1JB2A

Crystal structure of ntf2 m84e mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISEVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb2A00
2RCDA 2F99A 3LZAA 3F14A 2YFLB 3NBRA 1EA2A 3B8LA 3BB9A 2B24B 2QGUA 3G16A 3EJVA 3G8ZA 1EG9B 2Z76A 3T8NA 4L8OA 2HMJB 3F8XA 5FW5A 4CDLA 4N3VA 1JKGB 1OH0A 5DREA 1Z1SA 1WQLB 3K7CA 2JQ5A 3EF8A 5D83A 2BMQB 2OWPA 3VGNA 1ULJB 1NDOB 3CNMA 2A15A 2GBXB 2YFIB 3NV0B 4WYKA 5CLKA 3MHEA 3SEDA 2GEYA 5DRVA 3JUNA 4HKVB 5G2GA 1OF5B 2Z77A 5AIFA 4XBTA 1OUNA 1A2KA 3MYTA 4L8PA 2F86B 4J8TA 3EQQB 1JN5B 3MG2A 4XDWA 1JKGA 1GYBA 4XB5A 5EVHA 1E3VA 3EX9A 1GY5A 1O7HB 3A76A 3RGRA 3NUVA 3VSYA 3E99A 5KP1A 1O7WB 1TUHA 3M8CA 1OGXA 2BMOB 4HVNA 3F9SA 3FF2A 3NXJA 5IG5A 3OV4A 3NV0A 4STDA 1UUVB 5CF2A 2HMMB 1BUQA 1ASKA 3OXAA 2STDA 2F98A 3FSDA 4R9LA 2HMLB 2B1XB 3DZLA 3OX9A 3H3HA 3CNXA 3FKAA 4HM4B 5AEWB 3LYGA 3DMCA 3JUOA 4HZBB 1ULIB 3GWRA 1OF5A 3GZYB 3STDA 5BXQA 1HKXA 1IDPA 1JN5A 3MG3A 3ER7A 4FCMA 4HM3B 1W00A 1ZO2A 5IF6A 1E97A 3DUKA 3KZTA 3BLZA 3G0KA 5BVBA 1JB5A 4HM6B 3FZWA 1SJWA 4R9KA 3T8UA 5D82A 5IEOA 4FCJA 4RZMA 2CKFB 3EBTA 2RGQA 3F7SA 4XBXA 2QIYA 4XBYA 4WP5A 1OPYA 4U13A 4L7KA 4X2OA 1Q40A 3KKGA 3RGAA 4OUQA 4HM2B 3EC9A 1QMAA 1ZX2A 2BNGA 3Q90A 2YFJB 1C7HA 1OHSA 2HMOB 2XRXB 1NWWA 3KE7A 4IIAA 3SOAA 4HM0B 5IG0A 4KVHA 5IEPA 3FLJA 3HX8A 8CHOA 3I0YA 5D81A 1VZZA 2INXA 2RFRA 3GZRA 1K41A 3DXOA 3HZPA 2XSHB 4HZ9B 2HMNB 3H51A 1S5AA 1OCVA 4HM1B 5AIHA 3HK4A 4HM8B 4LEHA 3OWUA 4WWUC 3OWSA 4ORLA 1O7GB 2W2CA 3OWYA 1GY7A 1TP6A 3JUMA 2PZVA 5AEUB 3B4PA 5CXOA 3F8HA 1OHOA 5IENA 4HM5B 3JUQA 3EN1B 5CK6A 3B4OA 5AIGA 3FF0A 5AI1A 6STDA 4X2HA 4LGQA 5JPUA 1STDA 2GEXA 3FH1A 1E3RA 3MSOA 3ROBA 5KP4A 2Z7AA 3NHXA 4H3UA 5HGRA 3JUPA 5KP3A 4XDVA 3IPTA 3GZBA 3SOYA 1W6YA 3F7XA 3D9RA 4LMIA 4OVMA 2IMJA 1OGZA 1UUWB 2R4IA 1JB4A 1O7PB 1DMQA 4Q53A 1GS3A 3EHCA 2BMRB 2HMKB 3KSPA 2GBWB 2I9WA 5JPPA 1DMNA 3ECFA 5IERA 1W01A 2XR8B 1AR0A 3EBYA 3UNLA 4GB5A 3B7CA 3CU3A 3MG1A 3GZXB 1QJGA 4K1UA 3GRDA 4HM7B 3K0ZA 5STDA 1OHPA 3FGYA 4K1VA 2GXFA 4XM4A 3NM2A 1JB2A 1U5OA 4I4KA 3DM8A 1CQSA 1ISKA 1DMMA 2XSOB 3MKIA 4MJDA 4PEJA 1Q42A 7STDA 5IG4A 1W02A 3F40A 1O7NB 4R1KA 3EN8A 1GY6A 3WMDA 5IG3A 4HJLB 5CF1A 4J9AA 5TGNA 4WYKB 2UX0A 2CHCA 1O7MB 2K54A 1NU3A 1Q40B 5AIIA 3S5CA 3UJMA 3CPOA
chains in the Genus database with same CATH superfamily
2OOVC 3O8YA 2RCDA 4AKZA 2F99A 3SLUA 1S723 3URPA 3LZAA 3F14A 1RKYA 2YFLB 3Q1CA 1QVF2 3HOHA 3NBRA 1EA2A 2BHMA 3B8LA 3BB9A 4BU4A 1YI23 2B24B 3X3ZA 1HZ1A 1LOVA 1SIHA 2QGUA 1TJDA 1K734 1TFKA 2CWTA 3G16A 3EJVA 1I0XA 1UDII 2H0IA 3G8ZA 1EG9B 1BRKA 4LYLB 2Z76A 5G1KA 3T8NA 3RNTA 3WOEB 1MWTA 1LOXA 3FG3A 4L8OA 1KC84 2HMJB 1CH0A 3F8XA 3S29A 5FW5A 3V98A 3V99A 2WO0A 3NBJA 1JKGB 2P38A 4N3VA 3U1WA 4CDLA 1SIIA 4GSPA 1OH0A 3CCQ3 1EKMA 1UI8A 7GSPA 1FGTA 4LZIA 2WOHA 3CCE3 5JBSA 5DREA 1AVKA 1Z1SA 1CYUA 1WQLB 2FNQA 2E2UA 1X1UA 1BRIA 3WDGB 3K7CA 3TDGA 2L1SA 1B2ZA 1IV7A 2V1LA 3BU4A 2JQ5A 3KN4A 1N5PA 3EF8A 5D83A 2BMQB 4NPBA 1DE3A 2OWPA 2XGLA 3VGNA 1ULJB 2C10A 4O3VA 3G713 2L4VA 1FW7A 3MWZA 1JZOA 3DGNA 4EBGA 5FGOA 3AGNA 1NDOB 1RSNA 1D6YA 3CNMA 3S67A 2GU3A 1DVDA 2A15A 2XH9A 1GMPA 3ZG5A 1D6ZA 4BTXA 2BT3A 2CH9A 2C11A 1I8VA 2GBXB 2QEX3 2YFIB 4N6UA 3NV0B 1BSAA 4WYKA 3LT8A 5G1LA 9RNTA 1US1A 1YJ93 1EUIC 1BAOA 2CX0A 5CLKA 1B2UA 1UW1A 1EQKA 1IVVA 4KFDA 1W4NA 2IA7A 3MHEA 3SEDA 1YVBI 3KIIA 1K8A4 1BNRA 1VQ83 1RMSA 4TX4A 4QWTA 1V74A 1X1YA 3BNEA 2GEYA 1GOVA 1W2ZA 5DRVA 3JUNA 1N9EA 1I2FA 4HKVB 5G2GA 2AADA 3CC23 1OF5B 1Q7HA 4CJNA 2OTL3 2RNTA 2Z77A 2SARA 5AIFA 1FYSA 4XBTA 1OUNA 1A2KA 1JRQA 3MYTA 3CMA3 1L5GB 4L8PA 1RGCA 2R41A 1BNSA 1NJI4 1A67A 2F86B 4HAAA 2P0XA 4FCZA 1K9M4 4J8TA 1X1WA 4GHOA 3EQQB 2ZL8A 1JN5B 3MG2A 4XDWA 4KFEA 1JKGA 2WGOA 1VQK3 5BU4A 1G96A 3X40A 1TFOA 4BL2A 1GYBA 1MNLA 2P05A 3PYJA 2LYXA 3WODG 1W6GA 2W04A 3CPW2 4XB5A 5EVHA 3JVCA 2CG1A 1E3VA 2BO9B 3EX9A 1WMNA 3N8BA 2ZDJA 3PCRA 1GY5A 1FGOA 1O7HB 4I5QA 1UCJA 3NQYA 1BANA 4FMDA 3CC73 3A76A 1UI7A 3NUVA 1N5HA 3RGRA 3VSYA 1U8CB 5AYRB 2UUGC 3E99A 5KP1A 1VQL3 1O7WB 1TUHA 3M8CA 2CIUA 1OGXA 3X42A 1CYVA 2BMOB 4HVNA 1I0VA 3F9SA 1Q864 1B27A 4BL3A 3FF2A 1M1K4 3CME3 1FUTA 3NXJA 1FA3A 5IG5A 1N8R4 3AHWA 2O3OA 3OV4A 1YHQ3 1FGRA 3NV0A 4STDA 1UUVB 5CF2A 4KFFA 2HMMB 1BUQA 1ASKA 3OXAA 2STDA 2F98A 4ILFA 3FSDA 4R9LA 1BU4A 1DVCA 2CG0A 3OW22 1I3IA 1YGEA 2HMLB 1ZGXA 3CCR3 1WMPA 2B1XB 1RGAA 2XFTA 3CCL3 1FGQA 3DZLA 1BNEA 2CW9A 2HOHA 2WGQA 3CNXA 3FKAA 3FG4A 3H3HA 3LYGA 3OX9A 3DMCA 4HM4B 4H61A 2OQEA 3IMAB 3SXXA 3S28A 3JUOA 3WOFB 5BIRA 4HZBB 1ULIB 4EYCA 4FMAA 1A90A 1V58A 2BIRA 3GWRA 1OF5A 5AEWB 1QVG2 1VQ43 2ML6A 3GZYB 3STDA 1BSEA 5BXQA 2W9PA 4EW5A 3QK9A 2MF7A 1BVIA 3SX1A 3I563 2D1WA 2F56A 2IYJA 2CWVA 3ZFZA 1LRAA 3K63A 3X3XA 1RNBA 1RGLA 1HKXA 1IDPA 1JN5A 2KF4A 1RGEA 3MG3A 4CPKA 2KCDA 1FZUA 1EEJA 1GOUA 1UCLA 3ER7A 1W00A 4FCMA 1N9JA 4HM3B 1I3FA 2CFLA 2WOFA 1ZO2A 1GMRA 4CCVA 5IF6A 3WR2A 1E97A 2ZA4A 3DUKA 3KZTA 1F8NA 1MGRA 1STFI 3BLZA 3G0KA 1LQMB 3N54B 3ALAA 1UCIA 2FXTA 1LNHA 3UL5A 1JB5A 4HM6B 5BVBA 3FZWA 2W9QA 4G1MB 3KSED 4IT7A 3VF1A 1RDSA 5HOHA 1M1XB 1LQGC 1SJWA 5I97A 1ZS7A 2SBLA 3EB8A 4R9KA 2KF5A 3T8UA 3CCV3 5D82A 1RGGA 2MC8A 5IEOA 4FCJA 3LH4A 4RZMA 3UL6A 1I70A 2CKFB 1UUGB 3EBTA 2RGQA 3F7SA 2CFKA 4XBXA 2IUJA 2OQEC 1YJW3 2QIYA 2CWUA 2XF3A 4XBYA 4WP5A 3SYUA 1OPYA 3D3LA 4U13A 2O9UX 4L7KA 5LC6A 4X2OA 1Q40A 3KKGA 3RGAA 1IQ8A 1PYLA 3S27A 4OUQA 1R4YA 3HI7A 4HM2B 1YVSA 1VQO3 1T2HA 3EC9A 1QMAA 1ZX2A 2BNGA 3CCU3 2QA43 1AQZA 3Q90A 3CXC2 1LNIA 2H0HA 1JBTA 3DGYA 1NNVA 3PGBA 3I553 2YFJB 4MEIA 4OK0A 1ROVA 1C7HA 1MWRA 1OHSA 2KXGA 2HMOB 1BGSA 2JDIH 2XRXB 1WMOA 1NWWA 4KZ1A 2W03A 1YJN3 5RNTA 1RTUA 1RGKA 2W0QA 1B2SA 1BSCA 3BNDA 3KE7A 1RLSA 4WHAA 3N9HA 3PS8A 3U97A 1UCKA 1TIJA 4O02B 5ELJA 1RN4A 1RHLA 4IIAA 4NHFA 3LXUX 2Q07A 3SOAA 4N6TA 4HM0B 1BRSA 4FR9A 4J5GA 1BSDA 3Q3FA 5IG0A 1SARA 5M1AA 3G6E3 4KVHA 1JBRA 5IEPA 1RRLA 1BNJA 3FLJA 3DGLA 3HX8A 8CHOA 1SQWA 2E2VA 1RGFA 3I0YA 5D81A 3CCM3 1VZZA 1RJOA 2INXA 2RFRA 2YX9A 4N6OB 3X3YA 2LQVA 3NBBA 2OOVA 3GZRA 5IW9A 1K41A 3DXOA 3HZPA 3LMLA 1JZDA 2XSHB 4MMXB 4HZ9B 2P0MA 1IT7A 3MPHA 3FG1A 2HMNB 3H51A 1S5AA 1RGHA 3CCS3 1QAFA 1Q9EA 4JRFA 1KD14 1OCVA 4HM1B 3D4AA 3HIGA 5AIHA 1W5ZA 1I2EA 1W6CA 1JBSA 1BUJA 2XFSA 1YGWA 3HK4A 3LTBA 4HM8B 4LEHA 5ELUA 3OWUA 1IVWA 4WWUC 1KWIA 2RSXA 3LTDA 3OWSA 3BIRA 1GSPA 2CK3H 1LXEA 1QAKA 1WNHA 2K3DA 4ORLA 1O7GB 1C54A 2ZHXB 4N6NB 3AMOB 2W2CA 2H0GA 3OWYA 2CFWA 2K0MA 1GY7A 1K28A 1TP6A 2KF3A 2PZVA 1T3BA 3JUMA 3K9MC 1PU4A 1A2PA 2W56B 1TTOA 1Y4KA 5AEUB 3B4PA 3PZWA 5CXOA 1Q814 3F8HA 1BNFA 1OHOA 2IUKA 1AVLA 1MGWA 1MWSA 5IENA 5M18A 4HM5B 3JUQA 2XEPA 3EN1B 1VQQA 5CK6A 5M19A 3B4OA 5AYSC 5AIGA 3FF0A 1V57A 5AI1A 2OTJ3 6STDA 2GU1A 1IYYA 1B3SA 1BNGA 4X2HA 1DETA 1IT8A 2XGNA 1UGIA 4LGQA 3AHSA 1VQ63 1MOLA 1BRJA 5JPUA 1STDA 3PXMA 2GEXA 2Y74A 1IQXA 4K90B 3A5EA 1IQYA 3FH1A 1B20A 1RRHA 1BNIA 1BSBA 1E3RA 4WFOA 1T5YA 1X1XA 1YIJ3 3MSOA 3L0RA 3ROBA 4O2HA 1FUSA 3LT9A 5KP4A 1BOXA 2Z7AA 3NHXA 3NQZA 3GAXA 2CFDA 4H3UA 5HGRA 3JUPA 4AKYA 5LC7A 3DGMA 2GSPA 5KP3A 3AGOA 4XDVA 3IPTA 3GZBA 3DH2A 3DY5A 1M904 3Q2PA 1VQ93 6GSPA 2PNCA 2M7OA 4MMYB 1Q824 3SOYA 1BIRA 1QALA 1W6YA 3F7XA 3BNCA 2KF6A 1D6UA 3D9RA 2P09A 4LMIA 4OVMA 2IMJA 3X41A 3HIIA 1M9GA 1OGZA 1I2GA 1JJ22 3D5IA 2F4YA 1UUWB 2Z6BA 1G02A 2R4IA 3T0UA 4BTWA 1IVXA 1JB4A 1O7PB 2FGTA 1DMQA 4HBRA 5EQLA 1RCLA 1LOYA 4Q53A 4BTYA 1GMQA 3AMOA 1GS3A 3EHCA 2BMRB 3FCSB 1VQN3 1KQS2 2HMKB 2CC3A 3RDEA 1N8QA 4J5KA 8RNTA 1BRGA 2W56A 3KSPA 1B2MA 1TRQA 2GBWB 1KSIA 2I9WA 5JPPA 2BU4A 4MMZB 4BIRA 3G4S3 1HU9A 1DMNA 1JV2B 2F5WA 3ECFA 4ZM8A 3NM7A 4EC6A 1WTHA 3LTAA 4HOHA 4EV5A 1Q7Y4 4RBNA 5IERA 1W7CA 3J7Yd 3GSPA 2F5MA 1W2B2 1VQP3 1W01A 3CC43 1AV4A 1IVUA 2XR8B 2CFGA 1AR0A 1RN1A 3SVAA 4KT3B 1LOWA 3EBYA 4IPBA 3UNLA 3CD63 1ROAA 4GB5A 4LSOA 1IK3A 1LVNA 1NB5I 3B7CA 3CU3A 3MG1A 1DYUA 1TRPA 4NREA 3GZXB 1QJGA 4K1UA 3GRDA 3WA2X 3KCHA 2KAAA 4HM7B 4N6V0 3K0ZA 2OCTA 1G0TA 1PFPA 4RNZA 5STDA 4EXRA 1OHPA 1IV9A 3IJEB 1SPUA 3FGYA 4K1VA 2GXFA 1VQ53 1PY3A 3D79A 1HYFA 4FMCA 4XM4A 3WHOA 1TU5A 3NM2A 1CEWI 1JNQA 1VQ73 1GD3A 4R80A 1JB2A 1BRHA 1U5OA 4I4KA 4N6MA 1BRNL 3PCSA 4K61A 3D5GA 3DM8A 2ML5A 1CQSA 3CCJ3 3UB1A 5EEOA 4EV2A 1NB3I 1ISKA 1DMMA 1B2XA 2J8XB 2XSOB 3MKIA 4MJDA 3QRDA 1Q42A 1B21A 1GOYA 2RBIA 4PEJA 5GSPA 3WA3A 1MWUA 2AAEA 7STDA 5IG4A 1YNVX 2D42A 2W6JH 1W02A 3BNBA 1R4CA 2KRTA 3F40A 4RNYA 1GD4A 3K5TA 1O7NB 4N6LA 4R1KA 1A2VA 3EN8A 5A0OB 1GY6A 4R4KA 3WMDA 1FGMA 7RNTA 3V92A 4HJLB 5IG3A 2E2TA 1NO3A 1IU7A 5CF1A 3NX0A 3ZG0A 3LTCA 4DKIA 4JF8A 1FUWA 4J9AA 4HYZA 4GL6A 5TGNA 1YIT3 1RN7A 2IY2A 6RNTA 3DGOA 4WYKB 2Y73A 2C4BA 2UX0A 1AY7A 3LOYA 1J2BA 3KFQC 2CHCA 1O7MB 2K54A 4AEQA 1RNTA 3EE1A 1OACA 4O8SA 1VQM3 4RNTA 1NU3A 1Q40B 5AIIA 4FMBA 3S5CA 1T2IA 2CX1A 1UGHI 2UGIA 3UJMA 1RCKA 3CPOA
chains in the Genus database with same CATH topology
2OOVC 3O8YA 2RCDA 4AKZA 2F99A 3SLUA 1S723 3LZAA 3F14A 1RKYA 2YFLB 3Q1CA 1QVF2 3NBRA 1EA2A 2BHMA 3B8LA 3BB9A 1YI23 2B24B 3X3ZA 1SIHA 2QGUA 1K734 1TFKA 2CWTA 3G16A 3EJVA 3G8ZA 1EG9B 2Z76A 3T8NA 3WOEB 1LOXA 3FG3A 4L8OA 1KC84 2HMJB 3F8XA 3S29A 5FW5A 3V98A 3V99A 2WO0A 3NBJA 1JKGB 2P38A 4N3VA 3U1WA 4CDLA 1SIIA 3CCQ3 1OH0A 1EKMA 1UI8A 1FGTA 4LZIA 2WOHA 3CCE3 5JBSA 5DREA 1AVKA 1Z1SA 1CYUA 1WQLB 2FNQA 2E2UA 3WDGB 3K7CA 3TDGA 1IV7A 2V1LA 2JQ5A 3KN4A 1N5PA 3EF8A 5D83A 2BMQB 2OWPA 2XGLA 3VGNA 1ULJB 2C10A 4O3VA 3G713 2L4VA 3MWZA 3DGNA 4EBGA 5FGOA 1NDOB 1D6YA 3CNMA 3S67A 2GU3A 1DVDA 2A15A 2XH9A 1D6ZA 4BTXA 2BT3A 2CH9A 2C11A 2GBXB 2QEX3 2YFIB 4N6UA 3NV0B 4WYKA 3LT8A 1US1A 1YJ93 5CLKA 1UW1A 1EQKA 1IVVA 4KFDA 1W4NA 2IA7A 3MHEA 3SEDA 1YVBI 3KIIA 1K8A4 1VQ83 4TX4A 4QWTA 1V74A 3BNEA 2GEYA 1W2ZA 5DRVA 3JUNA 1N9EA 4HKVB 5G2GA 3CC23 1OF5B 2OTL3 2Z77A 5AIFA 4XBTA 1OUNA 1A2KA 1JRQA 3MYTA 3CMA3 1L5GB 4L8PA 1A67A 2F86B 2P0XA 4FCZA 1K9M4 4J8TA 3EQQB 2ZL8A 1JN5B 3MG2A 4XDWA 4KFEA 1JKGA 2WGOA 1VQK3 1G96A 3X40A 1TFOA 1GYBA 1MNLA 2P05A 3PYJA 2LYXA 3WODG 1W6GA 2W04A 3CPW2 4XB5A 5EVHA 3JVCA 2CG1A 1E3VA 2BO9B 3EX9A 1WMNA 3N8BA 2ZDJA 3PCRA 1GY5A 1FGOA 1O7HB 3NQYA 4FMDA 3CC73 3A76A 1UI7A 3NUVA 1N5HA 3RGRA 3VSYA 1U8CB 5AYRB 3E99A 5KP1A 1VQL3 1O7WB 1TUHA 3M8CA 2CIUA 1OGXA 3X42A 1CYVA 2BMOB 4HVNA 3F9SA 1Q864 3FF2A 1M1K4 3CME3 3NXJA 1FA3A 5IG5A 1N8R4 2O3OA 3OV4A 1YHQ3 1FGRA 3NV0A 4STDA 1UUVB 5CF2A 4KFFA 2HMMB 1BUQA 1ASKA 3OXAA 2STDA 2F98A 3FSDA 4R9LA 1DVCA 2CG0A 3OW22 1YGEA 2HMLB 3CCR3 1WMPA 2B1XB 2XFTA 3CCL3 1FGQA 3DZLA 2WGQA 2CW9A 3CNXA 3FKAA 3FG4A 3H3HA 3OX9A 4HM4B 3LYGA 5AEWB 3DMCA 2OQEA 4H61A 1NJI4 3IMAB 3SXXA 3S28A 3JUOA 3WOFB 4HZBB 1ULIB 4EYCA 4FMAA 1A90A 3GWRA 1OF5A 1QVG2 1VQ43 2ML6A 3GZYB 3STDA 5BXQA 2W9PA 3QK9A 2MF7A 3SX1A 3I563 2D1WA 2CWVA 3K63A 3X3XA 1HKXA 1IDPA 1JN5A 3MG3A 2KCDA 3ER7A 4FCMA 4HM3B 1W00A 1N9JA 2WOFA 2CFLA 1ZO2A 5IF6A 4CCVA 1E97A 3DUKA 3KZTA 1F8NA 1STFI 3BLZA 3G0KA 3N54B 3ALAA 2FXTA 1LNHA 3UL5A 1JB5A 4HM6B 5BVBA 3FZWA 2W9QA 4G1MB 3KSED 4IT7A 3VF1A 1M1XB 1SJWA 5I97A 3EB8A 2SBLA 4R9KA 3T8UA 3CCV3 5D82A 2MC8A 5IEOA 4FCJA 3LH4A 4RZMA 3UL6A 2CKFB 3EBTA 2RGQA 3F7SA 2CFKA 4XBXA 2IUJA 2OQEC 1YJW3 2QIYA 2CWUA 2XF3A 4XBYA 4WP5A 1OPYA 3D3LA 4U13A 2O9UX 4L7KA 5LC6A 4X2OA 1Q40A 3KKGA 3RGAA 1IQ8A 3S27A 4OUQA 3HI7A 4HM2B 1VQO3 3EC9A 1QMAA 1ZX2A 2BNGA 3CCU3 2QA43 3Q90A 3CXC2 3PGBA 3I553 2YFJB 4MEIA 4OK0A 1ROVA 1C7HA 1OHSA 2KXGA 2HMOB 2JDIH 2XRXB 1WMOA 1NWWA 4KZ1A 2W03A 1YJN3 2W0QA 3BNDA 3KE7A 4WHAA 3N9HA 3PS8A 3U97A 1TIJA 4O02B 5ELJA 4IIAA 4NHFA 3SOAA 3LXUX 2Q07A 4N6TA 4HM0B 4FR9A 5IG0A 3G6E3 4KVHA 5IEPA 1RRLA 3FLJA 3DGLA 3HX8A 8CHOA 1SQWA 2E2VA 3I0YA 5D81A 3CCM3 1VZZA 1RJOA 2INXA 2RFRA 2YX9A 4N6OB 3X3YA 2LQVA 3NBBA 2OOVA 3GZRA 5IW9A 1K41A 3DXOA 3HZPA 3LMLA 2XSHB 4MMXB 4HZ9B 2P0MA 1IT7A 3MPHA 3FG1A 2HMNB 3H51A 1S5AA 3CCS3 1QAFA 4JRFA 1KD14 1OCVA 4HM1B 3HIGA 5AIHA 1W5ZA 1W6CA 2XFSA 3HK4A 3LTBA 4HM8B 4LEHA 5ELUA 3OWUA 1IVWA 4WWUC 1KWIA 2RSXA 3LTDA 3OWSA 2CK3H 1LXEA 1QAKA 1WNHA 4ORLA 1O7GB 4N6NB 3AMOB 2W2CA 3OWYA 2CFWA 2K0MA 1GY7A 1K28A 1TP6A 2PZVA 3JUMA 3K9MC 1PU4A 2W56B 1Y4KA 5AEUB 3B4PA 3PZWA 5CXOA 1Q814 3F8HA 1OHOA 2IUKA 1AVLA 5IENA 4HM5B 3JUQA 2XEPA 3EN1B 5CK6A 3B4OA 5AYSC 5AIGA 3FF0A 5AI1A 2OTJ3 6STDA 2GU1A 4X2HA 1IT8A 2XGNA 4LGQA 1VQ63 1MOLA 5JPUA 1STDA 3PXMA 2GEXA 2Y74A 1IQXA 4K90B 1IQYA 3FH1A 1RRHA 1E3RA 4WFOA 1T5YA 1YIJ3 3MSOA 3L0RA 3ROBA 4O2HA 3LT9A 5KP4A 2Z7AA 3NHXA 3NQZA 3GAXA 2CFDA 4H3UA 5HGRA 3JUPA 4AKYA 5LC7A 3DGMA 5KP3A 4XDVA 3IPTA 3GZBA 3DY5A 1M904 3Q2PA 1VQ93 2PNCA 2M7OA 4MMYB 1Q824 3SOYA 1QALA 1W6YA 3F7XA 3BNCA 1D6UA 3D9RA 2P09A 4LMIA 4OVMA 2IMJA 3X41A 3HIIA 1M9GA 1OGZA 1JJ22 1UUWB 2Z6BA 2R4IA 3T0UA 4BTWA 1IVXA 1JB4A 1O7PB 2FGTA 1DMQA 4HBRA 5EQLA 4Q53A 4BTYA 3AMOA 1GS3A 3EHCA 2BMRB 3FCSB 1VQN3 1KQS2 2HMKB 2CC3A 3RDEA 1N8QA 2W56A 3KSPA 2GBWB 1KSIA 2I9WA 5JPPA 3G4S3 4MMZB 1HU9A 1DMNA 1JV2B 3ECFA 4ZM8A 3NM7A 4EC6A 1WTHA 3LTAA 4EV5A 1Q7Y4 4RBNA 5IERA 1W7CA 3J7Yd 1W2B2 1VQP3 1W01A 1AV4A 1IVUA 2XR8B 2CFGA 1AR0A 3SVAA 3EBYA 4IPBA 3UNLA 3CD63 1ROAA 4GB5A 4LSOA 1IK3A 1LVNA 1NB5I 3B7CA 3CU3A 3MG1A 1DYUA 4NREA 3GZXB 1QJGA 4K1UA 3GRDA 3WA2X 4HM7B 4N6V0 3K0ZA 2OCTA 5STDA 1PFPA 4RNZA 4EXRA 1OHPA 1IV9A 3IJEB 1SPUA 3FGYA 4K1VA 2GXFA 1VQ53 4FMCA 4XM4A 1TU5A 3NM2A 1CEWI 1JNQA 1VQ73 1GD3A 4R80A 1JB2A 1U5OA 4I4KA 4N6MA 3PCSA 4K61A 3DM8A 2ML5A 1CQSA 3CCJ3 3UB1A 5EEOA 4EV2A 1NB3I 1ISKA 1DMMA 2XSOB 3MKIA 4MJDA 4PEJA 3QRDA 1Q42A 3WA3A 3CC43 7STDA 5IG4A 2D42A 2W6JH 1W02A 3BNBA 1R4CA 2KRTA 3F40A 4RNYA 1GD4A 3K5TA 1O7NB 4N6LA 4R1KA 1A2VA 3EN8A 5A0OB 1GY6A 4R4KA 3WMDA 1FGMA 3V92A 4HJLB 5IG3A 2E2TA 1NO3A 1IU7A 5CF1A 3NX0A 3LTCA 4JF8A 1FUWA 4J9AA 4HYZA 4GL6A 5TGNA 1YIT3 1RN7A 3DGOA 4WYKB 2Y73A 2UX0A 3LOYA 1J2BA 3KFQC 2CHCA 1O7MB 2K54A 4AEQA 3EE1A 1VQM3 1OACA 4O8SA 1NU3A 1Q40B 5AIIA 4FMBA 3S5CA 3UJMA 3CPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCD A;  2F99 A;  3LZA A;  3F14 A;  2YFL B;  3NBR A;  1EA2 A;  3B8L A;  3BB9 A;  2B24 B;  2QGU A;  3G16 A;  3EJV A;  3G8Z A;  1EG9 B;  2Z76 A;  3T8N A;  4L8O A;  2HMJ B;  3F8X A;  5FW5 A;  4CDL A;  4N3V A;  1JKG B;  1OH0 A;  5DRE A;  1Z1S A;  1WQL B;  3K7C A;  2JQ5 A;  3EF8 A;  5D83 A;  2BMQ B;  2OWP A;  3VGN A;  1ULJ B;  1NDO B;  3CNM A;  2A15 A;  2GBX B;  2YFI B;  3NV0 B;  4WYK A;  5CLK A;  3MHE A;  3SED A;  2GEY A;  5DRV A;  3JUN A;  4HKV B;  5G2G A;  1OF5 B;  2Z77 A;  5AIF A;  4XBT A;  1OUN A;  1A2K A;  3MYT A;  4L8P A;  2F86 B;  4J8T A;  3EQQ B;  1JN5 B;  3MG2 A;  4XDW A;  1JKG A;  1GYB A;  4XB5 A;  5EVH A;  1E3V A;  3EX9 A;  1GY5 A;  1O7H B;  3A76 A;  3RGR A;  3NUV A;  3VSY A;  3E99 A;  5KP1 A;  1O7W B;  1TUH A;  3M8C A;  1OGX A;  2BMO B;  4HVN A;  3F9S A;  3FF2 A;  3NXJ A;  5IG5 A;  3OV4 A;  3NV0 A;  4STD A;  1UUV B;  5CF2 A;  2HMM B;  1BUQ A;  1ASK A;  3OXA A;  2STD A;  2F98 A;  3FSD A;  4R9L A;  2HML B;  2B1X B;  3DZL A;  3OX9 A;  3H3H A;  3CNX A;  3FKA A;  4HM4 B;  5AEW B;  3LYG A;  3DMC A;  3JUO A;  4HZB B;  1ULI B;  3GWR A;  1OF5 A;  3GZY B;  3STD A;  5BXQ A;  1HKX A;  1IDP A;  1JN5 A;  3MG3 A;  3ER7 A;  4FCM A;  4HM3 B;  1W00 A;  1ZO2 A;  5IF6 A;  1E97 A;  3DUK A;  3KZT A;  3BLZ A;  3G0K A;  5BVB A;  1JB5 A;  4HM6 B;  3FZW A;  1SJW A;  4R9K A;  3T8U A;  5D82 A;  5IEO A;  4FCJ A;  4RZM A;  2CKF B;  3EBT A;  2RGQ A;  3F7S A;  4XBX A;  2QIY A;  4XBY A;  4WP5 A;  1OPY A;  4U13 A;  4L7K A;  4X2O A;  1Q40 A;  3KKG A;  3RGA A;  4OUQ A;  4HM2 B;  3EC9 A;  1QMA A;  1ZX2 A;  2BNG A;  3Q90 A;  2YFJ B;  1C7H A;  1OHS A;  2HMO B;  2XRX B;  1NWW A;  3KE7 A;  4IIA A;  3SOA A;  4HM0 B;  5IG0 A;  4KVH A;  5IEP A;  3FLJ A;  3HX8 A;  8CHO A;  3I0Y A;  5D81 A;  1VZZ A;  2INX A;  2RFR A;  3GZR A;  1K41 A;  3DXO A;  3HZP A;  2XSH B;  4HZ9 B;  2HMN B;  3H51 A;  1S5A A;  1OCV A;  4HM1 B;  5AIH A;  3HK4 A;  4HM8 B;  4LEH A;  3OWU A;  4WWU C;  3OWS A;  4ORL A;  1O7G B;  2W2C A;  3OWY A;  1GY7 A;  1TP6 A;  3JUM A;  2PZV A;  5AEU B;  3B4P A;  5CXO A;  3F8H A;  1OHO A;  5IEN A;  4HM5 B;  3JUQ A;  3EN1 B;  5CK6 A;  3B4O A;  5AIG A;  3FF0 A;  5AI1 A;  6STD A;  4X2H A;  4LGQ A;  5JPU A;  1STD A;  2GEX A;  3FH1 A;  1E3R A;  3MSO A;  3ROB A;  5KP4 A;  2Z7A A;  3NHX A;  4H3U A;  5HGR A;  3JUP A;  5KP3 A;  4XDV A;  3IPT A;  3GZB A;  3SOY A;  1W6Y A;  3F7X A;  3D9R A;  4LMI A;  4OVM A;  2IMJ A;  1OGZ A;  1UUW B;  2R4I A;  1JB4 A;  1O7P B;  1DMQ A;  4Q53 A;  1GS3 A;  3EHC A;  2BMR B;  2HMK B;  3KSP A;  2GBW B;  2I9W A;  5JPP A;  1DMN A;  3ECF A;  5IER A;  1W01 A;  2XR8 B;  1AR0 A;  3EBY A;  3UNL A;  4GB5 A;  3B7C A;  3CU3 A;  3MG1 A;  3GZX B;  1QJG A;  4K1U A;  3GRD A;  4HM7 B;  3K0Z A;  5STD A;  1OHP A;  3FGY A;  4K1V A;  2GXF A;  4XM4 A;  3NM2 A;  1JB2 A;  1U5O A;  4I4K A;  3DM8 A;  1CQS A;  1ISK A;  1DMM A;  2XSO B;  3MKI A;  4MJD A;  4PEJ A;  1Q42 A;  7STD A;  5IG4 A;  1W02 A;  3F40 A;  1O7N B;  4R1K A;  3EN8 A;  1GY6 A;  3WMD A;  5IG3 A;  4HJL B;  5CF1 A;  4J9A A;  5TGN A;  4WYK B;  2UX0 A;  2CHC A;  1O7M B;  2K54 A;  1NU3 A;  1Q40 B;  5AII A;  3S5C A;  3UJM A;  3CPO A; 
#chains in the Genus database with same CATH topology
 2OOV C;  3O8Y A;  2RCD A;  4AKZ A;  2F99 A;  3SLU A;  1S72 3;  3URP A;  3LZA A;  3F14 A;  1RKY A;  2YFL B;  3Q1C A;  1QVF 2;  3HOH A;  3NBR A;  1EA2 A;  2BHM A;  3B8L A;  3BB9 A;  4BU4 A;  1YI2 3;  2B24 B;  3X3Z A;  1HZ1 A;  1LOV A;  1SIH A;  2QGU A;  1TJD A;  1K73 4;  1TFK A;  2CWT A;  3G16 A;  3EJV A;  1I0X A;  1UDI I;  2H0I A;  3G8Z A;  1EG9 B;  1BRK A;  4LYL B;  2Z76 A;  5G1K A;  3T8N A;  3RNT A;  3WOE B;  1MWT A;  1LOX A;  3FG3 A;  4L8O A;  1KC8 4;  2HMJ B;  1CH0 A;  3F8X A;  3S29 A;  5FW5 A;  3V98 A;  3V99 A;  2WO0 A;  3NBJ A;  1JKG B;  2P38 A;  4N3V A;  3U1W A;  4CDL A;  1SII A;  4GSP A;  1OH0 A;  3CCQ 3;  1EKM A;  1UI8 A;  7GSP A;  1FGT A;  4LZI A;  2WOH A;  3CCE 3;  5JBS A;  5DRE A;  1AVK A;  1Z1S A;  1CYU A;  1WQL B;  2FNQ A;  2E2U A;  1X1U A;  1BRI A;  3WDG B;  3K7C A;  3TDG A;  2L1S A;  1B2Z A;  1IV7 A;  2V1L A;  3BU4 A;  2JQ5 A;  3KN4 A;  1N5P A;  3EF8 A;  5D83 A;  2BMQ B;  4NPB A;  1DE3 A;  2OWP A;  2XGL A;  3VGN A;  1ULJ B;  2C10 A;  4O3V A;  3G71 3;  2L4V A;  1FW7 A;  3MWZ A;  1JZO A;  3DGN A;  4EBG A;  5FGO A;  3AGN A;  1NDO B;  1RSN A;  1D6Y A;  3CNM A;  3S67 A;  2GU3 A;  1DVD A;  2A15 A;  2XH9 A;  1GMP A;  3ZG5 A;  1D6Z A;  4BTX A;  2BT3 A;  2CH9 A;  2C11 A;  1I8V A;  2GBX B;  2QEX 3;  2YFI B;  4N6U A;  3NV0 B;  1BSA A;  4WYK A;  3LT8 A;  5G1L A;  9RNT A;  1US1 A;  1YJ9 3;  1EUI C;  1BAO A;  2CX0 A;  5CLK A;  1B2U A;  1UW1 A;  1EQK A;  1IVV A;  4KFD A;  1W4N A;  2IA7 A;  3MHE A;  3SED A;  1YVB I;  3KII A;  1K8A 4;  1BNR A;  1VQ8 3;  1RMS A;  4TX4 A;  4QWT A;  1V74 A;  1X1Y A;  3BNE A;  2GEY A;  1GOV A;  1W2Z A;  5DRV A;  3JUN A;  1N9E A;  1I2F A;  4HKV B;  5G2G A;  2AAD A;  3CC2 3;  1OF5 B;  1Q7H A;  4CJN A;  2OTL 3;  2RNT A;  2Z77 A;  2SAR A;  5AIF A;  1FYS A;  4XBT A;  1OUN A;  1A2K A;  1JRQ A;  3MYT A;  3CMA 3;  1L5G B;  4L8P A;  1RGC A;  2R41 A;  1BNS A;  1NJI 4;  1A67 A;  2F86 B;  4HAA A;  2P0X A;  4FCZ A;  1K9M 4;  4J8T A;  1X1W A;  4GHO A;  3EQQ B;  2ZL8 A;  1JN5 B;  3MG2 A;  4XDW A;  4KFE A;  1JKG A;  2WGO A;  1VQK 3;  5BU4 A;  1G96 A;  3X40 A;  1TFO A;  4BL2 A;  1GYB A;  1MNL A;  2P05 A;  3PYJ A;  2LYX A;  3WOD G;  1W6G A;  2W04 A;  3CPW 2;  4XB5 A;  5EVH A;  3JVC A;  2CG1 A;  1E3V A;  2BO9 B;  3EX9 A;  1WMN A;  3N8B A;  2ZDJ A;  3PCR A;  1GY5 A;  1FGO A;  1O7H B;  4I5Q A;  1UCJ A;  3NQY A;  1BAN A;  4FMD A;  3CC7 3;  3A76 A;  1UI7 A;  3NUV A;  1N5H A;  3RGR A;  3VSY A;  1U8C B;  5AYR B;  2UUG C;  3E99 A;  5KP1 A;  1VQL 3;  1O7W B;  1TUH A;  3M8C A;  2CIU A;  1OGX A;  3X42 A;  1CYV A;  2BMO B;  4HVN A;  1I0V A;  3F9S A;  1Q86 4;  1B27 A;  4BL3 A;  3FF2 A;  1M1K 4;  3CME 3;  1FUT A;  3NXJ A;  1FA3 A;  5IG5 A;  1N8R 4;  3AHW A;  2O3O A;  3OV4 A;  1YHQ 3;  1FGR A;  3NV0 A;  4STD A;  1UUV B;  5CF2 A;  4KFF A;  2HMM B;  1BUQ A;  1ASK A;  3OXA A;  2STD A;  2F98 A;  4ILF A;  3FSD A;  4R9L A;  1BU4 A;  1DVC A;  2CG0 A;  3OW2 2;  1I3I A;  1YGE A;  2HML B;  1ZGX A;  3CCR 3;  1WMP A;  2B1X B;  1RGA A;  2XFT A;  3CCL 3;  1FGQ A;  3DZL A;  1BNE A;  2CW9 A;  2HOH A;  2WGQ A;  3CNX A;  3FKA A;  3FG4 A;  3H3H A;  3LYG A;  3OX9 A;  3DMC A;  4HM4 B;  4H61 A;  2OQE A;  3IMA B;  3SXX A;  3S28 A;  3JUO A;  3WOF B;  5BIR A;  4HZB B;  1ULI B;  4EYC A;  4FMA A;  1A90 A;  1V58 A;  2BIR A;  3GWR A;  1OF5 A;  5AEW B;  1QVG 2;  1VQ4 3;  2ML6 A;  3GZY B;  3STD A;  1BSE A;  5BXQ A;  2W9P A;  4EW5 A;  3QK9 A;  2MF7 A;  1BVI A;  3SX1 A;  3I56 3;  2D1W A;  2F56 A;  2IYJ A;  2CWV A;  3ZFZ A;  1LRA A;  3K63 A;  3X3X A;  1RNB A;  1RGL A;  1HKX A;  1IDP A;  1JN5 A;  2KF4 A;  1RGE A;  3MG3 A;  4CPK A;  2KCD A;  1FZU A;  1EEJ A;  1GOU A;  1UCL A;  3ER7 A;  1W00 A;  4FCM A;  1N9J A;  4HM3 B;  1I3F A;  2CFL A;  2WOF A;  1ZO2 A;  1GMR A;  4CCV A;  5IF6 A;  3WR2 A;  1E97 A;  2ZA4 A;  3DUK A;  3KZT A;  1F8N A;  1MGR A;  1STF I;  3BLZ A;  3G0K A;  1LQM B;  3N54 B;  3ALA A;  1UCI A;  2FXT A;  1LNH A;  3UL5 A;  1JB5 A;  4HM6 B;  5BVB A;  3FZW A;  2W9Q A;  4G1M B;  3KSE D;  4IT7 A;  3VF1 A;  1RDS A;  5HOH A;  1M1X B;  1LQG C;  1SJW A;  5I97 A;  1ZS7 A;  2SBL A;  3EB8 A;  4R9K A;  2KF5 A;  3T8U A;  3CCV 3;  5D82 A;  1RGG A;  2MC8 A;  5IEO A;  4FCJ A;  3LH4 A;  4RZM A;  3UL6 A;  1I70 A;  2CKF B;  1UUG B;  3EBT A;  2RGQ A;  3F7S A;  2CFK A;  4XBX A;  2IUJ A;  2OQE C;  1YJW 3;  2QIY A;  2CWU A;  2XF3 A;  4XBY A;  4WP5 A;  3SYU A;  1OPY A;  3D3L A;  4U13 A;  2O9U X;  4L7K A;  5LC6 A;  4X2O A;  1Q40 A;  3KKG A;  3RGA A;  1IQ8 A;  1PYL A;  3S27 A;  4OUQ A;  1R4Y A;  3HI7 A;  4HM2 B;  1YVS A;  1VQO 3;  1T2H A;  3EC9 A;  1QMA A;  1ZX2 A;  2BNG A;  3CCU 3;  2QA4 3;  1AQZ A;  3Q90 A;  3CXC 2;  1LNI A;  2H0H A;  1JBT A;  3DGY A;  1NNV A;  3PGB A;  3I55 3;  2YFJ B;  4MEI A;  4OK0 A;  1ROV A;  1C7H A;  1MWR A;  1OHS A;  2KXG A;  2HMO B;  1BGS A;  2JDI H;  2XRX B;  1WMO A;  1NWW A;  4KZ1 A;  2W03 A;  1YJN 3;  5RNT A;  1RTU A;  1RGK A;  2W0Q A;  1B2S A;  1BSC A;  3BND A;  3KE7 A;  1RLS A;  4WHA A;  3N9H A;  3PS8 A;  3U97 A;  1UCK A;  1TIJ A;  4O02 B;  5ELJ A;  1RN4 A;  1RHL A;  4IIA A;  4NHF A;  3LXU X;  2Q07 A;  3SOA A;  4N6T A;  4HM0 B;  1BRS A;  4FR9 A;  4J5G A;  1BSD A;  3Q3F A;  5IG0 A;  1SAR A;  5M1A A;  3G6E 3;  4KVH A;  1JBR A;  5IEP A;  1RRL A;  1BNJ A;  3FLJ A;  3DGL A;  3HX8 A;  8CHO A;  1SQW A;  2E2V A;  1RGF A;  3I0Y A;  5D81 A;  3CCM 3;  1VZZ A;  1RJO A;  2INX A;  2RFR A;  2YX9 A;  4N6O B;  3X3Y A;  2LQV A;  3NBB A;  2OOV A;  3GZR A;  5IW9 A;  1K41 A;  3DXO A;  3HZP A;  3LML A;  1JZD A;  2XSH B;  4MMX B;  4HZ9 B;  2P0M A;  1IT7 A;  3MPH A;  3FG1 A;  2HMN B;  3H51 A;  1S5A A;  1RGH A;  3CCS 3;  1QAF A;  1Q9E A;  4JRF A;  1KD1 4;  1OCV A;  4HM1 B;  3D4A A;  3HIG A;  5AIH A;  1W5Z A;  1I2E A;  1W6C A;  1JBS A;  1BUJ A;  2XFS A;  1YGW A;  3HK4 A;  3LTB A;  4HM8 B;  4LEH A;  5ELU A;  3OWU A;  1IVW A;  4WWU C;  1KWI A;  2RSX A;  3LTD A;  3OWS A;  3BIR A;  1GSP A;  2CK3 H;  1LXE A;  1QAK A;  1WNH A;  2K3D A;  4ORL A;  1O7G B;  1C54 A;  2ZHX B;  4N6N B;  3AMO B;  2W2C A;  2H0G A;  3OWY A;  2CFW A;  2K0M A;  1GY7 A;  1K28 A;  1TP6 A;  2KF3 A;  2PZV A;  1T3B A;  3JUM A;  3K9M C;  1PU4 A;  1A2P A;  2W56 B;  1TTO A;  1Y4K A;  5AEU B;  3B4P A;  3PZW A;  5CXO A;  1Q81 4;  3F8H A;  1BNF A;  1OHO A;  2IUK A;  1AVL A;  1MGW A;  1MWS A;  5IEN A;  5M18 A;  4HM5 B;  3JUQ A;  2XEP A;  3EN1 B;  1VQQ A;  5CK6 A;  5M19 A;  3B4O A;  5AYS C;  5AIG A;  3FF0 A;  1V57 A;  5AI1 A;  2OTJ 3;  6STD A;  2GU1 A;  1IYY A;  1B3S A;  1BNG A;  4X2H A;  1DET A;  1IT8 A;  2XGN A;  1UGI A;  4LGQ A;  3AHS A;  1VQ6 3;  1MOL A;  1BRJ A;  5JPU A;  1STD A;  3PXM A;  2GEX A;  2Y74 A;  1IQX A;  4K90 B;  3A5E A;  1IQY A;  3FH1 A;  1B20 A;  1RRH A;  1BNI A;  1BSB A;  1E3R A;  4WFO A;  1T5Y A;  1X1X A;  1YIJ 3;  3MSO A;  3L0R A;  3ROB A;  4O2H A;  1FUS A;  3LT9 A;  5KP4 A;  1BOX A;  2Z7A A;  3NHX A;  3NQZ A;  3GAX A;  2CFD A;  4H3U A;  5HGR A;  3JUP A;  4AKY A;  5LC7 A;  3DGM A;  2GSP A;  5KP3 A;  3AGO A;  4XDV A;  3IPT A;  3GZB A;  3DH2 A;  3DY5 A;  1M90 4;  3Q2P A;  1VQ9 3;  6GSP A;  2PNC A;  2M7O A;  4MMY B;  1Q82 4;  3SOY A;  1BIR A;  1QAL A;  1W6Y A;  3F7X A;  3BNC A;  2KF6 A;  1D6U A;  3D9R A;  2P09 A;  4LMI A;  4OVM A;  2IMJ A;  3X41 A;  3HII A;  1M9G A;  1OGZ A;  1I2G A;  1JJ2 2;  3D5I A;  2F4Y A;  1UUW B;  2Z6B A;  1G02 A;  2R4I A;  3T0U A;  4BTW A;  1IVX A;  1JB4 A;  1O7P B;  2FGT A;  1DMQ A;  4HBR A;  5EQL A;  1RCL A;  1LOY A;  4Q53 A;  4BTY A;  1GMQ A;  3AMO A;  1GS3 A;  3EHC A;  2BMR B;  3FCS B;  1VQN 3;  1KQS 2;  2HMK B;  2CC3 A;  3RDE A;  1N8Q A;  4J5K A;  8RNT A;  1BRG A;  2W56 A;  3KSP A;  1B2M A;  1TRQ A;  2GBW B;  1KSI A;  2I9W A;  5JPP A;  2BU4 A;  4MMZ B;  4BIR A;  3G4S 3;  1HU9 A;  1DMN A;  1JV2 B;  2F5W A;  3ECF A;  4ZM8 A;  3NM7 A;  4EC6 A;  1WTH A;  3LTA A;  4HOH A;  4EV5 A;  1Q7Y 4;  4RBN A;  5IER A;  1W7C A;  3J7Y d;  3GSP A;  2F5M A;  1W2B 2;  1VQP 3;  1W01 A;  3CC4 3;  1AV4 A;  1IVU A;  2XR8 B;  2CFG A;  1AR0 A;  1RN1 A;  3SVA A;  4KT3 B;  1LOW A;  3EBY A;  4IPB A;  3UNL A;  3CD6 3;  1ROA A;  4GB5 A;  4LSO A;  1IK3 A;  1LVN A;  1NB5 I;  3B7C A;  3CU3 A;  3MG1 A;  1DYU A;  1TRP A;  4NRE A;  3GZX B;  1QJG A;  4K1U A;  3GRD A;  3WA2 X;  3KCH A;  2KAA A;  4HM7 B;  4N6V 0;  3K0Z A;  2OCT A;  1G0T A;  1PFP A;  4RNZ A;  5STD A;  4EXR A;  1OHP A;  1IV9 A;  3IJE B;  1SPU A;  3FGY A;  4K1V A;  2GXF A;  1VQ5 3;  1PY3 A;  3D79 A;  1HYF A;  4FMC A;  4XM4 A;  3WHO A;  1TU5 A;  3NM2 A;  1CEW I;  1JNQ A;  1VQ7 3;  1GD3 A;  4R80 A;  1JB2 A;  1BRH A;  1U5O A;  4I4K A;  4N6M A;  1BRN L;  3PCS A;  4K61 A;  3D5G A;  3DM8 A;  2ML5 A;  1CQS A;  3CCJ 3;  3UB1 A;  5EEO A;  4EV2 A;  1NB3 I;  1ISK A;  1DMM A;  1B2X A;  2J8X B;  2XSO B;  3MKI A;  4MJD A;  3QRD A;  1Q42 A;  1B21 A;  1GOY A;  2RBI A;  4PEJ A;  5GSP A;  3WA3 A;  1MWU A;  2AAE A;  7STD A;  5IG4 A;  1YNV X;  2D42 A;  2W6J H;  1W02 A;  3BNB A;  1R4C A;  2KRT A;  3F40 A;  4RNY A;  1GD4 A;  3K5T A;  1O7N B;  4N6L A;  4R1K A;  1A2V A;  3EN8 A;  5A0O B;  1GY6 A;  4R4K A;  3WMD A;  1FGM A;  7RNT A;  3V92 A;  4HJL B;  5IG3 A;  2E2T A;  1NO3 A;  1IU7 A;  5CF1 A;  3NX0 A;  3ZG0 A;  3LTC A;  4DKI A;  4JF8 A;  1FUW A;  4J9A A;  4HYZ A;  4GL6 A;  5TGN A;  1YIT 3;  1RN7 A;  2IY2 A;  6RNT A;  3DGO A;  4WYK B;  2Y73 A;  2C4B A;  2UX0 A;  1AY7 A;  3LOY A;  1J2B A;  3KFQ C;  2CHC A;  1O7M B;  2K54 A;  4AEQ A;  1RNT A;  3EE1 A;  1OAC A;  4O8S A;  1VQM 3;  4RNT A;  1NU3 A;  1Q40 B;  5AII A;  4FMB A;  3S5C A;  1T2I A;  2CX1 A;  1UGH I;  2UGI A;  3UJM A;  1RCK A;  3CPO A; 
#chains in the Genus database with same CATH homology
 2OOV C;  3O8Y A;  2RCD A;  4AKZ A;  2F99 A;  3SLU A;  1S72 3;  3LZA A;  3F14 A;  1RKY A;  2YFL B;  3Q1C A;  1QVF 2;  3NBR A;  1EA2 A;  2BHM A;  3B8L A;  3BB9 A;  1YI2 3;  2B24 B;  3X3Z A;  1SIH A;  2QGU A;  1K73 4;  1TFK A;  2CWT A;  3G16 A;  3EJV A;  3G8Z A;  1EG9 B;  2Z76 A;  3T8N A;  3WOE B;  1LOX A;  3FG3 A;  4L8O A;  1KC8 4;  2HMJ B;  3F8X A;  3S29 A;  5FW5 A;  3V98 A;  3V99 A;  2WO0 A;  3NBJ A;  1JKG B;  2P38 A;  4N3V A;  3U1W A;  4CDL A;  1SII A;  3CCQ 3;  1OH0 A;  1EKM A;  1UI8 A;  1FGT A;  4LZI A;  2WOH A;  3CCE 3;  5JBS A;  5DRE A;  1AVK A;  1Z1S A;  1CYU A;  1WQL B;  2FNQ A;  2E2U A;  3WDG B;  3K7C A;  3TDG A;  1IV7 A;  2V1L A;  2JQ5 A;  3KN4 A;  1N5P A;  3EF8 A;  5D83 A;  2BMQ B;  2OWP A;  2XGL A;  3VGN A;  1ULJ B;  2C10 A;  4O3V A;  3G71 3;  2L4V A;  3MWZ A;  3DGN A;  4EBG A;  5FGO A;  1NDO B;  1D6Y A;  3CNM A;  3S67 A;  2GU3 A;  1DVD A;  2A15 A;  2XH9 A;  1D6Z A;  4BTX A;  2BT3 A;  2CH9 A;  2C11 A;  2GBX B;  2QEX 3;  2YFI B;  4N6U A;  3NV0 B;  4WYK A;  3LT8 A;  1US1 A;  1YJ9 3;  5CLK A;  1UW1 A;  1EQK A;  1IVV A;  4KFD A;  1W4N A;  2IA7 A;  3MHE A;  3SED A;  1YVB I;  3KII A;  1K8A 4;  1VQ8 3;  4TX4 A;  4QWT A;  1V74 A;  3BNE A;  2GEY A;  1W2Z A;  5DRV A;  3JUN A;  1N9E A;  4HKV B;  5G2G A;  3CC2 3;  1OF5 B;  2OTL 3;  2Z77 A;  5AIF A;  4XBT A;  1OUN A;  1A2K A;  1JRQ A;  3MYT A;  3CMA 3;  1L5G B;  4L8P A;  1A67 A;  2F86 B;  2P0X A;  4FCZ A;  1K9M 4;  4J8T A;  3EQQ B;  2ZL8 A;  1JN5 B;  3MG2 A;  4XDW A;  4KFE A;  1JKG A;  2WGO A;  1VQK 3;  1G96 A;  3X40 A;  1TFO A;  1GYB A;  1MNL A;  2P05 A;  3PYJ A;  2LYX A;  3WOD G;  1W6G A;  2W04 A;  3CPW 2;  4XB5 A;  5EVH A;  3JVC A;  2CG1 A;  1E3V A;  2BO9 B;  3EX9 A;  1WMN A;  3N8B A;  2ZDJ A;  3PCR A;  1GY5 A;  1FGO A;  1O7H B;  3NQY A;  4FMD A;  3CC7 3;  3A76 A;  1UI7 A;  3NUV A;  1N5H A;  3RGR A;  3VSY A;  1U8C B;  5AYR B;  3E99 A;  5KP1 A;  1VQL 3;  1O7W B;  1TUH A;  3M8C A;  2CIU A;  1OGX A;  3X42 A;  1CYV A;  2BMO B;  4HVN A;  3F9S A;  1Q86 4;  3FF2 A;  1M1K 4;  3CME 3;  3NXJ A;  1FA3 A;  5IG5 A;  1N8R 4;  2O3O A;  3OV4 A;  1YHQ 3;  1FGR A;  3NV0 A;  4STD A;  1UUV B;  5CF2 A;  4KFF A;  2HMM B;  1BUQ A;  1ASK A;  3OXA A;  2STD A;  2F98 A;  3FSD A;  4R9L A;  1DVC A;  2CG0 A;  3OW2 2;  1YGE A;  2HML B;  3CCR 3;  1WMP A;  2B1X B;  2XFT A;  3CCL 3;  1FGQ A;  3DZL A;  2WGQ A;  2CW9 A;  3CNX A;  3FKA A;  3FG4 A;  3H3H A;  3OX9 A;  4HM4 B;  3LYG A;  5AEW B;  3DMC A;  2OQE A;  4H61 A;  1NJI 4;  3IMA B;  3SXX A;  3S28 A;  3JUO A;  3WOF B;  4HZB B;  1ULI B;  4EYC A;  4FMA A;  1A90 A;  3GWR A;  1OF5 A;  1QVG 2;  1VQ4 3;  2ML6 A;  3GZY B;  3STD A;  5BXQ A;  2W9P A;  3QK9 A;  2MF7 A;  3SX1 A;  3I56 3;  2D1W A;  2CWV A;  3K63 A;  3X3X A;  1HKX A;  1IDP A;  1JN5 A;  3MG3 A;  2KCD A;  3ER7 A;  4FCM A;  4HM3 B;  1W00 A;  1N9J A;  2WOF A;  2CFL A;  1ZO2 A;  5IF6 A;  4CCV A;  1E97 A;  3DUK A;  3KZT A;  1F8N A;  1STF I;  3BLZ A;  3G0K A;  3N54 B;  3ALA A;  2FXT A;  1LNH A;  3UL5 A;  1JB5 A;  4HM6 B;  5BVB A;  3FZW A;  2W9Q A;  4G1M B;  3KSE D;  4IT7 A;  3VF1 A;  1M1X B;  1SJW A;  5I97 A;  3EB8 A;  2SBL A;  4R9K A;  3T8U A;  3CCV 3;  5D82 A;  2MC8 A;  5IEO A;  4FCJ A;  3LH4 A;  4RZM A;  3UL6 A;  2CKF B;  3EBT A;  2RGQ A;  3F7S A;  2CFK A;  4XBX A;  2IUJ A;  2OQE C;  1YJW 3;  2QIY A;  2CWU A;  2XF3 A;  4XBY A;  4WP5 A;  1OPY A;  3D3L A;  4U13 A;  2O9U X;  4L7K A;  5LC6 A;  4X2O A;  1Q40 A;  3KKG A;  3RGA A;  1IQ8 A;  3S27 A;  4OUQ A;  3HI7 A;  4HM2 B;  1VQO 3;  3EC9 A;  1QMA A;  1ZX2 A;  2BNG A;  3CCU 3;  2QA4 3;  3Q90 A;  3CXC 2;  3PGB A;  3I55 3;  2YFJ B;  4MEI A;  4OK0 A;  1ROV A;  1C7H A;  1OHS A;  2KXG A;  2HMO B;  2JDI H;  2XRX B;  1WMO A;  1NWW A;  4KZ1 A;  2W03 A;  1YJN 3;  2W0Q A;  3BND A;  3KE7 A;  4WHA A;  3N9H A;  3PS8 A;  3U97 A;  1TIJ A;  4O02 B;  5ELJ A;  4IIA A;  4NHF A;  3SOA A;  3LXU X;  2Q07 A;  4N6T A;  4HM0 B;  4FR9 A;  5IG0 A;  3G6E 3;  4KVH A;  5IEP A;  1RRL A;  3FLJ A;  3DGL A;  3HX8 A;  8CHO A;  1SQW A;  2E2V A;  3I0Y A;  5D81 A;  3CCM 3;  1VZZ A;  1RJO A;  2INX A;  2RFR A;  2YX9 A;  4N6O B;  3X3Y A;  2LQV A;  3NBB A;  2OOV A;  3GZR A;  5IW9 A;  1K41 A;  3DXO A;  3HZP A;  3LML A;  2XSH B;  4MMX B;  4HZ9 B;  2P0M A;  1IT7 A;  3MPH A;  3FG1 A;  2HMN B;  3H51 A;  1S5A A;  3CCS 3;  1QAF A;  4JRF A;  1KD1 4;  1OCV A;  4HM1 B;  3HIG A;  5AIH A;  1W5Z A;  1W6C A;  2XFS A;  3HK4 A;  3LTB A;  4HM8 B;  4LEH A;  5ELU A;  3OWU A;  1IVW A;  4WWU C;  1KWI A;  2RSX A;  3LTD A;  3OWS A;  2CK3 H;  1LXE A;  1QAK A;  1WNH A;  4ORL A;  1O7G B;  4N6N B;  3AMO B;  2W2C A;  3OWY A;  2CFW A;  2K0M A;  1GY7 A;  1K28 A;  1TP6 A;  2PZV A;  3JUM A;  3K9M C;  1PU4 A;  2W56 B;  1Y4K A;  5AEU B;  3B4P A;  3PZW A;  5CXO A;  1Q81 4;  3F8H A;  1OHO A;  2IUK A;  1AVL A;  5IEN A;  4HM5 B;  3JUQ A;  2XEP A;  3EN1 B;  5CK6 A;  3B4O A;  5AYS C;  5AIG A;  3FF0 A;  5AI1 A;  2OTJ 3;  6STD A;  2GU1 A;  4X2H A;  1IT8 A;  2XGN A;  4LGQ A;  1VQ6 3;  1MOL A;  5JPU A;  1STD A;  3PXM A;  2GEX A;  2Y74 A;  1IQX A;  4K90 B;  1IQY A;  3FH1 A;  1RRH A;  1E3R A;  4WFO A;  1T5Y A;  1YIJ 3;  3MSO A;  3L0R A;  3ROB A;  4O2H A;  3LT9 A;  5KP4 A;  2Z7A A;  3NHX A;  3NQZ A;  3GAX A;  2CFD A;  4H3U A;  5HGR A;  3JUP A;  4AKY A;  5LC7 A;  3DGM A;  5KP3 A;  4XDV A;  3IPT A;  3GZB A;  3DY5 A;  1M90 4;  3Q2P A;  1VQ9 3;  2PNC A;  2M7O A;  4MMY B;  1Q82 4;  3SOY A;  1QAL A;  1W6Y A;  3F7X A;  3BNC A;  1D6U A;  3D9R A;  2P09 A;  4LMI A;  4OVM A;  2IMJ A;  3X41 A;  3HII A;  1M9G A;  1OGZ A;  1JJ2 2;  1UUW B;  2Z6B A;  2R4I A;  3T0U A;  4BTW A;  1IVX A;  1JB4 A;  1O7P B;  2FGT A;  1DMQ A;  4HBR A;  5EQL A;  4Q53 A;  4BTY A;  3AMO A;  1GS3 A;  3EHC A;  2BMR B;  3FCS B;  1VQN 3;  1KQS 2;  2HMK B;  2CC3 A;  3RDE A;  1N8Q A;  2W56 A;  3KSP A;  2GBW B;  1KSI A;  2I9W A;  5JPP A;  3G4S 3;  4MMZ B;  1HU9 A;  1DMN A;  1JV2 B;  3ECF A;  4ZM8 A;  3NM7 A;  4EC6 A;  1WTH A;  3LTA A;  4EV5 A;  1Q7Y 4;  4RBN A;  5IER A;  1W7C A;  3J7Y d;  1W2B 2;  1VQP 3;  1W01 A;  1AV4 A;  1IVU A;  2XR8 B;  2CFG A;  1AR0 A;  3SVA A;  3EBY A;  4IPB A;  3UNL A;  3CD6 3;  1ROA A;  4GB5 A;  4LSO A;  1IK3 A;  1LVN A;  1NB5 I;  3B7C A;  3CU3 A;  3MG1 A;  1DYU A;  4NRE A;  3GZX B;  1QJG A;  4K1U A;  3GRD A;  3WA2 X;  4HM7 B;  4N6V 0;  3K0Z A;  2OCT A;  5STD A;  1PFP A;  4RNZ A;  4EXR A;  1OHP A;  1IV9 A;  3IJE B;  1SPU A;  3FGY A;  4K1V A;  2GXF A;  1VQ5 3;  4FMC A;  4XM4 A;  1TU5 A;  3NM2 A;  1CEW I;  1JNQ A;  1VQ7 3;  1GD3 A;  4R80 A;  1JB2 A;  1U5O A;  4I4K A;  4N6M A;  3PCS A;  4K61 A;  3DM8 A;  2ML5 A;  1CQS A;  3CCJ 3;  3UB1 A;  5EEO A;  4EV2 A;  1NB3 I;  1ISK A;  1DMM A;  2XSO B;  3MKI A;  4MJD A;  4PEJ A;  3QRD A;  1Q42 A;  3WA3 A;  3CC4 3;  7STD A;  5IG4 A;  2D42 A;  2W6J H;  1W02 A;  3BNB A;  1R4C A;  2KRT A;  3F40 A;  4RNY A;  1GD4 A;  3K5T A;  1O7N B;  4N6L A;  4R1K A;  1A2V A;  3EN8 A;  5A0O B;  1GY6 A;  4R4K A;  3WMD A;  1FGM A;  3V92 A;  4HJL B;  5IG3 A;  2E2T A;  1NO3 A;  1IU7 A;  5CF1 A;  3NX0 A;  3LTC A;  4JF8 A;  1FUW A;  4J9A A;  4HYZ A;  4GL6 A;  5TGN A;  1YIT 3;  1RN7 A;  3DGO A;  4WYK B;  2Y73 A;  2UX0 A;  3LOY A;  1J2B A;  3KFQ C;  2CHC A;  1O7M B;  2K54 A;  4AEQ A;  3EE1 A;  1VQM 3;  1OAC A;  4O8S A;  1NU3 A;  1Q40 B;  5AII A;  4FMB A;  3S5C A;  3UJM A;  3CPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...