1JB2A

Crystal structure of ntf2 m84e mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISEVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords NUCLEAR TRANSPORT FACTOR 2
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb2A00
1E3RA 5G2GA 1GS3A 1E3VA 4STDA 1GY6A 4HM2B 2OWPA 2QIYA 4XBTA 1GYBA 3HZPA 3B8LA 4WWUC 3CPOA 1OF5B 2GXFA 3UJMA 3FGYA 3MYTA 5IEPA 1UUVB 1OHPA 1Z1SA 2XR8B 3F8XA 3OV4A 4HM0B 1NU3A 3VGNA 4J8TA 8CHOA 4LEHA 5D82A 3RGAA 1ZX2A 1K41A 2YFLB 3B4OA 3JUOA 2HMMB 3ECFA 2W2CA 4WP5A 3G0KA 3SOYA 3JUPA 3KSPA 3VSYA 3CNMA 2F99A 3F14A 3NV0A 3MKIA 4LGQA 1AR0A 1JKGB 1TUHA 3KKGA 7STDA 2F86B 1QJGA 4LMIA 5AIGA 2GBWB 1DMQA 3IPTA 1OGXA 1WQLB 3FH1A 1VZZA 3E99A 1O7NB 2Z77A 1Q40B 3JUNA 3NM2A 2A15A 4XM4A 5CF2A 5KP1A 1U5OA 1SJWA 1W00A 3GZRA 3KE7A 2UX0A 3DUKA 3EX9A 3FKAA 1DMMA 4FCMA 2HMJB 1OF5A 3B7CA 3NUVA 4HKVB 2BMOB 1HKXA 1OHSA 1Q40A 1Q42A 1ULJB 4FCJA 2CKFB 3A76A 4HM1B 4PEJA 1W6YA 4KVHA 1C7HA 2PZVA 4R9KA 4WYKB 2RGQA 3OX9A 4XBYA 3OWUA 3G8ZA 1ASKA 3GZYB 4XDVA 4X2OA 1GY7A 2GBXB 2JQ5A 1S5AA 3CU3A 3H3HA 1JB4A 1JB5A 1W01A 4L8OA 5D81A 5CXOA 3HX8A 3OWYA 2XSHB 4CDLA 3MG1A 1BUQA 3F7SA 3BB9A 3BLZA 5BXQA 3LYGA 4R1KA 2RFRA 3F9SA 6STDA 2STDA 1JKGA 3GRDA 4J9AA 5IG4A 4RZMA 5IF6A 4I4KA 3DM8A 3S5CA 2BMRB 1QMAA 2BMQB 3B4PA 5FW5A 3MSOA 2GEXA 5TGNA 3EC9A 3JUMA 3CNXA 3JUQA 3NHXA 4K1VA 1TP6A 1OPYA 5KP4A 1W02A 1OCVA 4ORLA 2I9WA 3F40A 3GZXB 3SEDA 4HJLB 5AIIA 1OGZA 4WYKA 3FSDA 3F7XA 1O7MB 5IG3A 4HZ9B 2XRXB 1OH0A 4L7KA 3EN1B 2QGUA 4H3UA 4HM7B 4K1UA 1NWWA 1GY5A 1IDPA 3MG3A 5CF1A 1OUNA 1O7GB 2HMOB 2GEYA 3NBRA 1EG9B 5DRVA 3G16A 2YFJB 3ROBA 4HM6B 3STDA 2Z76A 1JB2A 3EQQB 2HMLB 3HK4A 3MG2A 5KP3A 3T8UA 3UNLA 5CK6A 1ULIB 3DXOA 5EVHA 3T8NA 2K54A 5IG5A 3K7CA 4R9LA 3Q90A 3EHCA 1E97A 3EN8A 4GB5A 4IIAA 4X2HA 4OVMA 5CLKA 5AIHA 3MHEA 4HM3B 4XBXA 4OUQA 3EF8A 5AIFA 5IG0A 2R4IA 5IENA 5IEOA 4N3VA 3OXAA 3FZWA 4HM5B 3EBTA 4HM8B 5BVBA 3GZBA 4HVNA 2B24B 1O7PB 1CQSA 2BNGA 2HMKB 3NXJA 5D83A 1UUWB 5HGRA 5IERA 1A2KA 2XSOB 3NV0B 2F98A 3RGRA 5AEWB 1O7WB 3EBYA 4XDWA 3DZLA 1OHOA 3K0ZA 2CHCA 3OWSA 1JN5A 3GWRA 4HM4B 4HZBB 4L8PA 2RCDA 3F8HA 3ER7A 5AI1A 3KZTA 3FLJA 3I0YA 3EJVA 4XB5A 3DMCA 2INXA 1ISKA 1NDOB 3M8CA 2B1XB 1JN5B 2HMNB 5STDA 3WMDA 3SOAA 1DMNA 3FF2A 2Z7AA 3H51A 5JPPA 4MJDA 3D9RA 1EA2A 1ZO2A 3LZAA 4Q53A 4U13A 5DREA 2YFIB 5JPUA 2IMJA 3FF0A 1O7HB 1STDA 5AEUB
chains in the Genus database with same CATH superfamily
1VQ63 1PFPA 3U1WA 2CFLA 1SQWA 3BU4A 4KZ1A 2ZDJA 3B8LA 1I8VA 1G02A 3CPOA 3U97A 3UJMA 5IEPA 3S27A 2XR8B 2F5MA 5EEOA 3OV4A 1BSDA 4JRFA 1W7CA 1ZX2A 3B4OA 4K61A 5ELUA 1JBTA 1EKMA 2OQEA 3ECFA 1B2XA 4WP5A 3SOYA 1VQN3 2XGNA 3NV0A 2E2TA 3SLUA 3KKGA 2F86B 5AIGA 4LMIA 1L5GB 1BGSA 1OGXA 2RNTA 3TDGA 1W5ZA 1O7NB 2BHMA 4N6V0 3CC23 1VQ73 1Q40B 2A15A 1BU4A 5KP1A 1U5OA 4K90B 1AVLA 3D3LA 3S67A 1N5HA 1V58A 3WOFB 3DUKA 4HKVB 2CFKA 3NUVA 1OF5A 1HKXA 4HM1B 1N8QA 3CMA3 4XBYA 1W6YA 2IA7A 3FCSB 4CPKA 2WGQA 1AQZA 2W03A 2GU3A 4JF8A 4BIRA 4EV2A 3G8ZA 1PU4A 2L4VA 3X3XA 1NO3A 3HX8A 1WTHA 4CDLA 1UI7A 5G1KA 3K63A 4R1KA 2E2UA 1IVUA 5IG4A 1J2BA 4RZMA 1T2IA 1B27A 2BT3A 1BNEA 1D6UA 1BNIA 3KCHA 1UUGB 1X1XA 3T0UA 2BMQB 3MSOA 1TIJA 1BNSA 3JUMA 4K1VA 3JUQA 6GSPA 4ILFA 1WNHA 3K5TA 1BRSA 1OCVA 1BOXA 1RN4A 2M7OA 2W56A 3GZXB 4ORLA 3G4S3 7RNTA 4HJLB 1M904 3FSDA 1JBRA 4HZ9B 2CFDA 2QGUA 4KFDA 2CWUA 4HM7B 4AKZA 1Y4KA 3WDGB 1AY7A 1OUNA 1VQM3 3I553 1B2UA 1BRIA 1IVXA 1RRLA 1YIT3 2YFJB 3T8UA 2Z76A 3EQQB 2HMLB 4EW5A 1JBSA 2ZL8A 3NQZA 1QVG2 2BO9B 1GSPA 3Q90A 3WA2X 1GD4A 2C11A 5AIHA 2L1SA 4OUQA 1FGOA 2R4IA 2KF4A 1RN7A 1STFI 2CK3H 4HM8B 4GHOA 3NXJA 2XGLA 1EEJA 3RGRA 1B2SA 1O7WB 4LYLB 4XDWA 2D42A 1YHQ3 1BNJA 1K9M4 1WMOA 2CHCA 2R41A 3NBBA 3OWSA 4HM4B 5AI1A 1YJW3 2RCDA 3F8HA 3VSYA 1WMPA 3KFQC 2INXA 4QWTA 3M8CA 5AYRB 1JN5B 5FGOA 1SPUA 3NQYA 4IPBA 5JPPA 4MJDA 2K0MA 2JDIH 2IUJA 1EA2A 3LT9A 5DREA 5JPUA 2CX0A 2KAAA 2YFIB 3N54B 3PS8A 3WA3A 1STDA 3PXMA 4HM3B 1E3RA 3WOEB 2WOHA 2P0XA 1QVF2 4BU4A 1GS3A 4STDA 2Z6BA 1RHLA 2OWPA 3FG4A 1CYVA 3Q3FA 4N6TA 4EBGA 1NNVA 1EQKA 1GMPA 3LTCA 1IQ8A 1I0VA 2GXFA 6RNTA 1UUVB 1OHPA 1LXEA 8CHOA 4LEHA 1BANA 3RGAA 1FGQA 1N8R4 2W2CA 4I5QA 4OK0A 3V92A 1SIIA 3JUPA 1FGRA 3KSPA 2ZHXB 2KF5A 3CNMA 1X1UA 3F14A 1BNRA 3MKIA 1HU9A 1IT8A 4LGQA 1K734 1ZS7A 1U8CB 1WMNA 1W6CA 2GBWB 3IPTA 4NPBA 3FH1A 1RGLA 1BRGA 1A90A 3NM2A 3X41A 3AMOB 1RNBA 4XM4A 5CF2A 1MWTA 3GZRA 1IU7A 3IJEB 3CCS3 3LXUX 2UX0A 1TRQA 4BTXA 1DMMA 2HMJB 3B7CA 2W9QA 1ULJB 1Q40A 3LTBA 1UCKA 2CKFB 3A76A 4WYKB 1C7HA 1B20A 1MGWA 2RGQA 3OX9A 4N6MA 2W56B 2XH9A 2KF3A 2XEPA 3GZYB 1QALA 2OCTA 4XDVA 2OTL3 1SIHA 1GOYA 2JQ5A 4CCVA 3X42A 3CXC2 3HIGA 1JZDA 5D81A 1RMSA 4GL6A 2MC8A 2XFTA 4N6OB 3MG1A 3F7SA 3X3ZA 3BLZA 2XF3A 3D5GA 3LYGA 3MWZA 4FMAA 4NHFA 3WR2A 1B21A 2OOVC 6STDA 1KD14 3DY5A 2ZA4A 2QA43 3CCL3 1GMQA 2KRTA 1GOVA 3LTAA 3PYJA 1YI23 1D6YA 1GOUA 3DM8A 1T2HA 1QMAA 1RCLA 1V74A 2O9UX 1MNLA 1G0TA 1OPYA 2ML5A 1X1YA 3F40A 1AV4A 5IG3A 5AIIA 4WYKA 1N9EA 3NM7A 3F7XA 2AADA 3NBJA 4IT7A 2UGIA 2XRXB 1OH0A 3EN1B 2CH9A 4ZM8A 2IY2A 2O3OA 1I2GA 3MG3A 1GY5A 4J5GA 5CF1A 1VQP3 1JNQA 1O7GB 2F56A 2GEYA 5DRVA 3ROBA 3AMOA 4HM6B 2KCDA 2W04A 3HK4A 3DXOA 1R4CA 4KFFA 2K54A 1YJ93 5JBSA 3DH2A 3WHOA 1QAFA 4X2HA 4IIAA 4EXRA 5CLKA 4OVMA 4XBXA 2RBIA 2H0GA 7GSPA 1RDSA 1BVIA 2FGTA 3FZWA 1X1WA 3OXAA 4HM5B 3EBTA 1IV9A 3CCQ3 1O7PB 2BNGA 3BIRA 5HGRA 3CCM3 2XSOB 3NV0B 1KC84 4O02B 3EBYA 3DZLA 1OHOA 3K0ZA 4MMYB 1JN5A 3GWRA 1BRNL 5M19A 2CFGA 3HI7A 3MPHA 1RGCA 3I0YA 1Q824 3DMCA 3SX1A 1FUSA 4N6LA 1FGMA 2GU1A 1TU5A 1MWRA 2CFWA 3FF2A 1NB5I 3PGBA 1SARA 4WFOA 4EV5A 1ZO2A 2CW9A 2Y74A 1RJOA 2IMJA 1W4NA 1RGAA 1Q7HA 3FF0A 3AGOA 3ZG0A 1JZOA 3BNDA 4LZIA 5AEUB 3G6E3 3S29A 1VQQA 4HM2B 1LOXA 2QIYA 4MMXB 1GYBA 3HZPA 3KSED 3Q1CA 4WWUC 1KWIA 2W6JH 1LOVA 1Q864 3CCR3 5LC6A 1LQGC 1RTUA 3FG3A 1CEWI 2PNCA 2P09A 5IW9A 4RBNA 4AEQA 3A5EA 1UCLA 1V57A 1BRKA 1M1K4 1YGWA 1LOWA 3G0KA 3CCV3 4WHAA 4HOHA 1DE3A 3CC43 2F99A 2IYJA 2P05A 1JKGB 1RSNA 1VQ83 3IMAB 1CYUA 1B2MA 1ZGXA 1QAKA 4CJNA 1I70A 3UL6A 1PYLA 2IUKA 3L0RA 3S28A 2CG1A 3JUNA 2P0MA 2CWVA 2SARA 4FMDA 3RDEA 1SJWA 1US1A 1BSCA 3KIIA 1LRAA 3KE7A 3URPA 1R4YA 4J5KA 1TRPA 3EX9A 3FKAA 4FCMA 4L8OA 3UL5A 4PEJA 4FCJA 4KVHA 4R9KA 1FZUA 2HOHA 2WGOA 3OWUA 1I3IA 1UGIA 1AVKA 2C10A 1TFKA 2F5WA 1GY7A 4KT3B 2GBXB 1S5AA 1ROVA 1JB5A 1I2EA 2Q07A 5CXOA 2D1WA 2XSHB 3QRDA 2OOVA 3BB9A 5BXQA 1BRHA 2RFRA 3F9SA 1IV7A 2STDA 1JKGA 3DGOA 4FMBA 1A2PA 1RGHA 2CIUA 1IQYA 4BL2A 1OACA 2CWTA 3X3YA 4I4KA 2BMRB 3FG1A 2WOFA 4EC6A 2GEXA 3Q2PA 3GAXA 4RNZA 4AKYA 3V99A 2MF7A 1I2FA 4LSOA 2Y73A 4R80A 1I3FA 1MWSA 2I9WA 2F4YA 1S723 1GMRA 1OGZA 4RNYA 3CME3 2KXGA 1NJI4 1TFOA 3CD63 3HOHA 4L7KA 4EYCA 3LTDA 3PCRA 3CCU3 1TJDA 4H3UA 4K1UA 1NWWA 1C54A 1NB3I 5LC7A 5I97A 3WODG 1EG9B 1YGEA 3STDA 1IK3A 4N6UA 1KQS2 1JB2A 2E2VA 1B2ZA 3MG2A 1D6ZA 3SXXA 3UNLA 1DETA 5CK6A 1ULIB 5EVHA 2AAEA 3D5IA 3T8NA 3AGNA 3D4AA 1ROAA 5IG5A 1BIRA 4R9LA 2WO0A 3QK9A 4MEIA 2YX9A 2ML6A 3MHEA 5IENA 5A0OB 1VQL3 3EF8A 5IG0A 3KN4A 3ZG5A 4N3VA 4GSPA 1N9JA 5GSPA 3GZBA 4HVNA 1RGKA 2B24B 1CQSA 2HMKB 1IQXA 3CCJ3 5D83A 1UUWB 1UCJA 5IERA 3V98A 5AEWB 2F98A 5RNTA 2QEX3 1VQK3 1VQO3 4L8PA 1GD3A 3J7Yd 3OW22 3LMLA 3SOAA 1RN1A 3FLJA 4DKIA 4XB5A 2UUGC 4O8SA 1NDOB 3AHSA 1DMNA 1Q9EA 3BNEA 4RNTA 9RNTA 3D9RA 1MOLA 5M18A 1O7HB 4N6NB 1BSBA 5G2GA 3SYUA 1E3VA 1GY6A 1MGRA 1TTOA 4XBTA 1OF5B 3FGYA 3MYTA 1FUWA 1Z1SA 3VGNA 4HM0B 3F8XA 1BSEA 1VQ93 1NU3A 4J8TA 2OQEC 5D82A 2YFLB 1K41A 3JUOA 2HMMB 3SVAA 1PY3A 2GSPA 2RSXA 4NREA 1T5YA 1JRQA 2CG0A 2J8XB 2LQVA 1EUIC 1RNTA 2BU4A 1AR0A 1RGFA 1TUHA 7STDA 1A67A 1QJGA 3JVCA 1DMQA 1WQLB 4HAAA 1VZZA 3E99A 1BSAA 1UW1A 5ELJA 2K3DA 1K28A 5G1LA 5BU4A 3CCE3 2Z77A 3PCSA 1YIJ3 3N9HA 1W00A 3LOYA 1IYYA 4FR9A 1LNIA 1LNHA 5KP4A 1IVWA 1RGEA 2BMOB 1OHSA 1KSIA 1Q42A 1VQ53 1RCKA 1BUQA 4BL3A 1HYFA 2PZVA 3UB1A 4BTYA 3PZWA 1FYSA 1VQ43 1ASKA 2C4BA 4X2OA 2SBLA 5EQLA 3G713 3CU3A 1M1XB 1IVVA 1JB4A 1W01A 3H3HA 1K8A4 1BAOA 3OWYA 2W0QA 3CPW2 3DGYA 1DVDA 1FA3A 1YVBI 3ALAA 1UGHI 5M1AA 1LVNA 2H0IA 1DYUA 3GRDA 4O3VA 4BTWA 3BNCA 5IF6A 4HBRA 4R4KA 1W2ZA 1I0XA 3S5CA 2CC3A 1FUTA 3I563 1JJ22 3B4PA 1CH0A 3K9MC 5FW5A 5TGNA 1T3BA 1IT7A 1FGTA 3CNXA 3BNBA 3EC9A 1TP6A 3NHXA 8RNTA 1W02A 3VF1A 1DVCA 1LOYA 3SEDA 1MWUA 4HYZA 1O7MB 3EB8A 1BRJA 3EE1A 2H0HA 3HIIA 1F8NA 1W6GA 1Q814 1IDPA 3LH4A 2HMOB 1RGGA 1UCIA 4KFEA 4MMZB 3NBRA 2P38A 3G16A 2W9PA 4O2HA 1RKYA 1HZ1A 4FMCA 5KP3A 3GSPA 2XFSA 3DGNA 1RLSA 3DGMA 2CX1A 2V1LA 1RRHA 3K7CA 1Q7Y4 3EHCA 1E97A 3EN8A 4GB5A 1UI8A 5AIFA 3N8BA 4G1MB 2LYXA 3AHWA 5IEOA 1YVSA 1UDII 3LT8A 5BVBA 1JV2B 1YJN3 1BUJA 2FNQA 5HOHA 2BIRA 2KF6A 1A2KA 5AYSC 1BNGA 4H61A 5BIRA 1FW7A 3RNTA 1B3SA 4HZBB 3DGLA 3ER7A 3KZTA 2OTJ3 1A2VA 1LQMB 3EJVA 3O8YA 1ISKA 1BNFA 2FXTA 3ZFZA 3X40A 1G96A 1W2B2 2B1XB 2HMNB 5STDA 1N5PA 3WMDA 3CC73 4FCZA 2Z7AA 3H51A 4TX4A 3LZAA 4Q53A 4U13A 1YNVX 1M9GA 4J9AA 3D79A 3NX0A
chains in the Genus database with same CATH topology
1VQ63 1PFPA 3U1WA 2CFLA 1SQWA 4KZ1A 2ZDJA 3B8LA 3CPOA 3U97A 3UJMA 5IEPA 3S27A 2XR8B 5EEOA 3OV4A 4JRFA 1W7CA 1ZX2A 3B4OA 4K61A 5ELUA 1EKMA 2OQEA 3ECFA 4WP5A 3SOYA 2XGNA 3NV0A 2E2TA 3SLUA 3KKGA 2F86B 5AIGA 4LMIA 1L5GB 1OGXA 3TDGA 1W5ZA 1O7NB 2BHMA 4N6V0 3CC23 1VQ73 1Q40B 2A15A 5KP1A 1U5OA 4K90B 1AVLA 3D3LA 3S67A 1N5HA 3WOFB 3DUKA 4HKVB 2CFKA 3NUVA 1OF5A 1HKXA 4HM1B 1N8QA 3CMA3 4XBYA 1W6YA 2IA7A 3FCSB 2WGQA 2W03A 4JF8A 2GU3A 4EV2A 3G8ZA 1PU4A 2L4VA 3X3XA 1NO3A 3HX8A 1WTHA 4CDLA 3K63A 4R1KA 2E2UA 1IVUA 5IG4A 1J2BA 4RZMA 2BT3A 1D6UA 3T0UA 2BMQB 3MSOA 1TIJA 3JUMA 4K1VA 3JUQA 1WNHA 3K5TA 1OCVA 2M7OA 4ORLA 2W56A 3G4S3 3GZXB 4HJLB 1M904 3FSDA 4HZ9B 2CFDA 2QGUA 4KFDA 2CWUA 4HM7B 4AKZA 1Y4KA 3WDGB 1OUNA 1VQM3 3I553 1IVXA 1RRLA 1YIT3 2YFJB 3T8UA 2Z76A 3EQQB 2HMLB 2ZL8A 3NQZA 1QVG2 2BO9B 3Q90A 3WA2X 1GD4A 2C11A 5AIHA 4OUQA 1FGOA 2R4IA 1RN7A 1STFI 2CK3H 4HM8B 3NXJA 2XGLA 3RGRA 1O7WB 4XDWA 1YHQ3 2D42A 1K9M4 1WMOA 2CHCA 3NBBA 3OWSA 4HM4B 1YJW3 5AI1A 2RCDA 3F8HA 3VSYA 1WMPA 3KFQC 2INXA 4QWTA 3M8CA 5AYRB 1JN5B 5FGOA 1SPUA 3NQYA 4IPBA 5JPPA 4MJDA 2K0MA 2JDIH 2IUJA 1EA2A 3LT9A 5DREA 5JPUA 3PS8A 3N54B 2YFIB 3WA3A 1STDA 3PXMA 4HM3B 1E3RA 3WOEB 2WOHA 2P0XA 1QVF2 1GS3A 4STDA 2Z6BA 2OWPA 3FG4A 1CYVA 4N6TA 4EBGA 1EQKA 3LTCA 1IQ8A 2GXFA 1UUVB 1OHPA 1LXEA 8CHOA 4LEHA 3RGAA 1FGQA 1N8R4 2W2CA 4OK0A 3V92A 1SIIA 3JUPA 1FGRA 3KSPA 3CNMA 3F14A 3MKIA 1HU9A 1IT8A 4LGQA 1K734 1U8CB 1WMNA 1W6CA 2GBWB 3IPTA 3FH1A 1A90A 3NM2A 3X41A 3AMOB 4XM4A 5CF2A 3GZRA 1IU7A 3IJEB 3CCS3 3LXUX 2UX0A 4BTXA 1DMMA 2HMJB 3B7CA 2W9QA 1ULJB 1Q40A 3LTBA 2CKFB 3A76A 4WYKB 1C7HA 2RGQA 3OX9A 4N6MA 2W56B 2XH9A 2XEPA 3GZYB 1QALA 2OCTA 4XDVA 2OTL3 1SIHA 4CCVA 2JQ5A 3CXC2 3X42A 3HIGA 5D81A 4GL6A 2MC8A 2XFTA 4N6OB 3MG1A 3F7SA 3X3ZA 3BLZA 2XF3A 3LYGA 3MWZA 4FMAA 4NHFA 6STDA 2OOVC 1KD14 3DY5A 2QA43 3CCL3 2KRTA 1YI23 3LTAA 3PYJA 1D6YA 3DM8A 1QMAA 1V74A 2O9UX 1MNLA 1OPYA 2ML5A 3F40A 1AV4A 5IG3A 5AIIA 4WYKA 1N9EA 3NM7A 3F7XA 3NBJA 4IT7A 2XRXB 1OH0A 3EN1B 2CH9A 4ZM8A 2O3OA 1VQP3 3MG3A 1GY5A 5CF1A 1JNQA 1O7GB 2GEYA 5DRVA 3ROBA 3AMOA 4HM6B 2KCDA 2W04A 3HK4A 3DXOA 1R4CA 4KFFA 2K54A 1YJ93 5JBSA 1QAFA 4X2HA 4IIAA 4EXRA 5CLKA 4OVMA 4XBXA 3OXAA 2FGTA 3FZWA 4HM5B 3EBTA 1IV9A 3CCQ3 1O7PB 2BNGA 5HGRA 3CCM3 2XSOB 3NV0B 1KC84 4O02B 3EBYA 3DZLA 1OHOA 3K0ZA 4MMYB 1JN5A 3GWRA 2CFGA 3HI7A 3MPHA 3I0YA 1Q824 3DMCA 3SX1A 4N6LA 1FGMA 2GU1A 1TU5A 2CFWA 3FF2A 1NB5I 3PGBA 4WFOA 4EV5A 1ZO2A 2CW9A 2Y74A 1RJOA 2IMJA 1W4NA 3FF0A 3G6E3 5AEUB 4LZIA 3BNDA 3S29A 4HM2B 1LOXA 2QIYA 4MMXB 1GYBA 3HZPA 3KSED 3Q1CA 4WWUC 1KWIA 2W6JH 1Q864 3CCR3 5LC6A 3FG3A 1CEWI 2PNCA 2P09A 5IW9A 4RBNA 4AEQA 1M1K4 3G0KA 3CCV3 4WHAA 3CC43 2F99A 2P05A 1JKGB 1VQ83 3IMAB 1CYUA 1QAKA 3UL6A 2IUKA 3L0RA 3S28A 2CG1A 3JUNA 2P0MA 2CWVA 3RDEA 4FMDA 1SJWA 1US1A 3KIIA 3KE7A 3EX9A 3FKAA 4FCMA 4L8OA 3UL5A 4PEJA 4FCJA 4KVHA 4R9KA 2WGOA 3OWUA 2C10A 1AVKA 1TFKA 1GY7A 2GBXB 1S5AA 1ROVA 1JB5A 2Q07A 5CXOA 2D1WA 2XSHB 3QRDA 2OOVA 3BB9A 5BXQA 2RFRA 3F9SA 1IV7A 2STDA 1JKGA 3DGOA 4FMBA 2CIUA 1IQYA 1OACA 2CWTA 3X3YA 4I4KA 2BMRB 3FG1A 2WOFA 4EC6A 2GEXA 3Q2PA 3GAXA 4RNZA 4AKYA 3V99A 2MF7A 4LSOA 2Y73A 4R80A 2I9WA 1S723 1OGZA 3CME3 4RNYA 2KXGA 1NJI4 1TFOA 3CD63 4L7KA 4EYCA 3LTDA 3PCRA 3CCU3 4H3UA 4K1UA 1NWWA 1NB3I 5LC7A 5I97A 3WODG 1EG9B 1YGEA 3STDA 1IK3A 4N6UA 1KQS2 1JB2A 2E2VA 3MG2A 3SXXA 1D6ZA 3UNLA 5CK6A 1ULIB 5EVHA 3T8NA 1ROAA 5IG5A 4R9LA 2WO0A 3QK9A 4MEIA 2YX9A 2ML6A 3MHEA 5IENA 5A0OB 1VQL3 3EF8A 5IG0A 3KN4A 4N3VA 1N9JA 3GZBA 4HVNA 2B24B 3CCJ3 1CQSA 2HMKB 1IQXA 5D83A 1UUWB 5IERA 3V98A 5AEWB 2F98A 2QEX3 1VQK3 1VQO3 4L8PA 1GD3A 3J7Yd 3OW22 3LMLA 3SOAA 3FLJA 4XB5A 4O8SA 1NDOB 1DMNA 3BNEA 3D9RA 1MOLA 1O7HB 4N6NB 5G2GA 1E3VA 1GY6A 4XBTA 1OF5B 3FGYA 3MYTA 1FUWA 1Z1SA 3VGNA 4HM0B 3F8XA 1VQ93 1NU3A 4J8TA 2OQEC 5D82A 2YFLB 1K41A 3JUOA 2HMMB 3SVAA 2RSXA 4NREA 1T5YA 1JRQA 2CG0A 2LQVA 1AR0A 1TUHA 7STDA 1A67A 1QJGA 3JVCA 1DMQA 1WQLB 5ELJA 1VZZA 3E99A 1VQN3 1UW1A 1K28A 3CCE3 2Z77A 3PCSA 1YIJ3 3N9HA 1W00A 3LOYA 4FR9A 1LNHA 5KP4A 1IVWA 2BMOB 1OHSA 1KSIA 1Q42A 1VQ53 1BUQA 2PZVA 3UB1A 4BTYA 3PZWA 1VQ43 1ASKA 4X2OA 2SBLA 5EQLA 3G713 3CU3A 1M1XB 1IVVA 1JB4A 1W01A 3H3HA 1K8A4 3OWYA 2W0QA 3CPW2 1FA3A 1DVDA 1YVBI 3ALAA 1LVNA 1DYUA 3GRDA 4O3VA 4BTWA 3BNCA 5IF6A 4HBRA 4R4KA 1W2ZA 3S5CA 2CC3A 3I563 1JJ22 3B4PA 3K9MC 5FW5A 5TGNA 3EC9A 1IT7A 1FGTA 3CNXA 3BNBA 3NHXA 1TP6A 1W02A 3VF1A 1DVCA 3SEDA 4HYZA 1O7MB 3EB8A 3EE1A 3HIIA 1F8NA 1W6GA 1Q814 1IDPA 3LH4A 2HMOB 4KFEA 4MMZB 3NBRA 2P38A 3G16A 2W9PA 4O2HA 1RKYA 4FMCA 5KP3A 2XFSA 3DGNA 3DGMA 2V1LA 1RRHA 3K7CA 1Q7Y4 3EHCA 1E97A 3EN8A 4GB5A 1UI8A 5AIFA 3N8BA 4G1MB 2LYXA 5IEOA 3LT8A 5BVBA 1JV2B 1YJN3 2FNQA 1A2KA 5AYSC 4H61A 4HZBB 3DGLA 3ER7A 3KZTA 2OTJ3 1A2VA 3EJVA 3O8YA 1ISKA 2FXTA 1W2B2 3X40A 1G96A 2B1XB 2HMNB 5STDA 1N5PA 3WMDA 3CC73 4FCZA 2Z7AA 3H51A 4TX4A 3LZAA 4Q53A 4U13A 1UI7A 1M9GA 4J9AA 3NX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3R A;  5G2G A;  1GS3 A;  1E3V A;  4STD A;  1GY6 A;  4HM2 B;  2OWP A;  2QIY A;  4XBT A;  1GYB A;  3HZP A;  3B8L A;  4WWU C;  3CPO A;  1OF5 B;  2GXF A;  3UJM A;  3FGY A;  3MYT A;  5IEP A;  1UUV B;  1OHP A;  1Z1S A;  2XR8 B;  3F8X A;  3OV4 A;  4HM0 B;  1NU3 A;  3VGN A;  4J8T A;  8CHO A;  4LEH A;  5D82 A;  3RGA A;  1ZX2 A;  1K41 A;  2YFL B;  3B4O A;  3JUO A;  2HMM B;  3ECF A;  2W2C A;  4WP5 A;  3G0K A;  3SOY A;  3JUP A;  3KSP A;  3VSY A;  3CNM A;  2F99 A;  3F14 A;  3NV0 A;  3MKI A;  4LGQ A;  1AR0 A;  1JKG B;  1TUH A;  3KKG A;  7STD A;  2F86 B;  1QJG A;  4LMI A;  5AIG A;  2GBW B;  1DMQ A;  3IPT A;  1OGX A;  1WQL B;  3FH1 A;  1VZZ A;  3E99 A;  1O7N B;  2Z77 A;  1Q40 B;  3JUN A;  3NM2 A;  2A15 A;  4XM4 A;  5CF2 A;  5KP1 A;  1U5O A;  1SJW A;  1W00 A;  3GZR A;  3KE7 A;  2UX0 A;  3DUK A;  3EX9 A;  3FKA A;  1DMM A;  4FCM A;  2HMJ B;  1OF5 A;  3B7C A;  3NUV A;  4HKV B;  2BMO B;  1HKX A;  1OHS A;  1Q40 A;  1Q42 A;  1ULJ B;  4FCJ A;  2CKF B;  3A76 A;  4HM1 B;  4PEJ A;  1W6Y A;  4KVH A;  1C7H A;  2PZV A;  4R9K A;  4WYK B;  2RGQ A;  3OX9 A;  4XBY A;  3OWU A;  3G8Z A;  1ASK A;  3GZY B;  4XDV A;  4X2O A;  1GY7 A;  2GBX B;  2JQ5 A;  1S5A A;  3CU3 A;  3H3H A;  1JB4 A;  1JB5 A;  1W01 A;  4L8O A;  5D81 A;  5CXO A;  3HX8 A;  3OWY A;  2XSH B;  4CDL A;  3MG1 A;  1BUQ A;  3F7S A;  3BB9 A;  3BLZ A;  5BXQ A;  3LYG A;  4R1K A;  2RFR A;  3F9S A;  6STD A;  2STD A;  1JKG A;  3GRD A;  4J9A A;  5IG4 A;  4RZM A;  5IF6 A;  4I4K A;  3DM8 A;  3S5C A;  2BMR B;  1QMA A;  2BMQ B;  3B4P A;  5FW5 A;  3MSO A;  2GEX A;  5TGN A;  3EC9 A;  3JUM A;  3CNX A;  3JUQ A;  3NHX A;  4K1V A;  1TP6 A;  1OPY A;  5KP4 A;  1W02 A;  1OCV A;  4ORL A;  2I9W A;  3F40 A;  3GZX B;  3SED A;  4HJL B;  5AII A;  1OGZ A;  4WYK A;  3FSD A;  3F7X A;  1O7M B;  5IG3 A;  4HZ9 B;  2XRX B;  1OH0 A;  4L7K A;  3EN1 B;  2QGU A;  4H3U A;  4HM7 B;  4K1U A;  1NWW A;  1GY5 A;  1IDP A;  3MG3 A;  5CF1 A;  1OUN A;  1O7G B;  2HMO B;  2GEY A;  3NBR A;  1EG9 B;  5DRV A;  3G16 A;  2YFJ B;  3ROB A;  4HM6 B;  3STD A;  2Z76 A;  1JB2 A;  3EQQ B;  2HML B;  3HK4 A;  3MG2 A;  5KP3 A;  3T8U A;  3UNL A;  5CK6 A;  1ULI B;  3DXO A;  5EVH A;  3T8N A;  2K54 A;  5IG5 A;  3K7C A;  4R9L A;  3Q90 A;  3EHC A;  1E97 A;  3EN8 A;  4GB5 A;  4IIA A;  4X2H A;  4OVM A;  5CLK A;  5AIH A;  3MHE A;  4HM3 B;  4XBX A;  4OUQ A;  3EF8 A;  5AIF A;  5IG0 A;  2R4I A;  5IEN A;  5IEO A;  4N3V A;  3OXA A;  3FZW A;  4HM5 B;  3EBT A;  4HM8 B;  5BVB A;  3GZB A;  4HVN A;  2B24 B;  1O7P B;  1CQS A;  2BNG A;  2HMK B;  3NXJ A;  5D83 A;  1UUW B;  5HGR A;  5IER A;  1A2K A;  2XSO B;  3NV0 B;  2F98 A;  3RGR A;  5AEW B;  1O7W B;  3EBY A;  4XDW A;  3DZL A;  1OHO A;  3K0Z A;  2CHC A;  3OWS A;  1JN5 A;  3GWR A;  4HM4 B;  4HZB B;  4L8P A;  2RCD A;  3F8H A;  3ER7 A;  5AI1 A;  3KZT A;  3FLJ A;  3I0Y A;  3EJV A;  4XB5 A;  3DMC A;  2INX A;  1ISK A;  1NDO B;  3M8C A;  2B1X B;  1JN5 B;  2HMN B;  5STD A;  3WMD A;  3SOA A;  1DMN A;  3FF2 A;  2Z7A A;  3H51 A;  5JPP A;  4MJD A;  3D9R A;  1EA2 A;  1ZO2 A;  3LZA A;  4Q53 A;  4U13 A;  5DRE A;  2YFI B;  5JPU A;  2IMJ A;  3FF0 A;  1O7H B;  1STD A;  5AEU B; 
#chains in the Genus database with same CATH topology
 1VQ6 3;  1PFP A;  3U1W A;  2CFL A;  1SQW A;  3BU4 A;  4KZ1 A;  2ZDJ A;  3B8L A;  1I8V A;  1G02 A;  3CPO A;  3U97 A;  3UJM A;  5IEP A;  3S27 A;  2XR8 B;  2F5M A;  5EEO A;  3OV4 A;  1BSD A;  4JRF A;  1W7C A;  1ZX2 A;  3B4O A;  4K61 A;  5ELU A;  1JBT A;  1EKM A;  2OQE A;  3ECF A;  1B2X A;  4WP5 A;  3SOY A;  1VQN 3;  2XGN A;  3NV0 A;  2E2T A;  3SLU A;  3KKG A;  2F86 B;  5AIG A;  4LMI A;  1L5G B;  1BGS A;  1OGX A;  2RNT A;  3TDG A;  1W5Z A;  1O7N B;  2BHM A;  4N6V 0;  3CC2 3;  1VQ7 3;  1Q40 B;  2A15 A;  1BU4 A;  5KP1 A;  1U5O A;  4K90 B;  1AVL A;  3D3L A;  3S67 A;  1N5H A;  1V58 A;  3WOF B;  3DUK A;  4HKV B;  2CFK A;  3NUV A;  1OF5 A;  1HKX A;  4HM1 B;  1N8Q A;  3CMA 3;  4XBY A;  1W6Y A;  2IA7 A;  3FCS B;  4CPK A;  2WGQ A;  1AQZ A;  2W03 A;  2GU3 A;  4JF8 A;  4BIR A;  4EV2 A;  3G8Z A;  1PU4 A;  2L4V A;  3X3X A;  1NO3 A;  3HX8 A;  1WTH A;  4CDL A;  1UI7 A;  5G1K A;  3K63 A;  4R1K A;  2E2U A;  1IVU A;  5IG4 A;  1J2B A;  4RZM A;  1T2I A;  1B27 A;  2BT3 A;  1BNE A;  1D6U A;  1BNI A;  3KCH A;  1UUG B;  1X1X A;  3T0U A;  2BMQ B;  3MSO A;  1TIJ A;  1BNS A;  3JUM A;  4K1V A;  3JUQ A;  6GSP A;  4ILF A;  1WNH A;  3K5T A;  1BRS A;  1OCV A;  1BOX A;  1RN4 A;  2M7O A;  2W56 A;  3GZX B;  4ORL A;  3G4S 3;  7RNT A;  4HJL B;  1M90 4;  3FSD A;  1JBR A;  4HZ9 B;  2CFD A;  2QGU A;  4KFD A;  2CWU A;  4HM7 B;  4AKZ A;  1Y4K A;  3WDG B;  1AY7 A;  1OUN A;  1VQM 3;  3I55 3;  1B2U A;  1BRI A;  1IVX A;  1RRL A;  1YIT 3;  2YFJ B;  3T8U A;  2Z76 A;  3EQQ B;  2HML B;  4EW5 A;  1JBS A;  2ZL8 A;  3NQZ A;  1QVG 2;  2BO9 B;  1GSP A;  3Q90 A;  3WA2 X;  1GD4 A;  2C11 A;  5AIH A;  2L1S A;  4OUQ A;  1FGO A;  2R4I A;  2KF4 A;  1RN7 A;  1STF I;  2CK3 H;  4HM8 B;  4GHO A;  3NXJ A;  2XGL A;  1EEJ A;  3RGR A;  1B2S A;  1O7W B;  4LYL B;  4XDW A;  2D42 A;  1YHQ 3;  1BNJ A;  1K9M 4;  1WMO A;  2CHC A;  2R41 A;  3NBB A;  3OWS A;  4HM4 B;  5AI1 A;  1YJW 3;  2RCD A;  3F8H A;  3VSY A;  1WMP A;  3KFQ C;  2INX A;  4QWT A;  3M8C A;  5AYR B;  1JN5 B;  5FGO A;  1SPU A;  3NQY A;  4IPB A;  5JPP A;  4MJD A;  2K0M A;  2JDI H;  2IUJ A;  1EA2 A;  3LT9 A;  5DRE A;  5JPU A;  2CX0 A;  2KAA A;  2YFI B;  3N54 B;  3PS8 A;  3WA3 A;  1STD A;  3PXM A;  4HM3 B;  1E3R A;  3WOE B;  2WOH A;  2P0X A;  1QVF 2;  4BU4 A;  1GS3 A;  4STD A;  2Z6B A;  1RHL A;  2OWP A;  3FG4 A;  1CYV A;  3Q3F A;  4N6T A;  4EBG A;  1NNV A;  1EQK A;  1GMP A;  3LTC A;  1IQ8 A;  1I0V A;  2GXF A;  6RNT A;  1UUV B;  1OHP A;  1LXE A;  8CHO A;  4LEH A;  1BAN A;  3RGA A;  1FGQ A;  1N8R 4;  2W2C A;  4I5Q A;  4OK0 A;  3V92 A;  1SII A;  3JUP A;  1FGR A;  3KSP A;  2ZHX B;  2KF5 A;  3CNM A;  1X1U A;  3F14 A;  1BNR A;  3MKI A;  1HU9 A;  1IT8 A;  4LGQ A;  1K73 4;  1ZS7 A;  1U8C B;  1WMN A;  1W6C A;  2GBW B;  3IPT A;  4NPB A;  3FH1 A;  1RGL A;  1BRG A;  1A90 A;  3NM2 A;  3X41 A;  3AMO B;  1RNB A;  4XM4 A;  5CF2 A;  1MWT A;  3GZR A;  1IU7 A;  3IJE B;  3CCS 3;  3LXU X;  2UX0 A;  1TRQ A;  4BTX A;  1DMM A;  2HMJ B;  3B7C A;  2W9Q A;  1ULJ B;  1Q40 A;  3LTB A;  1UCK A;  2CKF B;  3A76 A;  4WYK B;  1C7H A;  1B20 A;  1MGW A;  2RGQ A;  3OX9 A;  4N6M A;  2W56 B;  2XH9 A;  2KF3 A;  2XEP A;  3GZY B;  1QAL A;  2OCT A;  4XDV A;  2OTL 3;  1SIH A;  1GOY A;  2JQ5 A;  4CCV A;  3X42 A;  3CXC 2;  3HIG A;  1JZD A;  5D81 A;  1RMS A;  4GL6 A;  2MC8 A;  2XFT A;  4N6O B;  3MG1 A;  3F7S A;  3X3Z A;  3BLZ A;  2XF3 A;  3D5G A;  3LYG A;  3MWZ A;  4FMA A;  4NHF A;  3WR2 A;  1B21 A;  2OOV C;  6STD A;  1KD1 4;  3DY5 A;  2ZA4 A;  2QA4 3;  3CCL 3;  1GMQ A;  2KRT A;  1GOV A;  3LTA A;  3PYJ A;  1YI2 3;  1D6Y A;  1GOU A;  3DM8 A;  1T2H A;  1QMA A;  1RCL A;  1V74 A;  2O9U X;  1MNL A;  1G0T A;  1OPY A;  2ML5 A;  1X1Y A;  3F40 A;  1AV4 A;  5IG3 A;  5AII A;  4WYK A;  1N9E A;  3NM7 A;  3F7X A;  2AAD A;  3NBJ A;  4IT7 A;  2UGI A;  2XRX B;  1OH0 A;  3EN1 B;  2CH9 A;  4ZM8 A;  2IY2 A;  2O3O A;  1I2G A;  3MG3 A;  1GY5 A;  4J5G A;  5CF1 A;  1VQP 3;  1JNQ A;  1O7G B;  2F56 A;  2GEY A;  5DRV A;  3ROB A;  3AMO A;  4HM6 B;  2KCD A;  2W04 A;  3HK4 A;  3DXO A;  1R4C A;  4KFF A;  2K54 A;  1YJ9 3;  5JBS A;  3DH2 A;  3WHO A;  1QAF A;  4X2H A;  4IIA A;  4EXR A;  5CLK A;  4OVM A;  4XBX A;  2RBI A;  2H0G A;  7GSP A;  1RDS A;  1BVI A;  2FGT A;  3FZW A;  1X1W A;  3OXA A;  4HM5 B;  3EBT A;  1IV9 A;  3CCQ 3;  1O7P B;  2BNG A;  3BIR A;  5HGR A;  3CCM 3;  2XSO B;  3NV0 B;  1KC8 4;  4O02 B;  3EBY A;  3DZL A;  1OHO A;  3K0Z A;  4MMY B;  1JN5 A;  3GWR A;  1BRN L;  5M19 A;  2CFG A;  3HI7 A;  3MPH A;  1RGC A;  3I0Y A;  1Q82 4;  3DMC A;  3SX1 A;  1FUS A;  4N6L A;  1FGM A;  2GU1 A;  1TU5 A;  1MWR A;  2CFW A;  3FF2 A;  1NB5 I;  3PGB A;  1SAR A;  4WFO A;  4EV5 A;  1ZO2 A;  2CW9 A;  2Y74 A;  1RJO A;  2IMJ A;  1W4N A;  1RGA A;  1Q7H A;  3FF0 A;  3AGO A;  3ZG0 A;  1JZO A;  3BND A;  4LZI A;  5AEU B;  3G6E 3;  3S29 A;  1VQQ A;  4HM2 B;  1LOX A;  2QIY A;  4MMX B;  1GYB A;  3HZP A;  3KSE D;  3Q1C A;  4WWU C;  1KWI A;  2W6J H;  1LOV A;  1Q86 4;  3CCR 3;  5LC6 A;  1LQG C;  1RTU A;  3FG3 A;  1CEW I;  2PNC A;  2P09 A;  5IW9 A;  4RBN A;  4AEQ A;  3A5E A;  1UCL A;  1V57 A;  1BRK A;  1M1K 4;  1YGW A;  1LOW A;  3G0K A;  3CCV 3;  4WHA A;  4HOH A;  1DE3 A;  3CC4 3;  2F99 A;  2IYJ A;  2P05 A;  1JKG B;  1RSN A;  1VQ8 3;  3IMA B;  1CYU A;  1B2M A;  1ZGX A;  1QAK A;  4CJN A;  1I70 A;  3UL6 A;  1PYL A;  2IUK A;  3L0R A;  3S28 A;  2CG1 A;  3JUN A;  2P0M A;  2CWV A;  2SAR A;  4FMD A;  3RDE A;  1SJW A;  1US1 A;  1BSC A;  3KII A;  1LRA A;  3KE7 A;  3URP A;  1R4Y A;  4J5K A;  1TRP A;  3EX9 A;  3FKA A;  4FCM A;  4L8O A;  3UL5 A;  4PEJ A;  4FCJ A;  4KVH A;  4R9K A;  1FZU A;  2HOH A;  2WGO A;  3OWU A;  1I3I A;  1UGI A;  1AVK A;  2C10 A;  1TFK A;  2F5W A;  1GY7 A;  4KT3 B;  2GBX B;  1S5A A;  1ROV A;  1JB5 A;  1I2E A;  2Q07 A;  5CXO A;  2D1W A;  2XSH B;  3QRD A;  2OOV A;  3BB9 A;  5BXQ A;  1BRH A;  2RFR A;  3F9S A;  1IV7 A;  2STD A;  1JKG A;  3DGO A;  4FMB A;  1A2P A;  1RGH A;  2CIU A;  1IQY A;  4BL2 A;  1OAC A;  2CWT A;  3X3Y A;  4I4K A;  2BMR B;  3FG1 A;  2WOF A;  4EC6 A;  2GEX A;  3Q2P A;  3GAX A;  4RNZ A;  4AKY A;  3V99 A;  2MF7 A;  1I2F A;  4LSO A;  2Y73 A;  4R80 A;  1I3F A;  1MWS A;  2I9W A;  2F4Y A;  1S72 3;  1GMR A;  1OGZ A;  4RNY A;  3CME 3;  2KXG A;  1NJI 4;  1TFO A;  3CD6 3;  3HOH A;  4L7K A;  4EYC A;  3LTD A;  3PCR A;  3CCU 3;  1TJD A;  4H3U A;  4K1U A;  1NWW A;  1C54 A;  1NB3 I;  5LC7 A;  5I97 A;  3WOD G;  1EG9 B;  1YGE A;  3STD A;  1IK3 A;  4N6U A;  1KQS 2;  1JB2 A;  2E2V A;  1B2Z A;  3MG2 A;  1D6Z A;  3SXX A;  3UNL A;  1DET A;  5CK6 A;  1ULI B;  5EVH A;  2AAE A;  3D5I A;  3T8N A;  3AGN A;  3D4A A;  1ROA A;  5IG5 A;  1BIR A;  4R9L A;  2WO0 A;  3QK9 A;  4MEI A;  2YX9 A;  2ML6 A;  3MHE A;  5IEN A;  5A0O B;  1VQL 3;  3EF8 A;  5IG0 A;  3KN4 A;  3ZG5 A;  4N3V A;  4GSP A;  1N9J A;  5GSP A;  3GZB A;  4HVN A;  1RGK A;  2B24 B;  1CQS A;  2HMK B;  1IQX A;  3CCJ 3;  5D83 A;  1UUW B;  1UCJ A;  5IER A;  3V98 A;  5AEW B;  2F98 A;  5RNT A;  2QEX 3;  1VQK 3;  1VQO 3;  4L8P A;  1GD3 A;  3J7Y d;  3OW2 2;  3LML A;  3SOA A;  1RN1 A;  3FLJ A;  4DKI A;  4XB5 A;  2UUG C;  4O8S A;  1NDO B;  3AHS A;  1DMN A;  1Q9E A;  3BNE A;  4RNT A;  9RNT A;  3D9R A;  1MOL A;  5M18 A;  1O7H B;  4N6N B;  1BSB A;  5G2G A;  3SYU A;  1E3V A;  1GY6 A;  1MGR A;  1TTO A;  4XBT A;  1OF5 B;  3FGY A;  3MYT A;  1FUW A;  1Z1S A;  3VGN A;  4HM0 B;  3F8X A;  1BSE A;  1VQ9 3;  1NU3 A;  4J8T A;  2OQE C;  5D82 A;  2YFL B;  1K41 A;  3JUO A;  2HMM B;  3SVA A;  1PY3 A;  2GSP A;  2RSX A;  4NRE A;  1T5Y A;  1JRQ A;  2CG0 A;  2J8X B;  2LQV A;  1EUI C;  1RNT A;  2BU4 A;  1AR0 A;  1RGF A;  1TUH A;  7STD A;  1A67 A;  1QJG A;  3JVC A;  1DMQ A;  1WQL B;  4HAA A;  1VZZ A;  3E99 A;  1BSA A;  1UW1 A;  5ELJ A;  2K3D A;  1K28 A;  5G1L A;  5BU4 A;  3CCE 3;  2Z77 A;  3PCS A;  1YIJ 3;  3N9H A;  1W00 A;  3LOY A;  1IYY A;  4FR9 A;  1LNI A;  1LNH A;  5KP4 A;  1IVW A;  1RGE A;  2BMO B;  1OHS A;  1KSI A;  1Q42 A;  1VQ5 3;  1RCK A;  1BUQ A;  4BL3 A;  1HYF A;  2PZV A;  3UB1 A;  4BTY A;  3PZW A;  1FYS A;  1VQ4 3;  1ASK A;  2C4B A;  4X2O A;  2SBL A;  5EQL A;  3G71 3;  3CU3 A;  1M1X B;  1IVV A;  1JB4 A;  1W01 A;  3H3H A;  1K8A 4;  1BAO A;  3OWY A;  2W0Q A;  3CPW 2;  3DGY A;  1DVD A;  1FA3 A;  1YVB I;  3ALA A;  1UGH I;  5M1A A;  1LVN A;  2H0I A;  1DYU A;  3GRD A;  4O3V A;  4BTW A;  3BNC A;  5IF6 A;  4HBR A;  4R4K A;  1W2Z A;  1I0X A;  3S5C A;  2CC3 A;  1FUT A;  3I56 3;  1JJ2 2;  3B4P A;  1CH0 A;  3K9M C;  5FW5 A;  5TGN A;  1T3B A;  1IT7 A;  1FGT A;  3CNX A;  3BNB A;  3EC9 A;  1TP6 A;  3NHX A;  8RNT A;  1W02 A;  3VF1 A;  1DVC A;  1LOY A;  3SED A;  1MWU A;  4HYZ A;  1O7M B;  3EB8 A;  1BRJ A;  3EE1 A;  2H0H A;  3HII A;  1F8N A;  1W6G A;  1Q81 4;  1IDP A;  3LH4 A;  2HMO B;  1RGG A;  1UCI A;  4KFE A;  4MMZ B;  3NBR A;  2P38 A;  3G16 A;  2W9P A;  4O2H A;  1RKY A;  1HZ1 A;  4FMC A;  5KP3 A;  3GSP A;  2XFS A;  3DGN A;  1RLS A;  3DGM A;  2CX1 A;  2V1L A;  1RRH A;  3K7C A;  1Q7Y 4;  3EHC A;  1E97 A;  3EN8 A;  4GB5 A;  1UI8 A;  5AIF A;  3N8B A;  4G1M B;  2LYX A;  3AHW A;  5IEO A;  1YVS A;  1UDI I;  3LT8 A;  5BVB A;  1JV2 B;  1YJN 3;  1BUJ A;  2FNQ A;  5HOH A;  2BIR A;  2KF6 A;  1A2K A;  5AYS C;  1BNG A;  4H61 A;  5BIR A;  1FW7 A;  3RNT A;  1B3S A;  4HZB B;  3DGL A;  3ER7 A;  3KZT A;  2OTJ 3;  1A2V A;  1LQM B;  3EJV A;  3O8Y A;  1ISK A;  1BNF A;  2FXT A;  3ZFZ A;  3X40 A;  1G96 A;  1W2B 2;  2B1X B;  2HMN B;  5STD A;  1N5P A;  3WMD A;  3CC7 3;  4FCZ A;  2Z7A A;  3H51 A;  4TX4 A;  3LZA A;  4Q53 A;  4U13 A;  1YNV X;  1M9G A;  4J9A A;  3D79 A;  3NX0 A; 
#chains in the Genus database with same CATH homology
 1VQ6 3;  1PFP A;  3U1W A;  2CFL A;  1SQW A;  4KZ1 A;  2ZDJ A;  3B8L A;  3CPO A;  3U97 A;  3UJM A;  5IEP A;  3S27 A;  2XR8 B;  5EEO A;  3OV4 A;  4JRF A;  1W7C A;  1ZX2 A;  3B4O A;  4K61 A;  5ELU A;  1EKM A;  2OQE A;  3ECF A;  4WP5 A;  3SOY A;  2XGN A;  3NV0 A;  2E2T A;  3SLU A;  3KKG A;  2F86 B;  5AIG A;  4LMI A;  1L5G B;  1OGX A;  3TDG A;  1W5Z A;  1O7N B;  2BHM A;  4N6V 0;  3CC2 3;  1VQ7 3;  1Q40 B;  2A15 A;  5KP1 A;  1U5O A;  4K90 B;  1AVL A;  3D3L A;  3S67 A;  1N5H A;  3WOF B;  3DUK A;  4HKV B;  2CFK A;  3NUV A;  1OF5 A;  1HKX A;  4HM1 B;  1N8Q A;  3CMA 3;  4XBY A;  1W6Y A;  2IA7 A;  3FCS B;  2WGQ A;  2W03 A;  4JF8 A;  2GU3 A;  4EV2 A;  3G8Z A;  1PU4 A;  2L4V A;  3X3X A;  1NO3 A;  3HX8 A;  1WTH A;  4CDL A;  3K63 A;  4R1K A;  2E2U A;  1IVU A;  5IG4 A;  1J2B A;  4RZM A;  2BT3 A;  1D6U A;  3T0U A;  2BMQ B;  3MSO A;  1TIJ A;  3JUM A;  4K1V A;  3JUQ A;  1WNH A;  3K5T A;  1OCV A;  2M7O A;  4ORL A;  2W56 A;  3G4S 3;  3GZX B;  4HJL B;  1M90 4;  3FSD A;  4HZ9 B;  2CFD A;  2QGU A;  4KFD A;  2CWU A;  4HM7 B;  4AKZ A;  1Y4K A;  3WDG B;  1OUN A;  1VQM 3;  3I55 3;  1IVX A;  1RRL A;  1YIT 3;  2YFJ B;  3T8U A;  2Z76 A;  3EQQ B;  2HML B;  2ZL8 A;  3NQZ A;  1QVG 2;  2BO9 B;  3Q90 A;  3WA2 X;  1GD4 A;  2C11 A;  5AIH A;  4OUQ A;  1FGO A;  2R4I A;  1RN7 A;  1STF I;  2CK3 H;  4HM8 B;  3NXJ A;  2XGL A;  3RGR A;  1O7W B;  4XDW A;  1YHQ 3;  2D42 A;  1K9M 4;  1WMO A;  2CHC A;  3NBB A;  3OWS A;  4HM4 B;  1YJW 3;  5AI1 A;  2RCD A;  3F8H A;  3VSY A;  1WMP A;  3KFQ C;  2INX A;  4QWT A;  3M8C A;  5AYR B;  1JN5 B;  5FGO A;  1SPU A;  3NQY A;  4IPB A;  5JPP A;  4MJD A;  2K0M A;  2JDI H;  2IUJ A;  1EA2 A;  3LT9 A;  5DRE A;  5JPU A;  3PS8 A;  3N54 B;  2YFI B;  3WA3 A;  1STD A;  3PXM A;  4HM3 B;  1E3R A;  3WOE B;  2WOH A;  2P0X A;  1QVF 2;  1GS3 A;  4STD A;  2Z6B A;  2OWP A;  3FG4 A;  1CYV A;  4N6T A;  4EBG A;  1EQK A;  3LTC A;  1IQ8 A;  2GXF A;  1UUV B;  1OHP A;  1LXE A;  8CHO A;  4LEH A;  3RGA A;  1FGQ A;  1N8R 4;  2W2C A;  4OK0 A;  3V92 A;  1SII A;  3JUP A;  1FGR A;  3KSP A;  3CNM A;  3F14 A;  3MKI A;  1HU9 A;  1IT8 A;  4LGQ A;  1K73 4;  1U8C B;  1WMN A;  1W6C A;  2GBW B;  3IPT A;  3FH1 A;  1A90 A;  3NM2 A;  3X41 A;  3AMO B;  4XM4 A;  5CF2 A;  3GZR A;  1IU7 A;  3IJE B;  3CCS 3;  3LXU X;  2UX0 A;  4BTX A;  1DMM A;  2HMJ B;  3B7C A;  2W9Q A;  1ULJ B;  1Q40 A;  3LTB A;  2CKF B;  3A76 A;  4WYK B;  1C7H A;  2RGQ A;  3OX9 A;  4N6M A;  2W56 B;  2XH9 A;  2XEP A;  3GZY B;  1QAL A;  2OCT A;  4XDV A;  2OTL 3;  1SIH A;  4CCV A;  2JQ5 A;  3CXC 2;  3X42 A;  3HIG A;  5D81 A;  4GL6 A;  2MC8 A;  2XFT A;  4N6O B;  3MG1 A;  3F7S A;  3X3Z A;  3BLZ A;  2XF3 A;  3LYG A;  3MWZ A;  4FMA A;  4NHF A;  6STD A;  2OOV C;  1KD1 4;  3DY5 A;  2QA4 3;  3CCL 3;  2KRT A;  1YI2 3;  3LTA A;  3PYJ A;  1D6Y A;  3DM8 A;  1QMA A;  1V74 A;  2O9U X;  1MNL A;  1OPY A;  2ML5 A;  3F40 A;  1AV4 A;  5IG3 A;  5AII A;  4WYK A;  1N9E A;  3NM7 A;  3F7X A;  3NBJ A;  4IT7 A;  2XRX B;  1OH0 A;  3EN1 B;  2CH9 A;  4ZM8 A;  2O3O A;  1VQP 3;  3MG3 A;  1GY5 A;  5CF1 A;  1JNQ A;  1O7G B;  2GEY A;  5DRV A;  3ROB A;  3AMO A;  4HM6 B;  2KCD A;  2W04 A;  3HK4 A;  3DXO A;  1R4C A;  4KFF A;  2K54 A;  1YJ9 3;  5JBS A;  1QAF A;  4X2H A;  4IIA A;  4EXR A;  5CLK A;  4OVM A;  4XBX A;  3OXA A;  2FGT A;  3FZW A;  4HM5 B;  3EBT A;  1IV9 A;  3CCQ 3;  1O7P B;  2BNG A;  5HGR A;  3CCM 3;  2XSO B;  3NV0 B;  1KC8 4;  4O02 B;  3EBY A;  3DZL A;  1OHO A;  3K0Z A;  4MMY B;  1JN5 A;  3GWR A;  2CFG A;  3HI7 A;  3MPH A;  3I0Y A;  1Q82 4;  3DMC A;  3SX1 A;  4N6L A;  1FGM A;  2GU1 A;  1TU5 A;  2CFW A;  3FF2 A;  1NB5 I;  3PGB A;  4WFO A;  4EV5 A;  1ZO2 A;  2CW9 A;  2Y74 A;  1RJO A;  2IMJ A;  1W4N A;  3FF0 A;  3G6E 3;  5AEU B;  4LZI A;  3BND A;  3S29 A;  4HM2 B;  1LOX A;  2QIY A;  4MMX B;  1GYB A;  3HZP A;  3KSE D;  3Q1C A;  4WWU C;  1KWI A;  2W6J H;  1Q86 4;  3CCR 3;  5LC6 A;  3FG3 A;  1CEW I;  2PNC A;  2P09 A;  5IW9 A;  4RBN A;  4AEQ A;  1M1K 4;  3G0K A;  3CCV 3;  4WHA A;  3CC4 3;  2F99 A;  2P05 A;  1JKG B;  1VQ8 3;  3IMA B;  1CYU A;  1QAK A;  3UL6 A;  2IUK A;  3L0R A;  3S28 A;  2CG1 A;  3JUN A;  2P0M A;  2CWV A;  3RDE A;  4FMD A;  1SJW A;  1US1 A;  3KII A;  3KE7 A;  3EX9 A;  3FKA A;  4FCM A;  4L8O A;  3UL5 A;  4PEJ A;  4FCJ A;  4KVH A;  4R9K A;  2WGO A;  3OWU A;  2C10 A;  1AVK A;  1TFK A;  1GY7 A;  2GBX B;  1S5A A;  1ROV A;  1JB5 A;  2Q07 A;  5CXO A;  2D1W A;  2XSH B;  3QRD A;  2OOV A;  3BB9 A;  5BXQ A;  2RFR A;  3F9S A;  1IV7 A;  2STD A;  1JKG A;  3DGO A;  4FMB A;  2CIU A;  1IQY A;  1OAC A;  2CWT A;  3X3Y A;  4I4K A;  2BMR B;  3FG1 A;  2WOF A;  4EC6 A;  2GEX A;  3Q2P A;  3GAX A;  4RNZ A;  4AKY A;  3V99 A;  2MF7 A;  4LSO A;  2Y73 A;  4R80 A;  2I9W A;  1S72 3;  1OGZ A;  3CME 3;  4RNY A;  2KXG A;  1NJI 4;  1TFO A;  3CD6 3;  4L7K A;  4EYC A;  3LTD A;  3PCR A;  3CCU 3;  4H3U A;  4K1U A;  1NWW A;  1NB3 I;  5LC7 A;  5I97 A;  3WOD G;  1EG9 B;  1YGE A;  3STD A;  1IK3 A;  4N6U A;  1KQS 2;  1JB2 A;  2E2V A;  3MG2 A;  3SXX A;  1D6Z A;  3UNL A;  5CK6 A;  1ULI B;  5EVH A;  3T8N A;  1ROA A;  5IG5 A;  4R9L A;  2WO0 A;  3QK9 A;  4MEI A;  2YX9 A;  2ML6 A;  3MHE A;  5IEN A;  5A0O B;  1VQL 3;  3EF8 A;  5IG0 A;  3KN4 A;  4N3V A;  1N9J A;  3GZB A;  4HVN A;  2B24 B;  3CCJ 3;  1CQS A;  2HMK B;  1IQX A;  5D83 A;  1UUW B;  5IER A;  3V98 A;  5AEW B;  2F98 A;  2QEX 3;  1VQK 3;  1VQO 3;  4L8P A;  1GD3 A;  3J7Y d;  3OW2 2;  3LML A;  3SOA A;  3FLJ A;  4XB5 A;  4O8S A;  1NDO B;  1DMN A;  3BNE A;  3D9R A;  1MOL A;  1O7H B;  4N6N B;  5G2G A;  1E3V A;  1GY6 A;  4XBT A;  1OF5 B;  3FGY A;  3MYT A;  1FUW A;  1Z1S A;  3VGN A;  4HM0 B;  3F8X A;  1VQ9 3;  1NU3 A;  4J8T A;  2OQE C;  5D82 A;  2YFL B;  1K41 A;  3JUO A;  2HMM B;  3SVA A;  2RSX A;  4NRE A;  1T5Y A;  1JRQ A;  2CG0 A;  2LQV A;  1AR0 A;  1TUH A;  7STD A;  1A67 A;  1QJG A;  3JVC A;  1DMQ A;  1WQL B;  5ELJ A;  1VZZ A;  3E99 A;  1VQN 3;  1UW1 A;  1K28 A;  3CCE 3;  2Z77 A;  3PCS A;  1YIJ 3;  3N9H A;  1W00 A;  3LOY A;  4FR9 A;  1LNH A;  5KP4 A;  1IVW A;  2BMO B;  1OHS A;  1KSI A;  1Q42 A;  1VQ5 3;  1BUQ A;  2PZV A;  3UB1 A;  4BTY A;  3PZW A;  1VQ4 3;  1ASK A;  4X2O A;  2SBL A;  5EQL A;  3G71 3;  3CU3 A;  1M1X B;  1IVV A;  1JB4 A;  1W01 A;  3H3H A;  1K8A 4;  3OWY A;  2W0Q A;  3CPW 2;  1FA3 A;  1DVD A;  1YVB I;  3ALA A;  1LVN A;  1DYU A;  3GRD A;  4O3V A;  4BTW A;  3BNC A;  5IF6 A;  4HBR A;  4R4K A;  1W2Z A;  3S5C A;  2CC3 A;  3I56 3;  1JJ2 2;  3B4P A;  3K9M C;  5FW5 A;  5TGN A;  3EC9 A;  1IT7 A;  1FGT A;  3CNX A;  3BNB A;  3NHX A;  1TP6 A;  1W02 A;  3VF1 A;  1DVC A;  3SED A;  4HYZ A;  1O7M B;  3EB8 A;  3EE1 A;  3HII A;  1F8N A;  1W6G A;  1Q81 4;  1IDP A;  3LH4 A;  2HMO B;  4KFE A;  4MMZ B;  3NBR A;  2P38 A;  3G16 A;  2W9P A;  4O2H A;  1RKY A;  4FMC A;  5KP3 A;  2XFS A;  3DGN A;  3DGM A;  2V1L A;  1RRH A;  3K7C A;  1Q7Y 4;  3EHC A;  1E97 A;  3EN8 A;  4GB5 A;  1UI8 A;  5AIF A;  3N8B A;  4G1M B;  2LYX A;  5IEO A;  3LT8 A;  5BVB A;  1JV2 B;  1YJN 3;  2FNQ A;  1A2K A;  5AYS C;  4H61 A;  4HZB B;  3DGL A;  3ER7 A;  3KZT A;  2OTJ 3;  1A2V A;  3EJV A;  3O8Y A;  1ISK A;  2FXT A;  1W2B 2;  3X40 A;  1G96 A;  2B1X B;  2HMN B;  5STD A;  1N5P A;  3WMD A;  3CC7 3;  4FCZ A;  2Z7A A;  3H51 A;  4TX4 A;  3LZA A;  4Q53 A;  4U13 A;  1UI7 A;  1M9G A;  4J9A A;  3NX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...