3F9SA

Crystal structure of a putative polyketide cyclase (lferr_0659) from acidithiobacillus ferrooxidans atcc at 1.76 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
143
structure length
143
Chain Sequence
GMSISSKAKEILTQFTREVWSEGNIEASDKYIAPKYTVLHDPGDPWEGRELDVAGYKERVKTLRAAFPDQCFDIQGLFADGDAVVMTWLWTATHKEDIPGFPSTGKQIKMSGATVYYFDGNRLTGHWQITDRLGVYQQLRQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative polyketide cyclase
publication title Crystal structure of putative polyketide cyclase (AFE_2539) from ACIDITHIOBACILLUS FERROOXIDANS NCIB8455 at 1.76 A resolution
rcsb
source organism Acidithiobacillus ferrooxidans
molecule tags Lyase
total genus 44
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3f9sA00
3OWUA 3STDA 3BB9A 5FW5A 4PEJA 3OX9A 1JN5A 2XSHB 5AIHA 1JB4A 1ZO2A 3NHXA 3GRDA 1S5AA 3F8HA 8CHOA 3NUVA 3GZRA 3T8NA 4K1VA 3T8UA 3CPOA 3OWSA 1O7NB 1Z1SA 3NM2A 4Q53A 3RGAA 3Q90A 1STDA 4WP5A 2YFLB 4HM8B 4J8TA 1EG9B 1W01A 3UNLA 5JPUA 2JQ5A 2K54A 4N3VA 4HKVB 2Z7AA 3F7SA 2B24B 3OV4A 1GY5A 3G16A 2A15A 1UUVB 1JN5B 2BMRB 1NDOB 1TP6A 2F99A 1GY7A 3G0KA 3F8XA 3B8LA 1DMQA 3EN8A 4FCMA 3MKIA 3I0YA 3GZBA 3ECFA 2XRXB 4LMIA 4CDLA 4HM7B 6STDA 3SEDA 3HK4A 5D83A 4I4KA 1NU3A 2GEXA 4LGQA 5IG4A 3DM8A 4K1UA 1U5OA 4XDWA 4MJDA 1IDPA 2RFRA 1WQLB 3BLZA 1A2KA 3FH1A 3OXAA 1SJWA 2W2CA 4J9AA 3H51A 3GZXB 4HM5B 5DRVA 3DUKA 2HMKB 3RGRA 4WWUC 1O7HB 1K41A 2HMNB 3NXJA 5D82A 2XR8B 1VZZA 3HX8A 2QGUA 1OCVA 2STDA 3CU3A 1GS3A 5CF1A 3E99A 3F9SA 5G2GA 3FGYA 3OWYA 1O7GB 2YFIB 3VSYA 3FZWA 3K7CA 4HZ9B 1OUNA 3HZPA 4U13A 3JUPA 2HMLB 3EHCA 2B1XB 2RCDA 3DZLA 1E97A 1ULJB 3S5CA 3MG1A 5HGRA 1W00A 1NWWA 3EJVA 2Z76A 2HMJB 2CKFB 4OVMA 1OHSA 4XDVA 2RGQA 3GWRA 3IPTA 3B4OA 2HMMB 5CXOA 3EBYA 3CNMA 3EC9A 3NBRA 1HKXA 3LYGA 5AIGA 3D9RA 1ISKA 2CHCA 5KP4A 3K0ZA 3F40A 2GBWB 3FSDA 1OF5A 3SOYA 2UX0A 3JUQA 3H3HA 5AI1A 3GZYB 3ROBA 3NV0A 2BMQB 4R1KA 4STDA 1OHOA 5IG3A 4ORLA 5AIFA 1Q42A 2F86B 4R9KA 4X2HA 4IIAA 5DREA 3KKGA 3F7XA 5D81A 3JUMA 3MSOA 3KSPA 5STDA 3FF2A 1W02A 1OHPA 5IERA 3DMCA 5EVHA 1ULIB 1JB5A 1EA2A 1TUHA 1ASKA 4HM0B 2HMOB 2OWPA 5AEWB 1OF5B 3EN1B 5IEOA 3SOAA 4HZBB 3JUOA 5IF6A 3MG3A 3FLJA 2I9WA 3MG2A 1OH0A 1O7PB 3NV0B 3WMDA 3A76A 4XBYA 1CQSA 4HM1B 3G8ZA 3CNXA 3JUNA 4XM4A 3DXOA 4X2OA 3FKAA 1DMMA 2GXFA 4XB5A 4HJLB 7STDA 5CLKA 4KVHA 4XBXA 3KZTA 1ZX2A 3F14A 5AEUB 4H3UA 3LZAA 1W6YA 4OUQA 4HM2B 1E3VA 3VGNA 1JKGA 1BUQA 3UJMA 5CF2A 4HM6B 2Z77A 3FF0A 5AIIA 4LEHA 1GY6A 5JPPA 5TGNA 5KP3A 3EQQB 4R9LA 4GB5A 1O7MB 1UUWB 2GEYA 1AR0A 3EF8A 5IENA 4HVNA 1Q40A 4WYKA 3EBTA 2INXA 4XBTA 5IEPA 3M8CA 1DMNA 5IG0A 2IMJA 2YFJB 1JKGB 3B7CA 1OPYA 2PZVA 1OGXA 5BVBA 3MYTA 5BXQA 3EX9A 4L8PA 1C7HA 2XSOB 4L8OA 3B4PA 4L7KA 5IG5A 5CK6A 3KE7A 4HM3B 5KP1A 3ER7A 1O7WB 2QIYA 4HM4B 3MHEA 1JB2A 4RZMA 1OGZA 1QJGA 2BNGA 4FCJA 2GBXB 1QMAA 2BMOB 2R4IA 1Q40B 4WYKB 1GYBA 2F98A 1E3RA
chains in the Genus database with same CATH superfamily
4MMZB 4NHFA 3OWUA 2CWVA 4R4KA 3STDA 1YJN3 1RGAA 3BB9A 1I3FA 1PY3A 3NBBA 5FW5A 1N5HA 1RMSA 5I97A 1LOWA 4PEJA 3OX9A 1JN5A 3S67A 2WGQA 2O9UX 2XSHB 1OACA 5EQLA 5AIHA 1JB4A 1LQGC 1RN4A 1ZO2A 3GRDA 3NHXA 1S5AA 8RNTA 3KFQC 2OQEC 3F8HA 8CHOA 2OCTA 1K734 1BNJA 1RRHA 5FGOA 3NUVA 1T2IA 1GOVA 1BNIA 1RN1A 3GZRA 3T8NA 4K1VA 2H0IA 1FUSA 1LOYA 2M7OA 4GSPA 3T8UA 1RHLA 3CCJ3 3CPOA 2OTL3 1Y4KA 3OWSA 1RDSA 3S27A 1BOXA 1QAKA 1B2MA 2XGLA 1O7NB 2GU3A 1Z1SA 4FMBA 3NM2A 1B3SA 3QRDA 1QAFA 2UUGC 3LTDA 4Q53A 4LZIA 1TRQA 1IQYA 3RGAA 3Q90A 1SPUA 2ML6A 1STDA 4WP5A 4MMYB 1S723 3N9HA 2YFLB 4HM8B 4J8TA 3X40A 1BANA 1EG9B 1W01A 2ZL8A 1B2XA 3PGBA 3UNLA 5JPUA 2JQ5A 1WMNA 2GSPA 1TJDA 2K54A 2W6JH 4N3VA 4HKVB 2Z7AA 3WDGB 3F7SA 6GSPA 1UCLA 2B24B 1B20A 1RGCA 3OV4A 3N54B 3FG1A 1X1YA 1YVSA 2K3DA 2O3OA 9RNTA 1A2PA 1GY5A 2XEPA 3O8YA 3G16A 3N8BA 4EV2A 3X42A 2CW9A 2A15A 1VQM3 4BIRA 1HYFA 1UUVB 2W04A 1JN5B 4CPKA 1TFOA 2BMRB 2RSXA 2CWUA 1MWSA 1NDOB 3HIIA 1TP6A 3UL5A 1C54A 2F5WA 2D42A 3IJEB 2F99A 3G713 1KD14 1GY7A 1E3RA 3G0KA 2L1SA 4H61A 3PCRA 4KFDA 1US1A 1RN7A 1BSCA 3F8XA 3B8LA 3UB1A 1DMQA 4EW5A 1W2B2 1I0VA 2CK3H 3EN8A 1WTHA 1I8VA 1I2EA 1RSNA 3EBYA 1SIHA 3AHWA 4FCMA 4CJNA 2OOVC 3MKIA 3SVAA 2Q07A 3DGYA 3I0YA 3GZBA 3ECFA 2XRXB 4LMIA 5JBSA 3MWZA 4CDLA 2R41A 4HM7B 3L0RA 3Q2PA 3PYJA 1HZ1A 2CFWA 6STDA 1BRGA 4HYZA 3SEDA 4J5KA 1IT7A 3BU4A 3HK4A 5D83A 1TU5A 3CME3 1VQP3 3CMA3 1U8CB 2H0GA 4I4KA 1NU3A 2GEXA 3U97A 1MWUA 2KF4A 4LGQA 2KRTA 2WO0A 5IG4A 2C11A 3DM8A 4K1UA 1IVXA 1RGFA 1U5OA 4XDWA 5HOHA 1VQL3 3CCU3 1UI7A 1FGOA 1BNGA 4MJDA 3V99A 1J2BA 3AGNA 1IDPA 3LTCA 1MGWA 2CFGA 1JZDA 2RFRA 2XGNA 1BSAA 1WQLB 5M1AA 1YJW3 3BLZA 1A2KA 3RDEA 4BTWA 2E2UA 3I563 3FH1A 2F5MA 3OXAA 3Q3FA 4EC6A 1VQ83 1SJWA 1DE3A 3X3YA 2W2CA 2CWTA 1V58A 2MF7A 3H51A 4J9AA 1UCJA 1RRLA 1DVCA 3WODG 2W56A 3D5GA 3D3LA 3GZXB 3ALAA 4BU4A 2P38A 4HM5B 5DRVA 3DUKA 3K5TA 2FGTA 3BIRA 1A2VA 3K63A 1PU4A 3V98A 3LTBA 2HMKB 1L5GB 1IV9A 2E2VA 3RGRA 1IVWA 1W5ZA 3BNCA 4N6V0 4MEIA 4WWUC 1CYVA 1O7HB 3WOEB 4N6UA 2K0MA 1ROAA 5M19A 1K41A 2HMNB 3SLUA 4NREA 3GSPA 3NXJA 1VQ53 5D82A 1AQZA 4KFEA 2XR8B 1EQKA 1IQ8A 1VZZA 4J5GA 5IW9A 2OQEA 3HX8A 1LVNA 2FNQA 1R4CA 2AADA 1B2ZA 3NX0A 2QGUA 1GMRA 2CFKA 1OCVA 2P0XA 1FGMA 2CX1A 2STDA 1BGSA 1N8QA 1V57A 1M1XB 3U1WA 2D1WA 3CU3A 2KF5A 1GS3A 1TIJA 2WOHA 1RCKA 2BIRA 2GU1A 2RBIA 5CF1A 5EEOA 1UCKA 1SARA 2W9PA 3E99A 3F9SA 3X41A 5G2GA 3KCHA 3FGYA 3OWYA 1O7GB 2YFIB 3TDGA 3FZWA 3VSYA 1AVKA 4BTXA 3K7CA 3LT8A 4HZ9B 1KSIA 2OTJ3 1N8R4 3CPW2 2W03A 1FGRA 4AEQA 2ZHXB 1AV4A 3UL6A 3GAXA 1OUNA 1VQK3 4ILFA 3HZPA 5G1LA 2YX9A 1I3IA 4GHOA 1STFI 4U13A 1JBRA 3JUPA 2HMLB 3WHOA 4EXRA 3EHCA 2B1XB 2RCDA 2Y74A 3DZLA 1RGHA 1E97A 1ULJB 2W56B 4LSOA 3S5CA 3J7Yd 2BHMA 3CCQ3 3SYUA 1TFKA 4RBNA 3MG1A 5HGRA 1W00A 2Z6BA 1NWWA 4I5QA 1BRSA 1UI8A 1BSEA 1RLSA 3EJVA 1BSBA 2Z76A 3OW22 3K9MC 3CC23 2CFLA 1DVDA 3AHSA 2HMJB 1FZUA 1ROVA 2CKFB 2KCDA 3MPHA 7RNTA 1Q7Y4 1M1K4 4OVMA 4LYLB 1M904 1MWRA 1OHSA 4K61A 1MWTA 4CCVA 1IYYA 4XDVA 1BRHA 2RGQA 3GWRA 4N6LA 3IPTA 1A67A 3LH4A 3WR2A 3WA3A 2IA7A 3B4OA 1BVIA 2HMMB 1VQQA 2KXGA 1BNFA 1R4YA 1TTOA 1BNSA 1IVUA 1PYLA 2CC3A 2KF3A 3CNMA 3EC9A 3NBRA 4N6NB 2OOVA 1IV7A 3ZFZA 1HKXA 3LYGA 2SBLA 5AIGA 4AKYA 1JBSA 3CCE3 3D9RA 1Q9EA 1ZS7A 1UGHI 1B21A 3KSED 4GL6A 1NNVA 1GMQA 3WA2X 1ISKA 4N6TA 2CHCA 5KP4A 3LXUX 3K0ZA 1W6GA 3Q1CA 1YIJ3 3F40A 3RNTA 1EUIC 4N6MA 2GBWB 1YJ93 2ZDJA 3FSDA 1OF5A 3SOYA 4EBGA 4BTYA 1IT8A 2UX0A 3JVCA 2HOHA 1T5YA 1JJ22 1W4NA 2XH9A 3JUQA 1WMPA 1Q814 2JDIH 3H3HA 5AI1A 4HAAA 3PZWA 3GZYB 3ROBA 1X1UA 1F8NA 2IUKA 3LT9A 1JV2B 5AYRB 2CFDA 1RKYA 1LOVA 2RNTA 3NV0A 2P09A 5A0OB 2BMQB 1UW1A 4R1KA 1LOXA 1YGWA 2V1LA 3NBJA 4IT7A 4JF8A 4STDA 1NJI4 1OHOA 5IG3A 4ORLA 1VQN3 3KN4A 3FG3A 1PFPA 5BU4A 1FUWA 3BNEA 1CEWI 2CG1A 5AIFA 3DGOA 4KFFA 1Q42A 1BU4A 2F86B 1T3BA 4R9KA 4NPBA 1GMPA 4IIAA 1NO3A 1G96A 1I0XA 1RCLA 4X2HA 5DREA 1I2GA 1G0TA 4TX4A 4BL2A 1K9M4 1N9JA 1YNVX 2AAEA 2IY2A 3HIGA 3CC43 1FYSA 3KKGA 3F7XA 5D81A 2SARA 1UCIA 3CD63 3FCSB 3IMAB 3JUMA 1I70A 3MSOA 1FGQA 1EEJA 3KSPA 3QK9A 1X1WA 5STDA 2XFSA 3FF2A 1MOLA 4HBRA 3NM7A 3EE1A 1Q824 1W02A 1OHPA 1B2SA 5IERA 4EV5A 3CXC2 4JRFA 3DMCA 3T0UA 3D79A 1V74A 1GOYA 1A90A 5EVHA 1ULIB 1GSPA 1JB5A 1LQMB 1EA2A 1TUHA 1X1XA 1ASKA 4HM0B 3CC73 1GD3A 2Y73A 2QA43 2HMOB 2OWPA 5AEWB 1MGRA 1OF5B 3EN1B 5IEOA 3SOAA 1IVVA 1K28A 1VQO3 4HZBB 3JUOA 3CCM3 5IF6A 3HOHA 3MG3A 4BL3A 3FLJA 2I9WA 2UGIA 1VQ73 1RGEA 1KC84 3MG2A 3V92A 1OH0A 2LQVA 1O7PB 1RGGA 1W2ZA 2CG0A 3NV0B 3WMDA 1RTUA 3A76A 2ML5A 4XBYA 3A5EA 4MMXB 1CQSA 1VQ93 4HM1B 3G8ZA 1N9EA 3CNXA 3JUNA 1BUJA 3VF1A 4XM4A 3DXOA 1LXEA 4X2OA 3KIIA 3LMLA 3FKAA 1QVF2 4KT3B 1WMOA 1CYUA 5G1KA 1DMMA 1LNIA 2GXFA 1T2HA 1ZGXA 2J8XB 3NQZA 4O02B 4XB5A 3ZG5A 3URPA 1QALA 2CH9A 5GSPA 4HJLB 1IK3A 1AVLA 4FR9A 3PCSA 7STDA 5CLKA 1BNRA 1FA3A 1UUGB 1DETA 3DGMA 4KVHA 4G1MB 1BRJA 1BAOA 4O3VA 4XBXA 3KZTA 1ZX2A 3AGOA 3F14A 2C10A 5AEUB 2FXTA 4H3UA 4QWTA 4OK0A 1W6YA 3LZAA 1YIT3 5CXOA 3BNBA 4OUQA 1B27A 3D4AA 1GOUA 4HM2B 1KQS2 2W9QA 1E3VA 3VGNA 1BRNL 3HI7A 3G4S3 1LNHA 1JKGA 4RNZA 1RGLA 1BUQA 2C4BA 3UJMA 2KF6A 1DYUA 3I553 3DGLA 5CF2A 1HU9A 4HM6B 1UDII 5ELJA 1GD4A 2Z77A 1TRPA 6RNTA 1CH0A 3LOYA 4N6OB 3FF0A 5AIIA 3DH2A 3EB8A 4IPBA 4LEHA 1GY6A 5JPPA 4HOHA 1RJOA 4RNYA 2CX0A 2LYXA 2W0QA 5AYSC 5BIRA 2BT3A 5TGNA 5KP3A 3PS8A 1UGIA 3EQQB 4R9LA 2ZA4A 4FMCA 2BU4A 4GB5A 2P0MA 3FG4A 1RNBA 3X3XA 1O7MB 4R80A 3AMOA 2QEX3 1UUWB 3DGNA 2GEYA 1D6ZA 3PXMA 2WOFA 3SX1A 3G6E3 1AR0A 3D5IA 1N5PA 3EF8A 4FCZA 5IENA 2F56A 2WGOA 1EKMA 2L4VA 1Q7HA 4HVNA 3ZG0A 1YI23 1Q40A 4WYKA 3EBTA 2KAAA 2INXA 4XBTA 1K8A4 1D6YA 1D6UA 1MNLA 5IEPA 3M8CA 1DMNA 3S28A 5IG0A 1YVBI 2IMJA 1W6CA 2YFJB 3CCR3 3LTAA 3CCS3 1JKGB 1M9GA 1YHQ3 3B7CA 1OPYA 2PZVA 1W7CA 4KZ1A 3NQYA 1OGXA 5BVBA 1I2FA 1JRQA 1VQ43 3MYTA 4ZM8A 1IU7A 5BXQA 1BSDA 3EX9A 4O8SA 4FMAA 1AY7A 2IYJA 2XF3A 4L8PA 5LC6A 5RNTA 1LRAA 4WHAA 1C7HA 2XSOB 1FGTA 3WOFB 4L8OA 4FMDA 5ELUA 2CIUA 3CCL3 1QVG2 1NB5I 1SQWA 1BIRA 2XFTA 1FUTA 3B4PA 4DKIA 1FW7A 2IUJA 5M18A 4L7KA 5IG5A 1G02A 5CK6A 4O2HA 3KE7A 2MC8A 1WNHA 2H0HA 3SXXA 4EYCA 3S29A 2BO9B 4HM3B 4RNTA 2P05A 4WFOA 1JBTA 1BNEA 5KP1A 3AMOB 3ER7A 1RNTA 1O7WB 4K90B 1VQ63 2QIYA 5LC7A 1JZOA 3CCV3 1B2UA 4HM4B 3MHEA 1IQXA 1JB2A 1Q864 4RZMA 1OGZA 1BRKA 2F4YA 1QJGA 2BNGA 4FCJA 1YGEA 2GBXB 1BRIA 1RGKA 1QMAA 2BMOB 2R4IA 2PNCA 7GSPA 1Q40B 4WYKB 3BNDA 3DY5A 1GYBA 1NB3I 4AKZA 3X3ZA 1KWIA 2F98A 1SIIA 1JNQA 2E2TA
chains in the Genus database with same CATH topology
4MMZB 4NHFA 3OWUA 2CWVA 4R4KA 3STDA 1YJN3 3BB9A 3NBBA 5FW5A 1N5HA 5I97A 4PEJA 3OX9A 1JN5A 3S67A 2WGQA 2O9UX 2XSHB 1OACA 5EQLA 5AIHA 1JB4A 1ZO2A 3NHXA 3GRDA 1S5AA 3KFQC 2OQEC 3F8HA 8CHOA 2OCTA 1K734 1RRHA 5FGOA 3NUVA 3GZRA 3T8NA 4K1VA 2M7OA 3T8UA 3CCJ3 3CPOA 2OTL3 1Y4KA 3OWSA 3S27A 1QAKA 2XGLA 1O7NB 2GU3A 1Z1SA 4FMBA 3NM2A 3QRDA 1QAFA 3LTDA 4Q53A 4LZIA 1IQYA 3RGAA 3Q90A 1SPUA 2ML6A 1STDA 4WP5A 4MMYB 1S723 3N9HA 2YFLB 4HM8B 4J8TA 3X40A 1EG9B 2ZL8A 1W01A 3PGBA 3UNLA 5JPUA 2JQ5A 1WMNA 2K54A 2W6JH 4N3VA 4HKVB 2Z7AA 3WDGB 3F7SA 2B24B 3OV4A 3N54B 3FG1A 2O3OA 1GY5A 2XEPA 3O8YA 3G16A 3N8BA 4EV2A 3X42A 2CW9A 2A15A 1VQM3 1UUVB 2W04A 1JN5B 1TFOA 2BMRB 2RSXA 2CWUA 1NDOB 3HIIA 1TP6A 3UL5A 2D42A 3IJEB 2F99A 3G713 1KD14 1GY7A 1E3RA 3G0KA 4H61A 3PCRA 4KFDA 1US1A 1RN7A 3F8XA 3B8LA 3UB1A 1DMQA 1W2B2 2CK3H 3EN8A 1WTHA 1SIHA 4FCMA 2OOVC 3MKIA 3SVAA 2Q07A 3I0YA 3GZBA 3ECFA 2XRXB 4LMIA 5JBSA 3MWZA 4CDLA 4HM7B 3L0RA 3Q2PA 3PYJA 2CFWA 6STDA 4HYZA 3SEDA 3CMA3 1IT7A 3HK4A 5D83A 1TU5A 3CME3 1VQP3 1U8CB 4I4KA 1NU3A 2GEXA 3U97A 4LGQA 5IG4A 2WO0A 2KRTA 1EQKA 2C11A 3DM8A 4K1UA 1IVXA 1U5OA 4XDWA 1VQL3 3CCU3 1UI7A 1FGOA 4MJDA 3V99A 1J2BA 1IDPA 3LTCA 2CFGA 2RFRA 2XGNA 1YJW3 1WQLB 3BLZA 1A2KA 3RDEA 4BTWA 2E2UA 3I563 3FH1A 3OXAA 4EC6A 1VQ83 1SJWA 3X3YA 2W2CA 2CWTA 2MF7A 4J9AA 3H51A 1RRLA 1DVCA 3WODG 2W56A 3GZXB 3D3LA 3ALAA 1KC84 2P38A 4HM5B 5DRVA 3DUKA 3K5TA 2FGTA 3K63A 1A2VA 1PU4A 3V98A 3LTBA 2HMKB 1L5GB 1IV9A 2E2VA 3RGRA 1IVWA 1W5ZA 3BNCA 4N6V0 4MEIA 4WWUC 1CYVA 1O7HB 3WOEB 4N6UA 2K0MA 1ROAA 1K41A 2HMNB 3SLUA 4NREA 3NXJA 1VQ53 5D82A 4KFEA 2XR8B 1IQ8A 1VZZA 5IW9A 2OQEA 3HX8A 1LVNA 2FNQA 1R4CA 3NX0A 2QGUA 2CFKA 1OCVA 2P0XA 1FGMA 2STDA 1N8QA 1M1XB 3U1WA 2D1WA 3CU3A 1GS3A 1TIJA 2WOHA 2GU1A 5CF1A 5EEOA 2W9PA 3E99A 3F9SA 3X41A 5G2GA 3FGYA 3OWYA 1O7GB 2YFIB 3TDGA 3FZWA 3VSYA 1AVKA 4BTXA 3K7CA 3LT8A 4HZ9B 1KSIA 2OTJ3 1N8R4 3CPW2 2W03A 1FGRA 4AEQA 1AV4A 3UL6A 3GAXA 1OUNA 1VQK3 3HZPA 2YX9A 4U13A 1STFI 3JUPA 2HMLB 4EXRA 3EHCA 2B1XB 2RCDA 2Y74A 3DZLA 4LSOA 1E97A 1ULJB 2W56B 3S5CA 3J7Yd 3CCQ3 2BHMA 1TFKA 4RBNA 3MG1A 5HGRA 1W00A 2Z6BA 1NWWA 1UI8A 3EJVA 3OW22 2Z76A 3K9MC 3CC23 2CFLA 1DVDA 2HMJB 1ROVA 2CKFB 2KCDA 3MPHA 1Q7Y4 1M1K4 4OVMA 1M904 1OHSA 4K61A 4CCVA 4XDVA 2RGQA 3GWRA 4N6LA 3IPTA 1A67A 3LH4A 3WA3A 2IA7A 3B4OA 2HMMB 2KXGA 3EBYA 3CNMA 5CXOA 1IVUA 2CC3A 4N6NB 3EC9A 3NBRA 2OOVA 1IV7A 1HKXA 3LYGA 2SBLA 5AIGA 4AKYA 3CCE3 3D9RA 3KSED 4GL6A 3WA2X 1ISKA 4N6TA 2CHCA 5KP4A 3LXUX 3K0ZA 1W6GA 3Q1CA 1YIJ3 3F40A 4N6MA 2GBWB 1YJ93 2ZDJA 3FSDA 1OF5A 3SOYA 4EBGA 4BTYA 1IT8A 2UX0A 3JVCA 1T5YA 1JJ22 1W4NA 2XH9A 3JUQA 1WMPA 1Q814 2JDIH 3H3HA 5AI1A 3PZWA 3GZYB 3ROBA 1F8NA 2IUKA 3LT9A 1JV2B 5AYRB 2CFDA 1RKYA 3NV0A 2P09A 5A0OB 2BMQB 1UW1A 4R1KA 1LOXA 2V1LA 3NBJA 4IT7A 4JF8A 4STDA 1NJI4 1OHOA 5IG3A 4ORLA 1VQN3 3KN4A 3FG3A 1PFPA 1FUWA 3BNEA 1CEWI 2CG1A 5AIFA 3DGOA 4KFFA 1Q42A 2F86B 4R9KA 4X2HA 4IIAA 1NO3A 1G96A 5DREA 1K9M4 4TX4A 1N9JA 3HIGA 3CC43 3KKGA 3F7XA 5D81A 3CD63 3FCSB 3IMAB 3JUMA 3MSOA 1FGQA 3KSPA 3QK9A 5STDA 2XFSA 3FF2A 1MOLA 4HBRA 3NM7A 3EE1A 1Q824 1W02A 1OHPA 5IERA 4EV5A 3CXC2 4JRFA 3DMCA 3T0UA 1V74A 1A90A 5EVHA 1ULIB 1JB5A 1EA2A 1TUHA 1ASKA 4HM0B 3CC73 1GD3A 2Y73A 2QA43 2HMOB 2OWPA 5AEWB 1OF5B 3EN1B 5IEOA 3SOAA 1IVVA 1K28A 1VQO3 4HZBB 3JUOA 3CCM3 5IF6A 3MG3A 3FLJA 2I9WA 1VQ73 3MG2A 3V92A 1OH0A 2LQVA 1O7PB 1W2ZA 2CG0A 3NV0B 3WMDA 3A76A 2ML5A 4XBYA 4MMXB 1CQSA 1VQ93 4HM1B 3G8ZA 1N9EA 3CNXA 3JUNA 3VF1A 4XM4A 3DXOA 1LXEA 4X2OA 3KIIA 3LMLA 3FKAA 1QVF2 1WMOA 1CYUA 1DMMA 2GXFA 3NQZA 4XB5A 4O02B 1QALA 2CH9A 1IK3A 4HJLB 1AVLA 4FR9A 3PCSA 7STDA 5CLKA 1FA3A 3DGMA 4KVHA 4G1MB 4O3VA 4XBXA 3KZTA 1ZX2A 3F14A 2C10A 5AEUB 2FXTA 4H3UA 4QWTA 4OK0A 1W6YA 3LZAA 1YIT3 3BNBA 4OUQA 1KQS2 4HM2B 2W9QA 1E3VA 3VGNA 3HI7A 3G4S3 1LNHA 1JKGA 4RNZA 1BUQA 3UJMA 1DYUA 3I553 3DGLA 5CF2A 1HU9A 4HM6B 5ELJA 1GD4A 2Z77A 3LOYA 4N6OB 3FF0A 5AIIA 3EB8A 4IPBA 4LEHA 1GY6A 5JPPA 1RJOA 4RNYA 2LYXA 2W0QA 5AYSC 2BT3A 5TGNA 5KP3A 3PS8A 3EQQB 4R9LA 4FMCA 4GB5A 2P0MA 3FG4A 3X3XA 1O7MB 4R80A 3AMOA 2QEX3 1UUWB 3DGNA 2GEYA 1D6ZA 3PXMA 2WOFA 3SX1A 3G6E3 1AR0A 1N5PA 3EF8A 4FCZA 5IENA 2WGOA 1EKMA 2L4VA 4HVNA 1YI23 1Q40A 4WYKA 3EBTA 2INXA 4XBTA 1K8A4 1D6YA 1D6UA 1MNLA 5IEPA 3M8CA 1DMNA 3S28A 5IG0A 1YVBI 2IMJA 1W6CA 2YFJB 3CCR3 3LTAA 3CCS3 1JKGB 1M9GA 1YHQ3 3B7CA 1OPYA 2PZVA 1W7CA 4KZ1A 3NQYA 1OGXA 5BVBA 1JRQA 1VQ43 3MYTA 4ZM8A 1IU7A 5BXQA 3EX9A 4O8SA 4FMAA 2XF3A 4L8PA 5LC6A 4WHAA 1C7HA 2XSOB 1FGTA 3WOFB 4L8OA 4FMDA 5ELUA 2CIUA 3CCL3 1QVG2 1NB5I 1SQWA 2XFTA 3B4PA 2IUJA 4L7KA 5IG5A 5CK6A 4O2HA 3KE7A 2MC8A 1WNHA 3SXXA 4EYCA 3S29A 2BO9B 4HM3B 4WFOA 2P05A 5KP1A 3AMOB 3ER7A 1VQ63 1O7WB 4K90B 2QIYA 5LC7A 3CCV3 4HM4B 3MHEA 1IQXA 1JB2A 1Q864 4RZMA 1OGZA 1QJGA 2BNGA 4FCJA 1YGEA 2GBXB 1QMAA 2BMOB 2R4IA 2PNCA 1Q40B 4WYKB 3BNDA 3DY5A 1GYBA 1NB3I 4AKZA 3X3ZA 1KWIA 2F98A 1SIIA 1JNQA 2E2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWU A;  3STD A;  3BB9 A;  5FW5 A;  4PEJ A;  3OX9 A;  1JN5 A;  2XSH B;  5AIH A;  1JB4 A;  1ZO2 A;  3NHX A;  3GRD A;  1S5A A;  3F8H A;  8CHO A;  3NUV A;  3GZR A;  3T8N A;  4K1V A;  3T8U A;  3CPO A;  3OWS A;  1O7N B;  1Z1S A;  3NM2 A;  4Q53 A;  3RGA A;  3Q90 A;  1STD A;  4WP5 A;  2YFL B;  4HM8 B;  4J8T A;  1EG9 B;  1W01 A;  3UNL A;  5JPU A;  2JQ5 A;  2K54 A;  4N3V A;  4HKV B;  2Z7A A;  3F7S A;  2B24 B;  3OV4 A;  1GY5 A;  3G16 A;  2A15 A;  1UUV B;  1JN5 B;  2BMR B;  1NDO B;  1TP6 A;  2F99 A;  1GY7 A;  3G0K A;  3F8X A;  3B8L A;  1DMQ A;  3EN8 A;  4FCM A;  3MKI A;  3I0Y A;  3GZB A;  3ECF A;  2XRX B;  4LMI A;  4CDL A;  4HM7 B;  6STD A;  3SED A;  3HK4 A;  5D83 A;  4I4K A;  1NU3 A;  2GEX A;  4LGQ A;  5IG4 A;  3DM8 A;  4K1U A;  1U5O A;  4XDW A;  4MJD A;  1IDP A;  2RFR A;  1WQL B;  3BLZ A;  1A2K A;  3FH1 A;  3OXA A;  1SJW A;  2W2C A;  4J9A A;  3H51 A;  3GZX B;  4HM5 B;  5DRV A;  3DUK A;  2HMK B;  3RGR A;  4WWU C;  1O7H B;  1K41 A;  2HMN B;  3NXJ A;  5D82 A;  2XR8 B;  1VZZ A;  3HX8 A;  2QGU A;  1OCV A;  2STD A;  3CU3 A;  1GS3 A;  5CF1 A;  3E99 A;  3F9S A;  5G2G A;  3FGY A;  3OWY A;  1O7G B;  2YFI B;  3VSY A;  3FZW A;  3K7C A;  4HZ9 B;  1OUN A;  3HZP A;  4U13 A;  3JUP A;  2HML B;  3EHC A;  2B1X B;  2RCD A;  3DZL A;  1E97 A;  1ULJ B;  3S5C A;  3MG1 A;  5HGR A;  1W00 A;  1NWW A;  3EJV A;  2Z76 A;  2HMJ B;  2CKF B;  4OVM A;  1OHS A;  4XDV A;  2RGQ A;  3GWR A;  3IPT A;  3B4O A;  2HMM B;  5CXO A;  3EBY A;  3CNM A;  3EC9 A;  3NBR A;  1HKX A;  3LYG A;  5AIG A;  3D9R A;  1ISK A;  2CHC A;  5KP4 A;  3K0Z A;  3F40 A;  2GBW B;  3FSD A;  1OF5 A;  3SOY A;  2UX0 A;  3JUQ A;  3H3H A;  5AI1 A;  3GZY B;  3ROB A;  3NV0 A;  2BMQ B;  4R1K A;  4STD A;  1OHO A;  5IG3 A;  4ORL A;  5AIF A;  1Q42 A;  2F86 B;  4R9K A;  4X2H A;  4IIA A;  5DRE A;  3KKG A;  3F7X A;  5D81 A;  3JUM A;  3MSO A;  3KSP A;  5STD A;  3FF2 A;  1W02 A;  1OHP A;  5IER A;  3DMC A;  5EVH A;  1ULI B;  1JB5 A;  1EA2 A;  1TUH A;  1ASK A;  4HM0 B;  2HMO B;  2OWP A;  5AEW B;  1OF5 B;  3EN1 B;  5IEO A;  3SOA A;  4HZB B;  3JUO A;  5IF6 A;  3MG3 A;  3FLJ A;  2I9W A;  3MG2 A;  1OH0 A;  1O7P B;  3NV0 B;  3WMD A;  3A76 A;  4XBY A;  1CQS A;  4HM1 B;  3G8Z A;  3CNX A;  3JUN A;  4XM4 A;  3DXO A;  4X2O A;  3FKA A;  1DMM A;  2GXF A;  4XB5 A;  4HJL B;  7STD A;  5CLK A;  4KVH A;  4XBX A;  3KZT A;  1ZX2 A;  3F14 A;  5AEU B;  4H3U A;  3LZA A;  1W6Y A;  4OUQ A;  4HM2 B;  1E3V A;  3VGN A;  1JKG A;  1BUQ A;  3UJM A;  5CF2 A;  4HM6 B;  2Z77 A;  3FF0 A;  5AII A;  4LEH A;  1GY6 A;  5JPP A;  5TGN A;  5KP3 A;  3EQQ B;  4R9L A;  4GB5 A;  1O7M B;  1UUW B;  2GEY A;  1AR0 A;  3EF8 A;  5IEN A;  4HVN A;  1Q40 A;  4WYK A;  3EBT A;  2INX A;  4XBT A;  5IEP A;  3M8C A;  1DMN A;  5IG0 A;  2IMJ A;  2YFJ B;  1JKG B;  3B7C A;  1OPY A;  2PZV A;  1OGX A;  5BVB A;  3MYT A;  5BXQ A;  3EX9 A;  4L8P A;  1C7H A;  2XSO B;  4L8O A;  3B4P A;  4L7K A;  5IG5 A;  5CK6 A;  3KE7 A;  4HM3 B;  5KP1 A;  3ER7 A;  1O7W B;  2QIY A;  4HM4 B;  3MHE A;  1JB2 A;  4RZM A;  1OGZ A;  1QJG A;  2BNG A;  4FCJ A;  2GBX B;  1QMA A;  2BMO B;  2R4I A;  1Q40 B;  4WYK B;  1GYB A;  2F98 A;  1E3R A; 
#chains in the Genus database with same CATH topology
 4MMZ B;  4NHF A;  3OWU A;  2CWV A;  4R4K A;  3STD A;  1YJN 3;  1RGA A;  3BB9 A;  1I3F A;  1PY3 A;  3NBB A;  5FW5 A;  1N5H A;  1RMS A;  5I97 A;  1LOW A;  4PEJ A;  3OX9 A;  1JN5 A;  3S67 A;  2WGQ A;  2O9U X;  2XSH B;  1OAC A;  5EQL A;  5AIH A;  1JB4 A;  1LQG C;  1RN4 A;  1ZO2 A;  3GRD A;  3NHX A;  1S5A A;  8RNT A;  3KFQ C;  2OQE C;  3F8H A;  8CHO A;  2OCT A;  1K73 4;  1BNJ A;  1RRH A;  5FGO A;  3NUV A;  1T2I A;  1GOV A;  1BNI A;  1RN1 A;  3GZR A;  3T8N A;  4K1V A;  2H0I A;  1FUS A;  1LOY A;  2M7O A;  4GSP A;  3T8U A;  1RHL A;  3CCJ 3;  3CPO A;  2OTL 3;  1Y4K A;  3OWS A;  1RDS A;  3S27 A;  1BOX A;  1QAK A;  1B2M A;  2XGL A;  1O7N B;  2GU3 A;  1Z1S A;  4FMB A;  3NM2 A;  1B3S A;  3QRD A;  1QAF A;  2UUG C;  3LTD A;  4Q53 A;  4LZI A;  1TRQ A;  1IQY A;  3RGA A;  3Q90 A;  1SPU A;  2ML6 A;  1STD A;  4WP5 A;  4MMY B;  1S72 3;  3N9H A;  2YFL B;  4HM8 B;  4J8T A;  3X40 A;  1BAN A;  1EG9 B;  1W01 A;  2ZL8 A;  1B2X A;  3PGB A;  3UNL A;  5JPU A;  2JQ5 A;  1WMN A;  2GSP A;  1TJD A;  2K54 A;  2W6J H;  4N3V A;  4HKV B;  2Z7A A;  3WDG B;  3F7S A;  6GSP A;  1UCL A;  2B24 B;  1B20 A;  1RGC A;  3OV4 A;  3N54 B;  3FG1 A;  1X1Y A;  1YVS A;  2K3D A;  2O3O A;  9RNT A;  1A2P A;  1GY5 A;  2XEP A;  3O8Y A;  3G16 A;  3N8B A;  4EV2 A;  3X42 A;  2CW9 A;  2A15 A;  1VQM 3;  4BIR A;  1HYF A;  1UUV B;  2W04 A;  1JN5 B;  4CPK A;  1TFO A;  2BMR B;  2RSX A;  2CWU A;  1MWS A;  1NDO B;  3HII A;  1TP6 A;  3UL5 A;  1C54 A;  2F5W A;  2D42 A;  3IJE B;  2F99 A;  3G71 3;  1KD1 4;  1GY7 A;  1E3R A;  3G0K A;  2L1S A;  4H61 A;  3PCR A;  4KFD A;  1US1 A;  1RN7 A;  1BSC A;  3F8X A;  3B8L A;  3UB1 A;  1DMQ A;  4EW5 A;  1W2B 2;  1I0V A;  2CK3 H;  3EN8 A;  1WTH A;  1I8V A;  1I2E A;  1RSN A;  3EBY A;  1SIH A;  3AHW A;  4FCM A;  4CJN A;  2OOV C;  3MKI A;  3SVA A;  2Q07 A;  3DGY A;  3I0Y A;  3GZB A;  3ECF A;  2XRX B;  4LMI A;  5JBS A;  3MWZ A;  4CDL A;  2R41 A;  4HM7 B;  3L0R A;  3Q2P A;  3PYJ A;  1HZ1 A;  2CFW A;  6STD A;  1BRG A;  4HYZ A;  3SED A;  4J5K A;  1IT7 A;  3BU4 A;  3HK4 A;  5D83 A;  1TU5 A;  3CME 3;  1VQP 3;  3CMA 3;  1U8C B;  2H0G A;  4I4K A;  1NU3 A;  2GEX A;  3U97 A;  1MWU A;  2KF4 A;  4LGQ A;  2KRT A;  2WO0 A;  5IG4 A;  2C11 A;  3DM8 A;  4K1U A;  1IVX A;  1RGF A;  1U5O A;  4XDW A;  5HOH A;  1VQL 3;  3CCU 3;  1UI7 A;  1FGO A;  1BNG A;  4MJD A;  3V99 A;  1J2B A;  3AGN A;  1IDP A;  3LTC A;  1MGW A;  2CFG A;  1JZD A;  2RFR A;  2XGN A;  1BSA A;  1WQL B;  5M1A A;  1YJW 3;  3BLZ A;  1A2K A;  3RDE A;  4BTW A;  2E2U A;  3I56 3;  3FH1 A;  2F5M A;  3OXA A;  3Q3F A;  4EC6 A;  1VQ8 3;  1SJW A;  1DE3 A;  3X3Y A;  2W2C A;  2CWT A;  1V58 A;  2MF7 A;  3H51 A;  4J9A A;  1UCJ A;  1RRL A;  1DVC A;  3WOD G;  2W56 A;  3D5G A;  3D3L A;  3GZX B;  3ALA A;  4BU4 A;  2P38 A;  4HM5 B;  5DRV A;  3DUK A;  3K5T A;  2FGT A;  3BIR A;  1A2V A;  3K63 A;  1PU4 A;  3V98 A;  3LTB A;  2HMK B;  1L5G B;  1IV9 A;  2E2V A;  3RGR A;  1IVW A;  1W5Z A;  3BNC A;  4N6V 0;  4MEI A;  4WWU C;  1CYV A;  1O7H B;  3WOE B;  4N6U A;  2K0M A;  1ROA A;  5M19 A;  1K41 A;  2HMN B;  3SLU A;  4NRE A;  3GSP A;  3NXJ A;  1VQ5 3;  5D82 A;  1AQZ A;  4KFE A;  2XR8 B;  1EQK A;  1IQ8 A;  1VZZ A;  4J5G A;  5IW9 A;  2OQE A;  3HX8 A;  1LVN A;  2FNQ A;  1R4C A;  2AAD A;  1B2Z A;  3NX0 A;  2QGU A;  1GMR A;  2CFK A;  1OCV A;  2P0X A;  1FGM A;  2CX1 A;  2STD A;  1BGS A;  1N8Q A;  1V57 A;  1M1X B;  3U1W A;  2D1W A;  3CU3 A;  2KF5 A;  1GS3 A;  1TIJ A;  2WOH A;  1RCK A;  2BIR A;  2GU1 A;  2RBI A;  5CF1 A;  5EEO A;  1UCK A;  1SAR A;  2W9P A;  3E99 A;  3F9S A;  3X41 A;  5G2G A;  3KCH A;  3FGY A;  3OWY A;  1O7G B;  2YFI B;  3TDG A;  3FZW A;  3VSY A;  1AVK A;  4BTX A;  3K7C A;  3LT8 A;  4HZ9 B;  1KSI A;  2OTJ 3;  1N8R 4;  3CPW 2;  2W03 A;  1FGR A;  4AEQ A;  2ZHX B;  1AV4 A;  3UL6 A;  3GAX A;  1OUN A;  1VQK 3;  4ILF A;  3HZP A;  5G1L A;  2YX9 A;  1I3I A;  4GHO A;  1STF I;  4U13 A;  1JBR A;  3JUP A;  2HML B;  3WHO A;  4EXR A;  3EHC A;  2B1X B;  2RCD A;  2Y74 A;  3DZL A;  1RGH A;  1E97 A;  1ULJ B;  2W56 B;  4LSO A;  3S5C A;  3J7Y d;  2BHM A;  3CCQ 3;  3SYU A;  1TFK A;  4RBN A;  3MG1 A;  5HGR A;  1W00 A;  2Z6B A;  1NWW A;  4I5Q A;  1BRS A;  1UI8 A;  1BSE A;  1RLS A;  3EJV A;  1BSB A;  2Z76 A;  3OW2 2;  3K9M C;  3CC2 3;  2CFL A;  1DVD A;  3AHS A;  2HMJ B;  1FZU A;  1ROV A;  2CKF B;  2KCD A;  3MPH A;  7RNT A;  1Q7Y 4;  1M1K 4;  4OVM A;  4LYL B;  1M90 4;  1MWR A;  1OHS A;  4K61 A;  1MWT A;  4CCV A;  1IYY A;  4XDV A;  1BRH A;  2RGQ A;  3GWR A;  4N6L A;  3IPT A;  1A67 A;  3LH4 A;  3WR2 A;  3WA3 A;  2IA7 A;  3B4O A;  1BVI A;  2HMM B;  1VQQ A;  2KXG A;  1BNF A;  1R4Y A;  1TTO A;  1BNS A;  1IVU A;  1PYL A;  2CC3 A;  2KF3 A;  3CNM A;  3EC9 A;  3NBR A;  4N6N B;  2OOV A;  1IV7 A;  3ZFZ A;  1HKX A;  3LYG A;  2SBL A;  5AIG A;  4AKY A;  1JBS A;  3CCE 3;  3D9R A;  1Q9E A;  1ZS7 A;  1UGH I;  1B21 A;  3KSE D;  4GL6 A;  1NNV A;  1GMQ A;  3WA2 X;  1ISK A;  4N6T A;  2CHC A;  5KP4 A;  3LXU X;  3K0Z A;  1W6G A;  3Q1C A;  1YIJ 3;  3F40 A;  3RNT A;  1EUI C;  4N6M A;  2GBW B;  1YJ9 3;  2ZDJ A;  3FSD A;  1OF5 A;  3SOY A;  4EBG A;  4BTY A;  1IT8 A;  2UX0 A;  3JVC A;  2HOH A;  1T5Y A;  1JJ2 2;  1W4N A;  2XH9 A;  3JUQ A;  1WMP A;  1Q81 4;  2JDI H;  3H3H A;  5AI1 A;  4HAA A;  3PZW A;  3GZY B;  3ROB A;  1X1U A;  1F8N A;  2IUK A;  3LT9 A;  1JV2 B;  5AYR B;  2CFD A;  1RKY A;  1LOV A;  2RNT A;  3NV0 A;  2P09 A;  5A0O B;  2BMQ B;  1UW1 A;  4R1K A;  1LOX A;  1YGW A;  2V1L A;  3NBJ A;  4IT7 A;  4JF8 A;  4STD A;  1NJI 4;  1OHO A;  5IG3 A;  4ORL A;  1VQN 3;  3KN4 A;  3FG3 A;  1PFP A;  5BU4 A;  1FUW A;  3BNE A;  1CEW I;  2CG1 A;  5AIF A;  3DGO A;  4KFF A;  1Q42 A;  1BU4 A;  2F86 B;  1T3B A;  4R9K A;  4NPB A;  1GMP A;  4IIA A;  1NO3 A;  1G96 A;  1I0X A;  1RCL A;  4X2H A;  5DRE A;  1I2G A;  1G0T A;  4TX4 A;  4BL2 A;  1K9M 4;  1N9J A;  1YNV X;  2AAE A;  2IY2 A;  3HIG A;  3CC4 3;  1FYS A;  3KKG A;  3F7X A;  5D81 A;  2SAR A;  1UCI A;  3CD6 3;  3FCS B;  3IMA B;  3JUM A;  1I70 A;  3MSO A;  1FGQ A;  1EEJ A;  3KSP A;  3QK9 A;  1X1W A;  5STD A;  2XFS A;  3FF2 A;  1MOL A;  4HBR A;  3NM7 A;  3EE1 A;  1Q82 4;  1W02 A;  1OHP A;  1B2S A;  5IER A;  4EV5 A;  3CXC 2;  4JRF A;  3DMC A;  3T0U A;  3D79 A;  1V74 A;  1GOY A;  1A90 A;  5EVH A;  1ULI B;  1GSP A;  1JB5 A;  1LQM B;  1EA2 A;  1TUH A;  1X1X A;  1ASK A;  4HM0 B;  3CC7 3;  1GD3 A;  2Y73 A;  2QA4 3;  2HMO B;  2OWP A;  5AEW B;  1MGR A;  1OF5 B;  3EN1 B;  5IEO A;  3SOA A;  1IVV A;  1K28 A;  1VQO 3;  4HZB B;  3JUO A;  3CCM 3;  5IF6 A;  3HOH A;  3MG3 A;  4BL3 A;  3FLJ A;  2I9W A;  2UGI A;  1VQ7 3;  1RGE A;  1KC8 4;  3MG2 A;  3V92 A;  1OH0 A;  2LQV A;  1O7P B;  1RGG A;  1W2Z A;  2CG0 A;  3NV0 B;  3WMD A;  1RTU A;  3A76 A;  2ML5 A;  4XBY A;  3A5E A;  4MMX B;  1CQS A;  1VQ9 3;  4HM1 B;  3G8Z A;  1N9E A;  3CNX A;  3JUN A;  1BUJ A;  3VF1 A;  4XM4 A;  3DXO A;  1LXE A;  4X2O A;  3KII A;  3LML A;  3FKA A;  1QVF 2;  4KT3 B;  1WMO A;  1CYU A;  5G1K A;  1DMM A;  1LNI A;  2GXF A;  1T2H A;  1ZGX A;  2J8X B;  3NQZ A;  4O02 B;  4XB5 A;  3ZG5 A;  3URP A;  1QAL A;  2CH9 A;  5GSP A;  4HJL B;  1IK3 A;  1AVL A;  4FR9 A;  3PCS A;  7STD A;  5CLK A;  1BNR A;  1FA3 A;  1UUG B;  1DET A;  3DGM A;  4KVH A;  4G1M B;  1BRJ A;  1BAO A;  4O3V A;  4XBX A;  3KZT A;  1ZX2 A;  3AGO A;  3F14 A;  2C10 A;  5AEU B;  2FXT A;  4H3U A;  4QWT A;  4OK0 A;  1W6Y A;  3LZA A;  1YIT 3;  5CXO A;  3BNB A;  4OUQ A;  1B27 A;  3D4A A;  1GOU A;  4HM2 B;  1KQS 2;  2W9Q A;  1E3V A;  3VGN A;  1BRN L;  3HI7 A;  3G4S 3;  1LNH A;  1JKG A;  4RNZ A;  1RGL A;  1BUQ A;  2C4B A;  3UJM A;  2KF6 A;  1DYU A;  3I55 3;  3DGL A;  5CF2 A;  1HU9 A;  4HM6 B;  1UDI I;  5ELJ A;  1GD4 A;  2Z77 A;  1TRP A;  6RNT A;  1CH0 A;  3LOY A;  4N6O B;  3FF0 A;  5AII A;  3DH2 A;  3EB8 A;  4IPB A;  4LEH A;  1GY6 A;  5JPP A;  4HOH A;  1RJO A;  4RNY A;  2CX0 A;  2LYX A;  2W0Q A;  5AYS C;  5BIR A;  2BT3 A;  5TGN A;  5KP3 A;  3PS8 A;  1UGI A;  3EQQ B;  4R9L A;  2ZA4 A;  4FMC A;  2BU4 A;  4GB5 A;  2P0M A;  3FG4 A;  1RNB A;  3X3X A;  1O7M B;  4R80 A;  3AMO A;  2QEX 3;  1UUW B;  3DGN A;  2GEY A;  1D6Z A;  3PXM A;  2WOF A;  3SX1 A;  3G6E 3;  1AR0 A;  3D5I A;  1N5P A;  3EF8 A;  4FCZ A;  5IEN A;  2F56 A;  2WGO A;  1EKM A;  2L4V A;  1Q7H A;  4HVN A;  3ZG0 A;  1YI2 3;  1Q40 A;  4WYK A;  3EBT A;  2KAA A;  2INX A;  4XBT A;  1K8A 4;  1D6Y A;  1D6U A;  1MNL A;  5IEP A;  3M8C A;  1DMN A;  3S28 A;  5IG0 A;  1YVB I;  2IMJ A;  1W6C A;  2YFJ B;  3CCR 3;  3LTA A;  3CCS 3;  1JKG B;  1M9G A;  1YHQ 3;  3B7C A;  1OPY A;  2PZV A;  1W7C A;  4KZ1 A;  3NQY A;  1OGX A;  5BVB A;  1I2F A;  1JRQ A;  1VQ4 3;  3MYT A;  4ZM8 A;  1IU7 A;  5BXQ A;  1BSD A;  3EX9 A;  4O8S A;  4FMA A;  1AY7 A;  2IYJ A;  2XF3 A;  4L8P A;  5LC6 A;  5RNT A;  1LRA A;  4WHA A;  1C7H A;  2XSO B;  1FGT A;  3WOF B;  4L8O A;  4FMD A;  5ELU A;  2CIU A;  3CCL 3;  1QVG 2;  1NB5 I;  1SQW A;  1BIR A;  2XFT A;  1FUT A;  3B4P A;  4DKI A;  1FW7 A;  2IUJ A;  5M18 A;  4L7K A;  5IG5 A;  1G02 A;  5CK6 A;  4O2H A;  3KE7 A;  2MC8 A;  1WNH A;  2H0H A;  3SXX A;  4EYC A;  3S29 A;  2BO9 B;  4HM3 B;  4RNT A;  2P05 A;  4WFO A;  1JBT A;  1BNE A;  5KP1 A;  3AMO B;  3ER7 A;  1RNT A;  1O7W B;  4K90 B;  1VQ6 3;  2QIY A;  5LC7 A;  1JZO A;  3CCV 3;  1B2U A;  4HM4 B;  3MHE A;  1IQX A;  1JB2 A;  1Q86 4;  4RZM A;  1OGZ A;  1BRK A;  2F4Y A;  1QJG A;  2BNG A;  4FCJ A;  1YGE A;  2GBX B;  1BRI A;  1RGK A;  1QMA A;  2BMO B;  2R4I A;  2PNC A;  7GSP A;  1Q40 B;  4WYK B;  3BND A;  3DY5 A;  1GYB A;  1NB3 I;  4AKZ A;  3X3Z A;  1KWI A;  2F98 A;  1SII A;  1JNQ A;  2E2T A; 
#chains in the Genus database with same CATH homology
 4MMZ B;  4NHF A;  3OWU A;  2CWV A;  4R4K A;  3STD A;  1YJN 3;  3BB9 A;  3NBB A;  5FW5 A;  1N5H A;  5I97 A;  4PEJ A;  3OX9 A;  1JN5 A;  3S67 A;  2WGQ A;  2O9U X;  2XSH B;  1OAC A;  5EQL A;  5AIH A;  1JB4 A;  1ZO2 A;  3NHX A;  3GRD A;  1S5A A;  3KFQ C;  2OQE C;  3F8H A;  8CHO A;  2OCT A;  1K73 4;  1RRH A;  5FGO A;  3NUV A;  3GZR A;  3T8N A;  4K1V A;  2M7O A;  3T8U A;  3CCJ 3;  3CPO A;  2OTL 3;  1Y4K A;  3OWS A;  3S27 A;  1QAK A;  2XGL A;  1O7N B;  2GU3 A;  1Z1S A;  4FMB A;  3NM2 A;  3QRD A;  1QAF A;  3LTD A;  4Q53 A;  4LZI A;  1IQY A;  3RGA A;  3Q90 A;  1SPU A;  2ML6 A;  1STD A;  4WP5 A;  4MMY B;  1S72 3;  3N9H A;  2YFL B;  4HM8 B;  4J8T A;  3X40 A;  1EG9 B;  2ZL8 A;  1W01 A;  3PGB A;  3UNL A;  5JPU A;  2JQ5 A;  1WMN A;  2K54 A;  2W6J H;  4N3V A;  4HKV B;  2Z7A A;  3WDG B;  3F7S A;  2B24 B;  3OV4 A;  3N54 B;  3FG1 A;  2O3O A;  1GY5 A;  2XEP A;  3O8Y A;  3G16 A;  3N8B A;  4EV2 A;  3X42 A;  2CW9 A;  2A15 A;  1VQM 3;  1UUV B;  2W04 A;  1JN5 B;  1TFO A;  2BMR B;  2RSX A;  2CWU A;  1NDO B;  3HII A;  1TP6 A;  3UL5 A;  2D42 A;  3IJE B;  2F99 A;  3G71 3;  1KD1 4;  1GY7 A;  1E3R A;  3G0K A;  4H61 A;  3PCR A;  4KFD A;  1US1 A;  1RN7 A;  3F8X A;  3B8L A;  3UB1 A;  1DMQ A;  1W2B 2;  2CK3 H;  3EN8 A;  1WTH A;  1SIH A;  4FCM A;  2OOV C;  3MKI A;  3SVA A;  2Q07 A;  3I0Y A;  3GZB A;  3ECF A;  2XRX B;  4LMI A;  5JBS A;  3MWZ A;  4CDL A;  4HM7 B;  3L0R A;  3Q2P A;  3PYJ A;  2CFW A;  6STD A;  4HYZ A;  3SED A;  3CMA 3;  1IT7 A;  3HK4 A;  5D83 A;  1TU5 A;  3CME 3;  1VQP 3;  1U8C B;  4I4K A;  1NU3 A;  2GEX A;  3U97 A;  4LGQ A;  5IG4 A;  2WO0 A;  2KRT A;  1EQK A;  2C11 A;  3DM8 A;  4K1U A;  1IVX A;  1U5O A;  4XDW A;  1VQL 3;  3CCU 3;  1UI7 A;  1FGO A;  4MJD A;  3V99 A;  1J2B A;  1IDP A;  3LTC A;  2CFG A;  2RFR A;  2XGN A;  1YJW 3;  1WQL B;  3BLZ A;  1A2K A;  3RDE A;  4BTW A;  2E2U A;  3I56 3;  3FH1 A;  3OXA A;  4EC6 A;  1VQ8 3;  1SJW A;  3X3Y A;  2W2C A;  2CWT A;  2MF7 A;  4J9A A;  3H51 A;  1RRL A;  1DVC A;  3WOD G;  2W56 A;  3GZX B;  3D3L A;  3ALA A;  1KC8 4;  2P38 A;  4HM5 B;  5DRV A;  3DUK A;  3K5T A;  2FGT A;  3K63 A;  1A2V A;  1PU4 A;  3V98 A;  3LTB A;  2HMK B;  1L5G B;  1IV9 A;  2E2V A;  3RGR A;  1IVW A;  1W5Z A;  3BNC A;  4N6V 0;  4MEI A;  4WWU C;  1CYV A;  1O7H B;  3WOE B;  4N6U A;  2K0M A;  1ROA A;  1K41 A;  2HMN B;  3SLU A;  4NRE A;  3NXJ A;  1VQ5 3;  5D82 A;  4KFE A;  2XR8 B;  1IQ8 A;  1VZZ A;  5IW9 A;  2OQE A;  3HX8 A;  1LVN A;  2FNQ A;  1R4C A;  3NX0 A;  2QGU A;  2CFK A;  1OCV A;  2P0X A;  1FGM A;  2STD A;  1N8Q A;  1M1X B;  3U1W A;  2D1W A;  3CU3 A;  1GS3 A;  1TIJ A;  2WOH A;  2GU1 A;  5CF1 A;  5EEO A;  2W9P A;  3E99 A;  3F9S A;  3X41 A;  5G2G A;  3FGY A;  3OWY A;  1O7G B;  2YFI B;  3TDG A;  3FZW A;  3VSY A;  1AVK A;  4BTX A;  3K7C A;  3LT8 A;  4HZ9 B;  1KSI A;  2OTJ 3;  1N8R 4;  3CPW 2;  2W03 A;  1FGR A;  4AEQ A;  1AV4 A;  3UL6 A;  3GAX A;  1OUN A;  1VQK 3;  3HZP A;  2YX9 A;  4U13 A;  1STF I;  3JUP A;  2HML B;  4EXR A;  3EHC A;  2B1X B;  2RCD A;  2Y74 A;  3DZL A;  4LSO A;  1E97 A;  1ULJ B;  2W56 B;  3S5C A;  3J7Y d;  3CCQ 3;  2BHM A;  1TFK A;  4RBN A;  3MG1 A;  5HGR A;  1W00 A;  2Z6B A;  1NWW A;  1UI8 A;  3EJV A;  3OW2 2;  2Z76 A;  3K9M C;  3CC2 3;  2CFL A;  1DVD A;  2HMJ B;  1ROV A;  2CKF B;  2KCD A;  3MPH A;  1Q7Y 4;  1M1K 4;  4OVM A;  1M90 4;  1OHS A;  4K61 A;  4CCV A;  4XDV A;  2RGQ A;  3GWR A;  4N6L A;  3IPT A;  1A67 A;  3LH4 A;  3WA3 A;  2IA7 A;  3B4O A;  2HMM B;  2KXG A;  3EBY A;  3CNM A;  5CXO A;  1IVU A;  2CC3 A;  4N6N B;  3EC9 A;  3NBR A;  2OOV A;  1IV7 A;  1HKX A;  3LYG A;  2SBL A;  5AIG A;  4AKY A;  3CCE 3;  3D9R A;  3KSE D;  4GL6 A;  3WA2 X;  1ISK A;  4N6T A;  2CHC A;  5KP4 A;  3LXU X;  3K0Z A;  1W6G A;  3Q1C A;  1YIJ 3;  3F40 A;  4N6M A;  2GBW B;  1YJ9 3;  2ZDJ A;  3FSD A;  1OF5 A;  3SOY A;  4EBG A;  4BTY A;  1IT8 A;  2UX0 A;  3JVC A;  1T5Y A;  1JJ2 2;  1W4N A;  2XH9 A;  3JUQ A;  1WMP A;  1Q81 4;  2JDI H;  3H3H A;  5AI1 A;  3PZW A;  3GZY B;  3ROB A;  1F8N A;  2IUK A;  3LT9 A;  1JV2 B;  5AYR B;  2CFD A;  1RKY A;  3NV0 A;  2P09 A;  5A0O B;  2BMQ B;  1UW1 A;  4R1K A;  1LOX A;  2V1L A;  3NBJ A;  4IT7 A;  4JF8 A;  4STD A;  1NJI 4;  1OHO A;  5IG3 A;  4ORL A;  1VQN 3;  3KN4 A;  3FG3 A;  1PFP A;  1FUW A;  3BNE A;  1CEW I;  2CG1 A;  5AIF A;  3DGO A;  4KFF A;  1Q42 A;  2F86 B;  4R9K A;  4X2H A;  4IIA A;  1NO3 A;  1G96 A;  5DRE A;  1K9M 4;  4TX4 A;  1N9J A;  3HIG A;  3CC4 3;  3KKG A;  3F7X A;  5D81 A;  3CD6 3;  3FCS B;  3IMA B;  3JUM A;  3MSO A;  1FGQ A;  3KSP A;  3QK9 A;  5STD A;  2XFS A;  3FF2 A;  1MOL A;  4HBR A;  3NM7 A;  3EE1 A;  1Q82 4;  1W02 A;  1OHP A;  5IER A;  4EV5 A;  3CXC 2;  4JRF A;  3DMC A;  3T0U A;  1V74 A;  1A90 A;  5EVH A;  1ULI B;  1JB5 A;  1EA2 A;  1TUH A;  1ASK A;  4HM0 B;  3CC7 3;  1GD3 A;  2Y73 A;  2QA4 3;  2HMO B;  2OWP A;  5AEW B;  1OF5 B;  3EN1 B;  5IEO A;  3SOA A;  1IVV A;  1K28 A;  1VQO 3;  4HZB B;  3JUO A;  3CCM 3;  5IF6 A;  3MG3 A;  3FLJ A;  2I9W A;  1VQ7 3;  3MG2 A;  3V92 A;  1OH0 A;  2LQV A;  1O7P B;  1W2Z A;  2CG0 A;  3NV0 B;  3WMD A;  3A76 A;  2ML5 A;  4XBY A;  4MMX B;  1CQS A;  1VQ9 3;  4HM1 B;  3G8Z A;  1N9E A;  3CNX A;  3JUN A;  3VF1 A;  4XM4 A;  3DXO A;  1LXE A;  4X2O A;  3KII A;  3LML A;  3FKA A;  1QVF 2;  1WMO A;  1CYU A;  1DMM A;  2GXF A;  3NQZ A;  4XB5 A;  4O02 B;  1QAL A;  2CH9 A;  1IK3 A;  4HJL B;  1AVL A;  4FR9 A;  3PCS A;  7STD A;  5CLK A;  1FA3 A;  3DGM A;  4KVH A;  4G1M B;  4O3V A;  4XBX A;  3KZT A;  1ZX2 A;  3F14 A;  2C10 A;  5AEU B;  2FXT A;  4H3U A;  4QWT A;  4OK0 A;  1W6Y A;  3LZA A;  1YIT 3;  3BNB A;  4OUQ A;  1KQS 2;  4HM2 B;  2W9Q A;  1E3V A;  3VGN A;  3HI7 A;  3G4S 3;  1LNH A;  1JKG A;  4RNZ A;  1BUQ A;  3UJM A;  1DYU A;  3I55 3;  3DGL A;  5CF2 A;  1HU9 A;  4HM6 B;  5ELJ A;  1GD4 A;  2Z77 A;  3LOY A;  4N6O B;  3FF0 A;  5AII A;  3EB8 A;  4IPB A;  4LEH A;  1GY6 A;  5JPP A;  1RJO A;  4RNY A;  2LYX A;  2W0Q A;  5AYS C;  2BT3 A;  5TGN A;  5KP3 A;  3PS8 A;  3EQQ B;  4R9L A;  4FMC A;  4GB5 A;  2P0M A;  3FG4 A;  3X3X A;  1O7M B;  4R80 A;  3AMO A;  2QEX 3;  1UUW B;  3DGN A;  2GEY A;  1D6Z A;  3PXM A;  2WOF A;  3SX1 A;  3G6E 3;  1AR0 A;  1N5P A;  3EF8 A;  4FCZ A;  5IEN A;  2WGO A;  1EKM A;  2L4V A;  4HVN A;  1YI2 3;  1Q40 A;  4WYK A;  3EBT A;  2INX A;  4XBT A;  1K8A 4;  1D6Y A;  1D6U A;  1MNL A;  5IEP A;  3M8C A;  1DMN A;  3S28 A;  5IG0 A;  1YVB I;  2IMJ A;  1W6C A;  2YFJ B;  3CCR 3;  3LTA A;  3CCS 3;  1JKG B;  1M9G A;  1YHQ 3;  3B7C A;  1OPY A;  2PZV A;  1W7C A;  4KZ1 A;  3NQY A;  1OGX A;  5BVB A;  1JRQ A;  1VQ4 3;  3MYT A;  4ZM8 A;  1IU7 A;  5BXQ A;  3EX9 A;  4O8S A;  4FMA A;  2XF3 A;  4L8P A;  5LC6 A;  4WHA A;  1C7H A;  2XSO B;  1FGT A;  3WOF B;  4L8O A;  4FMD A;  5ELU A;  2CIU A;  3CCL 3;  1QVG 2;  1NB5 I;  1SQW A;  2XFT A;  3B4P A;  2IUJ A;  4L7K A;  5IG5 A;  5CK6 A;  4O2H A;  3KE7 A;  2MC8 A;  1WNH A;  3SXX A;  4EYC A;  3S29 A;  2BO9 B;  4HM3 B;  4WFO A;  2P05 A;  5KP1 A;  3AMO B;  3ER7 A;  1VQ6 3;  1O7W B;  4K90 B;  2QIY A;  5LC7 A;  3CCV 3;  4HM4 B;  3MHE A;  1IQX A;  1JB2 A;  1Q86 4;  4RZM A;  1OGZ A;  1QJG A;  2BNG A;  4FCJ A;  1YGE A;  2GBX B;  1QMA A;  2BMO B;  2R4I A;  2PNC A;  1Q40 B;  4WYK B;  3BND A;  3DY5 A;  1GYB A;  1NB3 I;  4AKZ A;  3X3Z A;  1KWI A;  2F98 A;  1SII A;  1JNQ A;  2E2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...