3F9SA

Crystal structure of a putative polyketide cyclase (lferr_0659) from acidithiobacillus ferrooxidans atcc at 1.76 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
GMSISSKAKEILTQFTREVWSEGNIEASDKYIAPKYTVLHDPGDPWEGRELDVAGYKERVKTLRAAFPDQCFDIQGLFADGDAVVMTWLWTATHKEDIPGFPSTGKQIKMSGATVYYFDGNRLTGHWQITDRLGVYQQLRQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (AFE_2539) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 1.76 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans
total genus 44
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f9sA00
3HK4A 5AIGA 3OV4A 1OUNA 2HMJB 3HZPA 4IIAA 3FLJA 3SOAA 1O7PB 2F99A 3JUNA 5AI1A 3NBRA 3B8LA 1W00A 3BB9A 3GZBA 1GS3A 4J8TA 3B7CA 3KSPA 1JB5A 5IG0A 5JPUA 1EA2A 3EBTA 3VSYA 1O7MB 3NM2A 4XM4A 5IG5A 4LMIA 3F7SA 1U5OA 2HMOB 3OWUA 3B4PA 4L8OA 3G8ZA 2Z7AA 5D82A 2RGQA 4HM0B 2GXFA 1E97A 2RCDA 3GZXB 3MHEA 2CKFB 2HMLB 1OGZA 3UNLA 1E3RA 5IEOA 3EHCA 3STDA 2JQ5A 2UX0A 2XSHB 2YFIB 3OWSA 4K1UA 3DMCA 1AR0A 5HGRA 5IF6A 3ECFA 1ZO2A 4HVNA 1JKGA 3CNXA 4HM7B 3Q90A 2QIYA 3I0YA 2Z76A 1ZX2A 3MG1A 3FH1A 3F8HA 3T8NA 5DREA 4X2HA 5IENA 3S5CA 3EC9A 1ASKA 3FF2A 4U13A 3SEDA 5CF2A 1JB2A 2Z77A 2RFRA 4XBTA 3FKAA 4XDWA 4HM2B 3LZAA 4I4KA 4R9KA 4FCMA 4HM5B 2BMQB 3IPTA 3KZTA 4R9LA 4LEHA 3E99A 4HM4B 3MKIA 5CF1A 3KKGA 3KE7A 2W2CA 1OHSA 4N3VA 1K41A 1JKGB 2IMJA 4HM1B 5DRVA 4HJLB 5AEUB 3JUPA 4HM6B 2B1XB 3GRDA 1OGXA 6STDA 1IDPA 1OHPA 2PZVA 4HM8B 2HMMB 4ORLA 2K54A 3M8CA 1JN5A 3F40A 2STDA 5EVHA 2I9WA 1OF5A 3EX9A 1E3VA 5CXOA 8CHOA 5BVBA 1OH0A 3EQQB 3FSDA 3GZRA 3DUKA 3MYTA 4R1KA 4OVMA 5D83A 1C7HA 3JUMA 4HM3B 4Q53A 4STDA 5D81A 4CDLA 1O7GB 4MJDA 1O7NB 3UJMA 2HMKB 1DMQA 2HMNB 2YFLB 3CNMA 3G16A 4XBYA 5AIFA 4X2OA 1QJGA 4L8PA 1UUWB 4H3UA 4RZMA 3MG2A 1Z1SA 4HKVB 3RGRA 2XSOB 2BMRB 2A15A 1GY7A 4HZ9B 2GBWB 3DM8A 1ISKA 1JN5B 3WMDA 3F14A 3MG3A 1OF5B 3BLZA 3OXAA 3VGNA 1W6YA 3EF8A 1TP6A 1STDA 1OCVA 3EBYA 3H51A 5KP3A 3K0ZA 1NDOB 2BNGA 5JPPA 2F98A 3FZWA 4WYKA 3FGYA 5IG3A 1W02A 1OPYA 3ER7A 1VZZA 3CPOA 5IEPA 5CK6A 5AIHA 5TGNA 4J9AA 3EN8A 4XDVA 5STDA 1NWWA 1O7HB 3SOYA 4PEJA 3B4OA 1GYBA 3GWRA 4L7KA 3T8UA 3GZYB 4LGQA 5AIIA 1W01A 7STDA 5AEWB 5G2GA 3CU3A 1GY6A 3JUQA 3NV0A 1DMMA 3EN1B 1NU3A 4OUQA 4HZBB 4K1VA 4WP5A 5IERA 1HKXA 3HX8A 3RGAA 1Q40A 4GB5A 1A2KA 4WYKB 3ROBA 1TUHA 1EG9B 3OX9A 4XB5A 4KVHA 2R4IA 5CLKA 2B24B 1Q42A 3NXJA 1CQSA 3DZLA 2CHCA 1UUVB 1DMNA 1QMAA 2INXA 1SJWA 1OHOA 3LYGA 3F8XA 3DXOA 2QGUA 3MSOA 1O7WB 3NUVA 2BMOB 1BUQA 3FF0A 2GBXB 5BXQA 3K7CA 1GY5A 5KP1A 2GEYA 3EJVA 5FW5A 2F86B 3G0KA 3NHXA 1WQLB 2XRXB 3F9SA 2OWPA 2GEXA 1JB4A 3NV0B 3JUOA 3F7XA 5IG4A 4XBXA 3D9RA 1ULIB 3H3HA 5KP4A 1Q40B 3A76A 2XR8B 1S5AA 4WWUC 2YFJB 1ULJB 4FCJA 3OWYA
chains in the Genus database with same CATH superfamily
2KRTA 4NPBA 2BHMA 3V98A 3HK4A 1FYSA 5AIGA 1ROVA 7RNTA 3OV4A 1OUNA 4O3VA 6GSPA 2HMJB 3HZPA 1D6ZA 3CCU3 1FGOA 4AEQA 1N5PA 2E2VA 1STFI 1IQXA 4EXRA 4IIAA 1ROAA 1M904 1KQS2 4BIRA 1FGQA 3WODG 3FLJA 5EEOA 1D6YA 1BOXA 2W56B 1RDSA 4MMYB 3SOAA 3SLUA 1B20A 1O7PB 2WGQA 2F99A 3D3LA 1IYYA 1QAKA 3JUNA 3LT8A 5AI1A 3NBRA 1WMPA 3B8LA 1BSCA 1W00A 5BIRA 1FGTA 3BB9A 1NNVA 1RRLA 2CIUA 3GZBA 1GS3A 1BIRA 2H0IA 4J8TA 3WA2X 3B7CA 2PNCA 1JB5A 3KSPA 1W6GA 5IG0A 5JPUA 1EA2A 3LXUX 1M1XB 1X1XA 2RNTA 3EBTA 3VSYA 1OACA 1O7MB 1AVKA 3NM2A 3CPW2 2M7OA 3Q2PA 4ILFA 4XM4A 3AGOA 4LMIA 4BTXA 5IG5A 3F7SA 3SYUA 1JZDA 1U5OA 2HMOB 1RTUA 3OWUA 3B4PA 4L8OA 3G8ZA 1GOYA 2Z7AA 4HBRA 1LOWA 5D82A 2RGQA 1W7CA 1BGSA 1QVG2 3OW22 1UCKA 1BUJA 1X1WA 1FUWA 1FW7A 4HM0B 4RNTA 4EC6A 2GXFA 3ZG0A 1E97A 5M18A 1TIJA 2RCDA 3GZXB 1YIJ3 4FMBA 3MHEA 1GOVA 1MGRA 2CKFB 2HMLB 2W0QA 3O8YA 1W6CA 1OGZA 1MWRA 2CFWA 1E3RA 5IEOA 3UNLA 3EHCA 1YJ93 3STDA 2Y74A 1I3IA 4K90B 3PYJA 1BNRA 2JQ5A 2KXGA 2XH9A 2UX0A 1HZ1A 3V92A 4AKZA 1N8QA 3BNBA 2XSHB 4NHFA 2IA7A 1HU9A 2YFIB 2F5WA 3U1WA 2P05A 1IVWA 3OWSA 3DMCA 4K1UA 1AR0A 2CWVA 3S28A 4N6TA 1BRIA 3LTAA 1GOUA 4ZM8A 5HGRA 4HYZA 3ECFA 5IF6A 1DE3A 1ZO2A 4HVNA 1JKGA 2LYXA 2QA43 4MMZB 3CNXA 4FR9A 4HM7B 3X3XA 3Q90A 1CH0A 2QIYA 4J5GA 4R4KA 3I0YA 3PCSA 5M1AA 1M1K4 3LMLA 3KSED 2Z76A 1LOXA 2IUJA 1W5ZA 1I2EA 1B2SA 1MOLA 1ZX2A 1YVBI 1IVUA 2FXTA 3FH1A 3MG1A 1BRJA 3F8HA 5EQLA 2OTJ3 2KF4A 4IT7A 3T8NA 5DREA 5AYRB 2BIRA 3CC73 1RHLA 3MPHA 2KCDA 2QEX3 4X2HA 1B2MA 5IENA 1YGEA 2E2UA 2KF3A 1RGAA 1G02A 2CFKA 1ASKA 3EC9A 3S5CA 2CX0A 4GSPA 3FF2A 3HIIA 4N6NB 4U13A 1RSNA 3SEDA 1EUIC 5CF2A 3QK9A 1JB2A 1A2VA 2OOVC 1IU7A 3MWZA 2Z77A 1FUSA 1JBRA 2RFRA 1BAOA 4XBTA 4H61A 2CFLA 1RN4A 3FKAA 3K63A 4XDWA 5AYSC 1VQP3 4CCVA 2UUGC 4HOHA 3PZWA 4HM2B 1SIHA 2MF7A 2W04A 1YHQ3 3LZAA 3KFQC 1LOVA 4WFOA 1KSIA 1VQ73 3LTDA 4I4KA 2RSXA 3X40A 3FCSB 4N6OB 4R9KA 4FCMA 1Y4KA 1B3SA 4BU4A 1KD14 4HM5B 1UW1A 2OOVA 1WTHA 2BMQB 2XFTA 3GSPA 4JF8A 1FUTA 3IPTA 1I2GA 1RGKA 3KZTA 5FGOA 2P0XA 1GSPA 3UL6A 1VQO3 4R9LA 1I0VA 3D5IA 4LEHA 3SX1A 3E99A 4HM4B 2GU1A 3MKIA 3KKGA 3ZFZA 2J8XB 3BNDA 1EEJA 3KE7A 5CF1A 2W2CA 1IV9A 1OHSA 1R4CA 2SARA 4J5KA 4N3VA 5G1KA 3UB1A 1K41A 2CG0A 1JKGB 3SVAA 2C11A 1IVXA 2IMJA 3BIRA 1BRHA 4HM1B 2WOHA 1YJN3 1BNJA 1YGWA 2CX1A 5DRVA 1T2IA 2IY2A 2SBLA 1F8NA 4HJLB 1N5HA 1NB3I 3LH4A 5AEUB 1I3FA 3JUPA 4HM6B 1PFPA 9RNTA 2B1XB 3CC23 2ML6A 3GRDA 2H0HA 1OGXA 2OQEC 1UGHI 2IUKA 4MEIA 1B27A 6STDA 1IDPA 1IV7A 1OHPA 1LVNA 1FZUA 5JBSA 1IK3A 3AHSA 1YIT3 2PZVA 1BRGA 2CC3A 3EE1A 3IJEB 2HOHA 5G1LA 2W6JH 5I97A 4HM8B 3LT9A 3Q1CA 1LQMB 2HMMB 4ORLA 2O3OA 2Y73A 1LNHA 1UCJA 2K54A 1V58A 3LTCA 3M8CA 1JN5A 1I8VA 1T5YA 1YNVX 1BSBA 1BSEA 3F40A 2STDA 3NBBA 5EVHA 2I9WA 1OF5A 4WHAA 2F56A 1YJW3 2YX9A 4N6UA 4AKYA 2OQEA 2R41A 3CCL3 2IYJA 4FMDA 1K734 1VQ93 1BRKA 1Q864 1LNIA 4K61A 1TRPA 3EX9A 1E3VA 5CXOA 3QRDA 1IQYA 4BTWA 8CHOA 1JZOA 5BVBA 1OH0A 3EQQB 1R4YA 4GHOA 1K8A4 2P09A 3FSDA 1DYUA 1Q7Y4 4RBNA 4FCZA 3J7Yd 3GZRA 3N9HA 2CFDA 3DUKA 3MYTA 1VQ43 4FMAA 4R1KA 2L1SA 4OVMA 5D83A 2Q07A 1AQZA 4IPBA 1JBTA 1C7HA 3JUMA 1KWIA 1RGLA 4HM3B 4Q53A 4G1MB 4STDA 2CWTA 5D81A 1FA3A 3K5TA 4CDLA 1SIIA 1RMSA 5LC6A 4BL2A 1O7GB 3AMOA 3L0RA 4MJDA 4KFEA 3X3YA 4O02B 3AHWA 1SQWA 1O7NB 3UJMA 1AV4A 1UI8A 2HMKB 1D6UA 1DMQA 2HMNB 2YFLB 3CNMA 1PU4A 3EB8A 1K28A 1EKMA 3G16A 4XBYA 3KN4A 4KFFA 3CCE3 1J2BA 3DGLA 2E2TA 4EBGA 4KT3B 1BNGA 5AIFA 1IT7A 1SPUA 1G0TA 1NO3A 4X2OA 3S67A 1QJGA 1BNIA 1RGHA 4L8PA 1N8R4 1UUWB 2F5MA 4H3UA 1QALA 1VQL3 4OK0A 1DETA 1X1YA 4RZMA 3MG2A 3PCRA 3D5GA 1Z1SA 3IMAB 4HKVB 3RGRA 1WMOA 3I553 3D4AA 5BU4A 1BNFA 3G4S3 3CCJ3 1WMNA 2XSOB 2BMRB 2A15A 2BU4A 1GY7A 4HZ9B 1AY7A 2GBWB 5HOHA 1TTOA 3DM8A 3BU4A 1ISKA 2D1WA 2Z6BA 1HYFA 3WOEB 1JN5B 2ML5A 3WMDA 4EV5A 4TX4A 1UDII 3BNEA 3F14A 3MG3A 2W9PA 1OF5B 1UGIA 1RGFA 3BLZA 1LQGC 2C10A 3OXAA 5ELJA 7GSPA 3RDEA 3DGOA 3VGNA 3LTBA 1W6YA 2LQVA 3NX0A 1I2FA 1CYVA 2P0MA 3EF8A 3FG4A 1QAFA 1TP6A 1V74A 1U8CB 4N6MA 3SXXA 5ELUA 1I0XA 3CCQ3 1V57A 1RKYA 3CC43 1STDA 1OCVA 1GMPA 1ZGXA 2KF6A 3EBYA 2XFSA 4O2HA 1YI23 3H51A 4RNYA 5KP3A 2WGOA 1W4NA 3CCV3 1GD4A 3K0ZA 4NREA 3KIIA 1NDOB 3ZG5A 2BNGA 5JPPA 3CCM3 2CFGA 2F98A 8RNTA 1Q7HA 2D42A 3FZWA 3UL5A 2C4BA 4WYKA 1QVF2 3N8BA 1Q9EA 2CK3H 3G713 3FGYA 3TDGA 5IG3A 4RNZA 3CCR3 1NB5I 1PYLA 4MMXB 4KFDA 3AMOB 3BNCA 1W02A 1FGRA 2BT3A 3CXC2 1MWSA 1BSAA 1RLSA 1OPYA 1UI7A 1JV2B 3ER7A 1VZZA 1UUGB 2FGTA 1RN1A 2ZA4A 3CPOA 5IEPA 5CK6A 1BRSA 5AIHA 1LRAA 1RJOA 5TGNA 2KAAA 1MWTA 2RBIA 4J9AA 1RGGA 3CME3 3EN8A 4EV2A 4XDVA 4EW5A 5STDA 3WHOA 1SARA 1TRQA 4N6LA 1YVSA 3WDGB 1NWWA 2F4YA 1CEWI 1RGCA 5IW9A 1VQK3 1O7HB 2OCTA 3SOYA 1A67A 1JRQA 1B2XA 4PEJA 3T0UA 3DGYA 1C54A 3B4OA 1GYBA 1IT8A 1W2ZA 3FG1A 3PS8A 1S723 3V99A 2P38A 2BO9B 1LOYA 2O9UX 1FGMA 3D79A 1W2B2 1RCLA 3GWRA 3NQYA 4L7KA 1MNLA 3A5EA 4CPKA 1BNEA 4BTYA 4GL6A 3T8UA 3GZYB 3JVCA 4LGQA 5RNTA 3DGMA 1B2ZA 5AIIA 1W01A 3FG3A 7STDA 3X3ZA 1I70A 2XF3A 1UCLA 1TFOA 2UGIA 3Q3FA 5G2GA 5AEWB 2FNQA 1GY6A 2CH9A 3CU3A 1TFKA 3JUQA 1CYUA 3NV0A 1DMMA 3EN1B 1NU3A 4OUQA 4HZBB 4K1VA 3PXMA 4WP5A 3WR2A 1HKXA 3HX8A 3NBJA 4I5QA 5IERA 4LSOA 4JRFA 1TU5A 3PGBA 1MGWA 3GAXA 3RGAA 3NQZA 1Q40A 2CG1A 1BU4A 4GB5A 2AAEA 2W03A 5LC7A 1A2KA 1BANA 4FMCA 1TUHA 4WYKB 3ROBA 1NJI4 1EG9B 3OX9A 1RCKA 4XB5A 4LYLB 2XGLA 1VQ63 1JBSA 4KVHA 2ZDJA 2R4IA 5CLKA 2B24B 3LOYA 2WOFA 3KCHA 1Q42A 2XGNA 1BRNL 3NXJA 1CQSA 2ZHXB 3DGNA 2W9QA 3U97A 1K9M4 1US1A 1JNQA 3K9MC 3DZLA 3HI7A 1L5GB 3AGNA 4HAAA 2CHCA 3VF1A 1UUVB 1DMNA 1QMAA 3WA3A 1VQ53 1JJ22 1RGEA 2AADA 1ZS7A 2INXA 5M19A 1A2PA 4EYCA 1VQM3 2W56A 1OHOA 1SJWA 1X1UA 3LYGA 4CJNA 3CCS3 3F8XA 3DXOA 1B2UA 1GD3A 2QGUA 2JDIH 2GSPA 1RNBA 3MSOA 1LXEA 1T3BA 3CMA3 1GMQA 1O7WB 3NUVA 2BMOB 4N6V0 1BUQA 3FF0A 4R80A 1VQ83 3WOFB 2GBXB 5GSPA 5BXQA 1UCIA 3K7CA 1GY5A 4LZIA 3DH2A 2K0MA 1VQN3 2WO0A 5KP1A 2GEYA 3EJVA 5FW5A 2MC8A 2KF5A 1EQKA 1N9JA 2F86B 2CW9A 1G96A 3G0KA 1N9EA 2CWUA 1WQLB 3NHXA 4O8SA 2XRXB 2H0GA 1Q814 4QWTA 6RNTA 1TJDA 1B21A 3F9SA 3NM7A 2OWPA 2GEXA 1JB4A 3CD63 1GMRA 2L4VA 1PY3A 3NV0B 3HIGA 1MWUA 1IVVA 3I563 3G6E3 1BSDA 1RRHA 1DVDA 3JUOA 1M9GA 1WNHA 1IQ8A 3F7XA 5IG4A 4XBXA 4DKIA 1DVCA 3D9RA 1ULIB 3H3HA 5KP4A 1Q40B 4KZ1A 3URPA 3X41A 3ALAA 3N54B 4BL3A 1VQQA 1AVLA 3A76A 3S27A 1T2HA 1RNTA 2ZL8A 2XR8B 1S5AA 2XEPA 3RNTA 1BNSA 2V1LA 1Q824 3S29A 4WWUC 2YFJB 1KC84 2K3DA 1A90A 1ULJB 4FCJA 3HOHA 2GU3A 1BVIA 3DY5A 1RN7A 3OWYA 5A0OB 3X42A 2OTL3
chains in the Genus database with same CATH topology
2KRTA 2BHMA 3V98A 3HK4A 5AIGA 1ROVA 3OV4A 1OUNA 4O3VA 2HMJB 3HZPA 1D6ZA 3CCU3 1FGOA 4AEQA 1N5PA 2E2VA 1STFI 1IQXA 4EXRA 4IIAA 1ROAA 1M904 1KQS2 1FGQA 3WODG 3FLJA 5EEOA 1D6YA 2W56B 3SOAA 4MMYB 3SLUA 1O7PB 2WGQA 2F99A 3D3LA 1QAKA 3JUNA 3LT8A 5AI1A 3NBRA 1WMPA 3B8LA 1W00A 1FGTA 3BB9A 1RRLA 2CIUA 3GZBA 1GS3A 4J8TA 3WA2X 3B7CA 2PNCA 1JB5A 3KSPA 1W6GA 5IG0A 5JPUA 1EA2A 3LXUX 1M1XB 3EBTA 3VSYA 1OACA 1O7MB 1AVKA 3NM2A 3CPW2 2M7OA 3Q2PA 4XM4A 5IG5A 4LMIA 4BTXA 3F7SA 1U5OA 2HMOB 3OWUA 3B4PA 4L8OA 3G8ZA 2Z7AA 4HBRA 5D82A 2RGQA 1W7CA 1QVG2 3OW22 1FUWA 4HM0B 4EC6A 2GXFA 1E97A 1TIJA 2RCDA 3GZXB 1YIJ3 4FMBA 3MHEA 2CKFB 2HMLB 2W0QA 3O8YA 1W6CA 1OGZA 2CFWA 3UNLA 1E3RA 5IEOA 1YJ93 3EHCA 3STDA 2Y74A 4K90B 3PYJA 2JQ5A 2KXGA 2XH9A 2UX0A 3V92A 4AKZA 1N8QA 3BNBA 2XSHB 4NHFA 2IA7A 1HU9A 2YFIB 3U1WA 2P05A 1IVWA 3OWSA 3DMCA 4K1UA 1AR0A 2CWVA 3S28A 4N6TA 3LTAA 4ZM8A 5HGRA 4HYZA 3ECFA 5IF6A 1ZO2A 4HVNA 1JKGA 2LYXA 2QA43 4MMZB 3CNXA 4FR9A 4HM7B 3X3XA 3Q90A 2QIYA 4R4KA 1M1K4 3I0YA 3PCSA 3LMLA 3KSED 2Z76A 1LOXA 2IUJA 1W5ZA 1MOLA 1ZX2A 2FXTA 1YVBI 1IVUA 3MG1A 3FH1A 5EQLA 3F8HA 2OTJ3 4IT7A 3T8NA 5DREA 5AYRB 3CC73 3MPHA 2KCDA 2QEX3 4X2HA 5IENA 1YGEA 2E2UA 3S5CA 2CFKA 1ASKA 3EC9A 3FF2A 3HIIA 4N6NB 4U13A 3SEDA 5CF2A 3QK9A 1JB2A 1A2VA 2OOVC 1IU7A 3MWZA 2Z77A 2RFRA 4XBTA 4H61A 2CFLA 3FKAA 3K63A 4XDWA 5AYSC 1VQP3 4CCVA 1YHQ3 3PZWA 4HM2B 2W04A 1SIHA 2MF7A 3LZAA 3KFQC 4WFOA 1KSIA 1VQ73 3LTDA 4I4KA 2RSXA 3X40A 3FCSB 4N6OB 4R9KA 4FCMA 1Y4KA 1KD14 4HM5B 1UW1A 2OOVA 1WTHA 2BMQB 2XFTA 4JF8A 3IPTA 3KZTA 5FGOA 2P0XA 3UL6A 1VQO3 4R9LA 4LEHA 3SX1A 3E99A 4HM4B 2GU1A 3MKIA 3KKGA 5CF1A 3BNDA 3KE7A 2W2CA 1IV9A 1OHSA 1R4CA 4N3VA 3UB1A 1K41A 2CG0A 1JKGB 3SVAA 2C11A 1IVXA 2IMJA 4HM1B 2WOHA 1YJN3 5DRVA 2SBLA 1F8NA 4HJLB 1N5HA 1NB3I 3LH4A 5AEUB 3JUPA 4HM6B 1PFPA 2B1XB 3CC23 2ML6A 3GRDA 2OQEC 1OGXA 2IUKA 6STDA 4MEIA 1IDPA 1IV7A 1OHPA 1LVNA 5JBSA 1IK3A 1YIT3 2PZVA 2CC3A 3IJEB 3EE1A 2W6JH 5I97A 4HM8B 3LT9A 3Q1CA 2HMMB 4ORLA 2O3OA 2Y73A 1LNHA 2K54A 3LTCA 3M8CA 1JN5A 1T5YA 3F40A 2STDA 3NBBA 5EVHA 2I9WA 1OF5A 4WHAA 1YJW3 2YX9A 4N6UA 4AKYA 2OQEA 3CCL3 4FMDA 1K734 1VQ93 1Q864 4K61A 3EX9A 1E3VA 5CXOA 3QRDA 1IQYA 4BTWA 8CHOA 5BVBA 1OH0A 3EQQB 1K8A4 2P09A 3FSDA 1DYUA 1Q7Y4 4RBNA 4FCZA 3J7Yd 3GZRA 3N9HA 2CFDA 3DUKA 3MYTA 1VQ43 4FMAA 4R1KA 4OVMA 5D83A 2Q07A 4IPBA 1C7HA 3JUMA 1KWIA 4HM3B 4Q53A 4G1MB 4STDA 2CWTA 5D81A 1FA3A 3K5TA 4CDLA 1SIIA 5LC6A 1O7GB 3AMOA 3L0RA 4MJDA 4KFEA 3X3YA 4O02B 1SQWA 1O7NB 3UJMA 1AV4A 1UI8A 2HMKB 1D6UA 1DMQA 2HMNB 2YFLB 3CNMA 1PU4A 3EB8A 1K28A 1EKMA 3G16A 4XBYA 3KN4A 4KFFA 3CCE3 1J2BA 3DGLA 2E2TA 4EBGA 5AIFA 1IT7A 1SPUA 1NO3A 3S67A 4X2OA 1QJGA 4L8PA 1N8R4 1UUWB 4H3UA 1QALA 1VQL3 4OK0A 4RZMA 3MG2A 3PCRA 1Z1SA 3IMAB 4HKVB 3RGRA 1WMOA 3I553 3G4S3 3CCJ3 1WMNA 2XSOB 2BMRB 2A15A 1GY7A 4HZ9B 2GBWB 3DM8A 1ISKA 2D1WA 2Z6BA 3WOEB 1JN5B 2ML5A 3WMDA 4EV5A 4TX4A 3BNEA 3F14A 3MG3A 2W9PA 1OF5B 3BLZA 2C10A 3OXAA 5ELJA 3RDEA 3DGOA 3VGNA 3LTBA 1W6YA 2LQVA 3NX0A 3FG4A 1CYVA 2P0MA 3EF8A 3SXXA 1QAFA 1TP6A 1V74A 1U8CB 4N6MA 5ELUA 3CCQ3 1RKYA 3CC43 1STDA 1OCVA 1YI23 3EBYA 2XFSA 4O2HA 3H51A 4RNYA 5KP3A 2WGOA 1W4NA 3CCV3 1GD4A 3K0ZA 4NREA 3KIIA 1NDOB 2BNGA 5JPPA 3CCM3 2CFGA 2F98A 3UL5A 2D42A 3FZWA 1QVF2 4WYKA 3N8BA 2CK3H 3G713 3FGYA 3TDGA 5IG3A 4RNZA 3CCR3 1NB5I 4MMXB 4KFDA 3AMOB 3BNCA 1W02A 1FGRA 2BT3A 3CXC2 1OPYA 1UI7A 1JV2B 3ER7A 1VZZA 2FGTA 3CPOA 5IEPA 5CK6A 5AIHA 1RJOA 5TGNA 4J9AA 3CME3 3EN8A 4EV2A 4XDVA 5STDA 4N6LA 3WDGB 1NWWA 1CEWI 5IW9A 1VQK3 1O7HB 2OCTA 3SOYA 1A67A 1JRQA 4PEJA 3T0UA 3B4OA 1GYBA 1IT8A 1W2ZA 3FG1A 3PS8A 1S723 3V99A 2P38A 2BO9B 2O9UX 1FGMA 1W2B2 3GWRA 3NQYA 4L7KA 1MNLA 4BTYA 4GL6A 3T8UA 3GZYB 3JVCA 4LGQA 3DGMA 5AIIA 1W01A 3FG3A 7STDA 3X3ZA 2XF3A 1TFOA 5AEWB 5G2GA 2FNQA 1GY6A 2CH9A 3CU3A 1TFKA 3JUQA 1CYUA 3NV0A 1DMMA 3EN1B 1NU3A 4OUQA 4HZBB 4K1VA 3PXMA 4WP5A 5IERA 1HKXA 3HX8A 3NBJA 4LSOA 4JRFA 1TU5A 3PGBA 3GAXA 3RGAA 3NQZA 1Q40A 2CG1A 4GB5A 2W03A 5LC7A 1A2KA 4FMCA 4WYKB 1TUHA 3ROBA 1NJI4 1EG9B 3OX9A 4XB5A 2XGLA 1VQ63 4KVHA 2ZDJA 2R4IA 5CLKA 2B24B 3LOYA 2WOFA 1Q42A 2XGNA 3NXJA 1CQSA 3DGNA 2W9QA 3U97A 1K9M4 1US1A 1JNQA 3K9MC 3DZLA 3HI7A 1L5GB 2CHCA 3VF1A 1UUVB 1DMNA 1QMAA 3WA3A 1VQ53 1JJ22 2INXA 4EYCA 1VQM3 2W56A 1OHOA 1SJWA 3CCS3 3LYGA 3F8XA 3DXOA 1GD3A 2QGUA 2JDIH 3MSOA 1LXEA 3CMA3 1O7WB 3NUVA 2BMOB 4N6V0 1BUQA 3FF0A 4R80A 1VQ83 3WOFB 2GBXB 5BXQA 3K7CA 1GY5A 4LZIA 2K0MA 1VQN3 2WO0A 5KP1A 2GEYA 3EJVA 5FW5A 2MC8A 1EQKA 1N9JA 2F86B 2CW9A 1G96A 3G0KA 1N9EA 2CWUA 1WQLB 3NHXA 4O8SA 2XRXB 1Q814 4QWTA 3F9SA 3NM7A 2OWPA 2GEXA 1JB4A 3CD63 2L4VA 3NV0B 3HIGA 3I563 1IVVA 3G6E3 1RRHA 1DVDA 3JUOA 1M9GA 1WNHA 1IQ8A 3F7XA 5IG4A 4XBXA 1DVCA 3D9RA 1ULIB 3H3HA 5KP4A 1Q40B 4KZ1A 3X41A 3ALAA 3N54B 3S27A 1AVLA 3A76A 2ZL8A 2XR8B 1S5AA 2XEPA 2V1LA 1Q824 3S29A 4WWUC 2YFJB 1KC84 1A90A 1ULJB 4FCJA 2GU3A 3DY5A 1RN7A 3OWYA 5A0OB 3X42A 2OTL3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HK4 A;  5AIG A;  3OV4 A;  1OUN A;  2HMJ B;  3HZP A;  4IIA A;  3FLJ A;  3SOA A;  1O7P B;  2F99 A;  3JUN A;  5AI1 A;  3NBR A;  3B8L A;  1W00 A;  3BB9 A;  3GZB A;  1GS3 A;  4J8T A;  3B7C A;  3KSP A;  1JB5 A;  5IG0 A;  5JPU A;  1EA2 A;  3EBT A;  3VSY A;  1O7M B;  3NM2 A;  4XM4 A;  5IG5 A;  4LMI A;  3F7S A;  1U5O A;  2HMO B;  3OWU A;  3B4P A;  4L8O A;  3G8Z A;  2Z7A A;  5D82 A;  2RGQ A;  4HM0 B;  2GXF A;  1E97 A;  2RCD A;  3GZX B;  3MHE A;  2CKF B;  2HML B;  1OGZ A;  3UNL A;  1E3R A;  5IEO A;  3EHC A;  3STD A;  2JQ5 A;  2UX0 A;  2XSH B;  2YFI B;  3OWS A;  4K1U A;  3DMC A;  1AR0 A;  5HGR A;  5IF6 A;  3ECF A;  1ZO2 A;  4HVN A;  1JKG A;  3CNX A;  4HM7 B;  3Q90 A;  2QIY A;  3I0Y A;  2Z76 A;  1ZX2 A;  3MG1 A;  3FH1 A;  3F8H A;  3T8N A;  5DRE A;  4X2H A;  5IEN A;  3S5C A;  3EC9 A;  1ASK A;  3FF2 A;  4U13 A;  3SED A;  5CF2 A;  1JB2 A;  2Z77 A;  2RFR A;  4XBT A;  3FKA A;  4XDW A;  4HM2 B;  3LZA A;  4I4K A;  4R9K A;  4FCM A;  4HM5 B;  2BMQ B;  3IPT A;  3KZT A;  4R9L A;  4LEH A;  3E99 A;  4HM4 B;  3MKI A;  5CF1 A;  3KKG A;  3KE7 A;  2W2C A;  1OHS A;  4N3V A;  1K41 A;  1JKG B;  2IMJ A;  4HM1 B;  5DRV A;  4HJL B;  5AEU B;  3JUP A;  4HM6 B;  2B1X B;  3GRD A;  1OGX A;  6STD A;  1IDP A;  1OHP A;  2PZV A;  4HM8 B;  2HMM B;  4ORL A;  2K54 A;  3M8C A;  1JN5 A;  3F40 A;  2STD A;  5EVH A;  2I9W A;  1OF5 A;  3EX9 A;  1E3V A;  5CXO A;  8CHO A;  5BVB A;  1OH0 A;  3EQQ B;  3FSD A;  3GZR A;  3DUK A;  3MYT A;  4R1K A;  4OVM A;  5D83 A;  1C7H A;  3JUM A;  4HM3 B;  4Q53 A;  4STD A;  5D81 A;  4CDL A;  1O7G B;  4MJD A;  1O7N B;  3UJM A;  2HMK B;  1DMQ A;  2HMN B;  2YFL B;  3CNM A;  3G16 A;  4XBY A;  5AIF A;  4X2O A;  1QJG A;  4L8P A;  1UUW B;  4H3U A;  4RZM A;  3MG2 A;  1Z1S A;  4HKV B;  3RGR A;  2XSO B;  2BMR B;  2A15 A;  1GY7 A;  4HZ9 B;  2GBW B;  3DM8 A;  1ISK A;  1JN5 B;  3WMD A;  3F14 A;  3MG3 A;  1OF5 B;  3BLZ A;  3OXA A;  3VGN A;  1W6Y A;  3EF8 A;  1TP6 A;  1STD A;  1OCV A;  3EBY A;  3H51 A;  5KP3 A;  3K0Z A;  1NDO B;  2BNG A;  5JPP A;  2F98 A;  3FZW A;  4WYK A;  3FGY A;  5IG3 A;  1W02 A;  1OPY A;  3ER7 A;  1VZZ A;  3CPO A;  5IEP A;  5CK6 A;  5AIH A;  5TGN A;  4J9A A;  3EN8 A;  4XDV A;  5STD A;  1NWW A;  1O7H B;  3SOY A;  4PEJ A;  3B4O A;  1GYB A;  3GWR A;  4L7K A;  3T8U A;  3GZY B;  4LGQ A;  5AII A;  1W01 A;  7STD A;  5AEW B;  5G2G A;  3CU3 A;  1GY6 A;  3JUQ A;  3NV0 A;  1DMM A;  3EN1 B;  1NU3 A;  4OUQ A;  4HZB B;  4K1V A;  4WP5 A;  5IER A;  1HKX A;  3HX8 A;  3RGA A;  1Q40 A;  4GB5 A;  1A2K A;  4WYK B;  3ROB A;  1TUH A;  1EG9 B;  3OX9 A;  4XB5 A;  4KVH A;  2R4I A;  5CLK A;  2B24 B;  1Q42 A;  3NXJ A;  1CQS A;  3DZL A;  2CHC A;  1UUV B;  1DMN A;  1QMA A;  2INX A;  1SJW A;  1OHO A;  3LYG A;  3F8X A;  3DXO A;  2QGU A;  3MSO A;  1O7W B;  3NUV A;  2BMO B;  1BUQ A;  3FF0 A;  2GBX B;  5BXQ A;  3K7C A;  1GY5 A;  5KP1 A;  2GEY A;  3EJV A;  5FW5 A;  2F86 B;  3G0K A;  3NHX A;  1WQL B;  2XRX B;  3F9S A;  2OWP A;  2GEX A;  1JB4 A;  3NV0 B;  3JUO A;  3F7X A;  5IG4 A;  4XBX A;  3D9R A;  1ULI B;  3H3H A;  5KP4 A;  1Q40 B;  3A76 A;  2XR8 B;  1S5A A;  4WWU C;  2YFJ B;  1ULJ B;  4FCJ A;  3OWY A; 
#chains in the Genus database with same CATH topology
 2KRT A;  4NPB A;  2BHM A;  3V98 A;  3HK4 A;  1FYS A;  5AIG A;  1ROV A;  7RNT A;  3OV4 A;  1OUN A;  4O3V A;  6GSP A;  2HMJ B;  3HZP A;  1D6Z A;  3CCU 3;  1FGO A;  4AEQ A;  1N5P A;  2E2V A;  1STF I;  1IQX A;  4EXR A;  4IIA A;  1ROA A;  1M90 4;  1KQS 2;  4BIR A;  1FGQ A;  3WOD G;  3FLJ A;  5EEO A;  1D6Y A;  1BOX A;  2W56 B;  1RDS A;  4MMY B;  3SOA A;  3SLU A;  1B20 A;  1O7P B;  2WGQ A;  2F99 A;  3D3L A;  1IYY A;  1QAK A;  3JUN A;  3LT8 A;  5AI1 A;  3NBR A;  1WMP A;  3B8L A;  1BSC A;  1W00 A;  5BIR A;  1FGT A;  3BB9 A;  1NNV A;  1RRL A;  2CIU A;  3GZB A;  1GS3 A;  1BIR A;  2H0I A;  4J8T A;  3WA2 X;  3B7C A;  2PNC A;  1JB5 A;  3KSP A;  1W6G A;  5IG0 A;  5JPU A;  1EA2 A;  3LXU X;  1M1X B;  1X1X A;  2RNT A;  3EBT A;  3VSY A;  1OAC A;  1O7M B;  1AVK A;  3NM2 A;  3CPW 2;  2M7O A;  3Q2P A;  4ILF A;  4XM4 A;  3AGO A;  4LMI A;  4BTX A;  5IG5 A;  3F7S A;  3SYU A;  1JZD A;  1U5O A;  2HMO B;  1RTU A;  3OWU A;  3B4P A;  4L8O A;  3G8Z A;  1GOY A;  2Z7A A;  4HBR A;  1LOW A;  5D82 A;  2RGQ A;  1W7C A;  1BGS A;  1QVG 2;  3OW2 2;  1UCK A;  1BUJ A;  1X1W A;  1FUW A;  1FW7 A;  4HM0 B;  4RNT A;  4EC6 A;  2GXF A;  3ZG0 A;  1E97 A;  5M18 A;  1TIJ A;  2RCD A;  3GZX B;  1YIJ 3;  4FMB A;  3MHE A;  1GOV A;  1MGR A;  2CKF B;  2HML B;  2W0Q A;  3O8Y A;  1W6C A;  1OGZ A;  1MWR A;  2CFW A;  1E3R A;  5IEO A;  3UNL A;  3EHC A;  1YJ9 3;  3STD A;  2Y74 A;  1I3I A;  4K90 B;  3PYJ A;  1BNR A;  2JQ5 A;  2KXG A;  2XH9 A;  2UX0 A;  1HZ1 A;  3V92 A;  4AKZ A;  1N8Q A;  3BNB A;  2XSH B;  4NHF A;  2IA7 A;  1HU9 A;  2YFI B;  2F5W A;  3U1W A;  2P05 A;  1IVW A;  3OWS A;  3DMC A;  4K1U A;  1AR0 A;  2CWV A;  3S28 A;  4N6T A;  1BRI A;  3LTA A;  1GOU A;  4ZM8 A;  5HGR A;  4HYZ A;  3ECF A;  5IF6 A;  1DE3 A;  1ZO2 A;  4HVN A;  1JKG A;  2LYX A;  2QA4 3;  4MMZ B;  3CNX A;  4FR9 A;  4HM7 B;  3X3X A;  3Q90 A;  1CH0 A;  2QIY A;  4J5G A;  4R4K A;  3I0Y A;  3PCS A;  5M1A A;  1M1K 4;  3LML A;  3KSE D;  2Z76 A;  1LOX A;  2IUJ A;  1W5Z A;  1I2E A;  1B2S A;  1MOL A;  1ZX2 A;  1YVB I;  1IVU A;  2FXT A;  3FH1 A;  3MG1 A;  1BRJ A;  3F8H A;  5EQL A;  2OTJ 3;  2KF4 A;  4IT7 A;  3T8N A;  5DRE A;  5AYR B;  2BIR A;  3CC7 3;  1RHL A;  3MPH A;  2KCD A;  2QEX 3;  4X2H A;  1B2M A;  5IEN A;  1YGE A;  2E2U A;  2KF3 A;  1RGA A;  1G02 A;  2CFK A;  1ASK A;  3EC9 A;  3S5C A;  2CX0 A;  4GSP A;  3FF2 A;  3HII A;  4N6N B;  4U13 A;  1RSN A;  3SED A;  1EUI C;  5CF2 A;  3QK9 A;  1JB2 A;  1A2V A;  2OOV C;  1IU7 A;  3MWZ A;  2Z77 A;  1FUS A;  1JBR A;  2RFR A;  1BAO A;  4XBT A;  4H61 A;  2CFL A;  1RN4 A;  3FKA A;  3K63 A;  4XDW A;  5AYS C;  1VQP 3;  4CCV A;  2UUG C;  4HOH A;  3PZW A;  4HM2 B;  1SIH A;  2MF7 A;  2W04 A;  1YHQ 3;  3LZA A;  3KFQ C;  1LOV A;  4WFO A;  1KSI A;  1VQ7 3;  3LTD A;  4I4K A;  2RSX A;  3X40 A;  3FCS B;  4N6O B;  4R9K A;  4FCM A;  1Y4K A;  1B3S A;  4BU4 A;  1KD1 4;  4HM5 B;  1UW1 A;  2OOV A;  1WTH A;  2BMQ B;  2XFT A;  3GSP A;  4JF8 A;  1FUT A;  3IPT A;  1I2G A;  1RGK A;  3KZT A;  5FGO A;  2P0X A;  1GSP A;  3UL6 A;  1VQO 3;  4R9L A;  1I0V A;  3D5I A;  4LEH A;  3SX1 A;  3E99 A;  4HM4 B;  2GU1 A;  3MKI A;  3KKG A;  3ZFZ A;  2J8X B;  3BND A;  1EEJ A;  3KE7 A;  5CF1 A;  2W2C A;  1IV9 A;  1OHS A;  1R4C A;  2SAR A;  4J5K A;  4N3V A;  5G1K A;  3UB1 A;  1K41 A;  2CG0 A;  1JKG B;  3SVA A;  2C11 A;  1IVX A;  2IMJ A;  3BIR A;  1BRH A;  4HM1 B;  2WOH A;  1YJN 3;  1BNJ A;  1YGW A;  2CX1 A;  5DRV A;  1T2I A;  2IY2 A;  2SBL A;  1F8N A;  4HJL B;  1N5H A;  1NB3 I;  3LH4 A;  5AEU B;  1I3F A;  3JUP A;  4HM6 B;  1PFP A;  9RNT A;  2B1X B;  3CC2 3;  2ML6 A;  3GRD A;  2H0H A;  1OGX A;  2OQE C;  1UGH I;  2IUK A;  4MEI A;  1B27 A;  6STD A;  1IDP A;  1IV7 A;  1OHP A;  1LVN A;  1FZU A;  5JBS A;  1IK3 A;  3AHS A;  1YIT 3;  2PZV A;  1BRG A;  2CC3 A;  3EE1 A;  3IJE B;  2HOH A;  5G1L A;  2W6J H;  5I97 A;  4HM8 B;  3LT9 A;  3Q1C A;  1LQM B;  2HMM B;  4ORL A;  2O3O A;  2Y73 A;  1LNH A;  1UCJ A;  2K54 A;  1V58 A;  3LTC A;  3M8C A;  1JN5 A;  1I8V A;  1T5Y A;  1YNV X;  1BSB A;  1BSE A;  3F40 A;  2STD A;  3NBB A;  5EVH A;  2I9W A;  1OF5 A;  4WHA A;  2F56 A;  1YJW 3;  2YX9 A;  4N6U A;  4AKY A;  2OQE A;  2R41 A;  3CCL 3;  2IYJ A;  4FMD A;  1K73 4;  1VQ9 3;  1BRK A;  1Q86 4;  1LNI A;  4K61 A;  1TRP A;  3EX9 A;  1E3V A;  5CXO A;  3QRD A;  1IQY A;  4BTW A;  8CHO A;  1JZO A;  5BVB A;  1OH0 A;  3EQQ B;  1R4Y A;  4GHO A;  1K8A 4;  2P09 A;  3FSD A;  1DYU A;  1Q7Y 4;  4RBN A;  4FCZ A;  3J7Y d;  3GZR A;  3N9H A;  2CFD A;  3DUK A;  3MYT A;  1VQ4 3;  4FMA A;  4R1K A;  2L1S A;  4OVM A;  5D83 A;  2Q07 A;  1AQZ A;  4IPB A;  1JBT A;  1C7H A;  3JUM A;  1KWI A;  1RGL A;  4HM3 B;  4Q53 A;  4G1M B;  4STD A;  2CWT A;  5D81 A;  1FA3 A;  3K5T A;  4CDL A;  1SII A;  1RMS A;  5LC6 A;  4BL2 A;  1O7G B;  3AMO A;  3L0R A;  4MJD A;  4KFE A;  3X3Y A;  4O02 B;  3AHW A;  1SQW A;  1O7N B;  3UJM A;  1AV4 A;  1UI8 A;  2HMK B;  1D6U A;  1DMQ A;  2HMN B;  2YFL B;  3CNM A;  1PU4 A;  3EB8 A;  1K28 A;  1EKM A;  3G16 A;  4XBY A;  3KN4 A;  4KFF A;  3CCE 3;  1J2B A;  3DGL A;  2E2T A;  4EBG A;  4KT3 B;  1BNG A;  5AIF A;  1IT7 A;  1SPU A;  1G0T A;  1NO3 A;  4X2O A;  3S67 A;  1QJG A;  1BNI A;  1RGH A;  4L8P A;  1N8R 4;  1UUW B;  2F5M A;  4H3U A;  1QAL A;  1VQL 3;  4OK0 A;  1DET A;  1X1Y A;  4RZM A;  3MG2 A;  3PCR A;  3D5G A;  1Z1S A;  3IMA B;  4HKV B;  3RGR A;  1WMO A;  3I55 3;  3D4A A;  5BU4 A;  1BNF A;  3G4S 3;  3CCJ 3;  1WMN A;  2XSO B;  2BMR B;  2A15 A;  2BU4 A;  1GY7 A;  4HZ9 B;  1AY7 A;  2GBW B;  5HOH A;  1TTO A;  3DM8 A;  3BU4 A;  1ISK A;  2D1W A;  2Z6B A;  1HYF A;  3WOE B;  1JN5 B;  2ML5 A;  3WMD A;  4EV5 A;  4TX4 A;  1UDI I;  3BNE A;  3F14 A;  3MG3 A;  2W9P A;  1OF5 B;  1UGI A;  1RGF A;  3BLZ A;  1LQG C;  2C10 A;  3OXA A;  5ELJ A;  7GSP A;  3RDE A;  3DGO A;  3VGN A;  3LTB A;  1W6Y A;  2LQV A;  3NX0 A;  1I2F A;  1CYV A;  2P0M A;  3EF8 A;  3FG4 A;  1QAF A;  1TP6 A;  1V74 A;  1U8C B;  4N6M A;  3SXX A;  5ELU A;  1I0X A;  3CCQ 3;  1V57 A;  1RKY A;  3CC4 3;  1STD A;  1OCV A;  1GMP A;  1ZGX A;  2KF6 A;  3EBY A;  2XFS A;  4O2H A;  1YI2 3;  3H51 A;  4RNY A;  5KP3 A;  2WGO A;  1W4N A;  3CCV 3;  1GD4 A;  3K0Z A;  4NRE A;  3KII A;  1NDO B;  3ZG5 A;  2BNG A;  5JPP A;  3CCM 3;  2CFG A;  2F98 A;  8RNT A;  1Q7H A;  2D42 A;  3FZW A;  3UL5 A;  2C4B A;  4WYK A;  1QVF 2;  3N8B A;  1Q9E A;  2CK3 H;  3G71 3;  3FGY A;  3TDG A;  5IG3 A;  4RNZ A;  3CCR 3;  1NB5 I;  1PYL A;  4MMX B;  4KFD A;  3AMO B;  3BNC A;  1W02 A;  1FGR A;  2BT3 A;  3CXC 2;  1MWS A;  1BSA A;  1RLS A;  1OPY A;  1UI7 A;  1JV2 B;  3ER7 A;  1VZZ A;  1UUG B;  2FGT A;  1RN1 A;  2ZA4 A;  3CPO A;  5IEP A;  5CK6 A;  1BRS A;  5AIH A;  1LRA A;  1RJO A;  5TGN A;  2KAA A;  1MWT A;  2RBI A;  4J9A A;  1RGG A;  3CME 3;  3EN8 A;  4EV2 A;  4XDV A;  4EW5 A;  5STD A;  3WHO A;  1SAR A;  1TRQ A;  4N6L A;  1YVS A;  3WDG B;  1NWW A;  2F4Y A;  1CEW I;  1RGC A;  5IW9 A;  1VQK 3;  1O7H B;  2OCT A;  3SOY A;  1A67 A;  1JRQ A;  1B2X A;  4PEJ A;  3T0U A;  3DGY A;  1C54 A;  3B4O A;  1GYB A;  1IT8 A;  1W2Z A;  3FG1 A;  3PS8 A;  1S72 3;  3V99 A;  2P38 A;  2BO9 B;  1LOY A;  2O9U X;  1FGM A;  3D79 A;  1W2B 2;  1RCL A;  3GWR A;  3NQY A;  4L7K A;  1MNL A;  3A5E A;  4CPK A;  1BNE A;  4BTY A;  4GL6 A;  3T8U A;  3GZY B;  3JVC A;  4LGQ A;  5RNT A;  3DGM A;  1B2Z A;  5AII A;  1W01 A;  3FG3 A;  7STD A;  3X3Z A;  1I70 A;  2XF3 A;  1UCL A;  1TFO A;  2UGI A;  3Q3F A;  5G2G A;  5AEW B;  2FNQ A;  1GY6 A;  2CH9 A;  3CU3 A;  1TFK A;  3JUQ A;  1CYU A;  3NV0 A;  1DMM A;  3EN1 B;  1NU3 A;  4OUQ A;  4HZB B;  4K1V A;  3PXM A;  4WP5 A;  3WR2 A;  1HKX A;  3HX8 A;  3NBJ A;  4I5Q A;  5IER A;  4LSO A;  4JRF A;  1TU5 A;  3PGB A;  1MGW A;  3GAX A;  3RGA A;  3NQZ A;  1Q40 A;  2CG1 A;  1BU4 A;  4GB5 A;  2AAE A;  2W03 A;  5LC7 A;  1A2K A;  1BAN A;  4FMC A;  1TUH A;  4WYK B;  3ROB A;  1NJI 4;  1EG9 B;  3OX9 A;  1RCK A;  4XB5 A;  4LYL B;  2XGL A;  1VQ6 3;  1JBS A;  4KVH A;  2ZDJ A;  2R4I A;  5CLK A;  2B24 B;  3LOY A;  2WOF A;  3KCH A;  1Q42 A;  2XGN A;  1BRN L;  3NXJ A;  1CQS A;  2ZHX B;  3DGN A;  2W9Q A;  3U97 A;  1K9M 4;  1US1 A;  1JNQ A;  3K9M C;  3DZL A;  3HI7 A;  1L5G B;  3AGN A;  4HAA A;  2CHC A;  3VF1 A;  1UUV B;  1DMN A;  1QMA A;  3WA3 A;  1VQ5 3;  1JJ2 2;  1RGE A;  2AAD A;  1ZS7 A;  2INX A;  5M19 A;  1A2P A;  4EYC A;  1VQM 3;  2W56 A;  1OHO A;  1SJW A;  1X1U A;  3LYG A;  4CJN A;  3CCS 3;  3F8X A;  3DXO A;  1B2U A;  1GD3 A;  2QGU A;  2JDI H;  2GSP A;  1RNB A;  3MSO A;  1LXE A;  1T3B A;  3CMA 3;  1GMQ A;  1O7W B;  3NUV A;  2BMO B;  4N6V 0;  1BUQ A;  3FF0 A;  4R80 A;  1VQ8 3;  3WOF B;  2GBX B;  5GSP A;  5BXQ A;  1UCI A;  3K7C A;  1GY5 A;  4LZI A;  3DH2 A;  2K0M A;  1VQN 3;  2WO0 A;  5KP1 A;  2GEY A;  3EJV A;  5FW5 A;  2MC8 A;  2KF5 A;  1EQK A;  1N9J A;  2F86 B;  2CW9 A;  1G96 A;  3G0K A;  1N9E A;  2CWU A;  1WQL B;  3NHX A;  4O8S A;  2XRX B;  2H0G A;  1Q81 4;  4QWT A;  6RNT A;  1TJD A;  1B21 A;  3F9S A;  3NM7 A;  2OWP A;  2GEX A;  1JB4 A;  3CD6 3;  1GMR A;  2L4V A;  1PY3 A;  3NV0 B;  3HIG A;  1MWU A;  1IVV A;  3I56 3;  3G6E 3;  1BSD A;  1RRH A;  1DVD A;  3JUO A;  1M9G A;  1WNH A;  1IQ8 A;  3F7X A;  5IG4 A;  4XBX A;  4DKI A;  1DVC A;  3D9R A;  1ULI B;  3H3H A;  5KP4 A;  1Q40 B;  4KZ1 A;  3URP A;  3X41 A;  3ALA A;  3N54 B;  4BL3 A;  1VQQ A;  1AVL A;  3A76 A;  3S27 A;  1T2H A;  1RNT A;  2ZL8 A;  2XR8 B;  1S5A A;  2XEP A;  3RNT A;  1BNS A;  2V1L A;  1Q82 4;  3S29 A;  4WWU C;  2YFJ B;  1KC8 4;  2K3D A;  1A90 A;  1ULJ B;  4FCJ A;  3HOH A;  2GU3 A;  1BVI A;  3DY5 A;  1RN7 A;  3OWY A;  5A0O B;  3X42 A;  2OTL 3; 
#chains in the Genus database with same CATH homology
 2KRT A;  2BHM A;  3V98 A;  3HK4 A;  5AIG A;  1ROV A;  3OV4 A;  1OUN A;  4O3V A;  2HMJ B;  3HZP A;  1D6Z A;  3CCU 3;  1FGO A;  4AEQ A;  1N5P A;  2E2V A;  1STF I;  1IQX A;  4EXR A;  4IIA A;  1ROA A;  1M90 4;  1KQS 2;  1FGQ A;  3WOD G;  3FLJ A;  5EEO A;  1D6Y A;  2W56 B;  3SOA A;  4MMY B;  3SLU A;  1O7P B;  2WGQ A;  2F99 A;  3D3L A;  1QAK A;  3JUN A;  3LT8 A;  5AI1 A;  3NBR A;  1WMP A;  3B8L A;  1W00 A;  1FGT A;  3BB9 A;  1RRL A;  2CIU A;  3GZB A;  1GS3 A;  4J8T A;  3WA2 X;  3B7C A;  2PNC A;  1JB5 A;  3KSP A;  1W6G A;  5IG0 A;  5JPU A;  1EA2 A;  3LXU X;  1M1X B;  3EBT A;  3VSY A;  1OAC A;  1O7M B;  1AVK A;  3NM2 A;  3CPW 2;  2M7O A;  3Q2P A;  4XM4 A;  5IG5 A;  4LMI A;  4BTX A;  3F7S A;  1U5O A;  2HMO B;  3OWU A;  3B4P A;  4L8O A;  3G8Z A;  2Z7A A;  4HBR A;  5D82 A;  2RGQ A;  1W7C A;  1QVG 2;  3OW2 2;  1FUW A;  4HM0 B;  4EC6 A;  2GXF A;  1E97 A;  1TIJ A;  2RCD A;  3GZX B;  1YIJ 3;  4FMB A;  3MHE A;  2CKF B;  2HML B;  2W0Q A;  3O8Y A;  1W6C A;  1OGZ A;  2CFW A;  3UNL A;  1E3R A;  5IEO A;  1YJ9 3;  3EHC A;  3STD A;  2Y74 A;  4K90 B;  3PYJ A;  2JQ5 A;  2KXG A;  2XH9 A;  2UX0 A;  3V92 A;  4AKZ A;  1N8Q A;  3BNB A;  2XSH B;  4NHF A;  2IA7 A;  1HU9 A;  2YFI B;  3U1W A;  2P05 A;  1IVW A;  3OWS A;  3DMC A;  4K1U A;  1AR0 A;  2CWV A;  3S28 A;  4N6T A;  3LTA A;  4ZM8 A;  5HGR A;  4HYZ A;  3ECF A;  5IF6 A;  1ZO2 A;  4HVN A;  1JKG A;  2LYX A;  2QA4 3;  4MMZ B;  3CNX A;  4FR9 A;  4HM7 B;  3X3X A;  3Q90 A;  2QIY A;  4R4K A;  1M1K 4;  3I0Y A;  3PCS A;  3LML A;  3KSE D;  2Z76 A;  1LOX A;  2IUJ A;  1W5Z A;  1MOL A;  1ZX2 A;  2FXT A;  1YVB I;  1IVU A;  3MG1 A;  3FH1 A;  5EQL A;  3F8H A;  2OTJ 3;  4IT7 A;  3T8N A;  5DRE A;  5AYR B;  3CC7 3;  3MPH A;  2KCD A;  2QEX 3;  4X2H A;  5IEN A;  1YGE A;  2E2U A;  3S5C A;  2CFK A;  1ASK A;  3EC9 A;  3FF2 A;  3HII A;  4N6N B;  4U13 A;  3SED A;  5CF2 A;  3QK9 A;  1JB2 A;  1A2V A;  2OOV C;  1IU7 A;  3MWZ A;  2Z77 A;  2RFR A;  4XBT A;  4H61 A;  2CFL A;  3FKA A;  3K63 A;  4XDW A;  5AYS C;  1VQP 3;  4CCV A;  1YHQ 3;  3PZW A;  4HM2 B;  2W04 A;  1SIH A;  2MF7 A;  3LZA A;  3KFQ C;  4WFO A;  1KSI A;  1VQ7 3;  3LTD A;  4I4K A;  2RSX A;  3X40 A;  3FCS B;  4N6O B;  4R9K A;  4FCM A;  1Y4K A;  1KD1 4;  4HM5 B;  1UW1 A;  2OOV A;  1WTH A;  2BMQ B;  2XFT A;  4JF8 A;  3IPT A;  3KZT A;  5FGO A;  2P0X A;  3UL6 A;  1VQO 3;  4R9L A;  4LEH A;  3SX1 A;  3E99 A;  4HM4 B;  2GU1 A;  3MKI A;  3KKG A;  5CF1 A;  3BND A;  3KE7 A;  2W2C A;  1IV9 A;  1OHS A;  1R4C A;  4N3V A;  3UB1 A;  1K41 A;  2CG0 A;  1JKG B;  3SVA A;  2C11 A;  1IVX A;  2IMJ A;  4HM1 B;  2WOH A;  1YJN 3;  5DRV A;  2SBL A;  1F8N A;  4HJL B;  1N5H A;  1NB3 I;  3LH4 A;  5AEU B;  3JUP A;  4HM6 B;  1PFP A;  2B1X B;  3CC2 3;  2ML6 A;  3GRD A;  2OQE C;  1OGX A;  2IUK A;  6STD A;  4MEI A;  1IDP A;  1IV7 A;  1OHP A;  1LVN A;  5JBS A;  1IK3 A;  1YIT 3;  2PZV A;  2CC3 A;  3IJE B;  3EE1 A;  2W6J H;  5I97 A;  4HM8 B;  3LT9 A;  3Q1C A;  2HMM B;  4ORL A;  2O3O A;  2Y73 A;  1LNH A;  2K54 A;  3LTC A;  3M8C A;  1JN5 A;  1T5Y A;  3F40 A;  2STD A;  3NBB A;  5EVH A;  2I9W A;  1OF5 A;  4WHA A;  1YJW 3;  2YX9 A;  4N6U A;  4AKY A;  2OQE A;  3CCL 3;  4FMD A;  1K73 4;  1VQ9 3;  1Q86 4;  4K61 A;  3EX9 A;  1E3V A;  5CXO A;  3QRD A;  1IQY A;  4BTW A;  8CHO A;  5BVB A;  1OH0 A;  3EQQ B;  1K8A 4;  2P09 A;  3FSD A;  1DYU A;  1Q7Y 4;  4RBN A;  4FCZ A;  3J7Y d;  3GZR A;  3N9H A;  2CFD A;  3DUK A;  3MYT A;  1VQ4 3;  4FMA A;  4R1K A;  4OVM A;  5D83 A;  2Q07 A;  4IPB A;  1C7H A;  3JUM A;  1KWI A;  4HM3 B;  4Q53 A;  4G1M B;  4STD A;  2CWT A;  5D81 A;  1FA3 A;  3K5T A;  4CDL A;  1SII A;  5LC6 A;  1O7G B;  3AMO A;  3L0R A;  4MJD A;  4KFE A;  3X3Y A;  4O02 B;  1SQW A;  1O7N B;  3UJM A;  1AV4 A;  1UI8 A;  2HMK B;  1D6U A;  1DMQ A;  2HMN B;  2YFL B;  3CNM A;  1PU4 A;  3EB8 A;  1K28 A;  1EKM A;  3G16 A;  4XBY A;  3KN4 A;  4KFF A;  3CCE 3;  1J2B A;  3DGL A;  2E2T A;  4EBG A;  5AIF A;  1IT7 A;  1SPU A;  1NO3 A;  3S67 A;  4X2O A;  1QJG A;  4L8P A;  1N8R 4;  1UUW B;  4H3U A;  1QAL A;  1VQL 3;  4OK0 A;  4RZM A;  3MG2 A;  3PCR A;  1Z1S A;  3IMA B;  4HKV B;  3RGR A;  1WMO A;  3I55 3;  3G4S 3;  3CCJ 3;  1WMN A;  2XSO B;  2BMR B;  2A15 A;  1GY7 A;  4HZ9 B;  2GBW B;  3DM8 A;  1ISK A;  2D1W A;  2Z6B A;  3WOE B;  1JN5 B;  2ML5 A;  3WMD A;  4EV5 A;  4TX4 A;  3BNE A;  3F14 A;  3MG3 A;  2W9P A;  1OF5 B;  3BLZ A;  2C10 A;  3OXA A;  5ELJ A;  3RDE A;  3DGO A;  3VGN A;  3LTB A;  1W6Y A;  2LQV A;  3NX0 A;  3FG4 A;  1CYV A;  2P0M A;  3EF8 A;  3SXX A;  1QAF A;  1TP6 A;  1V74 A;  1U8C B;  4N6M A;  5ELU A;  3CCQ 3;  1RKY A;  3CC4 3;  1STD A;  1OCV A;  1YI2 3;  3EBY A;  2XFS A;  4O2H A;  3H51 A;  4RNY A;  5KP3 A;  2WGO A;  1W4N A;  3CCV 3;  1GD4 A;  3K0Z A;  4NRE A;  3KII A;  1NDO B;  2BNG A;  5JPP A;  3CCM 3;  2CFG A;  2F98 A;  3UL5 A;  2D42 A;  3FZW A;  1QVF 2;  4WYK A;  3N8B A;  2CK3 H;  3G71 3;  3FGY A;  3TDG A;  5IG3 A;  4RNZ A;  3CCR 3;  1NB5 I;  4MMX B;  4KFD A;  3AMO B;  3BNC A;  1W02 A;  1FGR A;  2BT3 A;  3CXC 2;  1OPY A;  1UI7 A;  1JV2 B;  3ER7 A;  1VZZ A;  2FGT A;  3CPO A;  5IEP A;  5CK6 A;  5AIH A;  1RJO A;  5TGN A;  4J9A A;  3CME 3;  3EN8 A;  4EV2 A;  4XDV A;  5STD A;  4N6L A;  3WDG B;  1NWW A;  1CEW I;  5IW9 A;  1VQK 3;  1O7H B;  2OCT A;  3SOY A;  1A67 A;  1JRQ A;  4PEJ A;  3T0U A;  3B4O A;  1GYB A;  1IT8 A;  1W2Z A;  3FG1 A;  3PS8 A;  1S72 3;  3V99 A;  2P38 A;  2BO9 B;  2O9U X;  1FGM A;  1W2B 2;  3GWR A;  3NQY A;  4L7K A;  1MNL A;  4BTY A;  4GL6 A;  3T8U A;  3GZY B;  3JVC A;  4LGQ A;  3DGM A;  5AII A;  1W01 A;  3FG3 A;  7STD A;  3X3Z A;  2XF3 A;  1TFO A;  5AEW B;  5G2G A;  2FNQ A;  1GY6 A;  2CH9 A;  3CU3 A;  1TFK A;  3JUQ A;  1CYU A;  3NV0 A;  1DMM A;  3EN1 B;  1NU3 A;  4OUQ A;  4HZB B;  4K1V A;  3PXM A;  4WP5 A;  5IER A;  1HKX A;  3HX8 A;  3NBJ A;  4LSO A;  4JRF A;  1TU5 A;  3PGB A;  3GAX A;  3RGA A;  3NQZ A;  1Q40 A;  2CG1 A;  4GB5 A;  2W03 A;  5LC7 A;  1A2K A;  4FMC A;  4WYK B;  1TUH A;  3ROB A;  1NJI 4;  1EG9 B;  3OX9 A;  4XB5 A;  2XGL A;  1VQ6 3;  4KVH A;  2ZDJ A;  2R4I A;  5CLK A;  2B24 B;  3LOY A;  2WOF A;  1Q42 A;  2XGN A;  3NXJ A;  1CQS A;  3DGN A;  2W9Q A;  3U97 A;  1K9M 4;  1US1 A;  1JNQ A;  3K9M C;  3DZL A;  3HI7 A;  1L5G B;  2CHC A;  3VF1 A;  1UUV B;  1DMN A;  1QMA A;  3WA3 A;  1VQ5 3;  1JJ2 2;  2INX A;  4EYC A;  1VQM 3;  2W56 A;  1OHO A;  1SJW A;  3CCS 3;  3LYG A;  3F8X A;  3DXO A;  1GD3 A;  2QGU A;  2JDI H;  3MSO A;  1LXE A;  3CMA 3;  1O7W B;  3NUV A;  2BMO B;  4N6V 0;  1BUQ A;  3FF0 A;  4R80 A;  1VQ8 3;  3WOF B;  2GBX B;  5BXQ A;  3K7C A;  1GY5 A;  4LZI A;  2K0M A;  1VQN 3;  2WO0 A;  5KP1 A;  2GEY A;  3EJV A;  5FW5 A;  2MC8 A;  1EQK A;  1N9J A;  2F86 B;  2CW9 A;  1G96 A;  3G0K A;  1N9E A;  2CWU A;  1WQL B;  3NHX A;  4O8S A;  2XRX B;  1Q81 4;  4QWT A;  3F9S A;  3NM7 A;  2OWP A;  2GEX A;  1JB4 A;  3CD6 3;  2L4V A;  3NV0 B;  3HIG A;  3I56 3;  1IVV A;  3G6E 3;  1RRH A;  1DVD A;  3JUO A;  1M9G A;  1WNH A;  1IQ8 A;  3F7X A;  5IG4 A;  4XBX A;  1DVC A;  3D9R A;  1ULI B;  3H3H A;  5KP4 A;  1Q40 B;  4KZ1 A;  3X41 A;  3ALA A;  3N54 B;  3S27 A;  1AVL A;  3A76 A;  2ZL8 A;  2XR8 B;  1S5A A;  2XEP A;  2V1L A;  1Q82 4;  3S29 A;  4WWU C;  2YFJ B;  1KC8 4;  1A90 A;  1ULJ B;  4FCJ A;  2GU3 A;  3DY5 A;  1RN7 A;  3OWY A;  5A0O B;  3X42 A;  2OTL 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...