1JB2A

Crystal structure of ntf2 m84e mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISEVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb2A00
3NBRA 4STDA 2STDA 2B1XB 4HM6B 4XDWA 3OWYA 1ULIB 4X2HA 1STDA 2INXA 4GB5A 3I0YA 2BNGA 4X2OA 4H3UA 4HM1B 1EA2A 3NXJA 4WP5A 4FCMA 3FZWA 3RGAA 2BMRB 5IEPA 1W01A 1JB5A 3NHXA 3EJVA 4HZ9B 1Z1SA 2CHCA 3F9SA 3RGRA 5IG5A 1O7NB 3G8ZA 3F14A 1SJWA 3BB9A 2UX0A 2YFIB 3FGYA 5AI1A 3UJMA 2R4IA 3T8NA 3NUVA 1E3VA 1NWWA 2F86B 3JUOA 2OWPA 3JUQA 5KP1A 1GS3A 1OHSA 2HMNB 4XB5A 3VSYA 2YFJB 3FF0A 3ECFA 1OUNA 4U13A 3F7SA 4J9AA 5KP4A 2HMLB 2BMOB 2CKFB 2XSOB 3KKGA 2JQ5A 2GBWB 3GZBA 3LYGA 5IG4A 4R9LA 3OX9A 1BUQA 3BLZA 5D83A 1QMAA 4I4KA 1K41A 2Z77A 2RCDA 2A15A 3FH1A 3SOAA 7STDA 1ZO2A 1JN5B 3CNMA 2K54A 2XRXB 5IENA 5EVHA 5AIHA 4HM5B 3WMDA 2YFLB 3HX8A 2F98A 3FSDA 3CU3A 4XM4A 3MSOA 4L8PA 4K1UA 2HMOB 1EG9B 3KSPA 5CXOA 4FCJA 3EF8A 4HM2B 2W2CA 3JUNA 4XBTA 1UUWB 3OWSA 4WYKB 3G16A 1OPYA 5BXQA 5CF2A 3K7CA 1OF5B 3B4OA 4LEHA 1JKGA 2I9WA 5AEUB 3OWUA 1OHPA 1JB2A 3F7XA 3GRDA 5IEOA 1GY6A 3NV0B 5JPPA 3EHCA 3Q90A 1W6YA 1NDOB 1QJGA 3H3HA 4R1KA 1JB4A 4WWUC 4LMIA 1WQLB 3ROBA 4HVNA 4L8OA 4HM4B 4CDLA 4HM7B 5AIFA 5CF1A 4L7KA 3JUMA 3F40A 1TUHA 1ULJB 2Z76A 5G2GA 2GBXB 1AR0A 3FF2A 5DREA 1C7HA 3HZPA 2GEXA 3SEDA 5CK6A 2Z7AA 3EC9A 3LZAA 3DZLA 3NM2A 1O7GB 3STDA 3EQQB 2HMJB 3EBTA 4IIAA 2IMJA 3MG2A 3EN8A 4HM8B 3DUKA 5D82A 1HKXA 4OUQA 3EBYA 3B4PA 5FW5A 1UUVB 1A2KA 3OV4A 4HZBB 1JN5A 3F8HA 3A76A 1E3RA 4HM0B 1DMNA 1U5OA 1DMMA 1O7HB 3MG1A 1O7MB 2XSHB 3ER7A 4LGQA 4Q53A 4OVMA 3UNLA 1CQSA 3GWRA 3M8CA 3B7CA 3SOYA 3FKAA 5DRVA 1OH0A 3VGNA 2HMKB 3FLJA 1OGZA 1S5AA 3S5CA 1O7WB 2GXFA 2QGUA 4WYKA 2XR8B 1W00A 1GYBA 1OF5A 1OGXA 1OCVA 4K1VA 5CLKA 1ZX2A 4XDVA 5TGNA 1VZZA 5KP3A 3G0KA 5STDA 3DMCA 4HKVB 3CPOA 2RGQA 1DMQA 5JPUA 3MG3A 5D81A 2PZVA 3KZTA 5HGRA 3DXOA 3NV0A 4N3VA 3GZYB 3MYTA 4KVHA 3H51A 1GY5A 1NU3A 1IDPA 3HK4A 3T8UA 5IF6A 3K0ZA 4RZMA 2BMQB 6STDA 3MHEA 1ASKA 4R9KA 3F8XA 5AEWB 2RFRA 1TP6A 3JUPA 2QIYA 5IG0A 1OHOA 5IERA 1Q40B 4MJDA 1O7PB 3D9RA 2F99A 3EX9A 3MKIA 5AIGA 4XBYA 3GZRA 4ORLA 2HMMB 5IG3A 4XBXA 3E99A 3CNXA 8CHOA 1E97A 3KE7A 1W02A 5AIIA 3IPTA 2B24B 1Q42A 3EN1B 1Q40A 3GZXB 3DM8A 1ISKA 4J8TA 2GEYA 4HJLB 4HM3B 1GY7A 5BVBA 4PEJA 3B8LA 3OXAA 1JKGB
chains in the Genus database with same CATH superfamily
1BRKA 3NBRA 4STDA 3KCHA 4J5GA 3RNTA 1M9GA 8RNTA 3DGNA 3WA2X 1G0TA 2STDA 4NREA 2B1XB 4HM6B 4XDWA 3AMOB 3OWYA 2WOFA 3N9HA 4RNTA 1ULIB 4KT3B 4LSOA 4X2HA 1STDA 2INXA 4CPKA 2BU4A 4NPBA 4FMAA 4GB5A 1RN4A 3I0YA 1MGRA 2BNGA 4X2OA 4H3UA 2SARA 3DGMA 4HM1B 1TFKA 2FXTA 2OTL3 1R4YA 1I70A 1DVCA 2CX1A 1EA2A 1RRHA 1NO3A 4H61A 1B21A 3NXJA 1EEJA 4WP5A 2D1WA 2MF7A 3O8YA 1JBSA 4FCMA 2C4BA 3FZWA 3RGAA 2BMRB 5IEPA 1W01A 1JB5A 3NHXA 1RN7A 2ZL8A 3EJVA 1BRJA 3V92A 4HZ9B 1Z1SA 2BIRA 2CHCA 2KF3A 3F9SA 1YI23 2FGTA 2MC8A 5IW9A 1DE3A 2L4VA 2UGIA 3PXMA 3RGRA 2F5MA 1LOVA 2OOVA 2H0GA 5IG5A 2KF4A 1VQ53 1O7NB 4N6V0 1VQ43 3G8ZA 3F14A 4BL3A 1TRPA 1SJWA 3ZG0A 2W6JH 2QEX3 2XGNA 3BB9A 4HAAA 1BUJA 2UX0A 1B20A 4HOHA 1FGQA 2YFIB 3FGYA 5AI1A 2XF3A 3UJMA 2R4IA 1X1WA 2CFKA 1BNSA 4FMCA 3T8NA 3PCSA 3NUVA 1E3VA 3G6E3 1NWWA 1UCJA 1IVWA 2F86B 1GMQA 2P09A 3JUOA 5M19A 1WMPA 2OWPA 2CWVA 2H0IA 3AGNA 5FGOA 3JUQA 5KP1A 1LQGC 1TIJA 1GS3A 1LRAA 1OHSA 3CME3 2HMNB 4EV5A 4AKZA 4N6NB 4XB5A 3VSYA 4N6LA 2YFJB 3FF0A 1BOXA 3ECFA 1YHQ3 1OUNA 3ZG5A 1UCIA 3ALAA 1B2UA 3KSED 4U13A 1BRGA 1N8R4 3F7SA 1AVKA 2OQEA 3DGLA 3V98A 6GSPA 4J9AA 1B2SA 1I8VA 3WR2A 1SIIA 1BSAA 1BSDA 1NB5I 1BNGA 1LVNA 1B2MA 5KP4A 3CCU3 4AEQA 2OQEC 2HMLB 2BMOB 2CKFB 2XSOB 3KKGA 2JQ5A 6RNTA 2GBWB 3GZBA 2IA7A 1YIT3 3LYGA 5G1KA 1RGHA 5IG4A 4N6OB 2RNTA 1RMSA 1N5PA 4R9LA 1M1K4 1IVUA 1QVG2 3UL6A 2KCDA 3WODG 5JBSA 2P38A 3OX9A 2E2UA 3FG3A 1BUQA 5ELJA 1IU7A 1IV9A 1K734 3BLZA 5D83A 1QMAA 4GL6A 4I4KA 1WMOA 1K41A 2M7OA 3LTBA 2FNQA 2PNCA 2Z77A 1GSPA 2RCDA 2A15A 2E2TA 3FH1A 3SOAA 1RLSA 2WGQA 7STDA 1ZO2A 4JRFA 1JN5B 3CNMA 2K54A 1RCLA 2XRXB 7RNTA 5IENA 2RBIA 1X1UA 5EVHA 1YVBI 1MGWA 1QAFA 2F5WA 5AIHA 5ELUA 3S5CA 4BTWA 4HBRA 1KSIA 3S29A 2H0HA 5LC6A 1A2PA 1I0XA 1UDII 3X3ZA 4HM5B 1MWUA 3WMDA 2GU3A 3ZFZA 3DGYA 3X41A 2YFLB 2CC3A 1VQP3 2L1SA 2HOHA 3CMA3 1FA3A 1F8NA 1UCLA 3HX8A 2F98A 3FSDA 3CU3A 3U97A 4XM4A 4ILFA 4RBNA 2OOVC 3LTDA 3MSOA 1R4CA 4L8PA 4K1UA 1W5ZA 1NNVA 2HMOB 1EG9B 4N6MA 1VQ83 3FG1A 1BAOA 3KSPA 1MOLA 5CXOA 4MEIA 3NQYA 1JJ22 1SQWA 1KWIA 1YJN3 3BIRA 4FCJA 3EF8A 4HM2B 2ZA4A 3X42A 2W2CA 2P05A 1IT8A 1BSEA 1VQL3 4BU4A 1UCKA 4QWTA 2Y74A 3MWZA 3JUNA 4XBTA 1FYSA 1UUWB 2CWUA 1UI7A 1RGCA 3OWSA 2YX9A 1I0VA 3PZWA 4WYKB 3G16A 1TU5A 3Q3FA 1WTHA 4MMXB 1OPYA 2O3OA 1Q824 3S67A 1IV7A 1QALA 5BXQA 5RNTA 1LOYA 1N8QA 5CF2A 2F4YA 3K7CA 1OF5B 4O2HA 1FGTA 1N5HA 1FUSA 1V74A 2J8XB 1GD3A 2C11A 3B4OA 4LEHA 4GSPA 1AV4A 2R41A 3D79A 1JKGA 4EC6A 1QVF2 2I9WA 5AEUB 1RDSA 1BNIA 4IPBA 4EV2A 3CCM3 3CCQ3 1N9JA 3FCSB 1NJI4 1VQ63 1I3FA 3OW22 3OWUA 1U8CB 1UW1A 1OHPA 1JB2A 3AMOA 1D6ZA 3F7XA 3NQZA 3UL5A 4FMDA 3HIGA 1RJOA 3QK9A 4JF8A 3GRDA 5IEOA 1GY6A 2WO0A 1US1A 3NV0B 5LC7A 1RNBA 1W6CA 1K28A 5JPPA 3EHCA 1S723 3NM7A 5AYRB 3Q90A 3SX1A 1C54A 1W6YA 2CIUA 3D5GA 1NDOB 3PYJA 1IQ8A 4KZ1A 1LNIA 2F56A 1MWRA 2WGOA 1BGSA 1IYYA 3CPW2 3LTCA 1ROVA 3HI7A 1QJGA 2W03A 4KFFA 3PGBA 3UB1A 1W4NA 3H3HA 3IMAB 3CCJ3 7GSPA 2W04A 4R1KA 2SBLA 1JB4A 4KFEA 1MNLA 2ML6A 1HZ1A 4WWUC 3AHSA 2KXGA 4LMIA 2KRTA 1SARA 1WQLB 1YGWA 3ROBA 3SYUA 1RHLA 1AY7A 1I2FA 1EKMA 4HVNA 3SLUA 4L8OA 4HM4B 3PS8A 1YJW3 1RGLA 2P0MA 1BNEA 4CDLA 4HM7B 1ZGXA 5AIFA 3K5TA 5CF1A 1YJ93 1CH0A 1PU4A 1VQO3 4L7KA 3D5IA 3SXXA 2K3DA 2WOHA 3JUMA 2IYJA 1RSNA 3F40A 1TUHA 4IT7A 1ULJB 3IJEB 4EXRA 2Z76A 3PCRA 1RTUA 1GD4A 1WNHA 5G2GA 2GBXB 3QRDA 4HYZA 1V58A 2E2VA 2CFWA 5M18A 1IK3A 1Q864 2CG0A 1MWTA 1UI8A 1CEWI 1GMRA 4EYCA 1VQN3 1AR0A 1YVSA 1M904 1RGAA 2BHMA 3Q1CA 1MWSA 4N6UA 2IUKA 3BNBA 3FF2A 5DREA 1Q9EA 5EEOA 3NBJA 1C7HA 3HZPA 3CXC2 4NHFA 2GEXA 3CCS3 4GHOA 1A90A 2CWTA 2OCTA 3SEDA 3EB8A 4TX4A 4RNYA 5CK6A 1B27A 2Z7AA 3EC9A 3KFQC 2RSXA 3LZAA 5EQLA 3DZLA 1X1XA 2W9QA 3GSPA 3NM2A 1O7GB 3STDA 4WHAA 3EQQB 2HMJB 3EBTA 3LMLA 1TRQA 1JZDA 4IIAA 1DVDA 1G02A 1DETA 2IMJA 3MG2A 3LT9A 4CCVA 1W6GA 4LZIA 1HYFA 1BNJA 3EN8A 3WOEB 1I3IA 3NX0A 4HM8B 2LYXA 1SPUA 2KF6A 4EBGA 3DUKA 4OK0A 4EW5A 1RGFA 1N9EA 3LTAA 5D82A 1HKXA 4OUQA 1PYLA 3EBYA 3B4PA 3AHWA 1AVLA 1VQQA 3HOHA 5FW5A 2KAAA 3WDGB 1UUVB 1RGGA 1A2KA 3X40A 3OV4A 4HZBB 2JDIH 3KN4A 1BNFA 3AGOA 5GSPA 1JRQA 4ZM8A 1JN5A 1RNTA 2O9UX 3CCL3 3F8HA 1IT7A 3A76A 1E3RA 1KD14 2CG1A 1RKYA 1D6UA 1RN1A 1TFOA 1DMNA 4HM0B 2LQVA 2QA43 1U5OA 1M1XB 1DMMA 1GMPA 1O7HB 3BNDA 3MG1A 1K9M4 1O7MB 1BNRA 2CW9A 2XSHB 3ER7A 3V99A 1DYUA 2AAEA 1T2HA 4LGQA 3G713 4FMBA 3CC73 1BRHA 4Q53A 1ROAA 4OVMA 4FR9A 3UNLA 1BRSA 1CQSA 1CYVA 3GWRA 1WMNA 3M8CA 3B7CA 3SOYA 3DGOA 1BANA 2ML5A 3FKAA 1PFPA 3LOYA 5DRVA 1FUWA 1OH0A 3S28A 1STFI 3VGNA 3MPHA 2HMKB 4LYLB 3SVAA 5BU4A 1KQS2 3G4S3 3FLJA 1J2BA 1OGZA 3J7Yd 1K8A4 1VQ93 1S5AA 3BU4A 5AYSC 1SIHA 2Z6BA 2UUGC 1O7WB 3K9MC 2GXFA 3EE1A 3DY5A 4O02B 1GOVA 2QGUA 4WYKA 5I97A 4BTXA 2XR8B 3N54B 1G96A 1W00A 1JBTA 4O3VA 4WFOA 1W2B2 1GYBA 1CYUA 1VQK3 1IVVA 1OF5A 2K0MA 2Y73A 1T5YA 1BU4A 1OGXA 5BIRA 3K63A 3CCE3 1OCVA 2CH9A 4K90B 4K1VA 5CLKA 3CD63 1ZX2A 4DKIA 4XDVA 4KFDA 5TGNA 1Y4KA 1VZZA 2XEPA 5KP3A 3G0KA 5STDA 1Q814 2ZDJA 1RGKA 3DMCA 4HKVB 4N6TA 4R4KA 1VQ73 1YIJ3 3CPOA 2RGQA 1DMQA 4R80A 3A5EA 3URPA 4BIRA 1GOUA 4BTYA 5JPUA 3WA3A 1KC84 3MG3A 5D81A 2PZVA 3KZTA 5HGRA 3DXOA 3LXUX 3NV0A 1FGMA 3CCV3 3X3XA 5G1LA 4N3VA 3GZYB 3N8BA 1IQYA 3I563 3MYTA 4KVHA 3H51A 1RGEA 3T0UA 4MMZB 1W2ZA 1GY5A 1LOXA 1FZUA 1NU3A 1IDPA 3HK4A 5A0OB 3T8UA 5IF6A 1BRIA 3K0ZA 4RZMA 1X1YA 1TTOA 2BMQB 1RCKA 1EUIC 1TJDA 2W56B 3JVCA 6STDA 3MHEA 1ASKA 1RRLA 1ZS7A 1UGIA 3F8XA 4R9KA 1LOWA 3D3LA 5AEWB 2RFRA 1TP6A 1B3SA 1W7CA 3JUPA 1YGEA 1JZOA 2QIYA 2W0QA 1BSCA 1OHOA 1QAKA 2BT3A 5IG0A 1L5GB 2IY2A 3TDGA 5IERA 1BRNL 3BNEA 1A2VA 3FG4A 1Q40B 1FW7A 4MJDA 1AQZA 1PY3A 2CFGA 2XFTA 1Q7Y4 1O7PB 2GSPA 1NB3I 3D9RA 2F99A 2W9PA 3EX9A 3S27A 3U1WA 3CC23 3MKIA 3NBBA 5AIGA 4AKYA 1EQKA 4XBYA 3GZRA 4ORLA 2HMMB 2P0XA 1OACA 5IG3A 1UUGB 1BSBA 1BIRA 4J5KA 4RNZA 1LQMB 1LNHA 1LXEA 3VF1A 4XBXA 3CC43 2XFSA 2XGLA 5M1AA 1V57A 4G1MB 2CFDA 2XH9A 2GU1A 3E99A 3CNXA 4I5QA 2CX0A 4K61A 8CHOA 1FGOA 1E97A 1B2XA 1W02A 1T3BA 2V1LA 2W56A 3KE7A 3HIIA 3KIIA 3CCR3 5HOHA 3X3YA 5AIIA 4FCZA 2KF5A 1IQXA 2D42A 3Q2PA 1IVXA 3IPTA 2B24B 1Q7HA 1FUTA 4MMYB 1Q42A 3EN1B 1Q40A 3GZXB 1BVIA 4BL2A 3DM8A 3GAXA 1ISKA 3LT8A 1JV2B 2BO9B 4J8TA 2GEYA 3WHOA 1D6YA 1FGRA 2CFLA 3D4AA 4HJLB 4HM3B 1I2EA 1GY7A 1GOYA 1I2GA 3L0RA 3RDEA 2Q07A 2C10A 4CJNA 1VQM3 5BVBA 3DH2A 1UGHI 2CK3H 4O8SA 1B2ZA 2ZHXB 4PEJA 3I553 1YNVX 2IUJA 1JBRA 2OTJ3 3WOFB 3B8LA 1HU9A 3OXAA 1JNQA 3LH4A 9RNTA 1T2IA 1A67A 2AADA 3BNCA 1JKGB
chains in the Genus database with same CATH topology
3NBRA 4STDA 1M9GA 3DGNA 3WA2X 2STDA 4NREA 2B1XB 4HM6B 4XDWA 3AMOB 3OWYA 2WOFA 3N9HA 1ULIB 4LSOA 4X2HA 1STDA 2INXA 4FMAA 4GB5A 3I0YA 2BNGA 4X2OA 4H3UA 3DGMA 4HM1B 1TFKA 2FXTA 2OTL3 1DVCA 1EA2A 1RRHA 1NO3A 4H61A 3NXJA 4WP5A 2D1WA 2MF7A 3O8YA 4FCMA 3FZWA 3RGAA 2BMRB 5IEPA 1W01A 1JB5A 3NHXA 1RN7A 2ZL8A 3EJVA 3V92A 4HZ9B 1Z1SA 2CHCA 3F9SA 1YI23 2FGTA 2MC8A 5IW9A 2L4VA 3PXMA 3RGRA 2OOVA 5IG5A 1VQ53 1O7NB 4N6V0 1VQ43 3G8ZA 3F14A 1SJWA 2QEX3 2W6JH 2XGNA 3BB9A 2UX0A 1FGQA 2YFIB 3FGYA 5AI1A 2XF3A 3UJMA 2R4IA 2CFKA 4FMCA 3T8NA 3PCSA 3NUVA 1E3VA 3G6E3 1NWWA 1IVWA 2F86B 2P09A 3JUOA 1WMPA 2OWPA 2CWVA 5FGOA 3JUQA 5KP1A 3CME3 1TIJA 1GS3A 1OHSA 2HMNB 4EV5A 4AKZA 4N6NB 4XB5A 3VSYA 4N6LA 2YFJB 3FF0A 3ECFA 1YHQ3 1OUNA 3ALAA 3KSED 4U13A 1N8R4 3F7SA 1AVKA 2OQEA 3DGLA 3V98A 4J9AA 1SIIA 1NB5I 1LVNA 5KP4A 3CCU3 4AEQA 2OQEC 2HMLB 2BMOB 2CKFB 2XSOB 3KKGA 2JQ5A 2GBWB 3GZBA 2IA7A 1YIT3 3LYGA 5IG4A 4N6OB 1N5PA 4R9LA 1M1K4 1IVUA 1QVG2 3UL6A 2KCDA 3WODG 5JBSA 2P38A 3OX9A 2E2UA 3FG3A 1BUQA 5ELJA 1IU7A 1IV9A 1K734 3BLZA 5D83A 1QMAA 4GL6A 4I4KA 2M7OA 1WMOA 1K41A 3LTBA 2FNQA 2PNCA 2Z77A 2RCDA 2A15A 2E2TA 3FH1A 3SOAA 2WGQA 7STDA 1ZO2A 4JRFA 1JN5B 3CNMA 2K54A 2XRXB 5IENA 5EVHA 1YVBI 1QAFA 5ELUA 5AIHA 4BTWA 4HBRA 1KSIA 3S29A 5LC6A 3X3ZA 4HM5B 3WMDA 2GU3A 3X41A 2YFLB 2CC3A 1VQP3 3CMA3 1FA3A 1F8NA 3HX8A 3U97A 2F98A 3FSDA 3CU3A 4XM4A 4RBNA 2OOVC 3LTDA 3MSOA 1R4CA 4L8PA 4K1UA 1W5ZA 2HMOB 1EG9B 4N6MA 1VQ83 3FG1A 3KSPA 1MOLA 5CXOA 4MEIA 3NQYA 1JJ22 1SQWA 1KWIA 1YJN3 4FCJA 3EF8A 4HM2B 3X42A 2W2CA 2P05A 1IT8A 1VQL3 4QWTA 2Y74A 3MWZA 3JUNA 4XBTA 1UUWB 2CWUA 1UI7A 3OWSA 3PZWA 2YX9A 4WYKB 3G16A 1TU5A 4MMXB 1WTHA 1OPYA 2O3OA 1Q824 3S67A 1IV7A 1QALA 5BXQA 1N8QA 5CF2A 3K7CA 1OF5B 4O2HA 1FGTA 1N5HA 1V74A 1GD3A 2C11A 3B4OA 4LEHA 4EC6A 1AV4A 1JKGA 1QVF2 2I9WA 5AEUB 4IPBA 4EV2A 3CCM3 3CCQ3 1N9JA 3FCSB 1NJI4 1VQ63 3OW22 3OWUA 1U8CB 1UW1A 1OHPA 1JB2A 3AMOA 1D6ZA 3F7XA 3NQZA 3UL5A 4FMDA 3HIGA 1RJOA 3QK9A 4JF8A 3GRDA 5IEOA 1GY6A 2WO0A 1US1A 3NV0B 5LC7A 1W6CA 1K28A 5JPPA 3EHCA 1S723 3NM7A 5AYRB 3Q90A 3SX1A 1W6YA 2CIUA 1NDOB 3PYJA 1IQ8A 4KZ1A 2WGOA 3CPW2 3LTCA 1ROVA 3HI7A 1QJGA 2W03A 4KFFA 3PGBA 3UB1A 1W4NA 3H3HA 3IMAB 3CCJ3 2W04A 4R1KA 2SBLA 1JB4A 4KFEA 1MNLA 2ML6A 4WWUC 2KXGA 4LMIA 2KRTA 1WQLB 3ROBA 1EKMA 4HVNA 3SLUA 4L8OA 4HM4B 3PS8A 1YJW3 2P0MA 4CDLA 4HM7B 5AIFA 3K5TA 5CF1A 1YJ93 1PU4A 1VQO3 4L7KA 3SXXA 2WOHA 3JUMA 3F40A 1TUHA 4IT7A 1ULJB 3IJEB 4EXRA 2Z76A 3PCRA 1WNHA 1GD4A 5G2GA 2GBXB 3QRDA 4HYZA 1Q864 2E2VA 2CFWA 1IK3A 2CG0A 1UI8A 1CEWI 4EYCA 1VQN3 1AR0A 2BHMA 3Q1CA 4N6UA 2IUKA 3BNBA 3FF2A 5DREA 5EEOA 3NBJA 1C7HA 3HZPA 3CXC2 4NHFA 2GEXA 3CCS3 1A90A 2CWTA 2OCTA 3SEDA 3EB8A 4TX4A 4RNYA 5CK6A 2Z7AA 3EC9A 3KFQC 2RSXA 3LZAA 5EQLA 3DZLA 2W9QA 3NM2A 1O7GB 3STDA 4WHAA 3EQQB 2HMJB 3EBTA 3LMLA 4IIAA 1DVDA 2IMJA 3MG2A 3LT9A 4CCVA 1W6GA 4LZIA 3EN8A 3WOEB 3NX0A 4HM8B 2LYXA 1SPUA 4EBGA 3DUKA 4OK0A 1N9EA 3LTAA 5D82A 1HKXA 4OUQA 3EBYA 3B4PA 5FW5A 1AVLA 3WDGB 1UUVB 1A2KA 3X40A 3OV4A 4HZBB 2JDIH 3KN4A 1JRQA 4ZM8A 1JN5A 2O9UX 3CCL3 3F8HA 1IT7A 3A76A 1E3RA 1KD14 2CG1A 1RKYA 1D6UA 1TFOA 1DMNA 4HM0B 2LQVA 2QA43 1U5OA 1M1XB 1DMMA 1O7HB 3BNDA 3MG1A 1K9M4 1O7MB 2CW9A 2XSHB 3ER7A 3V99A 1DYUA 4LGQA 3CC73 3G713 4FMBA 4Q53A 1ROAA 4OVMA 4FR9A 3UNLA 1CQSA 1CYVA 3GWRA 1WMNA 3M8CA 3B7CA 3SOYA 3DGOA 2ML5A 3FKAA 1PFPA 3LOYA 5DRVA 1FUWA 1OH0A 3S28A 1STFI 3VGNA 3MPHA 2HMKB 3SVAA 1KQS2 3G4S3 3FLJA 1J2BA 1OGZA 3J7Yd 1K8A4 1VQ93 1S5AA 5AYSC 1SIHA 2Z6BA 4O02B 1O7WB 3K9MC 2GXFA 3EE1A 3DY5A 3S5CA 2QGUA 4WYKA 5I97A 4BTXA 2XR8B 3N54B 1G96A 1W00A 4O3VA 4WFOA 1W2B2 1GYBA 1CYUA 1VQK3 1IVVA 1OF5A 2K0MA 2Y73A 1T5YA 1OGXA 3CCE3 3K63A 1OCVA 2CH9A 4K90B 4K1VA 5CLKA 3CD63 1ZX2A 4XDVA 4KFDA 5TGNA 1Y4KA 1VZZA 2XEPA 5KP3A 3G0KA 5STDA 1Q814 2ZDJA 4R4KA 3DMCA 4HKVB 4N6TA 1VQ73 1YIJ3 3CPOA 2RGQA 1DMQA 4R80A 4BTYA 5JPUA 3WA3A 1KC84 3MG3A 5D81A 2PZVA 3KZTA 5HGRA 3DXOA 3LXUX 3NV0A 1FGMA 3CCV3 3X3XA 4N3VA 3GZYB 3N8BA 1IQYA 3I563 3MYTA 4KVHA 3H51A 3T0UA 4MMZB 1W2ZA 1GY5A 1LOXA 1NU3A 1IDPA 3HK4A 5A0OB 3T8UA 5IF6A 3K0ZA 4RZMA 2BMQB 2W56B 3JVCA 6STDA 3MHEA 1ASKA 1RRLA 4R9KA 3F8XA 3D3LA 5AEWB 2RFRA 1TP6A 3JUPA 1W7CA 1YGEA 2QIYA 2W0QA 5IG0A 1OHOA 1QAKA 2BT3A 1L5GB 3TDGA 1M904 5IERA 3BNEA 1A2VA 3FG4A 1Q40B 4MJDA 2XFTA 2CFGA 1Q7Y4 1O7PB 1NB3I 3D9RA 2F99A 2W9PA 3EX9A 3S27A 3U1WA 3CC23 3MKIA 3NBBA 5AIGA 4AKYA 1EQKA 4XBYA 3GZRA 4ORLA 2HMMB 2P0XA 1OACA 5IG3A 4RNZA 1LNHA 1LXEA 3VF1A 4XBXA 3CC43 2XFSA 2XGLA 4G1MB 2CFDA 2XH9A 2GU1A 3E99A 3CNXA 4K61A 8CHOA 1FGOA 1E97A 2V1LA 1W02A 3KE7A 2W56A 3HIIA 3KIIA 3CCR3 3X3YA 5AIIA 4FCZA 1IQXA 2D42A 3Q2PA 1IVXA 3IPTA 2B24B 4MMYB 1Q42A 3EN1B 1Q40A 3GZXB 3DM8A 3GAXA 1ISKA 3LT8A 1JV2B 2BO9B 4J8TA 2GEYA 1D6YA 1FGRA 2CFLA 4HJLB 4HM3B 1GY7A 3L0RA 1VQM3 3RDEA 2Q07A 2C10A 5BVBA 2CK3H 4O8SA 4PEJA 3I553 2IUJA 2OTJ3 3WOFB 3B8LA 1HU9A 3OXAA 1JNQA 3LH4A 1A67A 3BNCA 1JKGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBR A;  4STD A;  2STD A;  2B1X B;  4HM6 B;  4XDW A;  3OWY A;  1ULI B;  4X2H A;  1STD A;  2INX A;  4GB5 A;  3I0Y A;  2BNG A;  4X2O A;  4H3U A;  4HM1 B;  1EA2 A;  3NXJ A;  4WP5 A;  4FCM A;  3FZW A;  3RGA A;  2BMR B;  5IEP A;  1W01 A;  1JB5 A;  3NHX A;  3EJV A;  4HZ9 B;  1Z1S A;  2CHC A;  3F9S A;  3RGR A;  5IG5 A;  1O7N B;  3G8Z A;  3F14 A;  1SJW A;  3BB9 A;  2UX0 A;  2YFI B;  3FGY A;  5AI1 A;  3UJM A;  2R4I A;  3T8N A;  3NUV A;  1E3V A;  1NWW A;  2F86 B;  3JUO A;  2OWP A;  3JUQ A;  5KP1 A;  1GS3 A;  1OHS A;  2HMN B;  4XB5 A;  3VSY A;  2YFJ B;  3FF0 A;  3ECF A;  1OUN A;  4U13 A;  3F7S A;  4J9A A;  5KP4 A;  2HML B;  2BMO B;  2CKF B;  2XSO B;  3KKG A;  2JQ5 A;  2GBW B;  3GZB A;  3LYG A;  5IG4 A;  4R9L A;  3OX9 A;  1BUQ A;  3BLZ A;  5D83 A;  1QMA A;  4I4K A;  1K41 A;  2Z77 A;  2RCD A;  2A15 A;  3FH1 A;  3SOA A;  7STD A;  1ZO2 A;  1JN5 B;  3CNM A;  2K54 A;  2XRX B;  5IEN A;  5EVH A;  5AIH A;  4HM5 B;  3WMD A;  2YFL B;  3HX8 A;  2F98 A;  3FSD A;  3CU3 A;  4XM4 A;  3MSO A;  4L8P A;  4K1U A;  2HMO B;  1EG9 B;  3KSP A;  5CXO A;  4FCJ A;  3EF8 A;  4HM2 B;  2W2C A;  3JUN A;  4XBT A;  1UUW B;  3OWS A;  4WYK B;  3G16 A;  1OPY A;  5BXQ A;  5CF2 A;  3K7C A;  1OF5 B;  3B4O A;  4LEH A;  1JKG A;  2I9W A;  5AEU B;  3OWU A;  1OHP A;  1JB2 A;  3F7X A;  3GRD A;  5IEO A;  1GY6 A;  3NV0 B;  5JPP A;  3EHC A;  3Q90 A;  1W6Y A;  1NDO B;  1QJG A;  3H3H A;  4R1K A;  1JB4 A;  4WWU C;  4LMI A;  1WQL B;  3ROB A;  4HVN A;  4L8O A;  4HM4 B;  4CDL A;  4HM7 B;  5AIF A;  5CF1 A;  4L7K A;  3JUM A;  3F40 A;  1TUH A;  1ULJ B;  2Z76 A;  5G2G A;  2GBX B;  1AR0 A;  3FF2 A;  5DRE A;  1C7H A;  3HZP A;  2GEX A;  3SED A;  5CK6 A;  2Z7A A;  3EC9 A;  3LZA A;  3DZL A;  3NM2 A;  1O7G B;  3STD A;  3EQQ B;  2HMJ B;  3EBT A;  4IIA A;  2IMJ A;  3MG2 A;  3EN8 A;  4HM8 B;  3DUK A;  5D82 A;  1HKX A;  4OUQ A;  3EBY A;  3B4P A;  5FW5 A;  1UUV B;  1A2K A;  3OV4 A;  4HZB B;  1JN5 A;  3F8H A;  3A76 A;  1E3R A;  4HM0 B;  1DMN A;  1U5O A;  1DMM A;  1O7H B;  3MG1 A;  1O7M B;  2XSH B;  3ER7 A;  4LGQ A;  4Q53 A;  4OVM A;  3UNL A;  1CQS A;  3GWR A;  3M8C A;  3B7C A;  3SOY A;  3FKA A;  5DRV A;  1OH0 A;  3VGN A;  2HMK B;  3FLJ A;  1OGZ A;  1S5A A;  3S5C A;  1O7W B;  2GXF A;  2QGU A;  4WYK A;  2XR8 B;  1W00 A;  1GYB A;  1OF5 A;  1OGX A;  1OCV A;  4K1V A;  5CLK A;  1ZX2 A;  4XDV A;  5TGN A;  1VZZ A;  5KP3 A;  3G0K A;  5STD A;  3DMC A;  4HKV B;  3CPO A;  2RGQ A;  1DMQ A;  5JPU A;  3MG3 A;  5D81 A;  2PZV A;  3KZT A;  5HGR A;  3DXO A;  3NV0 A;  4N3V A;  3GZY B;  3MYT A;  4KVH A;  3H51 A;  1GY5 A;  1NU3 A;  1IDP A;  3HK4 A;  3T8U A;  5IF6 A;  3K0Z A;  4RZM A;  2BMQ B;  6STD A;  3MHE A;  1ASK A;  4R9K A;  3F8X A;  5AEW B;  2RFR A;  1TP6 A;  3JUP A;  2QIY A;  5IG0 A;  1OHO A;  5IER A;  1Q40 B;  4MJD A;  1O7P B;  3D9R A;  2F99 A;  3EX9 A;  3MKI A;  5AIG A;  4XBY A;  3GZR A;  4ORL A;  2HMM B;  5IG3 A;  4XBX A;  3E99 A;  3CNX A;  8CHO A;  1E97 A;  3KE7 A;  1W02 A;  5AII A;  3IPT A;  2B24 B;  1Q42 A;  3EN1 B;  1Q40 A;  3GZX B;  3DM8 A;  1ISK A;  4J8T A;  2GEY A;  4HJL B;  4HM3 B;  1GY7 A;  5BVB A;  4PEJ A;  3B8L A;  3OXA A;  1JKG B; 
#chains in the Genus database with same CATH topology
 1BRK A;  3NBR A;  4STD A;  3KCH A;  4J5G A;  3RNT A;  1M9G A;  8RNT A;  3DGN A;  3WA2 X;  1G0T A;  2STD A;  4NRE A;  2B1X B;  4HM6 B;  4XDW A;  3AMO B;  3OWY A;  2WOF A;  3N9H A;  4RNT A;  1ULI B;  4KT3 B;  4LSO A;  4X2H A;  1STD A;  2INX A;  4CPK A;  2BU4 A;  4NPB A;  4FMA A;  4GB5 A;  1RN4 A;  3I0Y A;  1MGR A;  2BNG A;  4X2O A;  4H3U A;  2SAR A;  3DGM A;  4HM1 B;  1TFK A;  2FXT A;  2OTL 3;  1R4Y A;  1I70 A;  1DVC A;  2CX1 A;  1EA2 A;  1RRH A;  1NO3 A;  4H61 A;  1B21 A;  3NXJ A;  1EEJ A;  4WP5 A;  2D1W A;  2MF7 A;  3O8Y A;  1JBS A;  4FCM A;  2C4B A;  3FZW A;  3RGA A;  2BMR B;  5IEP A;  1W01 A;  1JB5 A;  3NHX A;  1RN7 A;  2ZL8 A;  3EJV A;  1BRJ A;  3V92 A;  4HZ9 B;  1Z1S A;  2BIR A;  2CHC A;  2KF3 A;  3F9S A;  1YI2 3;  2FGT A;  2MC8 A;  5IW9 A;  1DE3 A;  2L4V A;  2UGI A;  3PXM A;  3RGR A;  2F5M A;  1LOV A;  2OOV A;  2H0G A;  5IG5 A;  2KF4 A;  1VQ5 3;  1O7N B;  4N6V 0;  1VQ4 3;  3G8Z A;  3F14 A;  4BL3 A;  1TRP A;  1SJW A;  3ZG0 A;  2W6J H;  2QEX 3;  2XGN A;  3BB9 A;  4HAA A;  1BUJ A;  2UX0 A;  1B20 A;  4HOH A;  1FGQ A;  2YFI B;  3FGY A;  5AI1 A;  2XF3 A;  3UJM A;  2R4I A;  1X1W A;  2CFK A;  1BNS A;  4FMC A;  3T8N A;  3PCS A;  3NUV A;  1E3V A;  3G6E 3;  1NWW A;  1UCJ A;  1IVW A;  2F86 B;  1GMQ A;  2P09 A;  3JUO A;  5M19 A;  1WMP A;  2OWP A;  2CWV A;  2H0I A;  3AGN A;  5FGO A;  3JUQ A;  5KP1 A;  1LQG C;  1TIJ A;  1GS3 A;  1LRA A;  1OHS A;  3CME 3;  2HMN B;  4EV5 A;  4AKZ A;  4N6N B;  4XB5 A;  3VSY A;  4N6L A;  2YFJ B;  3FF0 A;  1BOX A;  3ECF A;  1YHQ 3;  1OUN A;  3ZG5 A;  1UCI A;  3ALA A;  1B2U A;  3KSE D;  4U13 A;  1BRG A;  1N8R 4;  3F7S A;  1AVK A;  2OQE A;  3DGL A;  3V98 A;  6GSP A;  4J9A A;  1B2S A;  1I8V A;  3WR2 A;  1SII A;  1BSA A;  1BSD A;  1NB5 I;  1BNG A;  1LVN A;  1B2M A;  5KP4 A;  3CCU 3;  4AEQ A;  2OQE C;  2HML B;  2BMO B;  2CKF B;  2XSO B;  3KKG A;  2JQ5 A;  6RNT A;  2GBW B;  3GZB A;  2IA7 A;  1YIT 3;  3LYG A;  5G1K A;  1RGH A;  5IG4 A;  4N6O B;  2RNT A;  1RMS A;  1N5P A;  4R9L A;  1M1K 4;  1IVU A;  1QVG 2;  3UL6 A;  2KCD A;  3WOD G;  5JBS A;  2P38 A;  3OX9 A;  2E2U A;  3FG3 A;  1BUQ A;  5ELJ A;  1IU7 A;  1IV9 A;  1K73 4;  3BLZ A;  5D83 A;  1QMA A;  4GL6 A;  4I4K A;  1WMO A;  1K41 A;  2M7O A;  3LTB A;  2FNQ A;  2PNC A;  2Z77 A;  1GSP A;  2RCD A;  2A15 A;  2E2T A;  3FH1 A;  3SOA A;  1RLS A;  2WGQ A;  7STD A;  1ZO2 A;  4JRF A;  1JN5 B;  3CNM A;  2K54 A;  1RCL A;  2XRX B;  7RNT A;  5IEN A;  2RBI A;  1X1U A;  5EVH A;  1YVB I;  1MGW A;  1QAF A;  2F5W A;  5AIH A;  5ELU A;  3S5C A;  4BTW A;  4HBR A;  1KSI A;  3S29 A;  2H0H A;  5LC6 A;  1A2P A;  1I0X A;  1UDI I;  3X3Z A;  4HM5 B;  1MWU A;  3WMD A;  2GU3 A;  3ZFZ A;  3DGY A;  3X41 A;  2YFL B;  2CC3 A;  1VQP 3;  2L1S A;  2HOH A;  3CMA 3;  1FA3 A;  1F8N A;  1UCL A;  3HX8 A;  2F98 A;  3FSD A;  3CU3 A;  3U97 A;  4XM4 A;  4ILF A;  4RBN A;  2OOV C;  3LTD A;  3MSO A;  1R4C A;  4L8P A;  4K1U A;  1W5Z A;  1NNV A;  2HMO B;  1EG9 B;  4N6M A;  1VQ8 3;  3FG1 A;  1BAO A;  3KSP A;  1MOL A;  5CXO A;  4MEI A;  3NQY A;  1JJ2 2;  1SQW A;  1KWI A;  1YJN 3;  3BIR A;  4FCJ A;  3EF8 A;  4HM2 B;  2ZA4 A;  3X42 A;  2W2C A;  2P05 A;  1IT8 A;  1BSE A;  1VQL 3;  4BU4 A;  1UCK A;  4QWT A;  2Y74 A;  3MWZ A;  3JUN A;  4XBT A;  1FYS A;  1UUW B;  2CWU A;  1UI7 A;  1RGC A;  3OWS A;  2YX9 A;  1I0V A;  3PZW A;  4WYK B;  3G16 A;  1TU5 A;  3Q3F A;  1WTH A;  4MMX B;  1OPY A;  2O3O A;  1Q82 4;  3S67 A;  1IV7 A;  1QAL A;  5BXQ A;  5RNT A;  1LOY A;  1N8Q A;  5CF2 A;  2F4Y A;  3K7C A;  1OF5 B;  4O2H A;  1FGT A;  1N5H A;  1FUS A;  1V74 A;  2J8X B;  1GD3 A;  2C11 A;  3B4O A;  4LEH A;  4GSP A;  1AV4 A;  2R41 A;  3D79 A;  1JKG A;  4EC6 A;  1QVF 2;  2I9W A;  5AEU B;  1RDS A;  1BNI A;  4IPB A;  4EV2 A;  3CCM 3;  3CCQ 3;  1N9J A;  3FCS B;  1NJI 4;  1VQ6 3;  1I3F A;  3OW2 2;  3OWU A;  1U8C B;  1UW1 A;  1OHP A;  1JB2 A;  3AMO A;  1D6Z A;  3F7X A;  3NQZ A;  3UL5 A;  4FMD A;  3HIG A;  1RJO A;  3QK9 A;  4JF8 A;  3GRD A;  5IEO A;  1GY6 A;  2WO0 A;  1US1 A;  3NV0 B;  5LC7 A;  1RNB A;  1W6C A;  1K28 A;  5JPP A;  3EHC A;  1S72 3;  3NM7 A;  5AYR B;  3Q90 A;  3SX1 A;  1C54 A;  1W6Y A;  2CIU A;  3D5G A;  1NDO B;  3PYJ A;  1IQ8 A;  4KZ1 A;  1LNI A;  2F56 A;  1MWR A;  2WGO A;  1BGS A;  1IYY A;  3CPW 2;  3LTC A;  1ROV A;  3HI7 A;  1QJG A;  2W03 A;  4KFF A;  3PGB A;  3UB1 A;  1W4N A;  3H3H A;  3IMA B;  3CCJ 3;  7GSP A;  2W04 A;  4R1K A;  2SBL A;  1JB4 A;  4KFE A;  1MNL A;  2ML6 A;  1HZ1 A;  4WWU C;  3AHS A;  2KXG A;  4LMI A;  2KRT A;  1SAR A;  1WQL B;  1YGW A;  3ROB A;  3SYU A;  1RHL A;  1AY7 A;  1I2F A;  1EKM A;  4HVN A;  3SLU A;  4L8O A;  4HM4 B;  3PS8 A;  1YJW 3;  1RGL A;  2P0M A;  1BNE A;  4CDL A;  4HM7 B;  1ZGX A;  5AIF A;  3K5T A;  5CF1 A;  1YJ9 3;  1CH0 A;  1PU4 A;  1VQO 3;  4L7K A;  3D5I A;  3SXX A;  2K3D A;  2WOH A;  3JUM A;  2IYJ A;  1RSN A;  3F40 A;  1TUH A;  4IT7 A;  1ULJ B;  3IJE B;  4EXR A;  2Z76 A;  3PCR A;  1RTU A;  1GD4 A;  1WNH A;  5G2G A;  2GBX B;  3QRD A;  4HYZ A;  1V58 A;  2E2V A;  2CFW A;  5M18 A;  1IK3 A;  1Q86 4;  2CG0 A;  1MWT A;  1UI8 A;  1CEW I;  1GMR A;  4EYC A;  1VQN 3;  1AR0 A;  1YVS A;  1M90 4;  1RGA A;  2BHM A;  3Q1C A;  1MWS A;  4N6U A;  2IUK A;  3BNB A;  3FF2 A;  5DRE A;  1Q9E A;  5EEO A;  3NBJ A;  1C7H A;  3HZP A;  3CXC 2;  4NHF A;  2GEX A;  3CCS 3;  4GHO A;  1A90 A;  2CWT A;  2OCT A;  3SED A;  3EB8 A;  4TX4 A;  4RNY A;  5CK6 A;  1B27 A;  2Z7A A;  3EC9 A;  3KFQ C;  2RSX A;  3LZA A;  5EQL A;  3DZL A;  1X1X A;  2W9Q A;  3GSP A;  3NM2 A;  1O7G B;  3STD A;  4WHA A;  3EQQ B;  2HMJ B;  3EBT A;  3LML A;  1TRQ A;  1JZD A;  4IIA A;  1DVD A;  1G02 A;  1DET A;  2IMJ A;  3MG2 A;  3LT9 A;  4CCV A;  1W6G A;  4LZI A;  1HYF A;  1BNJ A;  3EN8 A;  3WOE B;  1I3I A;  3NX0 A;  4HM8 B;  2LYX A;  1SPU A;  2KF6 A;  4EBG A;  3DUK A;  4OK0 A;  4EW5 A;  1RGF A;  1N9E A;  3LTA A;  5D82 A;  1HKX A;  4OUQ A;  1PYL A;  3EBY A;  3B4P A;  3AHW A;  1AVL A;  1VQQ A;  3HOH A;  5FW5 A;  2KAA A;  3WDG B;  1UUV B;  1RGG A;  1A2K A;  3X40 A;  3OV4 A;  4HZB B;  2JDI H;  3KN4 A;  1BNF A;  3AGO A;  5GSP A;  1JRQ A;  4ZM8 A;  1JN5 A;  1RNT A;  2O9U X;  3CCL 3;  3F8H A;  1IT7 A;  3A76 A;  1E3R A;  1KD1 4;  2CG1 A;  1RKY A;  1D6U A;  1RN1 A;  1TFO A;  1DMN A;  4HM0 B;  2LQV A;  2QA4 3;  1U5O A;  1M1X B;  1DMM A;  1GMP A;  1O7H B;  3BND A;  3MG1 A;  1K9M 4;  1O7M B;  1BNR A;  2CW9 A;  2XSH B;  3ER7 A;  3V99 A;  1DYU A;  2AAE A;  1T2H A;  4LGQ A;  3G71 3;  4FMB A;  3CC7 3;  1BRH A;  4Q53 A;  1ROA A;  4OVM A;  4FR9 A;  3UNL A;  1BRS A;  1CQS A;  1CYV A;  3GWR A;  1WMN A;  3M8C A;  3B7C A;  3SOY A;  3DGO A;  1BAN A;  2ML5 A;  3FKA A;  1PFP A;  3LOY A;  5DRV A;  1FUW A;  1OH0 A;  3S28 A;  1STF I;  3VGN A;  3MPH A;  2HMK B;  4LYL B;  3SVA A;  5BU4 A;  1KQS 2;  3G4S 3;  3FLJ A;  1J2B A;  1OGZ A;  3J7Y d;  1K8A 4;  1VQ9 3;  1S5A A;  3BU4 A;  5AYS C;  1SIH A;  2Z6B A;  2UUG C;  1O7W B;  3K9M C;  2GXF A;  3EE1 A;  3DY5 A;  4O02 B;  1GOV A;  2QGU A;  4WYK A;  5I97 A;  4BTX A;  2XR8 B;  3N54 B;  1G96 A;  1W00 A;  1JBT A;  4O3V A;  4WFO A;  1W2B 2;  1GYB A;  1CYU A;  1VQK 3;  1IVV A;  1OF5 A;  2K0M A;  2Y73 A;  1T5Y A;  1BU4 A;  1OGX A;  5BIR A;  3K63 A;  3CCE 3;  1OCV A;  2CH9 A;  4K90 B;  4K1V A;  5CLK A;  3CD6 3;  1ZX2 A;  4DKI A;  4XDV A;  4KFD A;  5TGN A;  1Y4K A;  1VZZ A;  2XEP A;  5KP3 A;  3G0K A;  5STD A;  1Q81 4;  2ZDJ A;  1RGK A;  3DMC A;  4HKV B;  4N6T A;  4R4K A;  1VQ7 3;  1YIJ 3;  3CPO A;  2RGQ A;  1DMQ A;  4R80 A;  3A5E A;  3URP A;  4BIR A;  1GOU A;  4BTY A;  5JPU A;  3WA3 A;  1KC8 4;  3MG3 A;  5D81 A;  2PZV A;  3KZT A;  5HGR A;  3DXO A;  3LXU X;  3NV0 A;  1FGM A;  3CCV 3;  3X3X A;  5G1L A;  4N3V A;  3GZY B;  3N8B A;  1IQY A;  3I56 3;  3MYT A;  4KVH A;  3H51 A;  1RGE A;  3T0U A;  4MMZ B;  1W2Z A;  1GY5 A;  1LOX A;  1FZU A;  1NU3 A;  1IDP A;  3HK4 A;  5A0O B;  3T8U A;  5IF6 A;  1BRI A;  3K0Z A;  4RZM A;  1X1Y A;  1TTO A;  2BMQ B;  1RCK A;  1EUI C;  1TJD A;  2W56 B;  3JVC A;  6STD A;  3MHE A;  1ASK A;  1RRL A;  1ZS7 A;  1UGI A;  3F8X A;  4R9K A;  1LOW A;  3D3L A;  5AEW B;  2RFR A;  1TP6 A;  1B3S A;  1W7C A;  3JUP A;  1YGE A;  1JZO A;  2QIY A;  2W0Q A;  1BSC A;  1OHO A;  1QAK A;  2BT3 A;  5IG0 A;  1L5G B;  2IY2 A;  3TDG A;  5IER A;  1BRN L;  3BNE A;  1A2V A;  3FG4 A;  1Q40 B;  1FW7 A;  4MJD A;  1AQZ A;  1PY3 A;  2CFG A;  2XFT A;  1Q7Y 4;  1O7P B;  2GSP A;  1NB3 I;  3D9R A;  2F99 A;  2W9P A;  3EX9 A;  3S27 A;  3U1W A;  3CC2 3;  3MKI A;  3NBB A;  5AIG A;  4AKY A;  1EQK A;  4XBY A;  3GZR A;  4ORL A;  2HMM B;  2P0X A;  1OAC A;  5IG3 A;  1UUG B;  1BSB A;  1BIR A;  4J5K A;  4RNZ A;  1LQM B;  1LNH A;  1LXE A;  3VF1 A;  4XBX A;  3CC4 3;  2XFS A;  2XGL A;  5M1A A;  1V57 A;  4G1M B;  2CFD A;  2XH9 A;  2GU1 A;  3E99 A;  3CNX A;  4I5Q A;  2CX0 A;  4K61 A;  8CHO A;  1FGO A;  1E97 A;  1B2X A;  1W02 A;  1T3B A;  2V1L A;  2W56 A;  3KE7 A;  3HII A;  3KII A;  3CCR 3;  5HOH A;  3X3Y A;  5AII A;  4FCZ A;  2KF5 A;  1IQX A;  2D42 A;  3Q2P A;  1IVX A;  3IPT A;  2B24 B;  1Q7H A;  1FUT A;  4MMY B;  1Q42 A;  3EN1 B;  1Q40 A;  3GZX B;  1BVI A;  4BL2 A;  3DM8 A;  3GAX A;  1ISK A;  3LT8 A;  1JV2 B;  2BO9 B;  4J8T A;  2GEY A;  3WHO A;  1D6Y A;  1FGR A;  2CFL A;  3D4A A;  4HJL B;  4HM3 B;  1I2E A;  1GY7 A;  1GOY A;  1I2G A;  3L0R A;  3RDE A;  2Q07 A;  2C10 A;  4CJN A;  1VQM 3;  5BVB A;  3DH2 A;  1UGH I;  2CK3 H;  4O8S A;  1B2Z A;  2ZHX B;  4PEJ A;  3I55 3;  1YNV X;  2IUJ A;  1JBR A;  2OTJ 3;  3WOF B;  3B8L A;  1HU9 A;  3OXA A;  1JNQ A;  3LH4 A;  9RNT A;  1T2I A;  1A67 A;  2AAD A;  3BNC A;  1JKG B; 
#chains in the Genus database with same CATH homology
 3NBR A;  4STD A;  1M9G A;  3DGN A;  3WA2 X;  2STD A;  4NRE A;  2B1X B;  4HM6 B;  4XDW A;  3AMO B;  3OWY A;  2WOF A;  3N9H A;  1ULI B;  4LSO A;  4X2H A;  1STD A;  2INX A;  4FMA A;  4GB5 A;  3I0Y A;  2BNG A;  4X2O A;  4H3U A;  3DGM A;  4HM1 B;  1TFK A;  2FXT A;  2OTL 3;  1DVC A;  1EA2 A;  1RRH A;  1NO3 A;  4H61 A;  3NXJ A;  4WP5 A;  2D1W A;  2MF7 A;  3O8Y A;  4FCM A;  3FZW A;  3RGA A;  2BMR B;  5IEP A;  1W01 A;  1JB5 A;  3NHX A;  1RN7 A;  2ZL8 A;  3EJV A;  3V92 A;  4HZ9 B;  1Z1S A;  2CHC A;  3F9S A;  1YI2 3;  2FGT A;  2MC8 A;  5IW9 A;  2L4V A;  3PXM A;  3RGR A;  2OOV A;  5IG5 A;  1VQ5 3;  1O7N B;  4N6V 0;  1VQ4 3;  3G8Z A;  3F14 A;  1SJW A;  2QEX 3;  2W6J H;  2XGN A;  3BB9 A;  2UX0 A;  1FGQ A;  2YFI B;  3FGY A;  5AI1 A;  2XF3 A;  3UJM A;  2R4I A;  2CFK A;  4FMC A;  3T8N A;  3PCS A;  3NUV A;  1E3V A;  3G6E 3;  1NWW A;  1IVW A;  2F86 B;  2P09 A;  3JUO A;  1WMP A;  2OWP A;  2CWV A;  5FGO A;  3JUQ A;  5KP1 A;  3CME 3;  1TIJ A;  1GS3 A;  1OHS A;  2HMN B;  4EV5 A;  4AKZ A;  4N6N B;  4XB5 A;  3VSY A;  4N6L A;  2YFJ B;  3FF0 A;  3ECF A;  1YHQ 3;  1OUN A;  3ALA A;  3KSE D;  4U13 A;  1N8R 4;  3F7S A;  1AVK A;  2OQE A;  3DGL A;  3V98 A;  4J9A A;  1SII A;  1NB5 I;  1LVN A;  5KP4 A;  3CCU 3;  4AEQ A;  2OQE C;  2HML B;  2BMO B;  2CKF B;  2XSO B;  3KKG A;  2JQ5 A;  2GBW B;  3GZB A;  2IA7 A;  1YIT 3;  3LYG A;  5IG4 A;  4N6O B;  1N5P A;  4R9L A;  1M1K 4;  1IVU A;  1QVG 2;  3UL6 A;  2KCD A;  3WOD G;  5JBS A;  2P38 A;  3OX9 A;  2E2U A;  3FG3 A;  1BUQ A;  5ELJ A;  1IU7 A;  1IV9 A;  1K73 4;  3BLZ A;  5D83 A;  1QMA A;  4GL6 A;  4I4K A;  2M7O A;  1WMO A;  1K41 A;  3LTB A;  2FNQ A;  2PNC A;  2Z77 A;  2RCD A;  2A15 A;  2E2T A;  3FH1 A;  3SOA A;  2WGQ A;  7STD A;  1ZO2 A;  4JRF A;  1JN5 B;  3CNM A;  2K54 A;  2XRX B;  5IEN A;  5EVH A;  1YVB I;  1QAF A;  5ELU A;  5AIH A;  4BTW A;  4HBR A;  1KSI A;  3S29 A;  5LC6 A;  3X3Z A;  4HM5 B;  3WMD A;  2GU3 A;  3X41 A;  2YFL B;  2CC3 A;  1VQP 3;  3CMA 3;  1FA3 A;  1F8N A;  3HX8 A;  3U97 A;  2F98 A;  3FSD A;  3CU3 A;  4XM4 A;  4RBN A;  2OOV C;  3LTD A;  3MSO A;  1R4C A;  4L8P A;  4K1U A;  1W5Z A;  2HMO B;  1EG9 B;  4N6M A;  1VQ8 3;  3FG1 A;  3KSP A;  1MOL A;  5CXO A;  4MEI A;  3NQY A;  1JJ2 2;  1SQW A;  1KWI A;  1YJN 3;  4FCJ A;  3EF8 A;  4HM2 B;  3X42 A;  2W2C A;  2P05 A;  1IT8 A;  1VQL 3;  4QWT A;  2Y74 A;  3MWZ A;  3JUN A;  4XBT A;  1UUW B;  2CWU A;  1UI7 A;  3OWS A;  3PZW A;  2YX9 A;  4WYK B;  3G16 A;  1TU5 A;  4MMX B;  1WTH A;  1OPY A;  2O3O A;  1Q82 4;  3S67 A;  1IV7 A;  1QAL A;  5BXQ A;  1N8Q A;  5CF2 A;  3K7C A;  1OF5 B;  4O2H A;  1FGT A;  1N5H A;  1V74 A;  1GD3 A;  2C11 A;  3B4O A;  4LEH A;  4EC6 A;  1AV4 A;  1JKG A;  1QVF 2;  2I9W A;  5AEU B;  4IPB A;  4EV2 A;  3CCM 3;  3CCQ 3;  1N9J A;  3FCS B;  1NJI 4;  1VQ6 3;  3OW2 2;  3OWU A;  1U8C B;  1UW1 A;  1OHP A;  1JB2 A;  3AMO A;  1D6Z A;  3F7X A;  3NQZ A;  3UL5 A;  4FMD A;  3HIG A;  1RJO A;  3QK9 A;  4JF8 A;  3GRD A;  5IEO A;  1GY6 A;  2WO0 A;  1US1 A;  3NV0 B;  5LC7 A;  1W6C A;  1K28 A;  5JPP A;  3EHC A;  1S72 3;  3NM7 A;  5AYR B;  3Q90 A;  3SX1 A;  1W6Y A;  2CIU A;  1NDO B;  3PYJ A;  1IQ8 A;  4KZ1 A;  2WGO A;  3CPW 2;  3LTC A;  1ROV A;  3HI7 A;  1QJG A;  2W03 A;  4KFF A;  3PGB A;  3UB1 A;  1W4N A;  3H3H A;  3IMA B;  3CCJ 3;  2W04 A;  4R1K A;  2SBL A;  1JB4 A;  4KFE A;  1MNL A;  2ML6 A;  4WWU C;  2KXG A;  4LMI A;  2KRT A;  1WQL B;  3ROB A;  1EKM A;  4HVN A;  3SLU A;  4L8O A;  4HM4 B;  3PS8 A;  1YJW 3;  2P0M A;  4CDL A;  4HM7 B;  5AIF A;  3K5T A;  5CF1 A;  1YJ9 3;  1PU4 A;  1VQO 3;  4L7K A;  3SXX A;  2WOH A;  3JUM A;  3F40 A;  1TUH A;  4IT7 A;  1ULJ B;  3IJE B;  4EXR A;  2Z76 A;  3PCR A;  1WNH A;  1GD4 A;  5G2G A;  2GBX B;  3QRD A;  4HYZ A;  1Q86 4;  2E2V A;  2CFW A;  1IK3 A;  2CG0 A;  1UI8 A;  1CEW I;  4EYC A;  1VQN 3;  1AR0 A;  2BHM A;  3Q1C A;  4N6U A;  2IUK A;  3BNB A;  3FF2 A;  5DRE A;  5EEO A;  3NBJ A;  1C7H A;  3HZP A;  3CXC 2;  4NHF A;  2GEX A;  3CCS 3;  1A90 A;  2CWT A;  2OCT A;  3SED A;  3EB8 A;  4TX4 A;  4RNY A;  5CK6 A;  2Z7A A;  3EC9 A;  3KFQ C;  2RSX A;  3LZA A;  5EQL A;  3DZL A;  2W9Q A;  3NM2 A;  1O7G B;  3STD A;  4WHA A;  3EQQ B;  2HMJ B;  3EBT A;  3LML A;  4IIA A;  1DVD A;  2IMJ A;  3MG2 A;  3LT9 A;  4CCV A;  1W6G A;  4LZI A;  3EN8 A;  3WOE B;  3NX0 A;  4HM8 B;  2LYX A;  1SPU A;  4EBG A;  3DUK A;  4OK0 A;  1N9E A;  3LTA A;  5D82 A;  1HKX A;  4OUQ A;  3EBY A;  3B4P A;  5FW5 A;  1AVL A;  3WDG B;  1UUV B;  1A2K A;  3X40 A;  3OV4 A;  4HZB B;  2JDI H;  3KN4 A;  1JRQ A;  4ZM8 A;  1JN5 A;  2O9U X;  3CCL 3;  3F8H A;  1IT7 A;  3A76 A;  1E3R A;  1KD1 4;  2CG1 A;  1RKY A;  1D6U A;  1TFO A;  1DMN A;  4HM0 B;  2LQV A;  2QA4 3;  1U5O A;  1M1X B;  1DMM A;  1O7H B;  3BND A;  3MG1 A;  1K9M 4;  1O7M B;  2CW9 A;  2XSH B;  3ER7 A;  3V99 A;  1DYU A;  4LGQ A;  3CC7 3;  3G71 3;  4FMB A;  4Q53 A;  1ROA A;  4OVM A;  4FR9 A;  3UNL A;  1CQS A;  1CYV A;  3GWR A;  1WMN A;  3M8C A;  3B7C A;  3SOY A;  3DGO A;  2ML5 A;  3FKA A;  1PFP A;  3LOY A;  5DRV A;  1FUW A;  1OH0 A;  3S28 A;  1STF I;  3VGN A;  3MPH A;  2HMK B;  3SVA A;  1KQS 2;  3G4S 3;  3FLJ A;  1J2B A;  1OGZ A;  3J7Y d;  1K8A 4;  1VQ9 3;  1S5A A;  5AYS C;  1SIH A;  2Z6B A;  4O02 B;  1O7W B;  3K9M C;  2GXF A;  3EE1 A;  3DY5 A;  3S5C A;  2QGU A;  4WYK A;  5I97 A;  4BTX A;  2XR8 B;  3N54 B;  1G96 A;  1W00 A;  4O3V A;  4WFO A;  1W2B 2;  1GYB A;  1CYU A;  1VQK 3;  1IVV A;  1OF5 A;  2K0M A;  2Y73 A;  1T5Y A;  1OGX A;  3CCE 3;  3K63 A;  1OCV A;  2CH9 A;  4K90 B;  4K1V A;  5CLK A;  3CD6 3;  1ZX2 A;  4XDV A;  4KFD A;  5TGN A;  1Y4K A;  1VZZ A;  2XEP A;  5KP3 A;  3G0K A;  5STD A;  1Q81 4;  2ZDJ A;  4R4K A;  3DMC A;  4HKV B;  4N6T A;  1VQ7 3;  1YIJ 3;  3CPO A;  2RGQ A;  1DMQ A;  4R80 A;  4BTY A;  5JPU A;  3WA3 A;  1KC8 4;  3MG3 A;  5D81 A;  2PZV A;  3KZT A;  5HGR A;  3DXO A;  3LXU X;  3NV0 A;  1FGM A;  3CCV 3;  3X3X A;  4N3V A;  3GZY B;  3N8B A;  1IQY A;  3I56 3;  3MYT A;  4KVH A;  3H51 A;  3T0U A;  4MMZ B;  1W2Z A;  1GY5 A;  1LOX A;  1NU3 A;  1IDP A;  3HK4 A;  5A0O B;  3T8U A;  5IF6 A;  3K0Z A;  4RZM A;  2BMQ B;  2W56 B;  3JVC A;  6STD A;  3MHE A;  1ASK A;  1RRL A;  4R9K A;  3F8X A;  3D3L A;  5AEW B;  2RFR A;  1TP6 A;  3JUP A;  1W7C A;  1YGE A;  2QIY A;  2W0Q A;  5IG0 A;  1OHO A;  1QAK A;  2BT3 A;  1L5G B;  3TDG A;  1M90 4;  5IER A;  3BNE A;  1A2V A;  3FG4 A;  1Q40 B;  4MJD A;  2XFT A;  2CFG A;  1Q7Y 4;  1O7P B;  1NB3 I;  3D9R A;  2F99 A;  2W9P A;  3EX9 A;  3S27 A;  3U1W A;  3CC2 3;  3MKI A;  3NBB A;  5AIG A;  4AKY A;  1EQK A;  4XBY A;  3GZR A;  4ORL A;  2HMM B;  2P0X A;  1OAC A;  5IG3 A;  4RNZ A;  1LNH A;  1LXE A;  3VF1 A;  4XBX A;  3CC4 3;  2XFS A;  2XGL A;  4G1M B;  2CFD A;  2XH9 A;  2GU1 A;  3E99 A;  3CNX A;  4K61 A;  8CHO A;  1FGO A;  1E97 A;  2V1L A;  1W02 A;  3KE7 A;  2W56 A;  3HII A;  3KII A;  3CCR 3;  3X3Y A;  5AII A;  4FCZ A;  1IQX A;  2D42 A;  3Q2P A;  1IVX A;  3IPT A;  2B24 B;  4MMY B;  1Q42 A;  3EN1 B;  1Q40 A;  3GZX B;  3DM8 A;  3GAX A;  1ISK A;  3LT8 A;  1JV2 B;  2BO9 B;  4J8T A;  2GEY A;  1D6Y A;  1FGR A;  2CFL A;  4HJL B;  4HM3 B;  1GY7 A;  3L0R A;  1VQM 3;  3RDE A;  2Q07 A;  2C10 A;  5BVB A;  2CK3 H;  4O8S A;  4PEJ A;  3I55 3;  2IUJ A;  2OTJ 3;  3WOF B;  3B8L A;  1HU9 A;  3OXA A;  1JNQ A;  3LH4 A;  1A67 A;  3BNC A;  1JKG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...