A 1O7PB 2P38A 1N9EA 3NV0B 3FG4A 5IERA 3CPOA 4Q53A 3AMOA 4GB5A 2B1XB 3DZLA 2W56A 1GD4A 3ROBA 2XEPA 2YFIB 2FXTA 2ZL8A 2IUKA 3U97A 1M904 5AIHA 2L4VA 2E2VA 3WOEB 4RNYA 3FSDA 1CYVA 3AMOB 1M9GA 1F8NA 4HM2B 3B7CA 4JF8A 1W4NA 1DMNA 1FA3A 3UL5A 4L7KA 2XSOB 3IMAB 1FGRA 4HM4B 4N6LA 3T8UA 1VQP3 1IV7A 1RJOA 3A76A 3K0ZA 3MG1A 3DGLA 1ROAA 3FH1A 1O7MB 1WTHA 1JB4A 3X41A 2GXFA 1NO3A 2CWVA 2KCDA 1U5OA 1J2BA 1YJW3 1N5PA 3FGYA 4KFFA 3LYGA 3CC43 5AEUB 4K1UA 4RZMA 4AEQA 3CMA3 2O9UX 3EHCA 3KSPA 1YIT3 2QA43 2W03A 3E99A 3WA2X 1RRHA 5JBSA 5IG0A 3PYJA 5AIFA 2CFDA 2OTJ3 1SJWA 5AI1A 4N3VA 3OWUA 1DMMA 3UNLA 3EC9A 1IQXA 4HZ9B 1DYUA 4R4KA 2XRXB 3CU3A 3HZPA 3SVAA 3DGOA 1K28A 2IUJA 3WA3A 3IJEB 3PS8A 3BNEA 5KP4A 5IG3A 1PU4A 5D83A 4FCJA 5EEOA 3GRDA 4N6UA 3CCJ3 1N8QA 3JVCA 1M1K4 3U1WA 4AKYA 4EC6A 4KVHA 3JUOA 3G4S3 1TUHA 3F7XA 4RBNA 2XSHB 2CFLA 2P05A 1QAKA 2RSXA 4G1MB 4XBXA 2I9WA 3CCE3 2LQVA 1Q40A 2D1WA 3B8LA 1A2KA 4TX4A 3IPTA 1VQN3 2W2CA 3Q1CA 1VQ53 1W01A 4N6OB 1K734 3T0UA 3BNCA 3VF1A 3FZWA 1QVG2 4IIAA 1TFOA 4H61A 3N8BA 4K61A 1NWWA 2WOFA 4JRFA 2HMLB 1HU9A 2YX9A 1GD3A 1A90A 4I4KA 1VQK3 3K5TA 1LNHA 1NB5I 5CF2A 4HJLB 4N6MA 5CK6A 2XGNA 2ML5A 2WGOA 3DM8A 5IW9A 2Z77A 4WP5A 2GU3A 2Z76A 3NX0A 2OOVC 3DGMA 2GU1A 1VQ73 1JB5A 1KQS2 1NJI4 2GBXB 3DY5A 3L0RA 5IF6A 4BTYA 1D6ZA 1L5GB 2GBWB 1VQ43 1TU5A 3FF0A 1VQ93 1YJN3 3KZTA 1DMQA 1OPYA 1IV9A 4RNZA 5IENA 1Q864 2V1LA 2JQ5A 1QALA 2GEYA 2CHCA 1ULIB 2XF3A 1JN5B 4LMIA 2E2UA 4N6V0 2OQEA 2QEX3 3CCQ3 2OOVA 3EQQB 4EYCA 1W6GA 1IVWA 1ASKA 4MEIA 4WYKB 1UI8A 4MMZB 2BMQB 2BMRB 5BVBA 1MOLA 2KXGA 1ROVA 4BTXA 1N8R4 1ZO2A 2XR8B 1JV2B 1O7GB 1SQWA 2LYXA 3EBYA 3KSED 1TP6A 1ZX2A 2W56B 3LXUX 2HMMB 1OGXA 3PCSA 1GS3A 3PCRA 1S5AA 4WHAA 3S29A 1AVLA 1EKMA 1WQLB 3LTCA 1DVCA 1ULJB 2CC3A 2CW9A 2BT3A 2HMOB 3G16A 1VZZA 4HM6B 4ORLA 4XM4A 5AYSC 3X40A 3CXC2 3K9MC 3MKIA 1Q42A 2M7OA 3PZWA 4O2HA 4O8SA 4HM5B 3Q2PA 1AVKA 3X42A 3VGNA 1VQO3 2Z6BA 2CWUA 3BNDA 1MNLA 1SIIA 1Y4KA 2MC8A 3CNXA 4WFOA 4FMBA 5STDA 3HIIA 1LXEA 4J8TA 4X2OA 1FGOA 4EV2A 1IT8A 1M1XB 3DMCA 3G8ZA 1VQ63 5G2GA 1RN7A 2OTL3 1D6YA 1QVF2 5HGRA 3FLJA 5IG5A 2HMKB 3O8YA 5AIIA 1WMOA 4BTWA 1STFI 4KFEA 2R4IA 3D3LA 2XFSA 1WNHA 4LGQA 1O7NB 1JRQA 4FR9A 1KC84 3RGRA 1W7CA 4HYZA 2CFGA 3NBBA 1O7HB 1OUNA 3LTAA 4ZM8A 2A15A 4R1KA 4L8OA 1W2B2 1YHQ3 1EG9B 3J7Yd 4MJDA 4HBRA 3OW22 4AKZA 3EN1B 3BB9A 3KKGA 1YVBI 5ELUA 1RRLA 4HM7B 1Q824 1R4CA 3JUQA 3CPW2 1W6CA 4XDVA 1STDA 3OXAA 3S5CA 4XB5A 1IK3A 1CYUA 3MHEA 3EJVA 4EXRA 1LOXA 2FNQA 2C11A 1Q40B 3H51A 5KP1A 2QIYA 1OCVA 2W04A 1U8CB 1OACA 2P0MA 1S723 5AEWB 1JB2A 3SXXA 1N9JA 4L8PA 3NHXA 5ELJA 3FG1A 3NQZA 1D6UA 1UW1A 2BNGA 3EF8A 2CKFB 1IQYA 5DRVA 2MF7A 5DREA 4XDWA 3X3YA 1OH0A 3CNMA 3SOAA 3G6E3 5JPUA 3LZAA 3QK9A 2C10A 6STDA 3CCS3 3NBJA 1G96A 5CLKA 1FGMA 3DXOA 3CCM3 3NQYA 2STDA 3LT9A 3F40A 1VQM3 4QWTA 2RGQA 1FGQA 3F9SA 4HM8B 4EV5A 3UJMA 3K63A 3STDA 4R9KA 1OGZA 1JJ22 1EQKA 3KN4A 3FKAA 5CF1A 4OK0A 3KIIA 1JKGA 2BHMA 2YFJB 2OCTA 1AV4A 5I97A 1IQ8A 3B4PA 3NBRA 3SX1A 3K7CA 3GZXB 3LTBA 1JKGB 1FGTA 5FW5A 1E97A 3ALAA 4MMXB 3SLUA 3EX9A 1SIHA 3GAXA 2WGQA 3H3HA 4O02B 3I563 3MPHA 1CEWI 4XBYA 3CC73 3WMDA 3G713 2W9PA 1AR0A 2ZDJA 3EE1A 3PXMA 3CCL3 4WWUC 5EVHA 2PZVA 2FGTA 1VQL3 1N5HA 3ER7A 4LEHA 3F7SA 2KRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFL B;  4R9L A;  3EN8 A;  3GWR A;  1BUQ A;  1GY5 A;  2B24 B;  3MSO A;  1E3R A;  1EA2 A;  1O7W B;  3HK4 A;  5IEP A;  2F86 B;  3OWS A;  3RGA A;  5D81 A;  3JUP A;  4OUQ A;  4HM0 B;  2UX0 A;  4HZB B;  1K41 A;  3BLZ A;  2GEX A;  3EBT A;  3HX8 A;  3SOY A;  3FF2 A;  3DUK A;  1W00 A;  5D82 A;  3OX9 A;  4CDL A;  4XBT A;  2INX A;  4OVM A;  4U13 A;  1C7H A;  2RFR A;  3F8H A;  4STD A;  3JUM A;  3MYT A;  1OHO A;  3M8C A;  4HVN A;  3NM2 A;  2K54 A;  4K1V A;  2HMJ B;  2RCD A;  1IDP A;  1ISK A;  1OF5 A;  5IG4 A;  3KE7 A;  5AIG A;  5BXQ A;  2BMO B;  5IEO A;  3OWY A;  2QGU A;  3MG3 A;  1HKX A;  1QMA A;  1CQS A;  3G0K A;  1OF5 B;  4PEJ A;  4FCM A;  1QJG A;  5KP3 A;  3I0Y A;  1GY7 A;  2IMJ A;  4HKV B;  5TGN A;  3F14 A;  3B4O A;  3VSY A;  1OHP A;  1NU3 A;  1OHS A;  4HM1 B;  3T8N A;  4HM3 B;  3GZY B;  1W02 A;  3NUV A;  3JUN A;  1GY6 A;  4X2H A;  3GZR A;  2HMN B;  3Q90 A;  1Z1S A;  3ECF A;  5JPP A;  1W6Y A;  3D9R A;  4H3U A;  2OWP A;  1UUW B;  3GZB A;  3MG2 A;  4J9A A;  1GYB A;  1JN5 A;  8CHO A;  3NV0 A;  7STD A;  3NXJ A;  1UUV B;  1NDO B;  4WYK A;  3SED A;  2Z7A A;  2F99 A;  3F8X A;  2F98 A;  5CXO A;  1E3V A;  3OV4 A;  1O7P B;  5IER A;  3NV0 B;  3CPO A;  4Q53 A;  4GB5 A;  2B1X B;  3DZL A;  3ROB A;  2YFI B;  5AIH A;  3FSD A;  4HM2 B;  3B7C A;  1DMN A;  4L7K A;  2XSO B;  4HM4 B;  3T8U A;  3A76 A;  3K0Z A;  3MG1 A;  3FH1 A;  1O7M B;  1JB4 A;  2GXF A;  1U5O A;  3FGY A;  3LYG A;  5AEU B;  4K1U A;  4RZM A;  3EHC A;  3KSP A;  3E99 A;  5IG0 A;  5AIF A;  1SJW A;  5AI1 A;  4N3V A;  3OWU A;  1DMM A;  3UNL A;  3EC9 A;  4HZ9 B;  2XRX B;  3CU3 A;  3HZP A;  5KP4 A;  5IG3 A;  5D83 A;  4FCJ A;  3GRD A;  4KVH A;  3JUO A;  1TUH A;  3F7X A;  2XSH B;  4XBX A;  2I9W A;  1Q40 A;  3B8L A;  1A2K A;  3IPT A;  2W2C A;  1W01 A;  3FZW A;  4IIA A;  1NWW A;  2HML B;  4I4K A;  5CF2 A;  4HJL B;  5CK6 A;  3DM8 A;  2Z77 A;  4WP5 A;  2Z76 A;  1JB5 A;  2GBX B;  5IF6 A;  2GBW B;  3FF0 A;  3KZT A;  1DMQ A;  1OPY A;  5IEN A;  2JQ5 A;  2GEY A;  2CHC A;  1ULI B;  1JN5 B;  4LMI A;  3EQQ B;  1ASK A;  4WYK B;  2BMQ B;  2BMR B;  5BVB A;  1ZO2 A;  2XR8 B;  1O7G B;  3EBY A;  1TP6 A;  1ZX2 A;  2HMM B;  1OGX A;  1GS3 A;  1S5A A;  1WQL B;  1ULJ B;  4ORL A;  3G16 A;  4XM4 A;  2HMO B;  1VZZ A;  4HM6 B;  3MKI A;  1Q42 A;  4HM5 B;  3VGN A;  5STD A;  3CNX A;  4J8T A;  4X2O A;  3DMC A;  3G8Z A;  5G2G A;  5HGR A;  3FLJ A;  5IG5 A;  2HMK B;  5AII A;  2R4I A;  4LGQ A;  1O7N B;  3RGR A;  1O7H B;  1OUN A;  2A15 A;  4R1K A;  4L8O A;  1EG9 B;  4MJD A;  3EN1 B;  3BB9 A;  3KKG A;  4HM7 B;  3JUQ A;  4XDV A;  1STD A;  3OXA A;  3S5C A;  4XB5 A;  3MHE A;  3EJV A;  1Q40 B;  3H51 A;  5KP1 A;  2QIY A;  1OCV A;  5AEW B;  1JB2 A;  4L8P A;  3NHX A;  2BNG A;  3EF8 A;  2CKF B;  5DRV A;  5DRE A;  4XDW A;  1OH0 A;  3CNM A;  3SOA A;  5JPU A;  3LZA A;  6STD A;  5CLK A;  3DXO A;  2STD A;  3F40 A;  2RGQ A;  3F9S A;  4HM8 B;  3UJM A;  3STD A;  4R9K A;  1OGZ A;  3FKA A;  5CF1 A;  1JKG A;  2YFJ B;  3B4P A;  3NBR A;  3K7C A;  3GZX B;  1JKG B;  5FW5 A;  1E97 A;  3EX9 A;  3H3H A;  4XBY A;  3WMD A;  1AR0 A;  4WWU C;  5EVH A;  2PZV A;  3ER7 A;  4LEH A;  3F7S A; 
#chains in the Genus database with same CATH topology
 1I2G A;  2YFL B;  4LYL B;  2XGL A;  2Y74 A;  4R9L A;  3EN8 A;  1B2U A;  3GWR A;  3S27 A;  2D42 A;  1GY5 A;  1BUQ A;  2B24 B;  3MSO A;  3V99 A;  1GOV A;  4NHF A;  1E3R A;  1HYF A;  1BNF A;  1YGE A;  1EA2 A;  1O7W B;  2E2T A;  3N54 B;  1UI7 A;  3AGO A;  4IT7 A;  3PGB A;  3HK4 A;  3S28 A;  1KD1 4;  1YI2 3;  5BIR A;  1IT7 A;  3N9H A;  3QRD A;  4LZI A;  3V92 A;  5IEP A;  1IVX A;  2F86 B;  1RLS A;  3OWS A;  3RGA A;  1JBT A;  1RGL A;  1W5Z A;  3HI7 A;  5D81 A;  3JUP A;  4OUQ A;  2CK3 H;  1TTO A;  1JNQ A;  4HM0 B;  2PNC A;  2UX0 A;  4HZB B;  3UB1 A;  1VQ8 3;  2CWT A;  1IVV A;  1RGF A;  1BUJ A;  1Q81 4;  1K41 A;  3BLZ A;  1LVN A;  2GEX A;  3EBT A;  1RMS A;  3HX8 A;  2IY2 A;  3SOY A;  3FF2 A;  1EUI C;  1KSI A;  1NNV A;  1IVU A;  2K0M A;  3TDG A;  1SPU A;  3DUK A;  1Q7Y 4;  4KT3 B;  1W00 A;  5D82 A;  4N6N B;  2CFK A;  1JBS A;  3OX9 A;  3X3X A;  4CDL A;  4EBG A;  1I70 A;  5LC7 A;  1W2Z A;  2WO0 A;  4R80 A;  4FCZ A;  4XBT A;  1GMP A;  3AHW A;  2INX A;  1FUS A;  3WR2 A;  1BSE A;  1US1 A;  3MWZ A;  4OVM A;  3S67 A;  1BRN L;  1PYL A;  1FUW A;  4U13 A;  1BSA A;  1C7H A;  1RHL A;  4FMC A;  2RFR A;  3F8H A;  4STD A;  3LML A;  5G1L A;  1TIJ A;  3JUM A;  2Q07 A;  1A67 A;  1RKY A;  1V74 A;  3MYT A;  2BO9 B;  1OHO A;  2W9Q A;  3M8C A;  4HVN A;  1RGA A;  2K54 A;  3NM2 A;  4K1V A;  2UUG C;  5EQL A;  2CIU A;  2HMJ B;  2P0X A;  3EB8 A;  1BNI A;  4FMD A;  1RN4 A;  2RCD A;  2CG1 A;  1GOY A;  1IDP A;  1ISK A;  1IU7 A;  1OF5 A;  5IG4 A;  3KE7 A;  5AIG A;  1BIR A;  4N6T A;  5BXQ A;  3WOD G;  5AYR B;  1RNB A;  1IYY A;  2BMO B;  2CH9 A;  5IEO A;  3RDE A;  5A0O B;  1MWU A;  2QGU A;  3MG3 A;  1HKX A;  2JDI H;  3OWY A;  4CCV A;  1QMA A;  4GL6 A;  1CQS A;  7RNT A;  3G0K A;  1OF5 B;  1K9M 4;  1HZ1 A;  2XH9 A;  2Y73 A;  2XFT A;  4FCM A;  4PEJ A;  1DVD A;  3I55 3;  1QJG A;  1ZGX A;  5KP3 A;  1NB3 I;  3DGN A;  2P09 A;  3I0Y A;  1GY7 A;  3LH4 A;  2IMJ A;  3KFQ C;  4HKV B;  1G02 A;  5TGN A;  3F14 A;  3WDG B;  2SBL A;  1BNJ A;  3B4O A;  3VSY A;  1OHP A;  1TFK A;  3CME 3;  1NU3 A;  2O3O A;  1K8A 4;  1OHS A;  2WOH A;  3BNB A;  4KZ1 A;  4HM1 B;  3T8N A;  1JBR A;  3CCU 3;  1X1X A;  5FGO A;  4HM3 B;  1YNV X;  1ZS7 A;  3GZY B;  1YIJ 3;  1TRQ A;  3AGN A;  1UGI A;  3HIG A;  3WOF B;  1WMN A;  1A2V A;  1W02 A;  3NUV A;  3AHS A;  1GY6 A;  2IA7 A;  3JUN A;  3NM7 A;  2W0Q A;  4X2H A;  1WMP A;  4O3V A;  1JZO A;  1FUT A;  3GZR A;  1I3I A;  2CFW A;  2HMN B;  3LTD A;  4LSO A;  3Q90 A;  1YJ9 3;  1Z1S A;  3X3Z A;  1KWI A;  1DET A;  2OQE C;  3ECF A;  5JPP A;  2KF4 A;  3CCR 3;  1W6Y A;  4FMA A;  3LOY A;  4MMY B;  3D9R A;  3V98 A;  1B20 A;  2W6J H;  2OWP A;  4H3U A;  2BU4 A;  1UDI I;  1UUW B;  3GZB A;  3MG2 A;  4IPB A;  2H0I A;  3D4A A;  3FG3 A;  5LC6 A;  4J9A A;  1GYB A;  3DGY A;  1T5Y A;  1YVS A;  1JN5 A;  4NPB A;  1JZD A;  1PFP A;  2ML6 A;  3LT8 A;  1QAF A;  3CC2 3;  3D5G A;  1FZU A;  3NV0 A;  4NRE A;  4BU4 A;  8CHO A;  2CG0 A;  3CD6 3;  7STD A;  3NXJ A;  3CCV 3;  1UUV B;  4KFD A;  1NDO B;  3UL6 A;  4WYK A;  3SED A;  4CPK A;  2Z7A A;  2F99 A;  3F8X A;  3FCS B;  4K90 B;  2F98 A;  5CXO A;  1E3V A;  1X1U A;  3D5I A;  3OV4 A;  1O7P B;  2P38 A;  1N9E A;  3NV0 B;  3FG4 A;  5IER A;  3CPO A;  4Q53 A;  1R4Y A;  1C54 A;  3AMO A;  4GB5 A;  1A2P A;  2B1X B;  1B2S A;  3DZL A;  2W56 A;  2F5W A;  1GD4 A;  3ROB A;  2XEP A;  2YFI B;  2FXT A;  2ZL8 A;  2IUK A;  3U97 A;  1M90 4;  5AIH A;  2L4V A;  2E2V A;  3A5E A;  3WOE B;  4RNY A;  1FYS A;  3FSD A;  1CYV A;  1MWS A;  3AMO B;  1B3S A;  1F8N A;  1M9G A;  3B7C A;  4HM2 B;  4JF8 A;  1W4N A;  1DMN A;  1FA3 A;  3UL5 A;  4L7K A;  2XSO B;  3IMA B;  3SYU A;  1FGR A;  1RGG A;  4HM4 B;  4N6L A;  1X1Y A;  3T8U A;  1TJD A;  1VQP 3;  1I2E A;  1IV7 A;  1RJO A;  3A76 A;  3K0Z A;  3MG1 A;  3DGL A;  3Q3F A;  1ROA A;  3FH1 A;  1O7M B;  1WTH A;  1JB4 A;  2HOH A;  3X41 A;  1BRH A;  3URP A;  2GXF A;  1NO3 A;  2CWV A;  2KCD A;  1U5O A;  7GSP A;  1YJW 3;  1J2B A;  1N5P A;  2F5M A;  3FGY A;  4KFF A;  3LYG A;  1AQZ A;  3CC4 3;  5AEU B;  4K1U A;  4RZM A;  4AEQ A;  3CMA 3;  2O9U X;  3EHC A;  3KSP A;  4BL3 A;  2QA4 3;  2W03 A;  1YIT 3;  2L1S A;  2KF3 A;  1RRH A;  2CX0 A;  3E99 A;  3PYJ A;  5IG0 A;  3WA2 X;  5JBS A;  5AIF A;  6GSP A;  2CFD A;  2OTJ 3;  1SJW A;  5AI1 A;  4N3V A;  2AAD A;  3OWU A;  1DMM A;  3UNL A;  1BVI A;  3EC9 A;  1IQX A;  4HZ9 B;  1DYU A;  1B21 A;  4R4K A;  2XRX B;  3CU3 A;  2ZA4 A;  3HZP A;  2J8X B;  3SVA A;  3DGO A;  1K28 A;  2IUJ A;  3WA3 A;  3IJE B;  3PS8 A;  9RNT A;  1BNE A;  1UCK A;  3BNE A;  5KP4 A;  4RNT A;  5IG3 A;  1PU4 A;  5D83 A;  2KF6 A;  4FCJ A;  5EEO A;  3GRD A;  1MWT A;  2KAA A;  1N8Q A;  1I8V A;  3JVC A;  4N6U A;  3CCJ 3;  1M1K 4;  3U1W A;  4AKY A;  4EC6 A;  4KVH A;  3JUO A;  3G4S 3;  1I0V A;  1TUH A;  3F7X A;  1RGK A;  4GSP A;  4RBN A;  2XSH B;  1QAK A;  2CFL A;  2P05 A;  3KCH A;  2RSX A;  4G1M B;  4XBX A;  8RNT A;  1BSD A;  2I9W A;  3CCE 3;  1RTU A;  1GOU A;  2LQV A;  3D79 A;  1Q40 A;  1UUG B;  2D1W A;  1EEJ A;  3B8L A;  1A2K A;  4TX4 A;  3IPT A;  4GHO A;  1VQN 3;  2W2C A;  3Q1C A;  1VQ5 3;  1W01 A;  4N6O B;  1K73 4;  1B2M A;  3T0U A;  3BNC A;  3VF1 A;  3FZW A;  1QVG 2;  4IIA A;  4J5K A;  1TFO A;  2RNT A;  2IYJ A;  4H61 A;  3N8B A;  1BRK A;  4K61 A;  1NWW A;  2WOF A;  4JRF A;  2HML B;  1HU9 A;  2YX9 A;  1GD3 A;  1A90 A;  1FW7 A;  3ZG0 A;  1B27 A;  4I4K A;  1VQK 3;  2BIR A;  3K5T A;  1YGW A;  3DH2 A;  5HOH A;  5RNT A;  1LNH A;  1NB5 I;  1LOW A;  5CF2 A;  4HJL B;  4N6M A;  5CK6 A;  2XGN A;  2ML5 A;  2WGO A;  3DM8 A;  5IW9 A;  2Z77 A;  1LQG C;  1RNT A;  4WP5 A;  2GU3 A;  2Z76 A;  3NX0 A;  2OOV C;  3DGM A;  2SAR A;  2GU1 A;  1VQ7 3;  1JB5 A;  2GSP A;  1KQS 2;  1NJI 4;  1LNI A;  2GBX B;  3DY5 A;  3GSP A;  3L0R A;  6RNT A;  4J5G A;  1RGH A;  2CX1 A;  5IF6 A;  4BTY A;  1D6Z A;  1L5G B;  2GBW B;  5G1K A;  1VQ4 3;  1TU5 A;  3FF0 A;  1VQ9 3;  1BNS A;  2K3D A;  1YJN 3;  3KZT A;  1DMQ A;  1OPY A;  1BOX A;  1IV9 A;  4RNZ A;  5IEN A;  1Q86 4;  2V1L A;  2JQ5 A;  1QAL A;  1T2I A;  2ZHX B;  2GEY A;  5GSP A;  2CHC A;  1ULI B;  2XF3 A;  1JN5 B;  4LMI A;  2E2U A;  1TRP A;  4N6V 0;  2OQE A;  2QEX 3;  3CCQ 3;  2OOV A;  1LOV A;  3EQQ B;  2H0G A;  4EYC A;  2UGI A;  1W6G A;  1IVW A;  1ASK A;  4MEI A;  4WYK B;  4DKI A;  1UI8 A;  1B2Z A;  4MMZ B;  2BMQ B;  2BMR B;  5BVB A;  1MOL A;  2KXG A;  1ROV A;  4BTX A;  1N8R 4;  1ZO2 A;  2XR8 B;  1JV2 B;  1O7G B;  1SQW A;  2LYX A;  3EBY A;  3KSE D;  3ZFZ A;  1TP6 A;  1ZX2 A;  2W56 B;  3LXU X;  1AY7 A;  1RGC A;  2HMM B;  1LOY A;  1OGX A;  3PCS A;  1GS3 A;  3PCR A;  4ILF A;  1S5A A;  4WHA A;  3S29 A;  1AVL A;  2AAE A;  1EKM A;  1WQL B;  1T3B A;  1VQQ A;  1V57 A;  1MGW A;  2F56 A;  3LTC A;  1DVC A;  1ULJ B;  2CC3 A;  2CW9 A;  2BT3 A;  2HMO B;  3G16 A;  1VZZ A;  4HM6 B;  4ORL A;  4XM4 A;  5AYS C;  3X40 A;  3CXC 2;  1I0X A;  3K9M C;  3MKI A;  1Q42 A;  2M7O A;  3PZW A;  4O2H A;  4O8S A;  4HM5 B;  3Q2P A;  1AVK A;  2F4Y A;  3X42 A;  3VGN A;  1VQO 3;  2Z6B A;  1BAN A;  2CWU A;  1MWR A;  1RGE A;  3BND A;  1I2F A;  4BL2 A;  1MNL A;  1SII A;  1Q9E A;  1Y4K A;  1BRG A;  1BRI A;  1V58 A;  2MC8 A;  3CNX A;  4WFO A;  1I3F A;  4FMB A;  3HII A;  1LXE A;  4J8T A;  5STD A;  2C4B A;  4HAA A;  4X2O A;  1FGO A;  4EV2 A;  1IT8 A;  1M1X B;  3DMC A;  3G8Z A;  1VQ6 3;  1BNG A;  5G2G A;  1RN7 A;  2OTL 3;  1D6Y A;  1QVF 2;  1GSP A;  5HGR A;  3FLJ A;  1T2H A;  5IG5 A;  2HMK B;  1UCI A;  3BU4 A;  3O8Y A;  5AII A;  3ZG5 A;  1WMO A;  4BTW A;  4HOH A;  1STF I;  4KFE A;  2R4I A;  3D3L A;  2XFS A;  1WNH A;  5M19 A;  1UGH I;  4LGQ A;  1LQM B;  1JRQ A;  1O7N B;  4FR9 A;  1KC8 4;  3RGR A;  1CH0 A;  1W7C A;  2CFG A;  4HYZ A;  3NBB A;  1BNR A;  1O7H B;  1OUN A;  5M18 A;  3LTA A;  4ZM8 A;  2A15 A;  4R1K A;  4L8O A;  1W2B 2;  1YHQ 3;  1RN1 A;  1SAR A;  1EG9 B;  3J7Y d;  4MJD A;  4HBR A;  2KF5 A;  4CJN A;  3OW2 2;  4AKZ A;  3EN1 B;  3BB9 A;  3KKG A;  1YVB I;  5ELU A;  1BRS A;  1RRL A;  4HM7 B;  1Q82 4;  1BU4 A;  1R4C A;  3JUQ A;  3CPW 2;  3HOH A;  1LRA A;  1W6C A;  2RBI A;  4XDV A;  1STD A;  3OXA A;  3S5C A;  4XB5 A;  1IK3 A;  1CYU A;  3MHE A;  3EJV A;  4EXR A;  1LOX A;  3WHO A;  2FNQ A;  2C11 A;  1Q40 B;  3H51 A;  5KP1 A;  2QIY A;  1OCV A;  2W04 A;  1U8C B;  1OAC A;  2P0M A;  5M1A A;  1S72 3;  1MGR A;  1JB2 A;  5AEW B;  3SXX A;  1N9J A;  4L8P A;  3NHX A;  5ELJ A;  5BU4 A;  3FG1 A;  3NQZ A;  1D6U A;  1UW1 A;  2BNG A;  3EF8 A;  2CKF B;  1IQY A;  5DRV A;  2MF7 A;  5DRE A;  1PY3 A;  4EW5 A;  4XDW A;  3X3Y A;  1OH0 A;  3CNM A;  3SOA A;  3G6E 3;  5JPU A;  3LZA A;  3QK9 A;  2C10 A;  6STD A;  3CCS 3;  3NBJ A;  1G96 A;  5CLK A;  1FGM A;  1RDS A;  4BIR A;  3DXO A;  1BSC A;  2R41 A;  3NQY A;  3CCM 3;  2STD A;  3LT9 A;  4I5Q A;  1BGS A;  3RNT A;  3F40 A;  1DE3 A;  1VQM 3;  4QWT A;  2RGQ A;  1FGQ A;  3F9S A;  4HM8 B;  4EV5 A;  3UJM A;  3K63 A;  3STD A;  4R9K A;  1OGZ A;  1JJ2 2;  1X1W A;  1GMR A;  1EQK A;  3KN4 A;  3FKA A;  5CF1 A;  4OK0 A;  3KII A;  1JKG A;  2BHM A;  2H0H A;  2YFJ B;  2OCT A;  1B2X A;  1AV4 A;  5I97 A;  1IQ8 A;  3B4P A;  3NBR A;  1BRJ A;  3K7C A;  3SX1 A;  3GZX B;  3LTB A;  1BAO A;  1JKG B;  1BSB A;  1FGT A;  5FW5 A;  1RCK A;  1E97 A;  3ALA A;  4MMX B;  3SLU A;  3EX9 A;  1SIH A;  3GAX A;  2WGQ A;  3H3H A;  4O02 B;  3I56 3;  1UCL A;  3MPH A;  1GMQ A;  1CEW I;  1RCL A;  4XBY A;  3CC7 3;  3WMD A;  3G71 3;  3BIR A;  1Q7H A;  2W9P A;  1AR0 A;  2ZDJ A;  3EE1 A;  1G0T A;  3PXM A;  4WWU C;  5EVH A;  3CCL 3;  1RSN A;  2PZV A;  2FGT A;  1VQL 3;  1N5H A;  3ER7 A;  4LEH A;  1UCJ A;  3F7S A;  2KRT A; 
#chains in the Genus database with same CATH homology
 2YFL B;  4R9L A;  2XGL A;  2Y74 A;  3EN8 A;  3GWR A;  3S27 A;  2D42 A;  1GY5 A;  1BUQ A;  2B24 B;  3MSO A;  3V99 A;  4NHF A;  1E3R A;  1YGE A;  3N54 B;  1EA2 A;  1O7W B;  2E2T A;  1UI7 A;  4IT7 A;  3PGB A;  3HK4 A;  3S28 A;  1KD1 4;  1YI2 3;  1IT7 A;  3N9H A;  3QRD A;  4LZI A;  3V92 A;  5IEP A;  1IVX A;  2F86 B;  3OWS A;  3RGA A;  1W5Z A;  3HI7 A;  5D81 A;  3JUP A;  4OUQ A;  2CK3 H;  4HM0 B;  1JNQ A;  2PNC A;  2UX0 A;  4HZB B;  3UB1 A;  1VQ8 3;  2CWT A;  1IVV A;  1Q81 4;  1K41 A;  3BLZ A;  1LVN A;  2GEX A;  3EBT A;  3HX8 A;  3SOY A;  3FF2 A;  1KSI A;  1IVU A;  2K0M A;  3TDG A;  1SPU A;  3DUK A;  1Q7Y 4;  1W00 A;  5D82 A;  4N6N B;  2CFK A;  3OX9 A;  3X3X A;  4CDL A;  4EBG A;  5LC7 A;  1W2Z A;  2WO0 A;  4R80 A;  4FCZ A;  4XBT A;  2INX A;  1US1 A;  3MWZ A;  4OVM A;  3S67 A;  1FUW A;  4U13 A;  1C7H A;  4FMC A;  2RFR A;  3F8H A;  4STD A;  3LML A;  1TIJ A;  3JUM A;  2Q07 A;  1A67 A;  1RKY A;  1V74 A;  3MYT A;  2BO9 B;  1OHO A;  2W9Q A;  3M8C A;  4HVN A;  3NM2 A;  2K54 A;  4K1V A;  5EQL A;  2CIU A;  2HMJ B;  2P0X A;  3EB8 A;  4FMD A;  2RCD A;  2CG1 A;  1IDP A;  1ISK A;  1IU7 A;  1OF5 A;  5IG4 A;  3KE7 A;  5AIG A;  4N6T A;  5BXQ A;  3WOD G;  5AYR B;  2BMO B;  2CH9 A;  5IEO A;  3RDE A;  5A0O B;  3OWY A;  2QGU A;  3MG3 A;  1HKX A;  2JDI H;  4CCV A;  1QMA A;  4GL6 A;  1CQS A;  3G0K A;  1OF5 B;  1K9M 4;  2XH9 A;  2Y73 A;  2XFT A;  4FCM A;  4PEJ A;  1DVD A;  3I55 3;  1QJG A;  5KP3 A;  1NB3 I;  3DGN A;  2P09 A;  3I0Y A;  1GY7 A;  3LH4 A;  2IMJ A;  3KFQ C;  4HKV B;  3WDG B;  5TGN A;  3F14 A;  2SBL A;  3B4O A;  3VSY A;  1OHP A;  1TFK A;  3CME 3;  1NU3 A;  2O3O A;  1K8A 4;  1OHS A;  2WOH A;  3BNB A;  4KZ1 A;  4HM1 B;  3T8N A;  3CCU 3;  5FGO A;  4HM3 B;  3GZY B;  1YIJ 3;  3WOF B;  3HIG A;  1A2V A;  1W02 A;  1WMN A;  3NUV A;  2IA7 A;  1GY6 A;  3JUN A;  3NM7 A;  2W0Q A;  4X2H A;  1WMP A;  4O3V A;  3GZR A;  2CFW A;  2HMN B;  3LTD A;  4LSO A;  3Q90 A;  1YJ9 3;  1Z1S A;  3X3Z A;  1KWI A;  2OQE C;  3ECF A;  5JPP A;  3CCR 3;  1W6Y A;  4FMA A;  3LOY A;  4MMY B;  3D9R A;  3V98 A;  2W6J H;  2OWP A;  4H3U A;  1UUW B;  3GZB A;  3MG2 A;  4IPB A;  5LC6 A;  3FG3 A;  4J9A A;  1GYB A;  1T5Y A;  1JN5 A;  3CC2 3;  1PFP A;  2ML6 A;  3LT8 A;  1QAF A;  8CHO A;  3NV0 A;  4NRE A;  3CD6 3;  2CG0 A;  7STD A;  3NXJ A;  3CCV 3;  1UUV B;  4KFD A;  1NDO B;  3UL6 A;  4WYK A;  3SED A;  2Z7A A;  2F99 A;  3F8X A;  3FCS B;  4K90 B;  2F98 A;  5CXO A;  1E3V A;  3OV4 A;  1O7P B;  2P38 A;  1N9E A;  3NV0 B;  3FG4 A;  5IER A;  3CPO A;  4Q53 A;  3AMO A;  4GB5 A;  2B1X B;  3DZL A;  2W56 A;  1GD4 A;  3ROB A;  2XEP A;  2YFI B;  2FXT A;  2ZL8 A;  2IUK A;  3U97 A;  1M90 4;  5AIH A;  2L4V A;  2E2V A;  3WOE B;  4RNY A;  3FSD A;  1CYV A;  3AMO B;  1M9G A;  1F8N A;  4HM2 B;  3B7C A;  4JF8 A;  1W4N A;  1DMN A;  1FA3 A;  3UL5 A;  4L7K A;  2XSO B;  3IMA B;  1FGR A;  4HM4 B;  4N6L A;  3T8U A;  1VQP 3;  1IV7 A;  1RJO A;  3A76 A;  3K0Z A;  3MG1 A;  3DGL A;  1ROA A;  3FH1 A;  1O7M B;  1WTH A;  1JB4 A;  3X41 A;  2GXF A;  1NO3 A;  2CWV A;  2KCD A;  1U5O A;  1J2B A;  1YJW 3;  1N5P A;  3FGY A;  4KFF A;  3LYG A;  3CC4 3;  5AEU B;  4K1U A;  4RZM A;  4AEQ A;  3CMA 3;  2O9U X;  3EHC A;  3KSP A;  1YIT 3;  2QA4 3;  2W03 A;  3E99 A;  3WA2 X;  1RRH A;  5JBS A;  5IG0 A;  3PYJ A;  5AIF A;  2CFD A;  2OTJ 3;  1SJW A;  5AI1 A;  4N3V A;  3OWU A;  1DMM A;  3UNL A;  3EC9 A;  1IQX A;  4HZ9 B;  1DYU A;  4R4K A;  2XRX B;  3CU3 A;  3HZP A;  3SVA A;  3DGO A;  1K28 A;  2IUJ A;  3WA3 A;  3IJE B;  3PS8 A;  3BNE A;  5KP4 A;  5IG3 A;  1PU4 A;  5D83 A;  4FCJ A;  5EEO A;  3GRD A;  4N6U A;  3CCJ 3;  1N8Q A;  3JVC A;  1M1K 4;  3U1W A;  4AKY A;  4EC6 A;  4KVH A;  3JUO A;  3G4S 3;  1TUH A;  3F7X A;  4RBN A;  2XSH B;  2CFL A;  2P05 A;  1QAK A;  2RSX A;  4G1M B;  4XBX A;  2I9W A;  3CCE 3;  2LQV A;  1Q40 A;  2D1W A;  3B8L A;  1A2K A;  4TX4 A;  3IPT A;  1VQN 3;  2W2C A;  3Q1C A;  1VQ5 3;  1W01 A;  4N6O B;  1K73 4;  3T0U A;  3BNC A;  3VF1 A;  3FZW A;  1QVG 2;  4IIA A;  1TFO A;  4H61 A;  3N8B A;  4K61 A;  1NWW A;  2WOF A;  4JRF A;  2HML B;  1HU9 A;  2YX9 A;  1GD3 A;  1A90 A;  4I4K A;  1VQK 3;  3K5T A;  1LNH A;  1NB5 I;  5CF2 A;  4HJL B;  4N6M A;  5CK6 A;  2XGN A;  2ML5 A;  2WGO A;  3DM8 A;  5IW9 A;  2Z77 A;  4WP5 A;  2GU3 A;  2Z76 A;  3NX0 A;  2OOV C;  3DGM A;  2GU1 A;  1VQ7 3;  1JB5 A;  1KQS 2;  1NJI 4;  2GBX B;  3DY5 A;  3L0R A;  5IF6 A;  4BTY A;  1D6Z A;  1L5G B;  2GBW B;  1VQ4 3;  1TU5 A;  3FF0 A;  1VQ9 3;  1YJN 3;  3KZT A;  1DMQ A;  1OPY A;  1IV9 A;  4RNZ A;  5IEN A;  1Q86 4;  2V1L A;  2JQ5 A;  1QAL A;  2GEY A;  2CHC A;  1ULI B;  2XF3 A;  1JN5 B;  4LMI A;  2E2U A;  4N6V 0;  2OQE A;  2QEX 3;  3CCQ 3;  2OOV A;  3EQQ B;  4EYC A;  1W6G A;  1IVW A;  1ASK A;  4MEI A;  4WYK B;  1UI8 A;  4MMZ B;  2BMQ B;  2BMR B;  5BVB A;  1MOL A;  2KXG A;  1ROV A;  4BTX A;  1N8R 4;  1ZO2 A;  2XR8 B;  1JV2 B;  1O7G B;  1SQW A;  2LYX A;  3EBY A;  3KSE D;  1TP6 A;  1ZX2 A;  2W56 B;  3LXU X;  2HMM B;  1OGX A;  3PCS A;  1GS3 A;  3PCR A;  1S5A A;  4WHA A;  3S29 A;  1AVL A;  1EKM A;  1WQL B;  3LTC A;  1DVC A;  1ULJ B;  2CC3 A;  2CW9 A;  2BT3 A;  2HMO B;  3G16 A;  1VZZ A;  4HM6 B;  4ORL A;  4XM4 A;  5AYS C;  3X40 A;  3CXC 2;  3K9M C;  3MKI A;  1Q42 A;  2M7O A;  3PZW A;  4O2H A;  4O8S A;  4HM5 B;  3Q2P A;  1AVK A;  3X42 A;  3VGN A;  1VQO 3;  2Z6B A;  2CWU A;  3BND A;  1MNL A;  1SII A;  1Y4K A;  2MC8 A;  3CNX A;  4WFO A;  4FMB A;  5STD A;  3HII A;  1LXE A;  4J8T A;  4X2O A;  1FGO A;  4EV2 A;  1IT8 A;  1M1X B;  3DMC A;  3G8Z A;  1VQ6 3;  5G2G A;  1RN7 A;  2OTL 3;  1D6Y A;  1QVF 2;  5HGR A;  3FLJ A;  5IG5 A;  2HMK B;  3O8Y A;  5AII A;  1WMO A;  4BTW A;  1STF I;  4KFE A;  2R4I A;  3D3L A;  2XFS A;  1WNH A;  4LGQ A;  1O7N B;  1JRQ A;  4FR9 A;  1KC8 4;  3RGR A;  1W7C A;  4HYZ A;  2CFG A;  3NBB A;  1O7H B;  1OUN A;  3LTA A;  4ZM8 A;  2A15 A;  4R1K A;  4L8O A;  1W2B 2;  1YHQ 3;  1EG9 B;  3J7Y d;  4MJD A;  4HBR A;  3OW2 2;  4AKZ A;  3EN1 B;  3BB9 A;  3KKG A;  1YVB I;  5ELU A;  1RRL A;  4HM7 B;  1Q82 4;  1R4C A;  3JUQ A;  3CPW 2;  1W6C A;  4XDV A;  1STD A;  3OXA A;  3S5C A;  4XB5 A;  1IK3 A;  1CYU A;  3MHE A;  3EJV A;  4EXR A;  1LOX A;  2FNQ A;  2C11 A;  1Q40 B;  3H51 A;  5KP1 A;  2QIY A;  1OCV A;  2W04 A;  1U8C B;  1OAC A;  2P0M A;  1S72 3;  5AEW B;  1JB2 A;  3SXX A;  1N9J A;  4L8P A;  3NHX A;  5ELJ A;  3FG1 A;  3NQZ A;  1D6U A;  1UW1 A;  2BNG A;  3EF8 A;  2CKF B;  1IQY A;  5DRV A;  2MF7 A;  5DRE A;  4XDW A;  3X3Y A;  1OH0 A;  3CNM A;  3SOA A;  3G6E 3;  5JPU A;  3LZA A;  3QK9 A;  2C10 A;  6STD A;  3CCS 3;  3NBJ A;  1G96 A;  5CLK A;  1FGM A;  3DXO A;  3CCM 3;  3NQY A;  2STD A;  3LT9 A;  3F40 A;  1VQM 3;  4QWT A;  2RGQ A;  1FGQ A;  3F9S A;  4HM8 B;  4EV5 A;  3UJM A;  3K63 A;  3STD A;  4R9K A;  1OGZ A;  1JJ2 2;  1EQK A;  3KN4 A;  3FKA A;  5CF1 A;  4OK0 A;  3KII A;  1JKG A;  2BHM A;  2YFJ B;  2OCT A;  1AV4 A;  5I97 A;  1IQ8 A;  3B4P A;  3NBR A;  3SX1 A;  3K7C A;  3GZX B;  3LTB A;  1JKG B;  1FGT A;  5FW5 A;  1E97 A;  3ALA A;  4MMX B;  3SLU A;  3EX9 A;  1SIH A;  3GAX A;  2WGQ A;  3H3H A;  4O02 B;  3I56 3;  3MPH A;  1CEW I;  4XBY A;  3CC7 3;  3WMD A;  3G71 3;  2W9P A;  1AR0 A;  2ZDJ A;  3EE1 A;  3PXM A;  3CCL 3;  4WWU C;  5EVH A;  2PZV A;  2FGT A;  1VQL 3;  1N5H A;  3ER7 A;  4LEH A;  3F7S A;  2KRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...