1JB2A

Crystal structure of ntf2 m84e mutant
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
b'KPIWEQIGSSFINHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISEVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR TRANSPORT FACTOR 2
publication title NTF2 monomer-dimer equilibrium.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 37
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1jb2A00
3FF0A 1Z1SA 1O7GB 3EBTA 3A76A 4HM0B 2YFIB 1OH0A 1ASKA 4J9AA 3CNMA 4ORLA 2GXFA 2HMNB 4HM2B 5D82A 3F14A 1NWWA 2XR8B 3WMDA 1UUVB 3GZXB 3DXOA 3UJMA 3B8LA 5IF6A 1W00A 3GWRA 5D81A 1CQSA 1GY5A 3FLJA 1OUNA 4L8OA 3LYGA 2K54A 3MG3A 1ISKA 2BMRB 3OX9A 4XBYA 2BNGA 1S5AA 3FSDA 3GZBA 3EHCA 3JUPA 3HX8A 2R4IA 4HZBB 3HZPA 1O7PB 1AR0A 4WYKB 4STDA 1GS3A 3F8HA 2I9WA 6STDA 4XB5A 2HMLB 3FF2A 4HJLB 1O7NB 2XSHB 5AIFA 2GBWB 3ER7A 3MSOA 3F7XA 2F98A 3ECFA 5IEOA 5IERA 3F9SA 1OF5B 4U13A 1OGZA 4HM4B 5KP1A 4R9LA 1QJGA 3I0YA 4OUQA 1OGXA 3SOYA 5IG5A 2B1XB 3MG1A 4LMIA 2GEYA 4Q53A 5CK6A 1ZO2A 2CKFB 8CHOA 3KZTA 1GY7A 1W02A 4N3VA 4IIAA 2Z76A 3DZLA 1W01A 3HK4A 3NUVA 4H3UA 5IENA 3OWUA 5CLKA 1Q40A 2XRXB 1JKGB 3LZAA 3B7CA 3OWSA 2XSOB 1O7WB 5BXQA 4CDLA 1NDOB 3H3HA 3GZYB 4XDVA 5CF1A 3SEDA 2CHCA 2OWPA 2W2CA 1OHOA 3BB9A 5KP4A 4GB5A 3EN1B 1ZX2A 5AI1A 5IEPA 4HM1B 3NV0A 3G0KA 5STDA 3JUNA 1STDA 3RGRA 4HM5B 4FCMA 2BMQB 1ULJB 3H51A 3VGNA 3JUOA 4WP5A 4KVHA 3BLZA 3DM8A 2BMOB 3NHXA 1JN5B 1K41A 1WQLB 3EJVA 3OXAA 4HM8B 1DMNA 5HGRA 1TP6A 4XBTA 3G16A 3M8CA 1DMMA 2IMJA 4RZMA 4MJDA 3EX9A 3DMCA 4LGQA 3T8UA 4HKVB 1JB4A 5CF2A 1OCVA 3IPTA 1OHSA 1GY6A 5EVHA 3KKGA 3F8XA 3CU3A 5AIGA 1OHPA 3CNXA 5AEWB 1QMAA 4K1UA 3B4OA 4PEJA 4WWUC 2B24B 3SOAA 2HMOB 1NU3A 2INXA 3MYTA 5DREA 3VSYA 3F7SA 4HZ9B 7STDA 3GRDA 2GBXB 1VZZA 5CXOA 2YFJB 2RGQA 1BUQA 3EBYA 2GEXA 4R9KA 4WYKA 2A15A 5AIHA 3F40A 5D83A 4HM7B 5JPPA 4K1VA 3RGAA 1O7MB 4L8PA 1GYBA 4HM3B 2RFRA 5TGNA 2QGUA 4FCJA 4J8TA 1EG9B 1O7HB 2Z77A 1JB2A 3MKIA 2JQ5A 3FKAA 4XBXA 2Z7AA 2STDA 1SJWA 4LEHA 3JUMA 1OF5A 2F86B 5IG0A 2QIYA 2PZVA 1E3RA 4X2HA 1C7HA 3KE7A 4L7KA 1DMQA 2HMJB 3OV4A 3B4PA 4HVNA 1HKXA 1OPYA 3FZWA 3EN8A 1E97A 2RCDA 2UX0A 3CPOA 1Q42A 1Q40B 3KSPA 3K0ZA 1UUWB 3STDA 3G8ZA 4R1KA 4XM4A 4XDWA 4OVMA 3EQQB 1W6YA 1TUHA 4I4KA 1IDPA 5AIIA 5DRVA 1JKGA 1A2KA 1EA2A 3S5CA 3UNLA 3MHEA 3OWYA 4HM6B 3FH1A 3NV0B 5G2GA 3NXJA 2HMKB 5JPUA 3D9RA 3Q90A 2F99A 1ULIB 5IG4A 4X2OA 3JUQA 2YFLB 5KP3A 3NM2A 3NBRA 3EF8A 3ROBA 3EC9A 5IG3A 3FGYA 5BVBA 1JB5A 2HMMB 3GZRA 3MG2A 3K7CA 1U5OA 3DUKA 5FW5A 1E3VA 5AEUB 3T8NA 1JN5A 3E99A
chains in the Genus database with same CATH superfamily
3FF0A 3PCRA 1NB5I 3PCSA 4RNTA 4R80A 1N5HA 1Z1SA 2CWVA 2WO0A 1O7GB 2W04A 2IY2A 1T2HA 1TFKA 3EBTA 1VQ73 3A76A 1WTHA 2YFIB 3N54B 4HM0B 1OH0A 1ASKA 4J9AA 1KWIA 3RNTA 3D5GA 1BSBA 1N9JA 3CNMA 4KFFA 3KN4A 4ORLA 2GXFA 2HMNB 4HM2B 2KAAA 3AHSA 1BNFA 5D82A 1LXEA 2KF3A 2AADA 3F14A 1IK3A 4BL3A 1VQM3 1NWWA 4KFEA 1S723 4LYLB 5EQLA 4J5KA 1RCKA 1JBTA 2XR8B 2UUGC 3WMDA 1MWUA 4R4KA 1B27A 1BSEA 1UUVB 3GZXB 1BSCA 3DXOA 3UJMA 3B8LA 3SVAA 5IF6A 1DVCA 3SLUA 1W00A 2W9QA 1G96A 1RLSA 2CFWA 2CWTA 1CQSA 1TTOA 1X1YA 3GWRA 1B2UA 5D81A 3UB1A 1GY5A 1Q814 3FLJA 2XGLA 1VQ93 1OUNA 3SX1A 3X42A 4L8OA 2MC8A 2CK3H 3MPHA 4IPBA 3LYGA 2K54A 3MG3A 3AGNA 2OTL3 1ISKA 3D4AA 4N6UA 1BNEA 2BMRB 2W0QA 3OX9A 3ZFZA 4BIRA 1RSNA 2BNGA 1S5AA 4XBYA 4AEQA 2QA43 2GU3A 3HI7A 3FSDA 3GZBA 3EHCA 1N8QA 1GMPA 3JUPA 2ZL8A 3HX8A 1I3IA 2R4IA 1PYLA 2QEX3 2H0HA 3Q1CA 4HZBB 3HZPA 1O7PB 2XF3A 3S29A 1Q824 3I563 1Q7HA 1I3FA 3CD63 1AR0A 4WYKB 4WHAA 3KCHA 2E2UA 3V98A 4STDA 9RNTA 6RNTA 5LC7A 3X3ZA 3D5IA 2P38A 1GS3A 2CW9A 2I9WA 1BRIA 3F8HA 6STDA 4XB5A 2HMLB 4FMCA 1Y4KA 1VQK3 3FF2A 4HJLB 3LMLA 1VQP3 1O7NB 3DGMA 4FMAA 3CCL3 3WOEB 1AQZA 1RGEA 2XSHB 1IT7A 1PFPA 5AIFA 1YJW3 1SPUA 2GBWB 4KT3B 3ER7A 4G1MB 5G1LA 3MSOA 4HBRA 3MWZA 3F7XA 3X3YA 2F98A 1G0TA 1IQXA 3PGBA 1T3BA 3ECFA 1LVNA 3V92A 2CX0A 5IEOA 1X1UA 1W6CA 3DGNA 5IERA 3HIIA 4CPKA 2CFLA 1MGRA 1FA3A 1BU4A 3WHOA 1BAOA 1DYUA 3F9SA 1VQN3 1GOVA 1OF5B 1Q9EA 2ML5A 1R4CA 1OGZA 2LYXA 3AMOA 4U13A 4HM4B 5KP1A 3LTBA 1RGLA 3CCJ3 4R9LA 3DGOA 1QJGA 3I0YA 4OUQA 1OGXA 2C4BA 2RBIA 3SOYA 1Q7Y4 2WGQA 4ZM8A 1QAFA 5IG5A 1UGHI 3X40A 1WMOA 1B20A 2B1XB 3MG1A 3CXC2 3DY5A 3HOHA 2KF6A 4LMIA 2P09A 2GEYA 3CCV3 1YGEA 4Q53A 2OCTA 5CK6A 1FYSA 1BRNL 1IQYA 1YHQ3 4TX4A 1ZO2A 2KCDA 2CKFB 2PNCA 8CHOA 2ZDJA 2OOVA 3OW22 3KZTA 1TJDA 1IVWA 2L1SA 2RSXA 4HYZA 1LQMB 1GY7A 1W02A 2O9UX 4KZ1A 4N3VA 3CCM3 1W2B2 2WOHA 1VQ63 1YVBI 1VQQA 2W56B 3Q3FA 4GL6A 1A90A 4IIAA 2Z76A 4MMZB 3DZLA 1W01A 1BIRA 3HK4A 1U8CB 3NUVA 4H3UA 1M1XB 3DH2A 2FNQA 3NM7A 5IENA 2BU4A 3OWUA 1MWSA 5CLKA 2K0MA 2D1WA 1BGSA 1W6GA 2CFKA 1BRGA 1QVF2 1Q40A 2XRXB 1JKGB 1N5PA 3LZAA 3B7CA 1GMRA 3OWSA 2XSOB 1CEWI 1O7WB 5AYRB 4LSOA 5BXQA 3D3LA 4CDLA 1N8R4 4BL2A 1NDOB 3WOFB 2ZA4A 2XGNA 3H3HA 3GZYB 3QK9A 4XDVA 1CYUA 1UI8A 2CC3A 5CF1A 1KSIA 3SEDA 7STDA 2MF7A 2CHCA 1LNIA 1B2MA 2OWPA 1RTUA 3JVCA 2W2CA 1YI23 1MOLA 3NX0A 1OHOA 1LOVA 3BB9A 4O2HA 4GB5A 5KP4A 3U97A 3BU4A 1K734 3EN1B 1YGWA 1ZX2A 1DETA 5G1KA 4WFOA 4NPBA 5AI1A 5IEPA 5M19A 1RGKA 1RGHA 1M9GA 1PY3A 1SARA 2XFTA 3FCSB 3PXMA 4HM1B 4N6MA 4EBGA 4O8SA 3ZG5A 1FUWA 3K5TA 3NV0A 3G0KA 1KC84 1WNHA 1L5GB 5STDA 3JUNA 1STDA 5M1AA 3RGRA 4CJNA 2IUKA 3CC43 1D6YA 4EC6A 4HM5B 3CMA3 2P0MA 1I70A 1NNVA 4FCMA 2BT3A 1RNTA 1ULJB 2BMQB 3EB8A 3H51A 1ZGXA 3VGNA 3JUOA 1VQ43 1IQ8A 3EE1A 1M904 4MMYB 4WP5A 1T5YA 4KVHA 1LOXA 3G4S3 2GSPA 3BLZA 1HYFA 3SYUA 1TU5A 1RJOA 3DM8A 4EV2A 2BMOB 1X1WA 1B2XA 2XFSA 1FGMA 1K8A4 1YIJ3 1BANA 3NHXA 1QVG2 1D6ZA 2CG0A 1JN5B 1K41A 1WQLB 1X1XA 1SQWA 1TRQA 4BTXA 3EJVA 1RHLA 2W03A 2W6JH 3TDGA 3OXAA 1BNIA 3LXUX 4HM8B 3WA2X 1KQS2 1RNBA 1DMNA 5HGRA 1TP6A 4IT7A 4XBTA 1RKYA 3G16A 3KIIA 3M8CA 1DMMA 1V58A 4FMDA 1FZUA 1GSPA 2IMJA 1B2SA 4RZMA 1IV9A 1MGWA 3FG3A 4MJDA 3EX9A 3DMCA 4LGQA 2SARA 4RNZA 3T8UA 5BU4A 4HKVB 1HU9A 1JB4A 3QRDA 3NQYA 5CF2A 3PS8A 3ALAA 1LOYA 1BNRA 1OCVA 3IPTA 1OHSA 1GY6A 5EVHA 3IMAB 4MEIA 3KKGA 1JNQA 3F8XA 3CU3A 1GD3A 3CCU3 2ZHXB 5AIGA 1JZDA 6GSPA 1I0XA 4RBNA 1F8NA 1OHPA 3CNXA 5AEWB 1MWRA 1BVIA 1NJI4 1QMAA 2K3DA 1TIJA 1SIIA 1BSDA 4K1UA 3B4OA 4PEJA 4WWUC 2F5MA 1K9M4 2B24B 1K28A 1IVVA 1I2GA 4EV5A 3KFQC 4BTYA 2CWUA 4EYCA 3SOAA 2HMOB 1BSAA 5A0OB 1NU3A 3CCE3 2WGOA 4N6V0 1BRJA 2INXA 1JBRA 4ILFA 3MYTA 1BOXA 3HIGA 2KRTA 5DREA 1RGCA 2F56A 3F7SA 1UUGB 4HZ9B 2CG1A 3U1WA 3GRDA 3VSYA 1V74A 2LQVA 3FG1A 2KF5A 1JBSA 2GBXB 4OVMA 1V57A 1VZZA 3BNBA 1GD4A 5CXOA 1US1A 3WDGB 3CCQ3 2W9PA 3V99A 1D6UA 1EEJA 2YFJB 2RGQA 3UL6A 1BUQA 2V1LA 3A5EA 1GOUA 3EBYA 1FGTA 3RDEA 5BIRA 2Y73A 7GSPA 3WR2A 2GEXA 4R9KA 3LOYA 1B3SA 2CFDA 4JF8A 2IA7A 3X41A 2H0GA 4NHFA 2CIUA 2Q07A 4WYKA 2A15A 2FXTA 3CCR3 5AIHA 4N6LA 1RRLA 4N6OB 2OQEC 1ROAA 2GU1A 2XEPA 1UCIA 4K90B 4O02B 2AAEA 2C10A 3F40A 5ELUA 2SBLA 1UW1A 1BRHA 3AHWA 5HOHA 1BUJA 5D83A 3LT9A 4HM7B 2RNTA 5JPPA 3G6E3 4K1VA 3RGAA 1J2BA 1O7MB 3BIRA 2KXGA 1W5ZA 1YIT3 4L8PA 4GHOA 3CC73 1GYBA 4HM3B 1R4YA 4GSPA 2RFRA 5TGNA 4AKYA 2QGUA 3AMOB 1ZS7A 3CPW2 5AYSC 4J5GA 4FCJA 1RDSA 4J8TA 5I97A 1EG9B 1O7HB 4FR9A 2Z77A 2R41A 1JB2A 3MKIA 2JQ5A 2C11A 1KD14 3FKAA 1B2ZA 4XBXA 2CH9A 3CCS3 1UI7A 5IW9A 1A2PA 2Z7AA 2E2VA 2STDA 4N6TA 3S28A 3N8BA 3CC23 1SJWA 2P05A 4LEHA 4O3VA 3JUMA 1OF5A 2F86B 5IG0A 1SIHA 3DGLA 1BRKA 2QIYA 1PU4A 2PZVA 2XH9A 1E3RA 2P0XA 4X2HA 1FGQA 2WOFA 1C7HA 1VQ53 1FGOA 3LT8A 3O8YA 4FMBA 3KE7A 1AV4A 1DMQA 4L7KA 1YJN3 1VQ83 1YJ93 1JZOA 2KF4A 2OOVC 3LTCA 3G713 2HMJB 1YVSA 4MMXB 1GOYA 4BTWA 2FGTA 1I2FA 3OV4A 3T0UA 5FGOA 1LQGC 3B4PA 4FCZA 1JV2B 5EEOA 3NBBA 1LNHA 4HVNA 1HKXA 1WMNA 2JDIH 1FGRA 1RRHA 3LTAA 1NO3A 5RNTA 1VQO3 3L0RA 1A67A 1OPYA 3FZWA 3EN8A 1E97A 2BO9B 2RCDA 4BU4A 4EW5A 2UX0A 3CPOA 1JJ22 1Q42A 1DE3A 3J7Yd 1I2EA 1GMQA 1EQKA 1IVUA 1Q40B 2F5WA 3KSPA 1G02A 3WA3A 3K0ZA 1UUWB 1W7CA 3STDA 7RNTA 1IVXA 3G8ZA 4R1KA 4XM4A 2W56A 1FUTA 1C54A 1JRQA 3AGOA 5ELJA 4XDWA 5GSPA 2IUJA 3S67A 3WODG 3PYJA 1IU7A 3K9MC 1UCJA 3PZWA 3EQQB 4I5QA 1TRPA 2E2TA 4H61A 2D42A 2J8XB 1BNGA 1WMPA 1QAKA 2M7OA 1W6YA 2ML6A 1TUHA 3NBJA 1IDPA 1IT8A 4I4KA 4K61A 4HAAA 3SXXA 5AIIA 2OQEA 1LRAA 1BNSA 1M1K4 2OTJ3 5DRVA 1JKGA 1A2KA 3GSPA 8RNTA 3BNCA 1NB3I 1EA2A 2Y74A 3S5CA 1RN7A 3UNLA 1RGAA 1RGGA 1UCLA 1I8VA 1LOWA 1TFOA 3MHEA 3OWYA 2L4VA 1A2VA 4HM6B 1QALA 3URPA 3IJEB 5M18A 4DKIA 1MWTA 1EKMA 3FH1A 4RNYA 3DGYA 2YX9A 3NQZA 5JBSA 1RGFA 3NV0B 3UL5A 4CCVA 3LH4A 5G2GA 3NXJA 2HMKB 2UGIA 1EUIC 5JPUA 1CYVA 1N9EA 3D9RA 3S27A 3Q90A 1UDII 2F99A 2BIRA 1IYYA 3VF1A 1RCLA 1ULIB 3BNEA 5IG4A 4X2OA 3X3XA 3CME3 4HOHA 3LTDA 1VQL3 3GAXA 3JUQA 3BNDA 2YFLB 1UGIA 2HOHA 3NM2A 5KP3A 1HZ1A 1I0VA 1OACA 1STFI 3NBRA 3ZG0A 4EXRA 1RMSA 3K63A 2IYJA 3EF8A 3ROBA 1AY7A 1IV7A 2O3OA 3EC9A 1BNJA 1W4NA 2Z6BA 4QWTA 5IG3A 4N6NB 1Q864 3D79A 1T2IA 3FGYA 2F4YA 3FG4A 1ROVA 2CX1A 3Q2PA 4JRFA 3N9HA 2H0IA 4AKZA 5BVBA 1RN1A 2BHMA 1YNVX 4KFDA 1CH0A 1FUSA 1JB5A 2HMMB 3GZRA 1RN4A 1FW7A 3MG2A 1AVKA 1DVDA 2CFGA 1U5OA 3K7CA 3I553 1UCKA 3DUKA 4NREA 1AVLA 5LC6A 5FW5A 1E3VA 1W2ZA 4OK0A 1BRSA 3KSED 5AEUB 3T8NA 1JN5A 1B21A 3E99A 1MNLA 4LZIA
chains in the Genus database with same CATH topology
3FF0A 3PCRA 1NB5I 3PCSA 4R80A 1N5HA 1Z1SA 2CWVA 2WO0A 1O7GB 2W04A 3EBTA 1TFKA 1VQ73 3A76A 1WTHA 2YFIB 3N54B 4HM0B 1OH0A 1ASKA 4J9AA 1KWIA 4KFFA 1N9JA 3CNMA 3KN4A 4ORLA 2GXFA 2HMNB 4HM2B 5D82A 1LXEA 3F14A 1IK3A 1VQM3 1NWWA 4KFEA 1S723 5EQLA 2XR8B 3WMDA 4R4KA 1UUVB 3GZXB 3DXOA 3UJMA 3B8LA 3SVAA 5IF6A 1DVCA 3SLUA 1W00A 2W9QA 1G96A 2CFWA 2CWTA 3GWRA 1CQSA 5D81A 3UB1A 1Q814 1GY5A 3FLJA 2XGLA 1VQ93 1OUNA 3SX1A 3X42A 4L8OA 2MC8A 2CK3H 3MPHA 4IPBA 3LYGA 2K54A 3MG3A 2OTL3 1ISKA 4N6UA 2BMRB 2W0QA 3OX9A 4XBYA 2BNGA 1S5AA 2QA43 4AEQA 2GU3A 3HI7A 3FSDA 3GZBA 3EHCA 1N8QA 3JUPA 2ZL8A 3HX8A 2R4IA 2QEX3 3Q1CA 4HZBB 3HZPA 1O7PB 2XF3A 3S29A 1Q824 3I563 3CD63 1AR0A 4WYKB 4WHAA 2E2UA 3V98A 4STDA 5LC7A 3X3ZA 2P38A 1GS3A 2CW9A 2I9WA 3F8HA 6STDA 4XB5A 2HMLB 4FMCA 1Y4KA 1VQK3 3FF2A 4HJLB 3LMLA 1VQP3 1O7NB 3DGMA 4FMAA 3CCL3 3WOEB 2XSHB 5AIFA 1IT7A 1PFPA 1YJW3 1SPUA 2GBWB 3ER7A 4G1MB 3MSOA 4HBRA 3MWZA 3F7XA 3X3YA 2F98A 1IQXA 3PGBA 3ECFA 1LVNA 3V92A 5IEOA 1W6CA 3DGNA 5IERA 3HIIA 2CFLA 1FA3A 1DYUA 3F9SA 1VQN3 1OF5B 2ML5A 3AMOA 1R4CA 1OGZA 2LYXA 4U13A 4HM4B 5KP1A 3LTBA 3CCJ3 4R9LA 3DGOA 1QJGA 3I0YA 4OUQA 1OGXA 3SOYA 1Q7Y4 2WGQA 1QAFA 5IG5A 3X40A 1WMOA 2B1XB 3MG1A 3CXC2 3DY5A 4LMIA 2P09A 2GEYA 3CCV3 1YGEA 4Q53A 2OCTA 5CK6A 1IQYA 1YHQ3 4TX4A 1ZO2A 2KCDA 2CKFB 2PNCA 8CHOA 2ZDJA 2OOVA 3OW22 3KZTA 1IVWA 2RSXA 4HYZA 1GY7A 1W02A 2O9UX 4KZ1A 4N3VA 3CCM3 1W2B2 2WOHA 1VQ63 1YVBI 4GL6A 2W56B 1A90A 4IIAA 2Z76A 4MMZB 3DZLA 1W01A 3HK4A 3NUVA 1U8CB 4H3UA 1M1XB 2FNQA 3NM7A 5IENA 3OWUA 5CLKA 2K0MA 2D1WA 1W6GA 2CFKA 1Q40A 2XRXB 1JKGB 1N5PA 3LZAA 3B7CA 3OWSA 2XSOB 1CEWI 1O7WB 5AYRB 4LSOA 5BXQA 3D3LA 4CDLA 1N8R4 1NDOB 2XGNA 3H3HA 3GZYB 3QK9A 4XDVA 1UI8A 2CC3A 5CF1A 1KSIA 3SEDA 2MF7A 2CHCA 2OWPA 3JVCA 2W2CA 1YI23 1MOLA 3NX0A 1OHOA 3BB9A 4O2HA 4GB5A 5KP4A 3U97A 1K734 3EN1B 1ZX2A 4WFOA 5AI1A 5IEPA 1M9GA 3FCSB 2XFTA 4N6MA 3PXMA 4HM1B 4EBGA 4O8SA 1FUWA 3K5TA 3NV0A 3G0KA 1KC84 1WNHA 1L5GB 5STDA 3JUNA 1STDA 3RGRA 2IUKA 3CC43 1D6YA 4EC6A 4HM5B 3CMA3 2P0MA 4FCMA 2BT3A 2BMQB 1ULJB 3EB8A 3H51A 3VGNA 1VQ43 3JUOA 1IQ8A 3EE1A 1M904 4MMYB 4WP5A 1T5YA 4KVHA 1LOXA 3G4S3 3BLZA 1TU5A 1RJOA 3DM8A 4EV2A 2BMOB 1K8A4 2XFSA 1FGMA 1YIJ3 3NHXA 1QVG2 2CG0A 1D6ZA 1JN5B 1K41A 1WQLB 1SQWA 4BTXA 3EJVA 2W03A 2W6JH 3TDGA 3OXAA 3LXUX 4HM8B 1KQS2 1DMNA 5HGRA 1TP6A 4IT7A 4XBTA 1RKYA 3G16A 3KIIA 3M8CA 1DMMA 4FMDA 2IMJA 4RZMA 1IV9A 3FG3A 4MJDA 3EX9A 3DMCA 4LGQA 4RNZA 3T8UA 4HKVB 1HU9A 1JB4A 3QRDA 3NQYA 5CF2A 3PS8A 3ALAA 1OCVA 3IPTA 1OHSA 1GY6A 5EVHA 3IMAB 4MEIA 3KKGA 1JNQA 3F8XA 3CU3A 1GD3A 3CCU3 5AIGA 4RBNA 1F8NA 1OHPA 3CNXA 5AEWB 1NJI4 1QMAA 1TIJA 1SIIA 4K1UA 3B4OA 4PEJA 4WWUC 1K9M4 2B24B 1K28A 1IVVA 4EV5A 3KFQC 4BTYA 2CWUA 4EYCA 3SOAA 2HMOB 5A0OB 1NU3A 3CCE3 2WGOA 4N6V0 2INXA 3MYTA 3HIGA 2KRTA 5DREA 2CG1A 3F7SA 4HZ9B 3U1WA 3VSYA 7STDA 1PU4A 3GRDA 1V74A 2LQVA 3FG1A 2GBXB 1VZZA 3BNBA 1GD4A 5CXOA 1US1A 3WDGB 3CCQ3 2W9PA 3V99A 1D6UA 2YFJB 2RGQA 3UL6A 1BUQA 2V1LA 3EBYA 1FGTA 3RDEA 2Y73A 2GEXA 4R9KA 3LOYA 2CFDA 4JF8A 2IA7A 3X41A 4NHFA 2CIUA 2Q07A 4WYKA 2A15A 2FXTA 3CCR3 5AIHA 4N6LA 1RRLA 4N6OB 2OQEC 1ROAA 2GU1A 2XEPA 4K90B 4O02B 2C10A 3F40A 5ELUA 2SBLA 1UW1A 5D83A 3LT9A 4HM7B 5JPPA 3G6E3 4K1VA 3RGAA 1J2BA 1O7MB 2KXGA 1W5ZA 1YIT3 4L8PA 3CC73 1GYBA 4HM3B 2RFRA 5TGNA 4AKYA 2QGUA 3AMOB 3CPW2 5AYSC 4FCJA 4J8TA 5I97A 1EG9B 1O7HB 4FR9A 2Z77A 1JB2A 3MKIA 2JQ5A 2C11A 1KD14 3FKAA 4XBXA 2CH9A 3CCS3 1UI7A 5IW9A 2Z7AA 2E2VA 2STDA 4N6TA 3S28A 3N8BA 3CC23 1SJWA 2P05A 4LEHA 4O3VA 3JUMA 1OF5A 2F86B 5IG0A 1SIHA 3DGLA 2QIYA 2PZVA 2XH9A 1E3RA 2P0XA 4X2HA 1FGQA 2WOFA 1C7HA 1VQ53 1FGOA 3LT8A 3O8YA 4FMBA 3KE7A 1AV4A 1DMQA 4L7KA 1YJN3 1VQ83 1YJ93 2OOVC 3LTCA 3G713 2HMJB 4MMXB 4BTWA 2FGTA 3OV4A 3T0UA 5FGOA 3B4PA 4FCZA 1JV2B 5EEOA 3NBBA 1LNHA 4HVNA 1HKXA 1WMNA 2JDIH 1FGRA 1RRHA 3LTAA 1NO3A 1VQO3 3L0RA 1A67A 1OPYA 3FZWA 3EN8A 1E97A 2BO9B 2RCDA 1JJ22 2UX0A 3CPOA 1Q42A 3J7Yd 1EQKA 1IVUA 1Q40B 3KSPA 3WA3A 3K0ZA 1UUWB 1W7CA 3STDA 1IVXA 3G8ZA 4R1KA 4XM4A 2W56A 1JRQA 5ELJA 4XDWA 2IUJA 3S67A 3WODG 3PYJA 1IU7A 3K9MC 3PZWA 4OVMA 3EQQB 3WOFB 1QVF2 2E2TA 4H61A 2D42A 2M7OA 2ML6A 1WMPA 1QAKA 3NBJA 1W6YA 4K61A 1TUHA 4I4KA 1IDPA 1IT8A 3SXXA 5AIIA 2OQEA 1M1K4 2OTJ3 5DRVA 1JKGA 1A2KA 3BNCA 1NB3I 1EA2A 2Y74A 3S5CA 1RN7A 3UNLA 3MHEA 1TFOA 3WA2X 3OWYA 4HM6B 4ZM8A 2L4VA 1A2VA 1CYUA 1QALA 3IJEB 3FH1A 1EKMA 4RNYA 2YX9A 3NQZA 5JBSA 3NV0B 3UL5A 4CCVA 3LH4A 5G2GA 3NXJA 2HMKB 5JPUA 1CYVA 1N9EA 3D9RA 3S27A 3Q90A 2F99A 3VF1A 1ULIB 3BNEA 5IG4A 4X2OA 3X3XA 3CME3 3LTDA 1VQL3 3GAXA 3JUQA 3BNDA 2YFLB 5KP3A 4EXRA 3NM2A 1OACA 1STFI 3NBRA 3K63A 3EF8A 3ROBA 1IV7A 2O3OA 3EC9A 1W4NA 2Z6BA 4QWTA 5IG3A 4N6NB 1Q864 3FGYA 3FG4A 1ROVA 3Q2PA 4JRFA 3N9HA 4AKZA 5BVBA 2BHMA 4KFDA 1JB5A 2HMMB 3GZRA 3MG2A 1AVKA 1DVDA 2CFGA 1U5OA 3K7CA 3I553 3DUKA 4NREA 1AVLA 5LC6A 5FW5A 1E3VA 1W2ZA 4OK0A 3KSED 5AEUB 3T8NA 1JN5A 3E99A 1MNLA 4LZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FF0 A;  1Z1S A;  1O7G B;  3EBT A;  3A76 A;  4HM0 B;  2YFI B;  1OH0 A;  1ASK A;  4J9A A;  3CNM A;  4ORL A;  2GXF A;  2HMN B;  4HM2 B;  5D82 A;  3F14 A;  1NWW A;  2XR8 B;  3WMD A;  1UUV B;  3GZX B;  3DXO A;  3UJM A;  3B8L A;  5IF6 A;  1W00 A;  3GWR A;  5D81 A;  1CQS A;  1GY5 A;  3FLJ A;  1OUN A;  4L8O A;  3LYG A;  2K54 A;  3MG3 A;  1ISK A;  2BMR B;  3OX9 A;  4XBY A;  2BNG A;  1S5A A;  3FSD A;  3GZB A;  3EHC A;  3JUP A;  3HX8 A;  2R4I A;  4HZB B;  3HZP A;  1O7P B;  1AR0 A;  4WYK B;  4STD A;  1GS3 A;  3F8H A;  2I9W A;  6STD A;  4XB5 A;  2HML B;  3FF2 A;  4HJL B;  1O7N B;  2XSH B;  5AIF A;  2GBW B;  3ER7 A;  3MSO A;  3F7X A;  2F98 A;  3ECF A;  5IEO A;  5IER A;  3F9S A;  1OF5 B;  4U13 A;  1OGZ A;  4HM4 B;  5KP1 A;  4R9L A;  1QJG A;  3I0Y A;  4OUQ A;  1OGX A;  3SOY A;  5IG5 A;  2B1X B;  3MG1 A;  4LMI A;  2GEY A;  4Q53 A;  5CK6 A;  1ZO2 A;  2CKF B;  8CHO A;  3KZT A;  1GY7 A;  1W02 A;  4N3V A;  4IIA A;  2Z76 A;  3DZL A;  1W01 A;  3HK4 A;  3NUV A;  4H3U A;  5IEN A;  3OWU A;  5CLK A;  1Q40 A;  2XRX B;  1JKG B;  3LZA A;  3B7C A;  3OWS A;  2XSO B;  1O7W B;  5BXQ A;  4CDL A;  1NDO B;  3H3H A;  3GZY B;  4XDV A;  5CF1 A;  3SED A;  2CHC A;  2OWP A;  2W2C A;  1OHO A;  3BB9 A;  5KP4 A;  4GB5 A;  3EN1 B;  1ZX2 A;  5AI1 A;  5IEP A;  4HM1 B;  3NV0 A;  3G0K A;  5STD A;  3JUN A;  1STD A;  3RGR A;  4HM5 B;  4FCM A;  2BMQ B;  1ULJ B;  3H51 A;  3VGN A;  3JUO A;  4WP5 A;  4KVH A;  3BLZ A;  3DM8 A;  2BMO B;  3NHX A;  1JN5 B;  1K41 A;  1WQL B;  3EJV A;  3OXA A;  4HM8 B;  1DMN A;  5HGR A;  1TP6 A;  4XBT A;  3G16 A;  3M8C A;  1DMM A;  2IMJ A;  4RZM A;  4MJD A;  3EX9 A;  3DMC A;  4LGQ A;  3T8U A;  4HKV B;  1JB4 A;  5CF2 A;  1OCV A;  3IPT A;  1OHS A;  1GY6 A;  5EVH A;  3KKG A;  3F8X A;  3CU3 A;  5AIG A;  1OHP A;  3CNX A;  5AEW B;  1QMA A;  4K1U A;  3B4O A;  4PEJ A;  4WWU C;  2B24 B;  3SOA A;  2HMO B;  1NU3 A;  2INX A;  3MYT A;  5DRE A;  3VSY A;  3F7S A;  4HZ9 B;  7STD A;  3GRD A;  2GBX B;  1VZZ A;  5CXO A;  2YFJ B;  2RGQ A;  1BUQ A;  3EBY A;  2GEX A;  4R9K A;  4WYK A;  2A15 A;  5AIH A;  3F40 A;  5D83 A;  4HM7 B;  5JPP A;  4K1V A;  3RGA A;  1O7M B;  4L8P A;  1GYB A;  4HM3 B;  2RFR A;  5TGN A;  2QGU A;  4FCJ A;  4J8T A;  1EG9 B;  1O7H B;  2Z77 A;  1JB2 A;  3MKI A;  2JQ5 A;  3FKA A;  4XBX A;  2Z7A A;  2STD A;  1SJW A;  4LEH A;  3JUM A;  1OF5 A;  2F86 B;  5IG0 A;  2QIY A;  2PZV A;  1E3R A;  4X2H A;  1C7H A;  3KE7 A;  4L7K A;  1DMQ A;  2HMJ B;  3OV4 A;  3B4P A;  4HVN A;  1HKX A;  1OPY A;  3FZW A;  3EN8 A;  1E97 A;  2RCD A;  2UX0 A;  3CPO A;  1Q42 A;  1Q40 B;  3KSP A;  3K0Z A;  1UUW B;  3STD A;  3G8Z A;  4R1K A;  4XM4 A;  4XDW A;  4OVM A;  3EQQ B;  1W6Y A;  1TUH A;  4I4K A;  1IDP A;  5AII A;  5DRV A;  1JKG A;  1A2K A;  1EA2 A;  3S5C A;  3UNL A;  3MHE A;  3OWY A;  4HM6 B;  3FH1 A;  3NV0 B;  5G2G A;  3NXJ A;  2HMK B;  5JPU A;  3D9R A;  3Q90 A;  2F99 A;  1ULI B;  5IG4 A;  4X2O A;  3JUQ A;  2YFL B;  5KP3 A;  3NM2 A;  3NBR A;  3EF8 A;  3ROB A;  3EC9 A;  5IG3 A;  3FGY A;  5BVB A;  1JB5 A;  2HMM B;  3GZR A;  3MG2 A;  3K7C A;  1U5O A;  3DUK A;  5FW5 A;  1E3V A;  5AEU B;  3T8N A;  1JN5 A;  3E99 A; 
#chains in the Genus database with same CATH topology
 3FF0 A;  3PCR A;  1NB5 I;  3PCS A;  4RNT A;  4R80 A;  1N5H A;  1Z1S A;  2CWV A;  2WO0 A;  1O7G B;  2W04 A;  2IY2 A;  1T2H A;  1TFK A;  3EBT A;  1VQ7 3;  3A76 A;  1WTH A;  2YFI B;  3N54 B;  4HM0 B;  1OH0 A;  1ASK A;  4J9A A;  1KWI A;  3RNT A;  3D5G A;  1BSB A;  1N9J A;  3CNM A;  4KFF A;  3KN4 A;  4ORL A;  2GXF A;  2HMN B;  4HM2 B;  2KAA A;  3AHS A;  1BNF A;  5D82 A;  1LXE A;  2KF3 A;  2AAD A;  3F14 A;  1IK3 A;  4BL3 A;  1VQM 3;  1NWW A;  4KFE A;  1S72 3;  4LYL B;  5EQL A;  4J5K A;  1RCK A;  1JBT A;  2XR8 B;  2UUG C;  3WMD A;  1MWU A;  4R4K A;  1B27 A;  1BSE A;  1UUV B;  3GZX B;  1BSC A;  3DXO A;  3UJM A;  3B8L A;  3SVA A;  5IF6 A;  1DVC A;  3SLU A;  1W00 A;  2W9Q A;  1G96 A;  1RLS A;  2CFW A;  2CWT A;  1CQS A;  1TTO A;  1X1Y A;  3GWR A;  1B2U A;  5D81 A;  3UB1 A;  1GY5 A;  1Q81 4;  3FLJ A;  2XGL A;  1VQ9 3;  1OUN A;  3SX1 A;  3X42 A;  4L8O A;  2MC8 A;  2CK3 H;  3MPH A;  4IPB A;  3LYG A;  2K54 A;  3MG3 A;  3AGN A;  2OTL 3;  1ISK A;  3D4A A;  4N6U A;  1BNE A;  2BMR B;  2W0Q A;  3OX9 A;  3ZFZ A;  4BIR A;  1RSN A;  2BNG A;  1S5A A;  4XBY A;  4AEQ A;  2QA4 3;  2GU3 A;  3HI7 A;  3FSD A;  3GZB A;  3EHC A;  1N8Q A;  1GMP A;  3JUP A;  2ZL8 A;  3HX8 A;  1I3I A;  2R4I A;  1PYL A;  2QEX 3;  2H0H A;  3Q1C A;  4HZB B;  3HZP A;  1O7P B;  2XF3 A;  3S29 A;  1Q82 4;  3I56 3;  1Q7H A;  1I3F A;  3CD6 3;  1AR0 A;  4WYK B;  4WHA A;  3KCH A;  2E2U A;  3V98 A;  4STD A;  9RNT A;  6RNT A;  5LC7 A;  3X3Z A;  3D5I A;  2P38 A;  1GS3 A;  2CW9 A;  2I9W A;  1BRI A;  3F8H A;  6STD A;  4XB5 A;  2HML B;  4FMC A;  1Y4K A;  1VQK 3;  3FF2 A;  4HJL B;  3LML A;  1VQP 3;  1O7N B;  3DGM A;  4FMA A;  3CCL 3;  3WOE B;  1AQZ A;  1RGE A;  2XSH B;  1IT7 A;  1PFP A;  5AIF A;  1YJW 3;  1SPU A;  2GBW B;  4KT3 B;  3ER7 A;  4G1M B;  5G1L A;  3MSO A;  4HBR A;  3MWZ A;  3F7X A;  3X3Y A;  2F98 A;  1G0T A;  1IQX A;  3PGB A;  1T3B A;  3ECF A;  1LVN A;  3V92 A;  2CX0 A;  5IEO A;  1X1U A;  1W6C A;  3DGN A;  5IER A;  3HII A;  4CPK A;  2CFL A;  1MGR A;  1FA3 A;  1BU4 A;  3WHO A;  1BAO A;  1DYU A;  3F9S A;  1VQN 3;  1GOV A;  1OF5 B;  1Q9E A;  2ML5 A;  1R4C A;  1OGZ A;  2LYX A;  3AMO A;  4U13 A;  4HM4 B;  5KP1 A;  3LTB A;  1RGL A;  3CCJ 3;  4R9L A;  3DGO A;  1QJG A;  3I0Y A;  4OUQ A;  1OGX A;  2C4B A;  2RBI A;  3SOY A;  1Q7Y 4;  2WGQ A;  4ZM8 A;  1QAF A;  5IG5 A;  1UGH I;  3X40 A;  1WMO A;  1B20 A;  2B1X B;  3MG1 A;  3CXC 2;  3DY5 A;  3HOH A;  2KF6 A;  4LMI A;  2P09 A;  2GEY A;  3CCV 3;  1YGE A;  4Q53 A;  2OCT A;  5CK6 A;  1FYS A;  1BRN L;  1IQY A;  1YHQ 3;  4TX4 A;  1ZO2 A;  2KCD A;  2CKF B;  2PNC A;  8CHO A;  2ZDJ A;  2OOV A;  3OW2 2;  3KZT A;  1TJD A;  1IVW A;  2L1S A;  2RSX A;  4HYZ A;  1LQM B;  1GY7 A;  1W02 A;  2O9U X;  4KZ1 A;  4N3V A;  3CCM 3;  1W2B 2;  2WOH A;  1VQ6 3;  1YVB I;  1VQQ A;  2W56 B;  3Q3F A;  4GL6 A;  1A90 A;  4IIA A;  2Z76 A;  4MMZ B;  3DZL A;  1W01 A;  1BIR A;  3HK4 A;  1U8C B;  3NUV A;  4H3U A;  1M1X B;  3DH2 A;  2FNQ A;  3NM7 A;  5IEN A;  2BU4 A;  3OWU A;  1MWS A;  5CLK A;  2K0M A;  2D1W A;  1BGS A;  1W6G A;  2CFK A;  1BRG A;  1QVF 2;  1Q40 A;  2XRX B;  1JKG B;  1N5P A;  3LZA A;  3B7C A;  1GMR A;  3OWS A;  2XSO B;  1CEW I;  1O7W B;  5AYR B;  4LSO A;  5BXQ A;  3D3L A;  4CDL A;  1N8R 4;  4BL2 A;  1NDO B;  3WOF B;  2ZA4 A;  2XGN A;  3H3H A;  3GZY B;  3QK9 A;  4XDV A;  1CYU A;  1UI8 A;  2CC3 A;  5CF1 A;  1KSI A;  3SED A;  7STD A;  2MF7 A;  2CHC A;  1LNI A;  1B2M A;  2OWP A;  1RTU A;  3JVC A;  2W2C A;  1YI2 3;  1MOL A;  3NX0 A;  1OHO A;  1LOV A;  3BB9 A;  4O2H A;  4GB5 A;  5KP4 A;  3U97 A;  3BU4 A;  1K73 4;  3EN1 B;  1YGW A;  1ZX2 A;  1DET A;  5G1K A;  4WFO A;  4NPB A;  5AI1 A;  5IEP A;  5M19 A;  1RGK A;  1RGH A;  1M9G A;  1PY3 A;  1SAR A;  2XFT A;  3FCS B;  3PXM A;  4HM1 B;  4N6M A;  4EBG A;  4O8S A;  3ZG5 A;  1FUW A;  3K5T A;  3NV0 A;  3G0K A;  1KC8 4;  1WNH A;  1L5G B;  5STD A;  3JUN A;  1STD A;  5M1A A;  3RGR A;  4CJN A;  2IUK A;  3CC4 3;  1D6Y A;  4EC6 A;  4HM5 B;  3CMA 3;  2P0M A;  1I70 A;  1NNV A;  4FCM A;  2BT3 A;  1RNT A;  1ULJ B;  2BMQ B;  3EB8 A;  3H51 A;  1ZGX A;  3VGN A;  3JUO A;  1VQ4 3;  1IQ8 A;  3EE1 A;  1M90 4;  4MMY B;  4WP5 A;  1T5Y A;  4KVH A;  1LOX A;  3G4S 3;  2GSP A;  3BLZ A;  1HYF A;  3SYU A;  1TU5 A;  1RJO A;  3DM8 A;  4EV2 A;  2BMO B;  1X1W A;  1B2X A;  2XFS A;  1FGM A;  1K8A 4;  1YIJ 3;  1BAN A;  3NHX A;  1QVG 2;  1D6Z A;  2CG0 A;  1JN5 B;  1K41 A;  1WQL B;  1X1X A;  1SQW A;  1TRQ A;  4BTX A;  3EJV A;  1RHL A;  2W03 A;  2W6J H;  3TDG A;  3OXA A;  1BNI A;  3LXU X;  4HM8 B;  3WA2 X;  1KQS 2;  1RNB A;  1DMN A;  5HGR A;  1TP6 A;  4IT7 A;  4XBT A;  1RKY A;  3G16 A;  3KII A;  3M8C A;  1DMM A;  1V58 A;  4FMD A;  1FZU A;  1GSP A;  2IMJ A;  1B2S A;  4RZM A;  1IV9 A;  1MGW A;  3FG3 A;  4MJD A;  3EX9 A;  3DMC A;  4LGQ A;  2SAR A;  4RNZ A;  3T8U A;  5BU4 A;  4HKV B;  1HU9 A;  1JB4 A;  3QRD A;  3NQY A;  5CF2 A;  3PS8 A;  3ALA A;  1LOY A;  1BNR A;  1OCV A;  3IPT A;  1OHS A;  1GY6 A;  5EVH A;  3IMA B;  4MEI A;  3KKG A;  1JNQ A;  3F8X A;  3CU3 A;  1GD3 A;  3CCU 3;  2ZHX B;  5AIG A;  1JZD A;  6GSP A;  1I0X A;  4RBN A;  1F8N A;  1OHP A;  3CNX A;  5AEW B;  1MWR A;  1BVI A;  1NJI 4;  1QMA A;  2K3D A;  1TIJ A;  1SII A;  1BSD A;  4K1U A;  3B4O A;  4PEJ A;  4WWU C;  2F5M A;  1K9M 4;  2B24 B;  1K28 A;  1IVV A;  1I2G A;  4EV5 A;  3KFQ C;  4BTY A;  2CWU A;  4EYC A;  3SOA A;  2HMO B;  1BSA A;  5A0O B;  1NU3 A;  3CCE 3;  2WGO A;  4N6V 0;  1BRJ A;  2INX A;  1JBR A;  4ILF A;  3MYT A;  1BOX A;  3HIG A;  2KRT A;  5DRE A;  1RGC A;  2F56 A;  3F7S A;  1UUG B;  4HZ9 B;  2CG1 A;  3U1W A;  3GRD A;  3VSY A;  1V74 A;  2LQV A;  3FG1 A;  2KF5 A;  1JBS A;  2GBX B;  4OVM A;  1V57 A;  1VZZ A;  3BNB A;  1GD4 A;  5CXO A;  1US1 A;  3WDG B;  3CCQ 3;  2W9P A;  3V99 A;  1D6U A;  1EEJ A;  2YFJ B;  2RGQ A;  3UL6 A;  1BUQ A;  2V1L A;  3A5E A;  1GOU A;  3EBY A;  1FGT A;  3RDE A;  5BIR A;  2Y73 A;  7GSP A;  3WR2 A;  2GEX A;  4R9K A;  3LOY A;  1B3S A;  2CFD A;  4JF8 A;  2IA7 A;  3X41 A;  2H0G A;  4NHF A;  2CIU A;  2Q07 A;  4WYK A;  2A15 A;  2FXT A;  3CCR 3;  5AIH A;  4N6L A;  1RRL A;  4N6O B;  2OQE C;  1ROA A;  2GU1 A;  2XEP A;  1UCI A;  4K90 B;  4O02 B;  2AAE A;  2C10 A;  3F40 A;  5ELU A;  2SBL A;  1UW1 A;  1BRH A;  3AHW A;  5HOH A;  1BUJ A;  5D83 A;  3LT9 A;  4HM7 B;  2RNT A;  5JPP A;  3G6E 3;  4K1V A;  3RGA A;  1J2B A;  1O7M B;  3BIR A;  2KXG A;  1W5Z A;  1YIT 3;  4L8P A;  4GHO A;  3CC7 3;  1GYB A;  4HM3 B;  1R4Y A;  4GSP A;  2RFR A;  5TGN A;  4AKY A;  2QGU A;  3AMO B;  1ZS7 A;  3CPW 2;  5AYS C;  4J5G A;  4FCJ A;  1RDS A;  4J8T A;  5I97 A;  1EG9 B;  1O7H B;  4FR9 A;  2Z77 A;  2R41 A;  1JB2 A;  3MKI A;  2JQ5 A;  2C11 A;  1KD1 4;  3FKA A;  1B2Z A;  4XBX A;  2CH9 A;  3CCS 3;  1UI7 A;  5IW9 A;  1A2P A;  2Z7A A;  2E2V A;  2STD A;  4N6T A;  3S28 A;  3N8B A;  3CC2 3;  1SJW A;  2P05 A;  4LEH A;  4O3V A;  3JUM A;  1OF5 A;  2F86 B;  5IG0 A;  1SIH A;  3DGL A;  1BRK A;  2QIY A;  1PU4 A;  2PZV A;  2XH9 A;  1E3R A;  2P0X A;  4X2H A;  1FGQ A;  2WOF A;  1C7H A;  1VQ5 3;  1FGO A;  3LT8 A;  3O8Y A;  4FMB A;  3KE7 A;  1AV4 A;  1DMQ A;  4L7K A;  1YJN 3;  1VQ8 3;  1YJ9 3;  1JZO A;  2KF4 A;  2OOV C;  3LTC A;  3G71 3;  2HMJ B;  1YVS A;  4MMX B;  1GOY A;  4BTW A;  2FGT A;  1I2F A;  3OV4 A;  3T0U A;  5FGO A;  1LQG C;  3B4P A;  4FCZ A;  1JV2 B;  5EEO A;  3NBB A;  1LNH A;  4HVN A;  1HKX A;  1WMN A;  2JDI H;  1FGR A;  1RRH A;  3LTA A;  1NO3 A;  5RNT A;  1VQO 3;  3L0R A;  1A67 A;  1OPY A;  3FZW A;  3EN8 A;  1E97 A;  2BO9 B;  2RCD A;  4BU4 A;  4EW5 A;  2UX0 A;  3CPO A;  1JJ2 2;  1Q42 A;  1DE3 A;  3J7Y d;  1I2E A;  1GMQ A;  1EQK A;  1IVU A;  1Q40 B;  2F5W A;  3KSP A;  1G02 A;  3WA3 A;  3K0Z A;  1UUW B;  1W7C A;  3STD A;  7RNT A;  1IVX A;  3G8Z A;  4R1K A;  4XM4 A;  2W56 A;  1FUT A;  1C54 A;  1JRQ A;  3AGO A;  5ELJ A;  4XDW A;  5GSP A;  2IUJ A;  3S67 A;  3WOD G;  3PYJ A;  1IU7 A;  3K9M C;  1UCJ A;  3PZW A;  3EQQ B;  4I5Q A;  1TRP A;  2E2T A;  4H61 A;  2D42 A;  2J8X B;  1BNG A;  1WMP A;  1QAK A;  2M7O A;  1W6Y A;  2ML6 A;  1TUH A;  3NBJ A;  1IDP A;  1IT8 A;  4I4K A;  4K61 A;  4HAA A;  3SXX A;  5AII A;  2OQE A;  1LRA A;  1BNS A;  1M1K 4;  2OTJ 3;  5DRV A;  1JKG A;  1A2K A;  3GSP A;  8RNT A;  3BNC A;  1NB3 I;  1EA2 A;  2Y74 A;  3S5C A;  1RN7 A;  3UNL A;  1RGA A;  1RGG A;  1UCL A;  1I8V A;  1LOW A;  1TFO A;  3MHE A;  3OWY A;  2L4V A;  1A2V A;  4HM6 B;  1QAL A;  3URP A;  3IJE B;  5M18 A;  4DKI A;  1MWT A;  1EKM A;  3FH1 A;  4RNY A;  3DGY A;  2YX9 A;  3NQZ A;  5JBS A;  1RGF A;  3NV0 B;  3UL5 A;  4CCV A;  3LH4 A;  5G2G A;  3NXJ A;  2HMK B;  2UGI A;  1EUI C;  5JPU A;  1CYV A;  1N9E A;  3D9R A;  3S27 A;  3Q90 A;  1UDI I;  2F99 A;  2BIR A;  1IYY A;  3VF1 A;  1RCL A;  1ULI B;  3BNE A;  5IG4 A;  4X2O A;  3X3X A;  3CME 3;  4HOH A;  3LTD A;  1VQL 3;  3GAX A;  3JUQ A;  3BND A;  2YFL B;  1UGI A;  2HOH A;  3NM2 A;  5KP3 A;  1HZ1 A;  1I0V A;  1OAC A;  1STF I;  3NBR A;  3ZG0 A;  4EXR A;  1RMS A;  3K63 A;  2IYJ A;  3EF8 A;  3ROB A;  1AY7 A;  1IV7 A;  2O3O A;  3EC9 A;  1BNJ A;  1W4N A;  2Z6B A;  4QWT A;  5IG3 A;  4N6N B;  1Q86 4;  3D79 A;  1T2I A;  3FGY A;  2F4Y A;  3FG4 A;  1ROV A;  2CX1 A;  3Q2P A;  4JRF A;  3N9H A;  2H0I A;  4AKZ A;  5BVB A;  1RN1 A;  2BHM A;  1YNV X;  4KFD A;  1CH0 A;  1FUS A;  1JB5 A;  2HMM B;  3GZR A;  1RN4 A;  1FW7 A;  3MG2 A;  1AVK A;  1DVD A;  2CFG A;  1U5O A;  3K7C A;  3I55 3;  1UCK A;  3DUK A;  4NRE A;  1AVL A;  5LC6 A;  5FW5 A;  1E3V A;  1W2Z A;  4OK0 A;  1BRS A;  3KSE D;  5AEU B;  3T8N A;  1JN5 A;  1B21 A;  3E99 A;  1MNL A;  4LZI A; 
#chains in the Genus database with same CATH homology
 3FF0 A;  3PCR A;  1NB5 I;  3PCS A;  4R80 A;  1N5H A;  1Z1S A;  2CWV A;  2WO0 A;  1O7G B;  2W04 A;  3EBT A;  1TFK A;  1VQ7 3;  3A76 A;  1WTH A;  2YFI B;  3N54 B;  4HM0 B;  1OH0 A;  1ASK A;  4J9A A;  1KWI A;  4KFF A;  1N9J A;  3CNM A;  3KN4 A;  4ORL A;  2GXF A;  2HMN B;  4HM2 B;  5D82 A;  1LXE A;  3F14 A;  1IK3 A;  1VQM 3;  1NWW A;  4KFE A;  1S72 3;  5EQL A;  2XR8 B;  3WMD A;  4R4K A;  1UUV B;  3GZX B;  3DXO A;  3UJM A;  3B8L A;  3SVA A;  5IF6 A;  1DVC A;  3SLU A;  1W00 A;  2W9Q A;  1G96 A;  2CFW A;  2CWT A;  3GWR A;  1CQS A;  5D81 A;  3UB1 A;  1Q81 4;  1GY5 A;  3FLJ A;  2XGL A;  1VQ9 3;  1OUN A;  3SX1 A;  3X42 A;  4L8O A;  2MC8 A;  2CK3 H;  3MPH A;  4IPB A;  3LYG A;  2K54 A;  3MG3 A;  2OTL 3;  1ISK A;  4N6U A;  2BMR B;  2W0Q A;  3OX9 A;  4XBY A;  2BNG A;  1S5A A;  2QA4 3;  4AEQ A;  2GU3 A;  3HI7 A;  3FSD A;  3GZB A;  3EHC A;  1N8Q A;  3JUP A;  2ZL8 A;  3HX8 A;  2R4I A;  2QEX 3;  3Q1C A;  4HZB B;  3HZP A;  1O7P B;  2XF3 A;  3S29 A;  1Q82 4;  3I56 3;  3CD6 3;  1AR0 A;  4WYK B;  4WHA A;  2E2U A;  3V98 A;  4STD A;  5LC7 A;  3X3Z A;  2P38 A;  1GS3 A;  2CW9 A;  2I9W A;  3F8H A;  6STD A;  4XB5 A;  2HML B;  4FMC A;  1Y4K A;  1VQK 3;  3FF2 A;  4HJL B;  3LML A;  1VQP 3;  1O7N B;  3DGM A;  4FMA A;  3CCL 3;  3WOE B;  2XSH B;  5AIF A;  1IT7 A;  1PFP A;  1YJW 3;  1SPU A;  2GBW B;  3ER7 A;  4G1M B;  3MSO A;  4HBR A;  3MWZ A;  3F7X A;  3X3Y A;  2F98 A;  1IQX A;  3PGB A;  3ECF A;  1LVN A;  3V92 A;  5IEO A;  1W6C A;  3DGN A;  5IER A;  3HII A;  2CFL A;  1FA3 A;  1DYU A;  3F9S A;  1VQN 3;  1OF5 B;  2ML5 A;  3AMO A;  1R4C A;  1OGZ A;  2LYX A;  4U13 A;  4HM4 B;  5KP1 A;  3LTB A;  3CCJ 3;  4R9L A;  3DGO A;  1QJG A;  3I0Y A;  4OUQ A;  1OGX A;  3SOY A;  1Q7Y 4;  2WGQ A;  1QAF A;  5IG5 A;  3X40 A;  1WMO A;  2B1X B;  3MG1 A;  3CXC 2;  3DY5 A;  4LMI A;  2P09 A;  2GEY A;  3CCV 3;  1YGE A;  4Q53 A;  2OCT A;  5CK6 A;  1IQY A;  1YHQ 3;  4TX4 A;  1ZO2 A;  2KCD A;  2CKF B;  2PNC A;  8CHO A;  2ZDJ A;  2OOV A;  3OW2 2;  3KZT A;  1IVW A;  2RSX A;  4HYZ A;  1GY7 A;  1W02 A;  2O9U X;  4KZ1 A;  4N3V A;  3CCM 3;  1W2B 2;  2WOH A;  1VQ6 3;  1YVB I;  4GL6 A;  2W56 B;  1A90 A;  4IIA A;  2Z76 A;  4MMZ B;  3DZL A;  1W01 A;  3HK4 A;  3NUV A;  1U8C B;  4H3U A;  1M1X B;  2FNQ A;  3NM7 A;  5IEN A;  3OWU A;  5CLK A;  2K0M A;  2D1W A;  1W6G A;  2CFK A;  1Q40 A;  2XRX B;  1JKG B;  1N5P A;  3LZA A;  3B7C A;  3OWS A;  2XSO B;  1CEW I;  1O7W B;  5AYR B;  4LSO A;  5BXQ A;  3D3L A;  4CDL A;  1N8R 4;  1NDO B;  2XGN A;  3H3H A;  3GZY B;  3QK9 A;  4XDV A;  1UI8 A;  2CC3 A;  5CF1 A;  1KSI A;  3SED A;  2MF7 A;  2CHC A;  2OWP A;  3JVC A;  2W2C A;  1YI2 3;  1MOL A;  3NX0 A;  1OHO A;  3BB9 A;  4O2H A;  4GB5 A;  5KP4 A;  3U97 A;  1K73 4;  3EN1 B;  1ZX2 A;  4WFO A;  5AI1 A;  5IEP A;  1M9G A;  3FCS B;  2XFT A;  4N6M A;  3PXM A;  4HM1 B;  4EBG A;  4O8S A;  1FUW A;  3K5T A;  3NV0 A;  3G0K A;  1KC8 4;  1WNH A;  1L5G B;  5STD A;  3JUN A;  1STD A;  3RGR A;  2IUK A;  3CC4 3;  1D6Y A;  4EC6 A;  4HM5 B;  3CMA 3;  2P0M A;  4FCM A;  2BT3 A;  2BMQ B;  1ULJ B;  3EB8 A;  3H51 A;  3VGN A;  1VQ4 3;  3JUO A;  1IQ8 A;  3EE1 A;  1M90 4;  4MMY B;  4WP5 A;  1T5Y A;  4KVH A;  1LOX A;  3G4S 3;  3BLZ A;  1TU5 A;  1RJO A;  3DM8 A;  4EV2 A;  2BMO B;  1K8A 4;  2XFS A;  1FGM A;  1YIJ 3;  3NHX A;  1QVG 2;  2CG0 A;  1D6Z A;  1JN5 B;  1K41 A;  1WQL B;  1SQW A;  4BTX A;  3EJV A;  2W03 A;  2W6J H;  3TDG A;  3OXA A;  3LXU X;  4HM8 B;  1KQS 2;  1DMN A;  5HGR A;  1TP6 A;  4IT7 A;  4XBT A;  1RKY A;  3G16 A;  3KII A;  3M8C A;  1DMM A;  4FMD A;  2IMJ A;  4RZM A;  1IV9 A;  3FG3 A;  4MJD A;  3EX9 A;  3DMC A;  4LGQ A;  4RNZ A;  3T8U A;  4HKV B;  1HU9 A;  1JB4 A;  3QRD A;  3NQY A;  5CF2 A;  3PS8 A;  3ALA A;  1OCV A;  3IPT A;  1OHS A;  1GY6 A;  5EVH A;  3IMA B;  4MEI A;  3KKG A;  1JNQ A;  3F8X A;  3CU3 A;  1GD3 A;  3CCU 3;  5AIG A;  4RBN A;  1F8N A;  1OHP A;  3CNX A;  5AEW B;  1NJI 4;  1QMA A;  1TIJ A;  1SII A;  4K1U A;  3B4O A;  4PEJ A;  4WWU C;  1K9M 4;  2B24 B;  1K28 A;  1IVV A;  4EV5 A;  3KFQ C;  4BTY A;  2CWU A;  4EYC A;  3SOA A;  2HMO B;  5A0O B;  1NU3 A;  3CCE 3;  2WGO A;  4N6V 0;  2INX A;  3MYT A;  3HIG A;  2KRT A;  5DRE A;  2CG1 A;  3F7S A;  4HZ9 B;  3U1W A;  3VSY A;  7STD A;  1PU4 A;  3GRD A;  1V74 A;  2LQV A;  3FG1 A;  2GBX B;  1VZZ A;  3BNB A;  1GD4 A;  5CXO A;  1US1 A;  3WDG B;  3CCQ 3;  2W9P A;  3V99 A;  1D6U A;  2YFJ B;  2RGQ A;  3UL6 A;  1BUQ A;  2V1L A;  3EBY A;  1FGT A;  3RDE A;  2Y73 A;  2GEX A;  4R9K A;  3LOY A;  2CFD A;  4JF8 A;  2IA7 A;  3X41 A;  4NHF A;  2CIU A;  2Q07 A;  4WYK A;  2A15 A;  2FXT A;  3CCR 3;  5AIH A;  4N6L A;  1RRL A;  4N6O B;  2OQE C;  1ROA A;  2GU1 A;  2XEP A;  4K90 B;  4O02 B;  2C10 A;  3F40 A;  5ELU A;  2SBL A;  1UW1 A;  5D83 A;  3LT9 A;  4HM7 B;  5JPP A;  3G6E 3;  4K1V A;  3RGA A;  1J2B A;  1O7M B;  2KXG A;  1W5Z A;  1YIT 3;  4L8P A;  3CC7 3;  1GYB A;  4HM3 B;  2RFR A;  5TGN A;  4AKY A;  2QGU A;  3AMO B;  3CPW 2;  5AYS C;  4FCJ A;  4J8T A;  5I97 A;  1EG9 B;  1O7H B;  4FR9 A;  2Z77 A;  1JB2 A;  3MKI A;  2JQ5 A;  2C11 A;  1KD1 4;  3FKA A;  4XBX A;  2CH9 A;  3CCS 3;  1UI7 A;  5IW9 A;  2Z7A A;  2E2V A;  2STD A;  4N6T A;  3S28 A;  3N8B A;  3CC2 3;  1SJW A;  2P05 A;  4LEH A;  4O3V A;  3JUM A;  1OF5 A;  2F86 B;  5IG0 A;  1SIH A;  3DGL A;  2QIY A;  2PZV A;  2XH9 A;  1E3R A;  2P0X A;  4X2H A;  1FGQ A;  2WOF A;  1C7H A;  1VQ5 3;  1FGO A;  3LT8 A;  3O8Y A;  4FMB A;  3KE7 A;  1AV4 A;  1DMQ A;  4L7K A;  1YJN 3;  1VQ8 3;  1YJ9 3;  2OOV C;  3LTC A;  3G71 3;  2HMJ B;  4MMX B;  4BTW A;  2FGT A;  3OV4 A;  3T0U A;  5FGO A;  3B4P A;  4FCZ A;  1JV2 B;  5EEO A;  3NBB A;  1LNH A;  4HVN A;  1HKX A;  1WMN A;  2JDI H;  1FGR A;  1RRH A;  3LTA A;  1NO3 A;  1VQO 3;  3L0R A;  1A67 A;  1OPY A;  3FZW A;  3EN8 A;  1E97 A;  2BO9 B;  2RCD A;  1JJ2 2;  2UX0 A;  3CPO A;  1Q42 A;  3J7Y d;  1EQK A;  1IVU A;  1Q40 B;  3KSP A;  3WA3 A;  3K0Z A;  1UUW B;  1W7C A;  3STD A;  1IVX A;  3G8Z A;  4R1K A;  4XM4 A;  2W56 A;  1JRQ A;  5ELJ A;  4XDW A;  2IUJ A;  3S67 A;  3WOD G;  3PYJ A;  1IU7 A;  3K9M C;  3PZW A;  4OVM A;  3EQQ B;  3WOF B;  1QVF 2;  2E2T A;  4H61 A;  2D42 A;  2M7O A;  2ML6 A;  1WMP A;  1QAK A;  3NBJ A;  1W6Y A;  4K61 A;  1TUH A;  4I4K A;  1IDP A;  1IT8 A;  3SXX A;  5AII A;  2OQE A;  1M1K 4;  2OTJ 3;  5DRV A;  1JKG A;  1A2K A;  3BNC A;  1NB3 I;  1EA2 A;  2Y74 A;  3S5C A;  1RN7 A;  3UNL A;  3MHE A;  1TFO A;  3WA2 X;  3OWY A;  4HM6 B;  4ZM8 A;  2L4V A;  1A2V A;  1CYU A;  1QAL A;  3IJE B;  3FH1 A;  1EKM A;  4RNY A;  2YX9 A;  3NQZ A;  5JBS A;  3NV0 B;  3UL5 A;  4CCV A;  3LH4 A;  5G2G A;  3NXJ A;  2HMK B;  5JPU A;  1CYV A;  1N9E A;  3D9R A;  3S27 A;  3Q90 A;  2F99 A;  3VF1 A;  1ULI B;  3BNE A;  5IG4 A;  4X2O A;  3X3X A;  3CME 3;  3LTD A;  1VQL 3;  3GAX A;  3JUQ A;  3BND A;  2YFL B;  5KP3 A;  4EXR A;  3NM2 A;  1OAC A;  1STF I;  3NBR A;  3K63 A;  3EF8 A;  3ROB A;  1IV7 A;  2O3O A;  3EC9 A;  1W4N A;  2Z6B A;  4QWT A;  5IG3 A;  4N6N B;  1Q86 4;  3FGY A;  3FG4 A;  1ROV A;  3Q2P A;  4JRF A;  3N9H A;  4AKZ A;  5BVB A;  2BHM A;  4KFD A;  1JB5 A;  2HMM B;  3GZR A;  3MG2 A;  1AVK A;  1DVD A;  2CFG A;  1U5O A;  3K7C A;  3I55 3;  3DUK A;  4NRE A;  1AVL A;  5LC6 A;  5FW5 A;  1E3V A;  1W2Z A;  4OK0 A;  3KSE D;  5AEU B;  3T8N A;  1JN5 A;  3E99 A;  1MNL A;  4LZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...