1TP6A

1.5 a crystal structure of a ntf-2 like protein of unknown function pa1314 from pseudomonas aeruginosa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
CAYRREIHHAHVAIRDWLAGDSRADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASGVDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA1314
publication title 1.5A crystal structure of a hypothetical protein PA1314 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tp6A00
3GWRA 3GZYB 1ULJB 3EJVA 2RGQA 4HZ9B 1E3VA 8CHOA 1AR0A 3EBTA 3I0YA 5IG4A 3EBYA 3DM8A 3F14A 4XBYA 5AIGA 7STDA 1A2KA 1BUQA 1O7WB 3S5CA 5IEPA 4IIAA 3MHEA 4WYKA 3DXOA 4X2HA 4HM7B 1W00A 3H51A 4HM4B 4HM0B 1OHSA 2F99A 1GY5A 4XM4A 3VSYA 4WP5A 2HMJB 1Q40B 5TGNA 5DRVA 3H3HA 3CNMA 1HKXA 4MJDA 3EQQB 4KVHA 3MG2A 3JUNA 3NBRA 5AIFA 5JPPA 4LMIA 4XDVA 1E97A 2XR8B 4K1VA 1NWWA 4ORLA 3OX9A 2GEYA 3ECFA 4XBXA 4GB5A 3NV0A 1JN5B 4R1KA 5IG5A 2GEXA 5STDA 3T8NA 3KE7A 3F8XA 5CXOA 4R9LA 1OGXA 3GRDA 1GY6A 4HJLB 5KP3A 5CF2A 3WMDA 4OVMA 4XDWA 5BVBA 4CDLA 1OH0A 5CLKA 3KSPA 4U13A 2OWPA 3KZTA 5CK6A 1GY7A 3HK4A 4STDA 3F7XA 3Q90A 5CF1A 2HMOB 1NDOB 2Z77A 3FF0A 3NXJA 4Q53A 2JQ5A 2HMKB 2PZVA 4HM5B 3FF2A 2B24B 6STDA 2GXFA 2CKFB 5IERA 4L7KA 3JUPA 4HKVB 3JUMA 2HMMB 4XB5A 1WQLB 3D9RA 3BLZA 3CPOA 3A76A 4XBTA 3OWUA 2RCDA 5KP4A 5IEOA 2HMNB 3SOYA 4K1UA 1JB5A 3DZLA 3RGAA 1EA2A 1OGZA 3KKGA 3NM2A 1O7GB 1K41A 4H3UA 1Q40A 1O7NB 1C7HA 3EN1B 2R4IA 1OF5B 2IMJA 3E99A 2YFLB 3FKAA 1S5AA 1IDPA 3T8UA 2W2CA 3FGYA 3F7SA 3SEDA 1ZO2A 2XRXB 4HZBB 3HZPA 3MG1A 5HGRA 5AIHA 1OCVA 3LYGA 1VZZA 1QJGA 3GZRA 2RFRA 5FW5A 2XSHB 1JN5A 1JKGB 2YFJB 3FSDA 1OUNA 4HM6B 1W6YA 3G8ZA 5AI1A 4LEHA 5AIIA 1OPYA 4HM3B 5KP1A 2BNGA 4FCMA 3JUOA 3ROBA 3K0ZA 3F8HA 3LZAA 3VGNA 1STDA 2F98A 3CU3A 4R9KA 4HM8B 5IG0A 4L8PA 2BMQB 2Z76A 3DUKA 3MKIA 3NHXA 3NUVA 1ULIB 4PEJA 3OWSA 3G0KA 2K54A 2XSOB 1O7HB 1TP6A 3EF8A 3G16A 3EC9A 1OHOA 1OHPA 4LGQA 3HX8A 3B4OA 1CQSA 3JUQA 5JPUA 3K7CA 1ASKA 1EG9B 1UUVB 3MG3A 1Q42A 2GBXB 4L8OA 3OXAA 1ISKA 2Z7AA 3FH1A 1E3RA 2HMLB 3ER7A 1DMMA 5IF6A 4HM2B 3GZXB 3EHCA 4J8TA 3IPTA 2YFIB 2STDA 5AEUB 3M8CA 2BMOB 1ZX2A 5IENA 4HVNA 1JB2A 4RZMA 1OF5A 2F86B 5BXQA 4N3VA 4WWUC 1SJWA 3UNLA 4WYKB 2QIYA 2CHCA 3B7CA 3UJMA 1UUWB 2A15A 3CNXA 5D82A 4OUQA 1O7PB 1GS3A 5DREA 1QMAA 1GYBA 3F40A 2BMRB 1JKGA 3SOAA 1O7MB 1NU3A 3OWYA 1JB4A 4HM1B 1W02A 3F9SA 5G2GA 3FZWA 1DMQA 4X2OA 4I4KA 2QGUA 3NV0B 3B4PA 3RGRA 3B8LA 2B1XB 2I9WA 5IG3A 5EVHA 4J9AA 3GZBA 1TUHA 5AEWB 1W01A 3MSOA 3EN8A 3BB9A 2GBWB 4FCJA 3FLJA 5D83A 3MYTA 2UX0A 3EX9A 1U5OA 3STDA 2INXA 1Z1SA 1DMNA 3DMCA 3OV4A 5D81A
chains in the Genus database with same CATH superfamily
1AVKA 3GWRA 2OCTA 4N6MA 2CX0A 3WA3A 1N5HA 3GZYB 5EEOA 1ULJB 3CCQ3 3ALAA 1NO3A 3EJVA 2RGQA 3AHSA 3ZG0A 4JRFA 4HZ9B 2KF5A 4OK0A 1IVXA 2KF6A 1E3VA 3SVAA 4N6LA 8CHOA 1IU7A 1AR0A 3SXXA 2YX9A 1I8VA 3X3XA 2ML5A 3EBTA 1BRSA 3TDGA 1IK3A 3J7Yd 1MNLA 3FG1A 2SARA 3I0YA 1TIJA 1ROVA 5IG4A 3EBYA 3NBBA 1WTHA 4BTXA 2H0GA 1N9JA 3DM8A 1FGMA 3PZWA 2IUKA 3CC73 2D1WA 3CCU3 1JBRA 1I2GA 3F14A 4EXRA 1FUTA 2Y73A 4IT7A 1RRHA 4XBYA 1JZDA 1UI7A 3CCJ3 1M904 5AIGA 1KQS2 1YJ93 1DVCA 1VQP3 2C10A 2CX1A 4ILFA 7STDA 1B2SA 1BANA 3CC43 1A2KA 4EV2A 1BUQA 1O7WB 3S5CA 4R4KA 1BRJA 3LTCA 5ELJA 4HAAA 5IEPA 1WMPA 1X1XA 2IA7A 4IIAA 3MHEA 4WYKA 1DYUA 1QALA 2L4VA 1FUSA 3DXOA 4X2HA 1K9M4 4HM7B 4AKYA 1BNJA 4ZM8A 1AV4A 1VQL3 1LOVA 3X42A 3WDGB 1VQ63 4IPBA 3D5IA 1W00A 5M19A 1IQ8A 3H51A 1LOWA 1B27A 3PXMA 4HM4B 1GOYA 4HM0B 1OHSA 2JDIH 2F99A 1G0TA 1D6UA 1I3IA 1RSNA 1GY5A 2FXTA 2O3OA 3K9MC 4FMDA 4H61A 2HMJB 2K0MA 4WP5A 2XH9A 1Q40B 5TGNA 1Q824 3CMA3 3H3HA 5DRVA 3CNMA 2F5WA 1N8QA 1RMSA 2FNQA 3G713 3Q3FA 3PGBA 3I563 1HKXA 1GOUA 4MJDA 3EQQB 1RTUA 4KVHA 3MG2A 2W0QA 3JUNA 3NBRA 5LC6A 5AIFA 5JPPA 4LMIA 4XDVA 3SYUA 3V92A 1E97A 1A67A 2XFSA 1LRAA 1EKMA 3X41A 1FGOA 2CH9A 3AGNA 6RNTA 3S27A 1PFPA 2XR8B 2OOVA 3D4AA 3BNEA 4JF8A 1ZGXA 1NNVA 4K1VA 3LMLA 3Q2PA 1NWWA 3LT8A 1MGWA 1KC84 4ORLA 3OX9A 1BUJA 1BSCA 2GEYA 3ECFA 4XBXA 1G96A 3CCM3 1BGSA 4GB5A 2V1LA 2WOFA 1JN5B 1R4CA 3NV0A 1D6YA 2W6JH 3UL6A 5FGOA 2OQEA 1JV2B 3S28A 4R1KA 4EV5A 5BU4A 2ZHXB 3D79A 5IG5A 4LSOA 1BRNL 1BNIA 1YVBI 1FGRA 1RJOA 2CWVA 2E2UA 2GEXA 2W56A 1BSEA 3D5GA 3DH2A 3DGOA 3PYJA 4RNTA 2CK3H 3KE7A 5STDA 3T8NA 1GMRA 1LQMB 3F8XA 5CXOA 3V99A 4HYZA 1OGXA 4R9LA 3V98A 3GRDA 1GY6A 4HJLB 1TRPA 2F56A 3HI7A 1FZUA 1K28A 5KP3A 1MOLA 3CCE3 1HZ1A 1TFOA 3X3YA 5CF2A 5BIRA 3CXC2 1W2ZA 3K5TA 3WMDA 1CEWI 4OVMA 4XDWA 5BVBA 1RGHA 2PNCA 4CDLA 1OH0A 2P38A 3L0RA 7RNTA 1RN1A 5CLKA 3KSPA 2M7OA 2WGOA 2XFTA 3WODG 3LTBA 4KFEA 4U13A 3CD63 5I97A 1TJDA 2BIRA 1IT7A 2BU4A 2OWPA 3HIGA 2E2TA 3KZTA 3PCSA 4O3VA 5CK6A 2CFGA 1GY7A 3LXUX 1M9GA 3HK4A 2OQEC 1OACA 4STDA 1QVF2 3F7XA 2D42A 1UCKA 1X1YA 3Q90A 5CF1A 3CCS3 2HMOB 3CCV3 4MMXB 3GSPA 1PY3A 1NDOB 2Z77A 3FF0A 1W4NA 1RGEA 3NXJA 4KT3B 4Q53A 1BIRA 2JQ5A 1YHQ3 3K63A 2HMKB 1W6CA 2PZVA 4O2HA 4HM5B 4LYLB 4RNZA 1V57A 2CC3A 3FF2A 2B24B 1WMNA 4N6NB 3AGOA 3LOYA 4BTYA 1BSDA 2GXFA 6STDA 1DVDA 2CG0A 1RDSA 2CKFB 5M18A 1RKYA 1IVVA 3LT9A 1JBSA 1YVSA 2MC8A 2Q07A 5IERA 4L7KA 3JUPA 1HU9A 2KXGA 1B2MA 3DGNA 2F4YA 1KD14 4HKVB 1GMPA 1LNHA 3JUMA 1RN7A 1MWTA 1PYLA 2HMMB 4XB5A 5AYRB 3SX1A 1BVIA 1YIT3 1WQLB 3WHOA 4BTWA 1KSIA 2IY2A 2AADA 3D9RA 3BLZA 1B21A 3CPOA 3PS8A 3A76A 3AMOB 4XBTA 3OWUA 4XM4A 3JVCA 1S723 1RGAA 3NQYA 1HYFA 2RCDA 1X1UA 3WOFB 5KP4A 5IEOA 1A90A 1LNIA 2W03A 1UCLA 1L5GB 2HMNB 1IQYA 3SOYA 4K1UA 1JB5A 1BNRA 1D6ZA 3DZLA 3RGAA 1EA2A 1OGZA 1UDII 2CIUA 1N8R4 3HIIA 1WMOA 3KKGA 3WR2A 1RCKA 3MPHA 3NM2A 2F5MA 1O7GB 1BSAA 4NPBA 3N8BA 1K41A 4KZ1A 2P0XA 1K734 1I2EA 4GL6A 3FG3A 1Q40A 4H3UA 1M1K4 1O7NB 1TFKA 1C7HA 1GMQA 1LXEA 1RGKA 3EN1B 2R4IA 2XGLA 1OF5B 2IMJA 2GSPA 3E99A 2YFLB 3FKAA 1S5AA 1B2ZA 1IDPA 1LOXA 2W2CA 3FGYA 3F7SA 3SEDA 3T8UA 1ZO2A 2XRXB 3MWZA 4HZBB 3HZPA 3MG1A 5G1KA 1RGGA 1AQZA 5HGRA 2Z6BA 5AIHA 3CC23 1OCVA 3U1WA 1SQWA 3LYGA 2CWTA 1VZZA 2CFLA 1STFI 2J8XB 2MF7A 3ZFZA 1QJGA 3QRDA 3BNBA 2RFRA 3GZRA 4BIRA 5FW5A 7GSPA 1N9EA 1Q7HA 4CPKA 2XSHB 3CCL3 3G4S3 1U8CB 1Q7Y4 5M1AA 3Q1CA 3WOEB 1JN5A 3S29A 1V58A 2QEX3 1JKGB 1IYYA 2YFJB 3FSDA 1QVG2 2KAAA 1QAFA 2OTL3 3EE1A 1OUNA 4HM6B 3AHWA 3KFQC 1W6YA 4GSPA 3G8ZA 1AVLA 1JNQA 3A5EA 5AI1A 1A2VA 3NX0A 3RDEA 2W9QA 4LEHA 5AIIA 1MWUA 1GD4A 1VQ73 1OPYA 3BNCA 4FCZA 3GAXA 4HM3B 1BRKA 4R80A 1TRQA 1RLSA 5KP1A 1PU4A 2BNGA 4FCMA 4N6OB 1B3SA 3BU4A 3JUOA 1RNTA 3ROBA 2P05A 1F8NA 4RBNA 1T5YA 1VQO3 3K0ZA 1VQN3 3F8HA 1W5ZA 1RHLA 1T2IA 3LZAA 1STDA 5LC7A 2F98A 3VGNA 3CU3A 4R9KA 1MGRA 4HM8B 4CCVA 1VQ83 5IG0A 4L8PA 2BMQB 1T2HA 4O02B 1W2B2 2Z76A 8RNTA 4AEQA 2LYXA 3DUKA 1IVUA 2RBIA 3LTAA 3MKIA 1R4YA 3NHXA 1TTOA 2FGTA 3NUVA 1ULIB 4PEJA 1VQ93 1RN4A 2UUGC 3KCHA 1I2FA 3G0KA 3OWSA 3U97A 2K54A 3FCSB 1GSPA 4FMAA 2CW9A 2XSOB 1LQGC 3CME3 1VQ43 1Q9EA 1O7HB 1TP6A 3EF8A 2ZL8A 1IT8A 1QAKA 2CFWA 3G16A 1IV7A 3EC9A 2QA43 1OHOA 1OHPA 4LGQA 1KWIA 5ELUA 1V74A 2P0MA 3HX8A 1IV9A 3X3ZA 1M1XB 1CQSA 2WGQA 3B4OA 3JUQA 5JPUA 3K7CA 1FGTA 2CFDA 1W7CA 1BSBA 2HOHA 2O9UX 5HOHA 1YIJ3 1SPUA 4EW5A 1GD3A 2RNTA 2UGIA 4J5KA 2BHMA 1ASKA 4O8SA 1EG9B 4NREA 1X1WA 1UUVB 3BIRA 3FG4A 1BOXA 1FW7A 2GU1A 4BL2A 1LVNA 1NB3I 4WHAA 4GHOA 2C4BA 3MG3A 2GU3A 1K8A4 1Q42A 2XF3A 1TU5A 2RSXA 2GBXB 3HOHA 4L8OA 4LZIA 3T0UA 3LH4A 1Y4KA 1YNVX 3AMOA 3UB1A 2LQVA 3OXAA 4MMZB 1ISKA 2Z7AA 3FH1A 1E3RA 1I70A 1VQK3 2HMLB 1RNBA 1I0XA 1UCJA 3ER7A 3NM7A 3DGYA 3PCRA 4G1MB 2K3DA 1BNFA 3KIIA 5G1LA 4EC6A 1MWSA 4N6TA 1DMMA 1CYVA 1I0VA 1J2BA 1JBTA 5GSPA 5IF6A 4HM2B 4BU4A 3GZXB 4KFFA 4KFDA 1UGHI 3VF1A 2L1SA 3EHCA 4J8TA 3IPTA 9RNTA 2YFIB 1A2PA 3X40A 1BNGA 2STDA 5AEUB 1FYSA 2BMOB 1ZX2A 3M8CA 4MMYB 5IENA 4NHFA 1YJW3 4HVNA 1JB2A 1UGIA 4RZMA 2ZA4A 2Y74A 1YGWA 1OF5A 2F86B 1W6GA 4I5QA 3VSYA 5BXQA 4N3VA 1EQKA 2ML6A 4WWUC 6GSPA 5IW9A 3N9HA 2ZDJA 1N5PA 1YJN3 1SJWA 3CPW2 3NQZA 1B20A 3RNTA 3UNLA 1C54A 1RGCA 4WYKB 2QIYA 2CHCA 3B7CA 1I3FA 1Q814 3UJMA 2BT3A 4AKZA 3KN4A 2XEPA 4RNYA 1YI23 5RNTA 4WFOA 1JRQA 3N54B 4K90B 1IQXA 1UUWB 2IUJA 2A15A 3CNXA 1BRGA 1FUWA 4N6V0 5D82A 4OUQA 1O7PB 1ROAA 1NB5I 1UW1A 1ZS7A 1GS3A 5DREA 1DE3A 1QMAA 1SARA 3OW22 1GYBA 1SIIA 3F40A 1IVWA 1EUIC 1GOVA 2BMRB 5IG3A 1JKGA 1Q864 3D3LA 4EBGA 1VQ53 1BAOA 3CCR3 3SOAA 1O7MB 4QWTA 1NU3A 2KRTA 2WO0A 1VQM3 3OWYA 1JB4A 1B2UA 4K61A 2SBLA 5EQLA 2R41A 2CG1A 1AY7A 1W02A 4HM1B 4TX4A 3F9SA 2AAEA 2BO9B 1FA3A 3QK9A 5G2GA 3DGLA 3FZWA 2WOHA 3S67A 3URPA 1SIHA 1B2XA 4MEIA 3IMAB 1FGQA 1MWRA 3IJEB 5JBSA 1DMQA 2C11A 1DETA 5A0OB 3KSED 3O8YA 4HBRA 4X2OA 1CH0A 1UUGB 4I4KA 1NJI4 2QGUA 3NV0B 2P09A 3WA2X 1CYUA 1G02A 3B4PA 3LTDA 3RGRA 3DY5A 1YGEA 1UI8A 3B8LA 4BL3A 3G6E3 2W9PA 2B1XB 1JZOA 2I9WA 3DGMA 4FR9A 5EVHA 4CJNA 2CWUA 4EYCA 2W56B 4J9AA 2IYJA 4N6UA 1EEJA 1RRLA 3GZBA 3ZG5A 2H0HA 1TUHA 1WNHA 1US1A 2CFKA 3I553 1RCLA 4FMBA 1W01A 3MSOA 3NBJA 5AEWB 3EN8A 2H0IA 4FMCA 3UL5A 1BRIA 1BNSA 2OOVC 3BB9A 2XGNA 4HOHA 2GBWB 4FCJA 1UCIA 3FLJA 5D83A 1RGFA 2KF3A 1JJ22 5AYSC 3MYTA 3BNDA 3EB8A 2UX0A 1LOYA 1T3BA 1BNEA 1RGLA 2KCDA 3EX9A 1U5OA 3STDA 1BRHA 2INXA 4J5GA 4DKIA 2OTJ3 1Z1SA 1DMNA 2E2VA 2KF4A 2W04A 3DMCA 3OV4A 5D81A 3SLUA 1BU4A 1VQQA
chains in the Genus database with same CATH topology
1AVKA 3GWRA 2OCTA 4N6MA 3WA3A 1N5HA 3GZYB 5EEOA 1ULJB 3CCQ3 3ALAA 1NO3A 3EJVA 2RGQA 4JRFA 4HZ9B 4OK0A 1IVXA 1E3VA 3SVAA 4N6LA 8CHOA 1IU7A 1AR0A 3SXXA 2YX9A 3X3XA 1IK3A 2ML5A 3EBTA 3TDGA 3J7Yd 1MNLA 3FG1A 3I0YA 1TIJA 1ROVA 5IG4A 3EBYA 3NBBA 1WTHA 4BTXA 1N9JA 3DM8A 1FGMA 3PZWA 2IUKA 3CC73 2D1WA 3CCU3 3F14A 4EXRA 2Y73A 4IT7A 1RRHA 4XBYA 1UI7A 3CCJ3 1M904 5AIGA 1KQS2 1YJ93 1DVCA 1VQP3 2C10A 7STDA 3CC43 1A2KA 4EV2A 1BUQA 1O7WB 3S5CA 4R4KA 5ELJA 3LTCA 5IEPA 1WMPA 2IA7A 4IIAA 3MHEA 4WYKA 1DYUA 1QALA 2L4VA 3DXOA 4X2HA 1K9M4 4HM7B 4AKYA 4ZM8A 1AV4A 1VQL3 3X42A 3WDGB 1VQ63 4IPBA 1W00A 1IQ8A 3H51A 3PXMA 4HM4B 4HM0B 1OHSA 2JDIH 2F99A 3PCSA 1D6UA 4FMDA 2FXTA 1GY5A 4H61A 2O3OA 3K9MC 4O3VA 4WP5A 2HMJB 2K0MA 4XM4A 2XH9A 1Q40B 5TGNA 1Q824 3H3HA 5DRVA 3CNMA 2FNQA 1N8QA 3G713 3PGBA 3I563 1HKXA 4MJDA 3EQQB 4KVHA 3MG2A 2W0QA 3JUNA 3NBRA 5LC6A 5AIFA 5JPPA 4LMIA 4XDVA 3V92A 1A67A 1E97A 2XFSA 3X41A 1EKMA 1FGOA 2CH9A 3S27A 1PFPA 2XR8B 2OOVA 3BNEA 4JF8A 4K1VA 3LMLA 3Q2PA 1NWWA 3LT8A 1KC84 4ORLA 3OX9A 2GEYA 3ECFA 4XBXA 1G96A 3CCM3 4GB5A 2V1LA 2WOFA 1JN5B 1R4CA 3NV0A 1D6YA 2W6JH 3UL6A 5FGOA 2OQEA 1JV2B 3S28A 4R1KA 4EV5A 5IG5A 4LSOA 1YVBI 1FGRA 1RJOA 2CWVA 2E2UA 2GEXA 2W56A 3PYJA 5STDA 3T8NA 3DGOA 1Q864 2CK3H 3KE7A 3F8XA 5CXOA 3V99A 4HYZA 1OGXA 4R9LA 3V98A 3GRDA 1GY6A 4HJLB 3HI7A 1K28A 5KP3A 1MOLA 3CCE3 1TFOA 3X3YA 5CF2A 3CXC2 1W2ZA 3K5TA 3WMDA 1CEWI 4OVMA 4XDWA 5BVBA 2PNCA 4CDLA 1OH0A 2P38A 3L0RA 5CLKA 3KSPA 2M7OA 2WGOA 2XFTA 3WODG 3LTBA 4KFEA 4U13A 3CD63 5I97A 1IT7A 2OWPA 3HIGA 3KZTA 2E2TA 5CK6A 2CFGA 1GY7A 3LXUX 1M9GA 3HK4A 2OQEC 1OACA 4STDA 1QVF2 3F7XA 2D42A 3Q90A 5CF1A 3CCS3 2HMOB 3CCV3 4MMXB 1NDOB 2Z77A 3FF0A 1W4NA 3NXJA 4Q53A 2JQ5A 1YHQ3 3K63A 2HMKB 1W6CA 2PZVA 4O2HA 4HM5B 4RNZA 2CC3A 3FF2A 2B24B 1WMNA 4N6NB 3LOYA 4BTYA 6STDA 2GXFA 1DVDA 2CG0A 2CKFB 1RKYA 1IVVA 3LT9A 2MC8A 2Q07A 5IERA 4L7KA 3JUPA 1HU9A 2KXGA 3DGNA 1KD14 4HKVB 1LNHA 3JUMA 1RN7A 2HMMB 4XB5A 5AYRB 3SX1A 1YIT3 1WQLB 4BTWA 1KSIA 3D9RA 3BLZA 3PS8A 3CPOA 3A76A 3AMOB 4XBTA 3OWUA 3JVCA 1S723 3NQYA 2RCDA 1A90A 3WOFB 5KP4A 5IEOA 2W03A 1L5GB 2HMNB 1IQYA 3SOYA 4K1UA 1JB5A 1D6ZA 3DZLA 3RGAA 1EA2A 1OGZA 2CIUA 1N8R4 3HIIA 1WMOA 3KKGA 3MPHA 3NM2A 1O7GB 3N8BA 1K41A 4KZ1A 2P0XA 1K734 4GL6A 3FG3A 1Q40A 4H3UA 1M1K4 1O7NB 1TFKA 1C7HA 1LXEA 3EN1B 2R4IA 2XGLA 1OF5B 2IMJA 3E99A 2YFLB 3FKAA 1S5AA 1IDPA 1LOXA 3T8UA 2W2CA 3FGYA 3F7SA 3SEDA 3CMA3 1ZO2A 2XRXB 3MWZA 4HZBB 3HZPA 3MG1A 5HGRA 2Z6BA 5AIHA 3CC23 1OCVA 3U1WA 1SQWA 3LYGA 2CWTA 1VZZA 2CFLA 1STFI 2MF7A 1QJGA 3QRDA 3BNBA 2RFRA 3GZRA 5FW5A 1N9EA 2XSHB 3CCL3 3G4S3 1U8CB 1Q7Y4 3Q1CA 3WOEB 1JN5A 3S29A 2QEX3 1JKGB 2YFJB 3FSDA 1QVG2 1QAFA 2OTL3 3EE1A 1OUNA 4HM6B 3KFQC 1W6YA 3G8ZA 1AVLA 1JNQA 5AI1A 1A2VA 3NX0A 3RDEA 2W9QA 4LEHA 5AIIA 1GD4A 1VQ73 1OPYA 3BNCA 4FCZA 3GAXA 4HM3B 4R80A 1PU4A 5KP1A 2BNGA 4FCMA 4N6OB 3JUOA 3ROBA 2P05A 1F8NA 4RBNA 1T5YA 1VQO3 3K0ZA 1VQN3 3F8HA 1W5ZA 3LZAA 3VGNA 1STDA 5LC7A 2F98A 3CU3A 4R9KA 4HM8B 4CCVA 1VQ83 5IG0A 4L8PA 2BMQB 4O02B 1W2B2 2Z76A 4AEQA 2LYXA 3DUKA 1IVUA 3LTAA 3MKIA 3NHXA 3NUVA 2FGTA 1ULIB 4PEJA 1VQ93 3OWSA 3G0KA 3U97A 2K54A 3FCSB 4FMAA 2CW9A 2XSOB 3CME3 1VQ43 1O7HB 1TP6A 3EF8A 2ZL8A 1IT8A 1QAKA 2CFWA 3G16A 1IV7A 3EC9A 2QA43 1OHOA 1OHPA 4LGQA 1KWIA 5ELUA 1V74A 2P0MA 3HX8A 1IV9A 3X3ZA 1M1XB 1CQSA 2WGQA 3B4OA 3JUQA 5JPUA 3K7CA 1FGTA 2CFDA 1W7CA 1YIJ3 2O9UX 1SPUA 1GD3A 2BHMA 1ASKA 4O8SA 1EG9B 4NREA 1UUVB 3FG4A 2GU1A 1LVNA 1NB3I 4WHAA 3MG3A 2GU3A 1K8A4 1Q42A 2XF3A 1TU5A 2RSXA 2GBXB 4L8OA 4LZIA 3T0UA 3LH4A 1Y4KA 3AMOA 3UB1A 2LQVA 3OXAA 4MMZB 1ISKA 2Z7AA 3FH1A 1E3RA 1VQK3 2HMLB 3ER7A 3NM7A 3PCRA 4G1MB 3KIIA 4EC6A 4N6TA 1DMMA 1CYVA 1J2BA 5IF6A 4HM2B 3GZXB 4KFFA 4KFDA 3VF1A 3EHCA 4J8TA 3IPTA 2YFIB 3X40A 2STDA 5AEUB 3M8CA 2BMOB 1ZX2A 4MMYB 5IENA 1YJW3 4NHFA 4HVNA 1JB2A 4RZMA 2Y74A 1OF5A 2F86B 1W6GA 3VSYA 5BXQA 4N3VA 1EQKA 2ML6A 4WWUC 5IW9A 3N9HA 2ZDJA 1N5PA 1YJN3 1SJWA 3CPW2 3NQZA 3UNLA 4WYKB 2QIYA 2CHCA 3B7CA 1Q814 3UJMA 2BT3A 4AKZA 3KN4A 2XEPA 4RNYA 1YI23 4WFOA 1JRQA 3N54B 4K90B 1IQXA 1UUWB 2IUJA 2A15A 3CNXA 1FUWA 4N6V0 5D82A 4OUQA 1O7PB 1ROAA 1NB5I 1UW1A 1GS3A 5DREA 1QMAA 3OW22 1GYBA 1SIIA 3F40A 1IVWA 2BMRB 1JKGA 3D3LA 4EBGA 1VQ53 3CCR3 3SOAA 1O7MB 4QWTA 1NU3A 2KRTA 2WO0A 1VQM3 3OWYA 1JB4A 4K61A 2SBLA 5EQLA 2CG1A 4HM1B 1W02A 4TX4A 3F9SA 2BO9B 1FA3A 3QK9A 5G2GA 3DGLA 3FZWA 2WOHA 3S67A 1SIHA 4MEIA 3IMAB 1FGQA 3IJEB 5JBSA 1DMQA 2C11A 5A0OB 3KSED 3O8YA 4HBRA 4X2OA 4I4KA 1NJI4 2QGUA 3NV0B 2P09A 3WA2X 1CYUA 3B4PA 3LTDA 3RGRA 3DY5A 1YGEA 1UI8A 3B8LA 3G6E3 2W9PA 2B1XB 2I9WA 4EYCA 3DGMA 4FR9A 5EVHA 5IG3A 2CWUA 2W56B 4J9AA 4N6UA 1RRLA 3GZBA 1TUHA 1WNHA 1US1A 2CFKA 3I553 5AEWB 4FMBA 1W01A 3MSOA 3NBJA 3EN8A 4FMCA 3UL5A 3BB9A 2OOVC 2XGNA 2GBWB 4FCJA 3FLJA 5D83A 1JJ22 5AYSC 3MYTA 3BNDA 3EB8A 2UX0A 2KCDA 3EX9A 1U5OA 3STDA 2INXA 2OTJ3 1Z1SA 1DMNA 2E2VA 2W04A 3DMCA 3OV4A 5D81A 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GWR A;  3GZY B;  1ULJ B;  3EJV A;  2RGQ A;  4HZ9 B;  1E3V A;  8CHO A;  1AR0 A;  3EBT A;  3I0Y A;  5IG4 A;  3EBY A;  3DM8 A;  3F14 A;  4XBY A;  5AIG A;  7STD A;  1A2K A;  1BUQ A;  1O7W B;  3S5C A;  5IEP A;  4IIA A;  3MHE A;  4WYK A;  3DXO A;  4X2H A;  4HM7 B;  1W00 A;  3H51 A;  4HM4 B;  4HM0 B;  1OHS A;  2F99 A;  1GY5 A;  4XM4 A;  3VSY A;  4WP5 A;  2HMJ B;  1Q40 B;  5TGN A;  5DRV A;  3H3H A;  3CNM A;  1HKX A;  4MJD A;  3EQQ B;  4KVH A;  3MG2 A;  3JUN A;  3NBR A;  5AIF A;  5JPP A;  4LMI A;  4XDV A;  1E97 A;  2XR8 B;  4K1V A;  1NWW A;  4ORL A;  3OX9 A;  2GEY A;  3ECF A;  4XBX A;  4GB5 A;  3NV0 A;  1JN5 B;  4R1K A;  5IG5 A;  2GEX A;  5STD A;  3T8N A;  3KE7 A;  3F8X A;  5CXO A;  4R9L A;  1OGX A;  3GRD A;  1GY6 A;  4HJL B;  5KP3 A;  5CF2 A;  3WMD A;  4OVM A;  4XDW A;  5BVB A;  4CDL A;  1OH0 A;  5CLK A;  3KSP A;  4U13 A;  2OWP A;  3KZT A;  5CK6 A;  1GY7 A;  3HK4 A;  4STD A;  3F7X A;  3Q90 A;  5CF1 A;  2HMO B;  1NDO B;  2Z77 A;  3FF0 A;  3NXJ A;  4Q53 A;  2JQ5 A;  2HMK B;  2PZV A;  4HM5 B;  3FF2 A;  2B24 B;  6STD A;  2GXF A;  2CKF B;  5IER A;  4L7K A;  3JUP A;  4HKV B;  3JUM A;  2HMM B;  4XB5 A;  1WQL B;  3D9R A;  3BLZ A;  3CPO A;  3A76 A;  4XBT A;  3OWU A;  2RCD A;  5KP4 A;  5IEO A;  2HMN B;  3SOY A;  4K1U A;  1JB5 A;  3DZL A;  3RGA A;  1EA2 A;  1OGZ A;  3KKG A;  3NM2 A;  1O7G B;  1K41 A;  4H3U A;  1Q40 A;  1O7N B;  1C7H A;  3EN1 B;  2R4I A;  1OF5 B;  2IMJ A;  3E99 A;  2YFL B;  3FKA A;  1S5A A;  1IDP A;  3T8U A;  2W2C A;  3FGY A;  3F7S A;  3SED A;  1ZO2 A;  2XRX B;  4HZB B;  3HZP A;  3MG1 A;  5HGR A;  5AIH A;  1OCV A;  3LYG A;  1VZZ A;  1QJG A;  3GZR A;  2RFR A;  5FW5 A;  2XSH B;  1JN5 A;  1JKG B;  2YFJ B;  3FSD A;  1OUN A;  4HM6 B;  1W6Y A;  3G8Z A;  5AI1 A;  4LEH A;  5AII A;  1OPY A;  4HM3 B;  5KP1 A;  2BNG A;  4FCM A;  3JUO A;  3ROB A;  3K0Z A;  3F8H A;  3LZA A;  3VGN A;  1STD A;  2F98 A;  3CU3 A;  4R9K A;  4HM8 B;  5IG0 A;  4L8P A;  2BMQ B;  2Z76 A;  3DUK A;  3MKI A;  3NHX A;  3NUV A;  1ULI B;  4PEJ A;  3OWS A;  3G0K A;  2K54 A;  2XSO B;  1O7H B;  1TP6 A;  3EF8 A;  3G16 A;  3EC9 A;  1OHO A;  1OHP A;  4LGQ A;  3HX8 A;  3B4O A;  1CQS A;  3JUQ A;  5JPU A;  3K7C A;  1ASK A;  1EG9 B;  1UUV B;  3MG3 A;  1Q42 A;  2GBX B;  4L8O A;  3OXA A;  1ISK A;  2Z7A A;  3FH1 A;  1E3R A;  2HML B;  3ER7 A;  1DMM A;  5IF6 A;  4HM2 B;  3GZX B;  3EHC A;  4J8T A;  3IPT A;  2YFI B;  2STD A;  5AEU B;  3M8C A;  2BMO B;  1ZX2 A;  5IEN A;  4HVN A;  1JB2 A;  4RZM A;  1OF5 A;  2F86 B;  5BXQ A;  4N3V A;  4WWU C;  1SJW A;  3UNL A;  4WYK B;  2QIY A;  2CHC A;  3B7C A;  3UJM A;  1UUW B;  2A15 A;  3CNX A;  5D82 A;  4OUQ A;  1O7P B;  1GS3 A;  5DRE A;  1QMA A;  1GYB A;  3F40 A;  2BMR B;  1JKG A;  3SOA A;  1O7M B;  1NU3 A;  3OWY A;  1JB4 A;  4HM1 B;  1W02 A;  3F9S A;  5G2G A;  3FZW A;  1DMQ A;  4X2O A;  4I4K A;  2QGU A;  3NV0 B;  3B4P A;  3RGR A;  3B8L A;  2B1X B;  2I9W A;  5IG3 A;  5EVH A;  4J9A A;  3GZB A;  1TUH A;  5AEW B;  1W01 A;  3MSO A;  3EN8 A;  3BB9 A;  2GBW B;  4FCJ A;  3FLJ A;  5D83 A;  3MYT A;  2UX0 A;  3EX9 A;  1U5O A;  3STD A;  2INX A;  1Z1S A;  1DMN A;  3DMC A;  3OV4 A;  5D81 A; 
#chains in the Genus database with same CATH topology
 1AVK A;  3GWR A;  2OCT A;  4N6M A;  2CX0 A;  3WA3 A;  1N5H A;  3GZY B;  5EEO A;  1ULJ B;  3CCQ 3;  3ALA A;  1NO3 A;  3EJV A;  2RGQ A;  3AHS A;  3ZG0 A;  4JRF A;  4HZ9 B;  2KF5 A;  4OK0 A;  1IVX A;  2KF6 A;  1E3V A;  3SVA A;  4N6L A;  8CHO A;  1IU7 A;  1AR0 A;  3SXX A;  2YX9 A;  1I8V A;  3X3X A;  2ML5 A;  3EBT A;  1BRS A;  3TDG A;  1IK3 A;  3J7Y d;  1MNL A;  3FG1 A;  2SAR A;  3I0Y A;  1TIJ A;  1ROV A;  5IG4 A;  3EBY A;  3NBB A;  1WTH A;  4BTX A;  2H0G A;  1N9J A;  3DM8 A;  1FGM A;  3PZW A;  2IUK A;  3CC7 3;  2D1W A;  3CCU 3;  1JBR A;  1I2G A;  3F14 A;  4EXR A;  1FUT A;  2Y73 A;  4IT7 A;  1RRH A;  4XBY A;  1JZD A;  1UI7 A;  3CCJ 3;  1M90 4;  5AIG A;  1KQS 2;  1YJ9 3;  1DVC A;  1VQP 3;  2C10 A;  2CX1 A;  4ILF A;  7STD A;  1B2S A;  1BAN A;  3CC4 3;  1A2K A;  4EV2 A;  1BUQ A;  1O7W B;  3S5C A;  4R4K A;  1BRJ A;  3LTC A;  5ELJ A;  4HAA A;  5IEP A;  1WMP A;  1X1X A;  2IA7 A;  4IIA A;  3MHE A;  4WYK A;  1DYU A;  1QAL A;  2L4V A;  1FUS A;  3DXO A;  4X2H A;  1K9M 4;  4HM7 B;  4AKY A;  1BNJ A;  4ZM8 A;  1AV4 A;  1VQL 3;  1LOV A;  3X42 A;  3WDG B;  1VQ6 3;  4IPB A;  3D5I A;  1W00 A;  5M19 A;  1IQ8 A;  3H51 A;  1LOW A;  1B27 A;  3PXM A;  4HM4 B;  1GOY A;  4HM0 B;  1OHS A;  2JDI H;  2F99 A;  1G0T A;  1D6U A;  1I3I A;  1RSN A;  1GY5 A;  2FXT A;  2O3O A;  3K9M C;  4FMD A;  4H61 A;  2HMJ B;  2K0M A;  4WP5 A;  2XH9 A;  1Q40 B;  5TGN A;  1Q82 4;  3CMA 3;  3H3H A;  5DRV A;  3CNM A;  2F5W A;  1N8Q A;  1RMS A;  2FNQ A;  3G71 3;  3Q3F A;  3PGB A;  3I56 3;  1HKX A;  1GOU A;  4MJD A;  3EQQ B;  1RTU A;  4KVH A;  3MG2 A;  2W0Q A;  3JUN A;  3NBR A;  5LC6 A;  5AIF A;  5JPP A;  4LMI A;  4XDV A;  3SYU A;  3V92 A;  1E97 A;  1A67 A;  2XFS A;  1LRA A;  1EKM A;  3X41 A;  1FGO A;  2CH9 A;  3AGN A;  6RNT A;  3S27 A;  1PFP A;  2XR8 B;  2OOV A;  3D4A A;  3BNE A;  4JF8 A;  1ZGX A;  1NNV A;  4K1V A;  3LML A;  3Q2P A;  1NWW A;  3LT8 A;  1MGW A;  1KC8 4;  4ORL A;  3OX9 A;  1BUJ A;  1BSC A;  2GEY A;  3ECF A;  4XBX A;  1G96 A;  3CCM 3;  1BGS A;  4GB5 A;  2V1L A;  2WOF A;  1JN5 B;  1R4C A;  3NV0 A;  1D6Y A;  2W6J H;  3UL6 A;  5FGO A;  2OQE A;  1JV2 B;  3S28 A;  4R1K A;  4EV5 A;  5BU4 A;  2ZHX B;  3D79 A;  5IG5 A;  4LSO A;  1BRN L;  1BNI A;  1YVB I;  1FGR A;  1RJO A;  2CWV A;  2E2U A;  2GEX A;  2W56 A;  1BSE A;  3D5G A;  3DH2 A;  3DGO A;  3PYJ A;  4RNT A;  2CK3 H;  3KE7 A;  5STD A;  3T8N A;  1GMR A;  1LQM B;  3F8X A;  5CXO A;  3V99 A;  4HYZ A;  1OGX A;  4R9L A;  3V98 A;  3GRD A;  1GY6 A;  4HJL B;  1TRP A;  2F56 A;  3HI7 A;  1FZU A;  1K28 A;  5KP3 A;  1MOL A;  3CCE 3;  1HZ1 A;  1TFO A;  3X3Y A;  5CF2 A;  5BIR A;  3CXC 2;  1W2Z A;  3K5T A;  3WMD A;  1CEW I;  4OVM A;  4XDW A;  5BVB A;  1RGH A;  2PNC A;  4CDL A;  1OH0 A;  2P38 A;  3L0R A;  7RNT A;  1RN1 A;  5CLK A;  3KSP A;  2M7O A;  2WGO A;  2XFT A;  3WOD G;  3LTB A;  4KFE A;  4U13 A;  3CD6 3;  5I97 A;  1TJD A;  2BIR A;  1IT7 A;  2BU4 A;  2OWP A;  3HIG A;  2E2T A;  3KZT A;  3PCS A;  4O3V A;  5CK6 A;  2CFG A;  1GY7 A;  3LXU X;  1M9G A;  3HK4 A;  2OQE C;  1OAC A;  4STD A;  1QVF 2;  3F7X A;  2D42 A;  1UCK A;  1X1Y A;  3Q90 A;  5CF1 A;  3CCS 3;  2HMO B;  3CCV 3;  4MMX B;  3GSP A;  1PY3 A;  1NDO B;  2Z77 A;  3FF0 A;  1W4N A;  1RGE A;  3NXJ A;  4KT3 B;  4Q53 A;  1BIR A;  2JQ5 A;  1YHQ 3;  3K63 A;  2HMK B;  1W6C A;  2PZV A;  4O2H A;  4HM5 B;  4LYL B;  4RNZ A;  1V57 A;  2CC3 A;  3FF2 A;  2B24 B;  1WMN A;  4N6N B;  3AGO A;  3LOY A;  4BTY A;  1BSD A;  2GXF A;  6STD A;  1DVD A;  2CG0 A;  1RDS A;  2CKF B;  5M18 A;  1RKY A;  1IVV A;  3LT9 A;  1JBS A;  1YVS A;  2MC8 A;  2Q07 A;  5IER A;  4L7K A;  3JUP A;  1HU9 A;  2KXG A;  1B2M A;  3DGN A;  2F4Y A;  1KD1 4;  4HKV B;  1GMP A;  1LNH A;  3JUM A;  1RN7 A;  1MWT A;  1PYL A;  2HMM B;  4XB5 A;  5AYR B;  3SX1 A;  1BVI A;  1YIT 3;  1WQL B;  3WHO A;  4BTW A;  1KSI A;  2IY2 A;  2AAD A;  3D9R A;  3BLZ A;  1B21 A;  3CPO A;  3PS8 A;  3A76 A;  3AMO B;  4XBT A;  3OWU A;  4XM4 A;  3JVC A;  1S72 3;  1RGA A;  3NQY A;  1HYF A;  2RCD A;  1X1U A;  3WOF B;  5KP4 A;  5IEO A;  1A90 A;  1LNI A;  2W03 A;  1UCL A;  1L5G B;  2HMN B;  1IQY A;  3SOY A;  4K1U A;  1JB5 A;  1BNR A;  1D6Z A;  3DZL A;  3RGA A;  1EA2 A;  1OGZ A;  1UDI I;  2CIU A;  1N8R 4;  3HII A;  1WMO A;  3KKG A;  3WR2 A;  1RCK A;  3MPH A;  3NM2 A;  2F5M A;  1O7G B;  1BSA A;  4NPB A;  3N8B A;  1K41 A;  4KZ1 A;  2P0X A;  1K73 4;  1I2E A;  4GL6 A;  3FG3 A;  1Q40 A;  4H3U A;  1M1K 4;  1O7N B;  1TFK A;  1C7H A;  1GMQ A;  1LXE A;  1RGK A;  3EN1 B;  2R4I A;  2XGL A;  1OF5 B;  2IMJ A;  2GSP A;  3E99 A;  2YFL B;  3FKA A;  1S5A A;  1B2Z A;  1IDP A;  1LOX A;  2W2C A;  3FGY A;  3F7S A;  3SED A;  3T8U A;  1ZO2 A;  2XRX B;  3MWZ A;  4HZB B;  3HZP A;  3MG1 A;  5G1K A;  1RGG A;  1AQZ A;  5HGR A;  2Z6B A;  5AIH A;  3CC2 3;  1OCV A;  3U1W A;  1SQW A;  3LYG A;  2CWT A;  1VZZ A;  2CFL A;  1STF I;  2J8X B;  2MF7 A;  3ZFZ A;  1QJG A;  3QRD A;  3BNB A;  2RFR A;  3GZR A;  4BIR A;  5FW5 A;  7GSP A;  1N9E A;  1Q7H A;  4CPK A;  2XSH B;  3CCL 3;  3G4S 3;  1U8C B;  1Q7Y 4;  5M1A A;  3Q1C A;  3WOE B;  1JN5 A;  3S29 A;  1V58 A;  2QEX 3;  1JKG B;  1IYY A;  2YFJ B;  3FSD A;  1QVG 2;  2KAA A;  1QAF A;  2OTL 3;  3EE1 A;  1OUN A;  4HM6 B;  3AHW A;  3KFQ C;  1W6Y A;  4GSP A;  3G8Z A;  1AVL A;  1JNQ A;  3A5E A;  5AI1 A;  1A2V A;  3NX0 A;  3RDE A;  2W9Q A;  4LEH A;  5AII A;  1MWU A;  1GD4 A;  1VQ7 3;  1OPY A;  3BNC A;  4FCZ A;  3GAX A;  4HM3 B;  1BRK A;  4R80 A;  1TRQ A;  1RLS A;  5KP1 A;  1PU4 A;  2BNG A;  4FCM A;  4N6O B;  1B3S A;  3BU4 A;  3JUO A;  1RNT A;  3ROB A;  2P05 A;  1F8N A;  4RBN A;  1T5Y A;  1VQO 3;  3K0Z A;  1VQN 3;  3F8H A;  1W5Z A;  1RHL A;  1T2I A;  3LZA A;  1STD A;  5LC7 A;  2F98 A;  3VGN A;  3CU3 A;  4R9K A;  1MGR A;  4HM8 B;  4CCV A;  1VQ8 3;  5IG0 A;  4L8P A;  2BMQ B;  1T2H A;  4O02 B;  1W2B 2;  2Z76 A;  8RNT A;  4AEQ A;  2LYX A;  3DUK A;  1IVU A;  2RBI A;  3LTA A;  3MKI A;  1R4Y A;  3NHX A;  1TTO A;  2FGT A;  3NUV A;  1ULI B;  4PEJ A;  1VQ9 3;  1RN4 A;  2UUG C;  3KCH A;  1I2F A;  3G0K A;  3OWS A;  3U97 A;  2K54 A;  3FCS B;  1GSP A;  4FMA A;  2CW9 A;  2XSO B;  1LQG C;  3CME 3;  1VQ4 3;  1Q9E A;  1O7H B;  1TP6 A;  3EF8 A;  2ZL8 A;  1IT8 A;  1QAK A;  2CFW A;  3G16 A;  1IV7 A;  3EC9 A;  2QA4 3;  1OHO A;  1OHP A;  4LGQ A;  1KWI A;  5ELU A;  1V74 A;  2P0M A;  3HX8 A;  1IV9 A;  3X3Z A;  1M1X B;  1CQS A;  2WGQ A;  3B4O A;  3JUQ A;  5JPU A;  3K7C A;  1FGT A;  2CFD A;  1W7C A;  1BSB A;  2HOH A;  2O9U X;  5HOH A;  1YIJ 3;  1SPU A;  4EW5 A;  1GD3 A;  2RNT A;  2UGI A;  4J5K A;  2BHM A;  1ASK A;  4O8S A;  1EG9 B;  4NRE A;  1X1W A;  1UUV B;  3BIR A;  3FG4 A;  1BOX A;  1FW7 A;  2GU1 A;  4BL2 A;  1LVN A;  1NB3 I;  4WHA A;  4GHO A;  2C4B A;  3MG3 A;  2GU3 A;  1K8A 4;  1Q42 A;  2XF3 A;  1TU5 A;  2RSX A;  2GBX B;  3HOH A;  4L8O A;  4LZI A;  3T0U A;  3LH4 A;  1Y4K A;  1YNV X;  3AMO A;  3UB1 A;  2LQV A;  3OXA A;  4MMZ B;  1ISK A;  2Z7A A;  3FH1 A;  1E3R A;  1I70 A;  1VQK 3;  2HML B;  1RNB A;  1I0X A;  1UCJ A;  3ER7 A;  3NM7 A;  3DGY A;  3PCR A;  4G1M B;  2K3D A;  1BNF A;  3KII A;  5G1L A;  4EC6 A;  1MWS A;  4N6T A;  1DMM A;  1CYV A;  1I0V A;  1J2B A;  1JBT A;  5GSP A;  5IF6 A;  4HM2 B;  4BU4 A;  3GZX B;  4KFF A;  4KFD A;  1UGH I;  3VF1 A;  2L1S A;  3EHC A;  4J8T A;  3IPT A;  9RNT A;  2YFI B;  1A2P A;  3X40 A;  1BNG A;  2STD A;  5AEU B;  1FYS A;  2BMO B;  1ZX2 A;  3M8C A;  4MMY B;  5IEN A;  4NHF A;  1YJW 3;  4HVN A;  1JB2 A;  1UGI A;  4RZM A;  2ZA4 A;  2Y74 A;  1YGW A;  1OF5 A;  2F86 B;  1W6G A;  4I5Q A;  3VSY A;  5BXQ A;  4N3V A;  1EQK A;  2ML6 A;  4WWU C;  6GSP A;  5IW9 A;  3N9H A;  2ZDJ A;  1N5P A;  1YJN 3;  1SJW A;  3CPW 2;  3NQZ A;  1B20 A;  3RNT A;  3UNL A;  1C54 A;  1RGC A;  4WYK B;  2QIY A;  2CHC A;  3B7C A;  1I3F A;  1Q81 4;  3UJM A;  2BT3 A;  4AKZ A;  3KN4 A;  2XEP A;  4RNY A;  1YI2 3;  5RNT A;  4WFO A;  1JRQ A;  3N54 B;  4K90 B;  1IQX A;  1UUW B;  2IUJ A;  2A15 A;  3CNX A;  1BRG A;  1FUW A;  4N6V 0;  5D82 A;  4OUQ A;  1O7P B;  1ROA A;  1NB5 I;  1UW1 A;  1ZS7 A;  1GS3 A;  5DRE A;  1DE3 A;  1QMA A;  1SAR A;  3OW2 2;  1GYB A;  1SII A;  3F40 A;  1IVW A;  1EUI C;  1GOV A;  2BMR B;  5IG3 A;  1JKG A;  1Q86 4;  3D3L A;  4EBG A;  1VQ5 3;  1BAO A;  3CCR 3;  3SOA A;  1O7M B;  4QWT A;  1NU3 A;  2KRT A;  2WO0 A;  1VQM 3;  3OWY A;  1JB4 A;  1B2U A;  4K61 A;  2SBL A;  5EQL A;  2R41 A;  2CG1 A;  1AY7 A;  1W02 A;  4HM1 B;  4TX4 A;  3F9S A;  2AAE A;  2BO9 B;  1FA3 A;  3QK9 A;  5G2G A;  3DGL A;  3FZW A;  2WOH A;  3S67 A;  3URP A;  1SIH A;  1B2X A;  4MEI A;  3IMA B;  1FGQ A;  1MWR A;  3IJE B;  5JBS A;  1DMQ A;  2C11 A;  1DET A;  5A0O B;  3KSE D;  3O8Y A;  4HBR A;  4X2O A;  1CH0 A;  1UUG B;  4I4K A;  1NJI 4;  2QGU A;  3NV0 B;  2P09 A;  3WA2 X;  1CYU A;  1G02 A;  3B4P A;  3LTD A;  3RGR A;  3DY5 A;  1YGE A;  1UI8 A;  3B8L A;  4BL3 A;  3G6E 3;  2W9P A;  2B1X B;  1JZO A;  2I9W A;  3DGM A;  4FR9 A;  5EVH A;  4CJN A;  2CWU A;  4EYC A;  2W56 B;  4J9A A;  2IYJ A;  4N6U A;  1EEJ A;  1RRL A;  3GZB A;  3ZG5 A;  2H0H A;  1TUH A;  1WNH A;  1US1 A;  2CFK A;  3I55 3;  1RCL A;  4FMB A;  1W01 A;  3MSO A;  3NBJ A;  5AEW B;  3EN8 A;  2H0I A;  4FMC A;  3UL5 A;  1BRI A;  1BNS A;  2OOV C;  3BB9 A;  2XGN A;  4HOH A;  2GBW B;  4FCJ A;  1UCI A;  3FLJ A;  5D83 A;  1RGF A;  2KF3 A;  1JJ2 2;  5AYS C;  3MYT A;  3BND A;  3EB8 A;  2UX0 A;  1LOY A;  1T3B A;  1BNE A;  1RGL A;  2KCD A;  3EX9 A;  1U5O A;  3STD A;  1BRH A;  2INX A;  4J5G A;  4DKI A;  2OTJ 3;  1Z1S A;  1DMN A;  2E2V A;  2KF4 A;  2W04 A;  3DMC A;  3OV4 A;  5D81 A;  3SLU A;  1BU4 A;  1VQQ A; 
#chains in the Genus database with same CATH homology
 1AVK A;  3GWR A;  2OCT A;  4N6M A;  3WA3 A;  1N5H A;  3GZY B;  5EEO A;  1ULJ B;  3CCQ 3;  3ALA A;  1NO3 A;  3EJV A;  2RGQ A;  4JRF A;  4HZ9 B;  4OK0 A;  1IVX A;  1E3V A;  3SVA A;  4N6L A;  8CHO A;  1IU7 A;  1AR0 A;  3SXX A;  2YX9 A;  3X3X A;  1IK3 A;  2ML5 A;  3EBT A;  3TDG A;  3J7Y d;  1MNL A;  3FG1 A;  3I0Y A;  1TIJ A;  1ROV A;  5IG4 A;  3EBY A;  3NBB A;  1WTH A;  4BTX A;  1N9J A;  3DM8 A;  1FGM A;  3PZW A;  2IUK A;  3CC7 3;  2D1W A;  3CCU 3;  3F14 A;  4EXR A;  2Y73 A;  4IT7 A;  1RRH A;  4XBY A;  1UI7 A;  3CCJ 3;  1M90 4;  5AIG A;  1KQS 2;  1YJ9 3;  1DVC A;  1VQP 3;  2C10 A;  7STD A;  3CC4 3;  1A2K A;  4EV2 A;  1BUQ A;  1O7W B;  3S5C A;  4R4K A;  5ELJ A;  3LTC A;  5IEP A;  1WMP A;  2IA7 A;  4IIA A;  3MHE A;  4WYK A;  1DYU A;  1QAL A;  2L4V A;  3DXO A;  4X2H A;  1K9M 4;  4HM7 B;  4AKY A;  4ZM8 A;  1AV4 A;  1VQL 3;  3X42 A;  3WDG B;  1VQ6 3;  4IPB A;  1W00 A;  1IQ8 A;  3H51 A;  3PXM A;  4HM4 B;  4HM0 B;  1OHS A;  2JDI H;  2F99 A;  3PCS A;  1D6U A;  4FMD A;  2FXT A;  1GY5 A;  4H61 A;  2O3O A;  3K9M C;  4O3V A;  4WP5 A;  2HMJ B;  2K0M A;  4XM4 A;  2XH9 A;  1Q40 B;  5TGN A;  1Q82 4;  3H3H A;  5DRV A;  3CNM A;  2FNQ A;  1N8Q A;  3G71 3;  3PGB A;  3I56 3;  1HKX A;  4MJD A;  3EQQ B;  4KVH A;  3MG2 A;  2W0Q A;  3JUN A;  3NBR A;  5LC6 A;  5AIF A;  5JPP A;  4LMI A;  4XDV A;  3V92 A;  1A67 A;  1E97 A;  2XFS A;  3X41 A;  1EKM A;  1FGO A;  2CH9 A;  3S27 A;  1PFP A;  2XR8 B;  2OOV A;  3BNE A;  4JF8 A;  4K1V A;  3LML A;  3Q2P A;  1NWW A;  3LT8 A;  1KC8 4;  4ORL A;  3OX9 A;  2GEY A;  3ECF A;  4XBX A;  1G96 A;  3CCM 3;  4GB5 A;  2V1L A;  2WOF A;  1JN5 B;  1R4C A;  3NV0 A;  1D6Y A;  2W6J H;  3UL6 A;  5FGO A;  2OQE A;  1JV2 B;  3S28 A;  4R1K A;  4EV5 A;  5IG5 A;  4LSO A;  1YVB I;  1FGR A;  1RJO A;  2CWV A;  2E2U A;  2GEX A;  2W56 A;  3PYJ A;  5STD A;  3T8N A;  3DGO A;  1Q86 4;  2CK3 H;  3KE7 A;  3F8X A;  5CXO A;  3V99 A;  4HYZ A;  1OGX A;  4R9L A;  3V98 A;  3GRD A;  1GY6 A;  4HJL B;  3HI7 A;  1K28 A;  5KP3 A;  1MOL A;  3CCE 3;  1TFO A;  3X3Y A;  5CF2 A;  3CXC 2;  1W2Z A;  3K5T A;  3WMD A;  1CEW I;  4OVM A;  4XDW A;  5BVB A;  2PNC A;  4CDL A;  1OH0 A;  2P38 A;  3L0R A;  5CLK A;  3KSP A;  2M7O A;  2WGO A;  2XFT A;  3WOD G;  3LTB A;  4KFE A;  4U13 A;  3CD6 3;  5I97 A;  1IT7 A;  2OWP A;  3HIG A;  3KZT A;  2E2T A;  5CK6 A;  2CFG A;  1GY7 A;  3LXU X;  1M9G A;  3HK4 A;  2OQE C;  1OAC A;  4STD A;  1QVF 2;  3F7X A;  2D42 A;  3Q90 A;  5CF1 A;  3CCS 3;  2HMO B;  3CCV 3;  4MMX B;  1NDO B;  2Z77 A;  3FF0 A;  1W4N A;  3NXJ A;  4Q53 A;  2JQ5 A;  1YHQ 3;  3K63 A;  2HMK B;  1W6C A;  2PZV A;  4O2H A;  4HM5 B;  4RNZ A;  2CC3 A;  3FF2 A;  2B24 B;  1WMN A;  4N6N B;  3LOY A;  4BTY A;  6STD A;  2GXF A;  1DVD A;  2CG0 A;  2CKF B;  1RKY A;  1IVV A;  3LT9 A;  2MC8 A;  2Q07 A;  5IER A;  4L7K A;  3JUP A;  1HU9 A;  2KXG A;  3DGN A;  1KD1 4;  4HKV B;  1LNH A;  3JUM A;  1RN7 A;  2HMM B;  4XB5 A;  5AYR B;  3SX1 A;  1YIT 3;  1WQL B;  4BTW A;  1KSI A;  3D9R A;  3BLZ A;  3PS8 A;  3CPO A;  3A76 A;  3AMO B;  4XBT A;  3OWU A;  3JVC A;  1S72 3;  3NQY A;  2RCD A;  1A90 A;  3WOF B;  5KP4 A;  5IEO A;  2W03 A;  1L5G B;  2HMN B;  1IQY A;  3SOY A;  4K1U A;  1JB5 A;  1D6Z A;  3DZL A;  3RGA A;  1EA2 A;  1OGZ A;  2CIU A;  1N8R 4;  3HII A;  1WMO A;  3KKG A;  3MPH A;  3NM2 A;  1O7G B;  3N8B A;  1K41 A;  4KZ1 A;  2P0X A;  1K73 4;  4GL6 A;  3FG3 A;  1Q40 A;  4H3U A;  1M1K 4;  1O7N B;  1TFK A;  1C7H A;  1LXE A;  3EN1 B;  2R4I A;  2XGL A;  1OF5 B;  2IMJ A;  3E99 A;  2YFL B;  3FKA A;  1S5A A;  1IDP A;  1LOX A;  3T8U A;  2W2C A;  3FGY A;  3F7S A;  3SED A;  3CMA 3;  1ZO2 A;  2XRX B;  3MWZ A;  4HZB B;  3HZP A;  3MG1 A;  5HGR A;  2Z6B A;  5AIH A;  3CC2 3;  1OCV A;  3U1W A;  1SQW A;  3LYG A;  2CWT A;  1VZZ A;  2CFL A;  1STF I;  2MF7 A;  1QJG A;  3QRD A;  3BNB A;  2RFR A;  3GZR A;  5FW5 A;  1N9E A;  2XSH B;  3CCL 3;  3G4S 3;  1U8C B;  1Q7Y 4;  3Q1C A;  3WOE B;  1JN5 A;  3S29 A;  2QEX 3;  1JKG B;  2YFJ B;  3FSD A;  1QVG 2;  1QAF A;  2OTL 3;  3EE1 A;  1OUN A;  4HM6 B;  3KFQ C;  1W6Y A;  3G8Z A;  1AVL A;  1JNQ A;  5AI1 A;  1A2V A;  3NX0 A;  3RDE A;  2W9Q A;  4LEH A;  5AII A;  1GD4 A;  1VQ7 3;  1OPY A;  3BNC A;  4FCZ A;  3GAX A;  4HM3 B;  4R80 A;  1PU4 A;  5KP1 A;  2BNG A;  4FCM A;  4N6O B;  3JUO A;  3ROB A;  2P05 A;  1F8N A;  4RBN A;  1T5Y A;  1VQO 3;  3K0Z A;  1VQN 3;  3F8H A;  1W5Z A;  3LZA A;  3VGN A;  1STD A;  5LC7 A;  2F98 A;  3CU3 A;  4R9K A;  4HM8 B;  4CCV A;  1VQ8 3;  5IG0 A;  4L8P A;  2BMQ B;  4O02 B;  1W2B 2;  2Z76 A;  4AEQ A;  2LYX A;  3DUK A;  1IVU A;  3LTA A;  3MKI A;  3NHX A;  3NUV A;  2FGT A;  1ULI B;  4PEJ A;  1VQ9 3;  3OWS A;  3G0K A;  3U97 A;  2K54 A;  3FCS B;  4FMA A;  2CW9 A;  2XSO B;  3CME 3;  1VQ4 3;  1O7H B;  1TP6 A;  3EF8 A;  2ZL8 A;  1IT8 A;  1QAK A;  2CFW A;  3G16 A;  1IV7 A;  3EC9 A;  2QA4 3;  1OHO A;  1OHP A;  4LGQ A;  1KWI A;  5ELU A;  1V74 A;  2P0M A;  3HX8 A;  1IV9 A;  3X3Z A;  1M1X B;  1CQS A;  2WGQ A;  3B4O A;  3JUQ A;  5JPU A;  3K7C A;  1FGT A;  2CFD A;  1W7C A;  1YIJ 3;  2O9U X;  1SPU A;  1GD3 A;  2BHM A;  1ASK A;  4O8S A;  1EG9 B;  4NRE A;  1UUV B;  3FG4 A;  2GU1 A;  1LVN A;  1NB3 I;  4WHA A;  3MG3 A;  2GU3 A;  1K8A 4;  1Q42 A;  2XF3 A;  1TU5 A;  2RSX A;  2GBX B;  4L8O A;  4LZI A;  3T0U A;  3LH4 A;  1Y4K A;  3AMO A;  3UB1 A;  2LQV A;  3OXA A;  4MMZ B;  1ISK A;  2Z7A A;  3FH1 A;  1E3R A;  1VQK 3;  2HML B;  3ER7 A;  3NM7 A;  3PCR A;  4G1M B;  3KII A;  4EC6 A;  4N6T A;  1DMM A;  1CYV A;  1J2B A;  5IF6 A;  4HM2 B;  3GZX B;  4KFF A;  4KFD A;  3VF1 A;  3EHC A;  4J8T A;  3IPT A;  2YFI B;  3X40 A;  2STD A;  5AEU B;  3M8C A;  2BMO B;  1ZX2 A;  4MMY B;  5IEN A;  1YJW 3;  4NHF A;  4HVN A;  1JB2 A;  4RZM A;  2Y74 A;  1OF5 A;  2F86 B;  1W6G A;  3VSY A;  5BXQ A;  4N3V A;  1EQK A;  2ML6 A;  4WWU C;  5IW9 A;  3N9H A;  2ZDJ A;  1N5P A;  1YJN 3;  1SJW A;  3CPW 2;  3NQZ A;  3UNL A;  4WYK B;  2QIY A;  2CHC A;  3B7C A;  1Q81 4;  3UJM A;  2BT3 A;  4AKZ A;  3KN4 A;  2XEP A;  4RNY A;  1YI2 3;  4WFO A;  1JRQ A;  3N54 B;  4K90 B;  1IQX A;  1UUW B;  2IUJ A;  2A15 A;  3CNX A;  1FUW A;  4N6V 0;  5D82 A;  4OUQ A;  1O7P B;  1ROA A;  1NB5 I;  1UW1 A;  1GS3 A;  5DRE A;  1QMA A;  3OW2 2;  1GYB A;  1SII A;  3F40 A;  1IVW A;  2BMR B;  1JKG A;  3D3L A;  4EBG A;  1VQ5 3;  3CCR 3;  3SOA A;  1O7M B;  4QWT A;  1NU3 A;  2KRT A;  2WO0 A;  1VQM 3;  3OWY A;  1JB4 A;  4K61 A;  2SBL A;  5EQL A;  2CG1 A;  4HM1 B;  1W02 A;  4TX4 A;  3F9S A;  2BO9 B;  1FA3 A;  3QK9 A;  5G2G A;  3DGL A;  3FZW A;  2WOH A;  3S67 A;  1SIH A;  4MEI A;  3IMA B;  1FGQ A;  3IJE B;  5JBS A;  1DMQ A;  2C11 A;  5A0O B;  3KSE D;  3O8Y A;  4HBR A;  4X2O A;  4I4K A;  1NJI 4;  2QGU A;  3NV0 B;  2P09 A;  3WA2 X;  1CYU A;  3B4P A;  3LTD A;  3RGR A;  3DY5 A;  1YGE A;  1UI8 A;  3B8L A;  3G6E 3;  2W9P A;  2B1X B;  2I9W A;  4EYC A;  3DGM A;  4FR9 A;  5EVH A;  5IG3 A;  2CWU A;  2W56 B;  4J9A A;  4N6U A;  1RRL A;  3GZB A;  1TUH A;  1WNH A;  1US1 A;  2CFK A;  3I55 3;  5AEW B;  4FMB A;  1W01 A;  3MSO A;  3NBJ A;  3EN8 A;  4FMC A;  3UL5 A;  3BB9 A;  2OOV C;  2XGN A;  2GBW B;  4FCJ A;  3FLJ A;  5D83 A;  1JJ2 2;  5AYS C;  3MYT A;  3BND A;  3EB8 A;  2UX0 A;  2KCD A;  3EX9 A;  1U5O A;  3STD A;  2INX A;  2OTJ 3;  1Z1S A;  1DMN A;  2E2V A;  2W04 A;  3DMC A;  3OV4 A;  5D81 A;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...