1TP6A

1.5 a crystal structure of a ntf-2 like protein of unknown function pa1314 from pseudomonas aeruginosa
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
126
structure length
126
Chain Sequence
CAYRREIHHAHVAIRDWLAGDSRADALDALMARFAEDFSMVTPHGVVLDKTALGELFRSKGGTRPGLRIEIDGESLLASGVDGATLAYREIQSDAAGRSERLSTVVLHRDDEGRLYWRHLQETFCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PA1314
publication title 1.5A crystal structure of a hypothetical protein PA1314 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 35
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1tp6A00
3OXAA 4U13A 1JKGB 2YFIB 4XBTA 3FZWA 2B24B 3EBTA 4XM4A 5AEWB 5BVBA 1WQLB 2YFJB 1O7HB 4STDA 3D9RA 2I9WA 3EX9A 5HGRA 1Q40A 3JUPA 5IG3A 4LMIA 4HZ9B 4OVMA 5CF2A 1HKXA 1GYBA 3F8HA 3GZRA 5EVHA 1A2KA 3CNXA 2OWPA 3LYGA 3IPTA 3T8NA 1C7HA 2UX0A 2W2CA 5D82A 5AEUB 4HZBB 3KSPA 4R9LA 2BMOB 3NXJA 1OF5A 2XSOB 2XR8B 3FLJA 4J8TA 1ZX2A 3CNMA 1W6YA 3GZBA 3F7XA 1O7PB 3F14A 8CHOA 1K41A 4CDLA 4J9AA 1GY7A 4HM1B 2BMRB 1IDPA 2F98A 1U5OA 1ULIB 1UUVB 3NV0A 3MSOA 3BLZA 5IENA 1CQSA 2K54A 5CXOA 2R4IA 1GS3A 5IG5A 1SJWA 3B4OA 4HM7B 5KP4A 5G2GA 3JUNA 2YFLB 2Z7AA 5IF6A 3BB9A 4WYKB 4Q53A 3EC9A 1O7GB 2HMLB 3GRDA 2HMMB 2RFRA 1JKGA 3RGRA 4KVHA 1S5AA 1AR0A 2XRXB 3JUOA 2QIYA 2F99A 2GXFA 4FCJA 1NU3A 3F9SA 1OUNA 5FW5A 3DXOA 3F8XA 4HM8B 1STDA 5KP3A 1GY5A 4ORLA 3DZLA 3ROBA 5JPUA 3B8LA 1TP6A 4HM0B 4K1VA 3UNLA 5AIGA 4HM3B 3NM2A 5KP1A 4HKVB 2B1XB 5AIIA 4I4KA 4X2HA 3CU3A 3H3HA 2Z76A 3DM8A 3G8ZA 2HMJB 1E3RA 3LZAA 3I0YA 4L8OA 3FGYA 5DREA 3OWSA 5IG4A 3STDA 1OGXA 3B7CA 2HMNB 3ER7A 4OUQA 3EHCA 3GZXB 4IIAA 3KE7A 4XBYA 5JPPA 1UUWB 2GBXB 3EBYA 3FF2A 4LGQA 1BUQA 5IERA 3CPOA 5AIHA 3JUQA 1O7WB 4R9KA 1JB2A 4XBXA 3T8UA 1W00A 5BXQA 1OHOA 1ULJB 3F40A 5STDA 1JN5B 3FKAA 1NWWA 2CKFB 3EF8A 5DRVA 3RGAA 4RZMA 1W02A 4HM5B 1QJGA 4R1KA 3H51A 3B4PA 1E97A 1QMAA 1OH0A 2A15A 3ECFA 4HJLB 3EN8A 1ASKA 3E99A 3DMCA 2XSHB 3NHXA 2Z77A 4HVNA 1GY6A 4WYKA 3GWRA 2HMOB 3GZYB 3OX9A 3FSDA 4HM4B 1OHSA 4LEHA 1Q42A 3UJMA 5IG0A 4L8PA 4XDWA 2IMJA 4MJDA 2BNGA 2STDA 4HM2B 2BMQB 1W01A 3MG1A 3VGNA 3NBRA 4XDVA 3VSYA 4HM6B 3KZTA 3OWUA 3Q90A 5AI1A 7STDA 5AIFA 4FCMA 1Q40B 1VZZA 4WWUC 5IEOA 1Z1SA 1O7NB 6STDA 1ISKA 2GEXA 5D83A 5CF1A 2RCDA 3DUKA 1OCVA 3K7CA 1OPYA 3MHEA 1OHPA 3EQQB 5CLKA 3OWYA 3MKIA 2INXA 2GBWB 2JQ5A 3S5CA 1ZO2A 4H3UA 2RGQA 3EJVA 4N3VA 1EA2A 5TGNA 1OF5B 4PEJA 1NDOB 1O7MB 1EG9B 1JB4A 1JB5A 1JN5A 1OGZA 3HK4A 3K0ZA 3G0KA 3MYTA 1DMMA 3SEDA 1DMQA 3JUMA 3NUVA 3F7SA 2CHCA 4K1UA 5IEPA 4X2OA 3SOYA 3M8CA 3HX8A 4WP5A 3KKGA 3OV4A 3WMDA 1E3VA 3FH1A 2GEYA 3FF0A 3A76A 4XB5A 2PZVA 3G16A 3NV0B 2HMKB 3EN1B 2F86B 3MG2A 1DMNA 3HZPA 2QGUA 5CK6A 5D81A 3SOAA 4L7KA 1TUHA 3MG3A 4GB5A
chains in the Genus database with same CATH superfamily
3HOHA 3OXAA 4U13A 2ML5A 1I70A 4BTYA 3LTAA 1K9M4 4N6MA 1JJ22 5ELUA 3HIGA 4RBNA 2OQEA 4HBRA 1JKGB 3LT9A 2YFIB 1TIJA 1L5GB 2F56A 1GD4A 4XBTA 2UGIA 3PXMA 1GMRA 1W6CA 3FZWA 2B24B 1OACA 4EV2A 3EBTA 4XM4A 1MNLA 3WR2A 5AEWB 1TJDA 1I8VA 5BVBA 4FMBA 1YI23 3J7Yd 1WQLB 2YFJB 3FG4A 3NQZA 1O7HB 1IVUA 4STDA 3D9RA 1KSIA 1V57A 1YGWA 1BSEA 1YNVX 2I9WA 3EX9A 3K9MC 5HGRA 1Q40A 3JUPA 1MWUA 3AMOA 5IG3A 3BU4A 5AYRB 4H61A 1PY3A 1MWRA 1UGHI 2Z6BA 4LMIA 1IU7A 1TFKA 3CCS3 3CCL3 2FGTA 1LOYA 4HZ9B 4OVMA 1JZDA 4EW5A 4WHAA 1Q9EA 2CFLA 5CF2A 1HKXA 1TU5A 1GYBA 1RN1A 2CC3A 9RNTA 1GD3A 1KQS2 3F8HA 3GZRA 5EVHA 5BIRA 1AVKA 1WMPA 1IVXA 1A2KA 3CNXA 1W5ZA 1CYVA 4FCZA 1TTOA 3S28A 3KSED 2OWPA 3LYGA 1R4CA 2GU3A 1UW1A 3PZWA 1W7CA 3IPTA 3T8NA 1C7HA 2BO9B 4NPBA 4LYLB 2AAEA 2UX0A 3LTDA 3V98A 1BNJA 1UCLA 1B2ZA 1N9JA 1IK3A 1CYUA 4BL2A 2W2CA 5D82A 3AHWA 5AEUB 4HYZA 1AY7A 4HZBB 2P38A 4BTWA 1W6GA 3OW22 1UCIA 1VQ53 1X1UA 4CCVA 3KSPA 4R9LA 1EKMA 2BMOB 3NXJA 4KFEA 2M7OA 1OF5A 2XSOB 2XR8B 3D4AA 1FGQA 1UCKA 1GOUA 3FLJA 3LTCA 3LXUX 3U97A 1T2HA 1JBRA 3CME3 3WHOA 1EUIC 2W56A 1VQ73 2P05A 2BHMA 1RNTA 4J8TA 4K90B 1BNEA 1RGHA 2OOVC 1VQQA 3Q3FA 4O02B 2W04A 2IY2A 4FR9A 2UUGC 1ZX2A 3GAXA 1YJW3 1N8QA 3G4S3 3SYUA 3HI7A 3CNMA 3V99A 2E2TA 1CEWI 1UI7A 1W6YA 3GZBA 3F7XA 2LYXA 3LTBA 5M19A 1BSAA 1IT8A 1O7PB 2C4BA 2FNQA 3F14A 3DGOA 4DKIA 4J5KA 3G713 8CHOA 1AV4A 1IV9A 2OCTA 2E2VA 1NO3A 1TRQA 1X1WA 1K41A 4BIRA 4CDLA 2D1WA 3KN4A 1BOXA 3CMA3 4J9AA 4EBGA 1DVCA 1M9GA 1GY7A 1NNVA 3I563 3CC73 4HM1B 5BU4A 2BT3A 1WMNA 2BMRB 1IDPA 2F98A 1U5OA 2K3DA 1KD14 1FW7A 3X3YA 1Q7Y4 1ULIB 1UUVB 1RGGA 2K0MA 3NV0A 3MSOA 1RN7A 3CC43 1MGWA 1MGRA 2WO0A 4AKYA 5M1AA 2ZHXB 3BLZA 1B2MA 1FA3A 1RGCA 5IENA 1CQSA 5IW9A 4GL6A 2K54A 5CXOA 1RSNA 4KFFA 1SIHA 2R4IA 1GSPA 1GS3A 2C10A 3K63A 5IG5A 1SJWA 3B4OA 4HM7B 5KP4A 5G2GA 3JUNA 3UL5A 3CD63 3PCRA 2YFLB 3ZG5A 1UGIA 2Z7AA 1HZ1A 5IF6A 3BB9A 1UUGB 4WYKB 2O9UX 3DGYA 1I3FA 1JV2B 1M1XB 4Q53A 1Q864 1K734 4KFDA 1VQO3 3EC9A 1O7GB 2HMLB 3GRDA 2QA43 2HMMB 2RFRA 1I2FA 1JKGA 3RGRA 2KCDA 1GMQA 2WGQA 1S5AA 4HAAA 4KVHA 2YX9A 5I97A 1AR0A 2XRXB 1BRHA 3JUOA 3U1WA 2CFDA 2QIYA 1B27A 1N5HA 2F99A 2GXFA 4FCJA 4CJNA 3AGNA 2MC8A 2H0HA 1NU3A 1YJN3 2HOHA 1ZS7A 1ZGXA 3F9SA 1DETA 4KT3B 3CPW2 2RSXA 4EV5A 1W2B2 1DE3A 1HU9A 2WOHA 1LQMB 1OUNA 3QRDA 3Q1CA 1US1A 2RBIA 4ILFA 4N6LA 5FW5A 3SXXA 3DXOA 2L1SA 2WOFA 3F8XA 3VF1A 3WOEB 3X41A 1A2PA 4HM8B 2F5WA 1STDA 5KP3A 1U8CB 1GY5A 1F8NA 4ORLA 3BNDA 3KFQC 1A67A 3DZLA 3ROBA 2W0QA 5JPUA 3AGOA 3D3LA 1MWTA 1TP6A 3B8LA 4HM0B 1CH0A 3BNBA 4K1VA 4HM3B 5AIGA 3NM2A 3ZG0A 5KP1A 1VQ93 4HKVB 2B1XB 1KWIA 5AIIA 4I4KA 4X2HA 3WODG 1KC84 2SARA 1IV7A 3CU3A 3H3HA 2E2UA 2Z76A 1I2GA 1QAKA 5FGOA 5EEOA 3T0UA 3LMLA 3PS8A 1RGFA 3DM8A 1BUJA 2KF4A 1UDII 2IUJA 2JDIH 3TDGA 1BANA 1K28A 3G8ZA 2HMJB 3URPA 2Y73A 1E3RA 1BNIA 1YGEA 1STFI 1G0TA 3I0YA 3LZAA 2OQEC 3KCHA 1FUTA 4RNZA 1RGEA 3FGYA 4L8OA 5G1LA 1M1K4 1LOXA 1FYSA 2H0GA 1RRHA 3BNCA 3OWSA 5DREA 2Q07A 5IG4A 1RDSA 2CG1A 3X3ZA 1EEJA 2ZA4A 3NBJA 3STDA 3SX1A 3I553 1DVDA 1BSBA 2O3OA 1OGXA 3D5IA 3B7CA 2HMNB 3ER7A 3V92A 2W9QA 1YVSA 2CWUA 4OUQA 3EHCA 1BRSA 1PU4A 3GZXB 4IIAA 1B2XA 1IQXA 3KE7A 3MWZA 4XBYA 3WOFB 3K5TA 3Q2PA 2KF5A 5JPPA 1UUWB 4FMDA 4IPBA 5JBSA 2GBXB 1MOLA 1BAOA 1N8R4 1RCLA 2CG0A 3EBYA 3FF2A 3DH2A 4LGQA 1BUQA 1BSDA 3ZFZA 1T2IA 5IERA 4FMAA 3CXC2 2W03A 1RCKA 1LQGC 3CPOA 3JUQA 1BNFA 5AIHA 1O7WB 4R9KA 1MWSA 1M904 4N6V0 1BGSA 1JB2A 4MMZB 2D42A 4XBXA 1RJOA 3FG3A 1T5YA 3A5EA 3T8UA 1RKYA 3G6E3 2OTL3 3FG1A 1W00A 3CCM3 1RTUA 5BXQA 1OHOA 1SARA 3NM7A 2XGNA 1V58A 1ULJB 3F40A 4N6TA 1GOYA 4N6NB 1YJ93 2CWVA 1PYLA 1VQL3 1WTHA 5STDA 1JN5B 3N9HA 3FKAA 1NWWA 3L0RA 2CKFB 1B21A 3EF8A 3JVCA 2Y74A 1IYYA 5DRVA 3RGAA 1I0XA 4GSPA 4RZMA 1W02A 1RGAA 2KXGA 4HM5B 1QJGA 1R4YA 4R1KA 3H51A 3B4PA 3LT8A 4KZ1A 1E97A 1QMAA 1OH0A 1BU4A 2A15A 2W6JH 1B3SA 3ECFA 4HJLB 2KRTA 1RGLA 2P09A 3EN8A 2C11A 2MF7A 4JRFA 3RDEA 1JBSA 1G02A 1ASKA 3E99A 1BNSA 1VQ43 4O3VA 4MEIA 3CCJ3 1BIRA 2XSHB 3DMCA 2Z77A 3NHXA 4HVNA 2P0XA 1VQ63 4QWTA 1GY6A 1JRQA 4WYKA 1IVWA 4EC6A 1YIJ3 4LSOA 1BNGA 3GWRA 1PFPA 2CFKA 2HMOB 1LXEA 4G1MB 1WMOA 3X3XA 3LH4A 1DYUA 3GZYB 1VQN3 5A0OB 3OX9A 1FZUA 3FSDA 1T3BA 2XH9A 1D6YA 1OHSA 4HM4B 4J5GA 5M18A 1WNHA 1Q42A 4LEHA 3IMAB 3UJMA 5IG0A 4L8PA 4MMYB 1IVVA 1QAFA 4XDWA 3PYJA 2IMJA 3NQYA 3HIIA 3DGNA 3DY5A 4K61A 4NHFA 2CIUA 4RNTA 4MJDA 2BNGA 1J2BA 2STDA 2PNCA 3DGLA 4BU4A 1RHLA 1B2UA 4HM2B 1GOVA 1IQ8A 1VQM3 1Q814 2BMQB 3FCSB 1SQWA 1A2VA 1W01A 1K8A4 1G96A 3MG1A 3VGNA 1AVLA 3DGMA 3NBRA 4XDVA 1BNRA 4N6OB 3SVAA 3VSYA 4AEQA 3X42A 1Q824 4HM6B 2CX1A 1NB5I 1UI8A 2BU4A 1LNIA 1W4NA 2AADA 3KZTA 3CCQ3 3OWUA 3Q90A 5AI1A 3CC23 7STDA 5AIFA 4FCMA 4EYCA 3BIRA 1Q40B 2CX0A 1I0VA 2KF6A 3AMOB 3WA2X 1RMSA 1VZZA 1X1YA 4RNYA 3BNEA 5HOHA 1S723 4WWUC 1EQKA 2ZL8A 1RNBA 1GMPA 5IEOA 1Z1SA 2J8XB 1O7NB 1LNHA 6STDA 1BRKA 2OOVA 1V74A 1ISKA 3WDGB 2XFTA 2GEXA 3QK9A 1IQYA 4EXRA 5D83A 5CF1A 7GSPA 4GHOA 2RCDA 2RNTA 3DUKA 1OCVA 1NB3I 2V1LA 3K7CA 3UL6A 1OPYA 3SLUA 2CH9A 3WA3A 1HYFA 1UCJA 2CK3H 1X1XA 3MHEA 1A90A 1N9EA 1I3IA 1D6UA 4OK0A 1FGMA 1FGOA 1BVIA 2F4YA 1OHPA 3EQQB 5CLKA 3X40A 4TX4A 6RNTA 2L4VA 1YIT3 1FUWA 3OWYA 4MMXB 3CCE3 3MKIA 2INXA 2GBWB 2CFGA 1Q7HA 2CW9A 3MPHA 4WFOA 2JQ5A 1SIIA 4CPKA 4R80A 2XGLA 5G1KA 3O8YA 3S5CA 1ZO2A 4H3UA 2F5MA 3AHSA 2RGQA 3EJVA 2KAAA 4N3VA 1FGRA 3UNLA 5GSPA 1BRNL 1B2SA 2KF3A 4JF8A 2XF3A 5EQLA 1RRLA 1Y4KA 4BTXA 1JNQA 1EA2A 1W2ZA 1IT7A 2WGOA 3PCSA 1LOWA 5TGNA 1OF5B 5RNTA 1LOVA 1FGTA 1D6ZA 1JZOA 4PEJA 3CCV3 3N54B 1BRJA 3ALAA 1RGKA 1NDOB 2W56B 3RNTA 1O7MB 1C54A 3N8BA 3S67A 1EG9B 1FUSA 4LZIA 1JB4A 2IA7A 2ML6A 1JB5A 1AQZA 1JN5A 1OGZA 3HK4A 3K0ZA 3GSPA 4FMCA 2P0MA 2IUKA 3G0KA 4I5QA 1ROAA 4NREA 2H0IA 3MYTA 4AKZA 1DMMA 2IYJA 3SEDA 2W9PA 4IT7A 3S27A 1DMQA 2GU1A 1RLSA 2GSPA 4N6UA 1BRIA 3JUMA 1YVBI 3LOYA 3NUVA 3F7SA 4HOHA 3D5GA 3CCU3 1RN4A 2CHCA 4K1UA 5IEPA 3NBBA 4X2OA 3SOYA 3M8CA 3HX8A 3EE1A 1QALA 4WP5A 3KKGA 1NJI4 3OV4A 3WMDA 5LC7A 5ELJA 1ROVA 5LC6A 1E3VA 3FH1A 1LRAA 2GEYA 3EB8A 3FF0A 2CWTA 3PGBA 4O2HA 4ZM8A 2FXTA 3A76A 3KIIA 2XFSA 3D79A 2ZDJA 4XB5A 2PZVA 1BRGA 1B20A 3G16A 3IJEB 4BL3A 4R4KA 3NV0B 2HMKB 3EN1B 1N5PA 2QEX3 6GSPA 2F86B 2R41A 1QVG2 1BSCA 3MG2A 3S29A 2OTJ3 4O8SA 2BIRA 7RNTA 1DMNA 1JBTA 1VQK3 1QVF2 3HZPA 1TRPA 5AYSC 2QGUA 8RNTA 1I2EA 2XEPA 2CFWA 5CK6A 3UB1A 1TFOA 5D81A 3SOAA 4L7KA 1YHQ3 1LVNA 1TUHA 3CCR3 3MG3A 3NX0A 2LQVA 1VQP3 2SBLA 1VQ83 1SPUA 4GB5A
chains in the Genus database with same CATH topology
3OXAA 4U13A 2ML5A 4BTYA 3LTAA 1K9M4 4N6MA 1JJ22 5ELUA 3HIGA 4RBNA 2OQEA 4HBRA 1JKGB 3LT9A 2YFIB 1TIJA 1L5GB 1GD4A 4XBTA 3PXMA 1W6CA 3FZWA 2B24B 1OACA 4EV2A 3EBTA 4XM4A 1MNLA 5AEWB 5BVBA 4FMBA 1YI23 3J7Yd 1WQLB 2YFJB 3FG4A 3NQZA 1O7HB 1IVUA 4STDA 3D9RA 1KSIA 3K9MC 2I9WA 3EX9A 5HGRA 1Q40A 3JUPA 5IG3A 3AMOA 5AYRB 4H61A 2Z6BA 4LMIA 1IU7A 1TFKA 3CCS3 3CCL3 2FGTA 4HZ9B 4OVMA 4WHAA 2CFLA 5CF2A 1HKXA 1TU5A 1GYBA 2CC3A 1GD3A 1KQS2 3F8HA 3GZRA 5EVHA 1AVKA 1WMPA 1IVXA 1A2KA 3CNXA 1W5ZA 1CYVA 4FCZA 3S28A 3KSED 2OWPA 3LYGA 1R4CA 2GU3A 1UW1A 3PZWA 1W7CA 3IPTA 3T8NA 1C7HA 2BO9B 2UX0A 3LTDA 3V98A 1N9JA 1CYUA 2W2CA 5D82A 5AEUB 4HYZA 4HZBB 2P38A 4BTWA 1W6GA 3OW22 1VQ53 4CCVA 3KSPA 4R9LA 1EKMA 2BMOB 3NXJA 4KFEA 2M7OA 1OF5A 2XSOB 2XR8B 1FGQA 3LTCA 3FLJA 3LXUX 3U97A 3CME3 2W56A 1VQ73 2P05A 2BHMA 4J8TA 4K90B 2OOVC 4O02B 2W04A 4FR9A 1ZX2A 3GAXA 1YJW3 1N8QA 3G4S3 3HI7A 3CNMA 3V99A 2E2TA 1CEWI 1UI7A 1W6YA 3GZBA 3F7XA 2LYXA 3LTBA 1O7PB 1IT8A 2FNQA 3F14A 3DGOA 3G713 8CHOA 1AV4A 1IV9A 2OCTA 2E2VA 1NO3A 3CMA3 1K41A 4CDLA 2D1WA 3KN4A 4J9AA 4EBGA 1DVCA 1M9GA 1GY7A 3I563 3CC73 4HM1B 2BT3A 1WMNA 2BMRB 1IDPA 2F98A 1U5OA 1KD14 3X3YA 1Q7Y4 1ULIB 1UUVB 2K0MA 3NV0A 3MSOA 1RN7A 3CC43 2WO0A 4AKYA 3BLZA 1FA3A 5IENA 1CQSA 5IW9A 4GL6A 2K54A 5CXOA 4KFFA 1SIHA 2R4IA 3K63A 1GS3A 2C10A 5IG5A 1SJWA 3B4OA 4HM7B 5KP4A 5G2GA 3JUNA 3UL5A 3CD63 3PCRA 2YFLB 2Z7AA 5IF6A 3BB9A 4WYKB 2O9UX 1Q864 1JV2B 4Q53A 1M1XB 1K734 4KFDA 1VQO3 3EC9A 1O7GB 2HMLB 3GRDA 2QA43 2HMMB 2RFRA 1JKGA 3RGRA 2KCDA 2WGQA 4KVHA 1S5AA 2YX9A 5I97A 1AR0A 2XRXB 3JUOA 3U1WA 2CFDA 2QIYA 1N5HA 2F99A 2GXFA 4FCJA 2MC8A 1YJN3 1NU3A 3F9SA 3CPW2 2RSXA 4EV5A 1W2B2 1HU9A 2WOHA 1OUNA 5FW5A 3QRDA 3Q1CA 1US1A 4N6LA 3SXXA 3DXOA 2WOFA 3F8XA 3VF1A 3WOEB 3X41A 4HM8B 1STDA 5KP3A 1U8CB 1GY5A 1F8NA 4ORLA 3BNDA 3KFQC 1A67A 3DZLA 3ROBA 2W0QA 5JPUA 3D3LA 3B8LA 1TP6A 4HM0B 4K1VA 3BNBA 3UNLA 5AIGA 4HM3B 1VQ93 3NM2A 5KP1A 4HKVB 2B1XB 1KWIA 5AIIA 4I4KA 4X2HA 3WODG 1KC84 1IV7A 3CU3A 3H3HA 2E2UA 2Z76A 1QAKA 5FGOA 3T0UA 5EEOA 3LMLA 3PS8A 3DM8A 2IUJA 2JDIH 3TDGA 1K28A 3G8ZA 2HMJB 2Y73A 1E3RA 1YGEA 1STFI 3LZAA 3I0YA 4RNZA 2OQEC 1IK3A 4L8OA 3FGYA 1M1K4 1LOXA 5DREA 1RRHA 3BNCA 3OWSA 2Q07A 5IG4A 3X3ZA 2CG1A 3I553 3NBJA 3STDA 3SX1A 1DVDA 2O3OA 1OGXA 3B7CA 2HMNB 3ER7A 3V92A 2W9QA 2CWUA 4OUQA 3EHCA 1PU4A 3GZXB 4IIAA 1IQXA 3KE7A 3MWZA 4XBYA 3WOFB 3K5TA 3Q2PA 5JPPA 1UUWB 4FMDA 4IPBA 5JBSA 2GBXB 1MOLA 1N8R4 2CG0A 3EBYA 3FF2A 4LGQA 1BUQA 5IERA 4FMAA 3CXC2 2W03A 3CPOA 5AIHA 3JUQA 1O7WB 4R9KA 1M904 4N6V0 1JB2A 4MMZB 2D42A 4XBXA 1RJOA 3FG3A 1T5YA 3T8UA 1RKYA 3G6E3 2OTL3 3FG1A 1W00A 3CCM3 5BXQA 1OHOA 3NM7A 2XGNA 1ULJB 3F40A 4N6TA 4N6NB 1YJ93 2CWVA 1VQL3 1WTHA 5STDA 1JN5B 3N9HA 3FKAA 1NWWA 3L0RA 2CKFB 3EF8A 3JVCA 2Y74A 5DRVA 3RGAA 4RZMA 1W02A 2KXGA 4HM5B 1QJGA 4R1KA 3H51A 3B4PA 3LT8A 4KZ1A 1E97A 1QMAA 1OH0A 2A15A 2W6JH 3ECFA 4HJLB 2KRTA 2P09A 3EN8A 2C11A 2MF7A 4JRFA 3RDEA 1ASKA 3E99A 1VQ43 4O3VA 4MEIA 3CCJ3 3DMCA 2XSHB 3NHXA 2Z77A 4HVNA 2P0XA 1VQ63 4QWTA 1GY6A 1JRQA 4WYKA 1IVWA 4EC6A 1YIJ3 4LSOA 3GWRA 1PFPA 2CFKA 2HMOB 1LXEA 4G1MB 1WMOA 3X3XA 3LH4A 1DYUA 3GZYB 1VQN3 5A0OB 3OX9A 3FSDA 2XH9A 1D6YA 1OHSA 4HM4B 1WNHA 1Q42A 4LEHA 3IMAB 3UJMA 5IG0A 4L8PA 4MMYB 1IVVA 1QAFA 4XDWA 3PYJA 2IMJA 3NQYA 3HIIA 3DGNA 3DY5A 4K61A 4NHFA 2CIUA 4MJDA 2BNGA 1J2BA 2STDA 2PNCA 3DGLA 4HM2B 1VQM3 1IQ8A 1Q814 2BMQB 3FCSB 1SQWA 1A2VA 1W01A 1K8A4 1G96A 3MG1A 3VGNA 1AVLA 3DGMA 3NBRA 4XDVA 4N6OB 3SVAA 3VSYA 4AEQA 3X42A 1Q824 4HM6B 1NB5I 1UI8A 3KZTA 1W4NA 3CCQ3 3OWUA 3Q90A 5AI1A 3CC23 7STDA 5AIFA 4FCMA 4EYCA 1Q40B 3WA2X 3AMOB 1VZZA 4RNYA 3BNEA 1S723 4WWUC 1EQKA 2ZL8A 5IEOA 1Z1SA 1O7NB 1LNHA 6STDA 2OOVA 1V74A 1ISKA 3WDGB 2XFTA 2GEXA 3QK9A 1IQYA 4EXRA 5D83A 5CF1A 2RCDA 3DUKA 1OCVA 1NB3I 2V1LA 3K7CA 3UL6A 1OPYA 3SLUA 2CH9A 3WA3A 2CK3H 3MHEA 1A90A 1N9EA 1D6UA 4OK0A 1FGMA 1FGOA 1OHPA 3EQQB 5CLKA 3X40A 4TX4A 2L4VA 1YIT3 1FUWA 3OWYA 4MMXB 3CCE3 3MKIA 2INXA 2GBWB 2CFGA 2CW9A 3MPHA 4WFOA 2JQ5A 1SIIA 4R80A 2XGLA 3O8YA 3S5CA 1ZO2A 4H3UA 2RGQA 3EJVA 4N3VA 1FGRA 4JF8A 2XF3A 5EQLA 1RRLA 1Y4KA 4BTXA 1JNQA 1EA2A 1W2ZA 1IT7A 2WGOA 3PCSA 5TGNA 1OF5B 1FGTA 1D6ZA 4PEJA 3CCV3 3N54B 3ALAA 1NDOB 2W56B 1O7MB 3N8BA 3S67A 1EG9B 4LZIA 1JB4A 2IA7A 2ML6A 1JB5A 1JN5A 1OGZA 3HK4A 3K0ZA 4FMCA 2P0MA 2IUKA 3G0KA 4NREA 1ROAA 3MYTA 4AKZA 1DMMA 3SEDA 2W9PA 4IT7A 3S27A 1DMQA 2GU1A 4N6UA 3JUMA 1YVBI 3LOYA 3NUVA 3F7SA 3CCU3 2CHCA 4K1UA 5IEPA 3NBBA 4X2OA 3SOYA 3M8CA 3HX8A 3EE1A 1QALA 4WP5A 3KKGA 1NJI4 3OV4A 3WMDA 5LC7A 5ELJA 1ROVA 5LC6A 1E3VA 3FH1A 2GEYA 3EB8A 3FF0A 2CWTA 3PGBA 4O2HA 4ZM8A 2FXTA 3A76A 3KIIA 2XFSA 4XB5A 2ZDJA 2PZVA 3G16A 3IJEB 4R4KA 3NV0B 2HMKB 3EN1B 1N5PA 2QEX3 2F86B 1QVG2 3MG2A 3S29A 2OTJ3 4O8SA 1DMNA 1VQK3 1QVF2 3HZPA 5AYSC 2QGUA 2XEPA 2CFWA 5CK6A 3UB1A 1TFOA 5D81A 3SOAA 4L7KA 1YHQ3 1LVNA 1TUHA 3CCR3 3MG3A 3NX0A 2LQVA 1VQP3 2SBLA 1VQ83 1SPUA 4GB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXA A;  4U13 A;  1JKG B;  2YFI B;  4XBT A;  3FZW A;  2B24 B;  3EBT A;  4XM4 A;  5AEW B;  5BVB A;  1WQL B;  2YFJ B;  1O7H B;  4STD A;  3D9R A;  2I9W A;  3EX9 A;  5HGR A;  1Q40 A;  3JUP A;  5IG3 A;  4LMI A;  4HZ9 B;  4OVM A;  5CF2 A;  1HKX A;  1GYB A;  3F8H A;  3GZR A;  5EVH A;  1A2K A;  3CNX A;  2OWP A;  3LYG A;  3IPT A;  3T8N A;  1C7H A;  2UX0 A;  2W2C A;  5D82 A;  5AEU B;  4HZB B;  3KSP A;  4R9L A;  2BMO B;  3NXJ A;  1OF5 A;  2XSO B;  2XR8 B;  3FLJ A;  4J8T A;  1ZX2 A;  3CNM A;  1W6Y A;  3GZB A;  3F7X A;  1O7P B;  3F14 A;  8CHO A;  1K41 A;  4CDL A;  4J9A A;  1GY7 A;  4HM1 B;  2BMR B;  1IDP A;  2F98 A;  1U5O A;  1ULI B;  1UUV B;  3NV0 A;  3MSO A;  3BLZ A;  5IEN A;  1CQS A;  2K54 A;  5CXO A;  2R4I A;  1GS3 A;  5IG5 A;  1SJW A;  3B4O A;  4HM7 B;  5KP4 A;  5G2G A;  3JUN A;  2YFL B;  2Z7A A;  5IF6 A;  3BB9 A;  4WYK B;  4Q53 A;  3EC9 A;  1O7G B;  2HML B;  3GRD A;  2HMM B;  2RFR A;  1JKG A;  3RGR A;  4KVH A;  1S5A A;  1AR0 A;  2XRX B;  3JUO A;  2QIY A;  2F99 A;  2GXF A;  4FCJ A;  1NU3 A;  3F9S A;  1OUN A;  5FW5 A;  3DXO A;  3F8X A;  4HM8 B;  1STD A;  5KP3 A;  1GY5 A;  4ORL A;  3DZL A;  3ROB A;  5JPU A;  3B8L A;  1TP6 A;  4HM0 B;  4K1V A;  3UNL A;  5AIG A;  4HM3 B;  3NM2 A;  5KP1 A;  4HKV B;  2B1X B;  5AII A;  4I4K A;  4X2H A;  3CU3 A;  3H3H A;  2Z76 A;  3DM8 A;  3G8Z A;  2HMJ B;  1E3R A;  3LZA A;  3I0Y A;  4L8O A;  3FGY A;  5DRE A;  3OWS A;  5IG4 A;  3STD A;  1OGX A;  3B7C A;  2HMN B;  3ER7 A;  4OUQ A;  3EHC A;  3GZX B;  4IIA A;  3KE7 A;  4XBY A;  5JPP A;  1UUW B;  2GBX B;  3EBY A;  3FF2 A;  4LGQ A;  1BUQ A;  5IER A;  3CPO A;  5AIH A;  3JUQ A;  1O7W B;  4R9K A;  1JB2 A;  4XBX A;  3T8U A;  1W00 A;  5BXQ A;  1OHO A;  1ULJ B;  3F40 A;  5STD A;  1JN5 B;  3FKA A;  1NWW A;  2CKF B;  3EF8 A;  5DRV A;  3RGA A;  4RZM A;  1W02 A;  4HM5 B;  1QJG A;  4R1K A;  3H51 A;  3B4P A;  1E97 A;  1QMA A;  1OH0 A;  2A15 A;  3ECF A;  4HJL B;  3EN8 A;  1ASK A;  3E99 A;  3DMC A;  2XSH B;  3NHX A;  2Z77 A;  4HVN A;  1GY6 A;  4WYK A;  3GWR A;  2HMO B;  3GZY B;  3OX9 A;  3FSD A;  4HM4 B;  1OHS A;  4LEH A;  1Q42 A;  3UJM A;  5IG0 A;  4L8P A;  4XDW A;  2IMJ A;  4MJD A;  2BNG A;  2STD A;  4HM2 B;  2BMQ B;  1W01 A;  3MG1 A;  3VGN A;  3NBR A;  4XDV A;  3VSY A;  4HM6 B;  3KZT A;  3OWU A;  3Q90 A;  5AI1 A;  7STD A;  5AIF A;  4FCM A;  1Q40 B;  1VZZ A;  4WWU C;  5IEO A;  1Z1S A;  1O7N B;  6STD A;  1ISK A;  2GEX A;  5D83 A;  5CF1 A;  2RCD A;  3DUK A;  1OCV A;  3K7C A;  1OPY A;  3MHE A;  1OHP A;  3EQQ B;  5CLK A;  3OWY A;  3MKI A;  2INX A;  2GBW B;  2JQ5 A;  3S5C A;  1ZO2 A;  4H3U A;  2RGQ A;  3EJV A;  4N3V A;  1EA2 A;  5TGN A;  1OF5 B;  4PEJ A;  1NDO B;  1O7M B;  1EG9 B;  1JB4 A;  1JB5 A;  1JN5 A;  1OGZ A;  3HK4 A;  3K0Z A;  3G0K A;  3MYT A;  1DMM A;  3SED A;  1DMQ A;  3JUM A;  3NUV A;  3F7S A;  2CHC A;  4K1U A;  5IEP A;  4X2O A;  3SOY A;  3M8C A;  3HX8 A;  4WP5 A;  3KKG A;  3OV4 A;  3WMD A;  1E3V A;  3FH1 A;  2GEY A;  3FF0 A;  3A76 A;  4XB5 A;  2PZV A;  3G16 A;  3NV0 B;  2HMK B;  3EN1 B;  2F86 B;  3MG2 A;  1DMN A;  3HZP A;  2QGU A;  5CK6 A;  5D81 A;  3SOA A;  4L7K A;  1TUH A;  3MG3 A;  4GB5 A; 
#chains in the Genus database with same CATH topology
 3HOH A;  3OXA A;  4U13 A;  2ML5 A;  1I70 A;  4BTY A;  3LTA A;  1K9M 4;  4N6M A;  1JJ2 2;  5ELU A;  3HIG A;  4RBN A;  2OQE A;  4HBR A;  1JKG B;  3LT9 A;  2YFI B;  1TIJ A;  1L5G B;  2F56 A;  1GD4 A;  4XBT A;  2UGI A;  3PXM A;  1GMR A;  1W6C A;  3FZW A;  2B24 B;  1OAC A;  4EV2 A;  3EBT A;  4XM4 A;  1MNL A;  3WR2 A;  5AEW B;  1TJD A;  1I8V A;  5BVB A;  4FMB A;  1YI2 3;  3J7Y d;  1WQL B;  2YFJ B;  3FG4 A;  3NQZ A;  1O7H B;  1IVU A;  4STD A;  3D9R A;  1KSI A;  1V57 A;  1YGW A;  1BSE A;  1YNV X;  2I9W A;  3EX9 A;  3K9M C;  5HGR A;  1Q40 A;  3JUP A;  1MWU A;  3AMO A;  5IG3 A;  3BU4 A;  5AYR B;  4H61 A;  1PY3 A;  1MWR A;  1UGH I;  2Z6B A;  4LMI A;  1IU7 A;  1TFK A;  3CCS 3;  3CCL 3;  2FGT A;  1LOY A;  4HZ9 B;  4OVM A;  1JZD A;  4EW5 A;  4WHA A;  1Q9E A;  2CFL A;  5CF2 A;  1HKX A;  1TU5 A;  1GYB A;  1RN1 A;  2CC3 A;  9RNT A;  1GD3 A;  1KQS 2;  3F8H A;  3GZR A;  5EVH A;  5BIR A;  1AVK A;  1WMP A;  1IVX A;  1A2K A;  3CNX A;  1W5Z A;  1CYV A;  4FCZ A;  1TTO A;  3S28 A;  3KSE D;  2OWP A;  3LYG A;  1R4C A;  2GU3 A;  1UW1 A;  3PZW A;  1W7C A;  3IPT A;  3T8N A;  1C7H A;  2BO9 B;  4NPB A;  4LYL B;  2AAE A;  2UX0 A;  3LTD A;  3V98 A;  1BNJ A;  1UCL A;  1B2Z A;  1N9J A;  1IK3 A;  1CYU A;  4BL2 A;  2W2C A;  5D82 A;  3AHW A;  5AEU B;  4HYZ A;  1AY7 A;  4HZB B;  2P38 A;  4BTW A;  1W6G A;  3OW2 2;  1UCI A;  1VQ5 3;  1X1U A;  4CCV A;  3KSP A;  4R9L A;  1EKM A;  2BMO B;  3NXJ A;  4KFE A;  2M7O A;  1OF5 A;  2XSO B;  2XR8 B;  3D4A A;  1FGQ A;  1UCK A;  1GOU A;  3FLJ A;  3LTC A;  3LXU X;  3U97 A;  1T2H A;  1JBR A;  3CME 3;  3WHO A;  1EUI C;  2W56 A;  1VQ7 3;  2P05 A;  2BHM A;  1RNT A;  4J8T A;  4K90 B;  1BNE A;  1RGH A;  2OOV C;  1VQQ A;  3Q3F A;  4O02 B;  2W04 A;  2IY2 A;  4FR9 A;  2UUG C;  1ZX2 A;  3GAX A;  1YJW 3;  1N8Q A;  3G4S 3;  3SYU A;  3HI7 A;  3CNM A;  3V99 A;  2E2T A;  1CEW I;  1UI7 A;  1W6Y A;  3GZB A;  3F7X A;  2LYX A;  3LTB A;  5M19 A;  1BSA A;  1IT8 A;  1O7P B;  2C4B A;  2FNQ A;  3F14 A;  3DGO A;  4DKI A;  4J5K A;  3G71 3;  8CHO A;  1AV4 A;  1IV9 A;  2OCT A;  2E2V A;  1NO3 A;  1TRQ A;  1X1W A;  1K41 A;  4BIR A;  4CDL A;  2D1W A;  3KN4 A;  1BOX A;  3CMA 3;  4J9A A;  4EBG A;  1DVC A;  1M9G A;  1GY7 A;  1NNV A;  3I56 3;  3CC7 3;  4HM1 B;  5BU4 A;  2BT3 A;  1WMN A;  2BMR B;  1IDP A;  2F98 A;  1U5O A;  2K3D A;  1KD1 4;  1FW7 A;  3X3Y A;  1Q7Y 4;  1ULI B;  1UUV B;  1RGG A;  2K0M A;  3NV0 A;  3MSO A;  1RN7 A;  3CC4 3;  1MGW A;  1MGR A;  2WO0 A;  4AKY A;  5M1A A;  2ZHX B;  3BLZ A;  1B2M A;  1FA3 A;  1RGC A;  5IEN A;  1CQS A;  5IW9 A;  4GL6 A;  2K54 A;  5CXO A;  1RSN A;  4KFF A;  1SIH A;  2R4I A;  1GSP A;  1GS3 A;  2C10 A;  3K63 A;  5IG5 A;  1SJW A;  3B4O A;  4HM7 B;  5KP4 A;  5G2G A;  3JUN A;  3UL5 A;  3CD6 3;  3PCR A;  2YFL B;  3ZG5 A;  1UGI A;  2Z7A A;  1HZ1 A;  5IF6 A;  3BB9 A;  1UUG B;  4WYK B;  2O9U X;  3DGY A;  1I3F A;  1JV2 B;  1M1X B;  4Q53 A;  1Q86 4;  1K73 4;  4KFD A;  1VQO 3;  3EC9 A;  1O7G B;  2HML B;  3GRD A;  2QA4 3;  2HMM B;  2RFR A;  1I2F A;  1JKG A;  3RGR A;  2KCD A;  1GMQ A;  2WGQ A;  1S5A A;  4HAA A;  4KVH A;  2YX9 A;  5I97 A;  1AR0 A;  2XRX B;  1BRH A;  3JUO A;  3U1W A;  2CFD A;  2QIY A;  1B27 A;  1N5H A;  2F99 A;  2GXF A;  4FCJ A;  4CJN A;  3AGN A;  2MC8 A;  2H0H A;  1NU3 A;  1YJN 3;  2HOH A;  1ZS7 A;  1ZGX A;  3F9S A;  1DET A;  4KT3 B;  3CPW 2;  2RSX A;  4EV5 A;  1W2B 2;  1DE3 A;  1HU9 A;  2WOH A;  1LQM B;  1OUN A;  3QRD A;  3Q1C A;  1US1 A;  2RBI A;  4ILF A;  4N6L A;  5FW5 A;  3SXX A;  3DXO A;  2L1S A;  2WOF A;  3F8X A;  3VF1 A;  3WOE B;  3X41 A;  1A2P A;  4HM8 B;  2F5W A;  1STD A;  5KP3 A;  1U8C B;  1GY5 A;  1F8N A;  4ORL A;  3BND A;  3KFQ C;  1A67 A;  3DZL A;  3ROB A;  2W0Q A;  5JPU A;  3AGO A;  3D3L A;  1MWT A;  1TP6 A;  3B8L A;  4HM0 B;  1CH0 A;  3BNB A;  4K1V A;  4HM3 B;  5AIG A;  3NM2 A;  3ZG0 A;  5KP1 A;  1VQ9 3;  4HKV B;  2B1X B;  1KWI A;  5AII A;  4I4K A;  4X2H A;  3WOD G;  1KC8 4;  2SAR A;  1IV7 A;  3CU3 A;  3H3H A;  2E2U A;  2Z76 A;  1I2G A;  1QAK A;  5FGO A;  5EEO A;  3T0U A;  3LML A;  3PS8 A;  1RGF A;  3DM8 A;  1BUJ A;  2KF4 A;  1UDI I;  2IUJ A;  2JDI H;  3TDG A;  1BAN A;  1K28 A;  3G8Z A;  2HMJ B;  3URP A;  2Y73 A;  1E3R A;  1BNI A;  1YGE A;  1STF I;  1G0T A;  3I0Y A;  3LZA A;  2OQE C;  3KCH A;  1FUT A;  4RNZ A;  1RGE A;  3FGY A;  4L8O A;  5G1L A;  1M1K 4;  1LOX A;  1FYS A;  2H0G A;  1RRH A;  3BNC A;  3OWS A;  5DRE A;  2Q07 A;  5IG4 A;  1RDS A;  2CG1 A;  3X3Z A;  1EEJ A;  2ZA4 A;  3NBJ A;  3STD A;  3SX1 A;  3I55 3;  1DVD A;  1BSB A;  2O3O A;  1OGX A;  3D5I A;  3B7C A;  2HMN B;  3ER7 A;  3V92 A;  2W9Q A;  1YVS A;  2CWU A;  4OUQ A;  3EHC A;  1BRS A;  1PU4 A;  3GZX B;  4IIA A;  1B2X A;  1IQX A;  3KE7 A;  3MWZ A;  4XBY A;  3WOF B;  3K5T A;  3Q2P A;  2KF5 A;  5JPP A;  1UUW B;  4FMD A;  4IPB A;  5JBS A;  2GBX B;  1MOL A;  1BAO A;  1N8R 4;  1RCL A;  2CG0 A;  3EBY A;  3FF2 A;  3DH2 A;  4LGQ A;  1BUQ A;  1BSD A;  3ZFZ A;  1T2I A;  5IER A;  4FMA A;  3CXC 2;  2W03 A;  1RCK A;  1LQG C;  3CPO A;  3JUQ A;  1BNF A;  5AIH A;  1O7W B;  4R9K A;  1MWS A;  1M90 4;  4N6V 0;  1BGS A;  1JB2 A;  4MMZ B;  2D42 A;  4XBX A;  1RJO A;  3FG3 A;  1T5Y A;  3A5E A;  3T8U A;  1RKY A;  3G6E 3;  2OTL 3;  3FG1 A;  1W00 A;  3CCM 3;  1RTU A;  5BXQ A;  1OHO A;  1SAR A;  3NM7 A;  2XGN A;  1V58 A;  1ULJ B;  3F40 A;  4N6T A;  1GOY A;  4N6N B;  1YJ9 3;  2CWV A;  1PYL A;  1VQL 3;  1WTH A;  5STD A;  1JN5 B;  3N9H A;  3FKA A;  1NWW A;  3L0R A;  2CKF B;  1B21 A;  3EF8 A;  3JVC A;  2Y74 A;  1IYY A;  5DRV A;  3RGA A;  1I0X A;  4GSP A;  4RZM A;  1W02 A;  1RGA A;  2KXG A;  4HM5 B;  1QJG A;  1R4Y A;  4R1K A;  3H51 A;  3B4P A;  3LT8 A;  4KZ1 A;  1E97 A;  1QMA A;  1OH0 A;  1BU4 A;  2A15 A;  2W6J H;  1B3S A;  3ECF A;  4HJL B;  2KRT A;  1RGL A;  2P09 A;  3EN8 A;  2C11 A;  2MF7 A;  4JRF A;  3RDE A;  1JBS A;  1G02 A;  1ASK A;  3E99 A;  1BNS A;  1VQ4 3;  4O3V A;  4MEI A;  3CCJ 3;  1BIR A;  2XSH B;  3DMC A;  2Z77 A;  3NHX A;  4HVN A;  2P0X A;  1VQ6 3;  4QWT A;  1GY6 A;  1JRQ A;  4WYK A;  1IVW A;  4EC6 A;  1YIJ 3;  4LSO A;  1BNG A;  3GWR A;  1PFP A;  2CFK A;  2HMO B;  1LXE A;  4G1M B;  1WMO A;  3X3X A;  3LH4 A;  1DYU A;  3GZY B;  1VQN 3;  5A0O B;  3OX9 A;  1FZU A;  3FSD A;  1T3B A;  2XH9 A;  1D6Y A;  1OHS A;  4HM4 B;  4J5G A;  5M18 A;  1WNH A;  1Q42 A;  4LEH A;  3IMA B;  3UJM A;  5IG0 A;  4L8P A;  4MMY B;  1IVV A;  1QAF A;  4XDW A;  3PYJ A;  2IMJ A;  3NQY A;  3HII A;  3DGN A;  3DY5 A;  4K61 A;  4NHF A;  2CIU A;  4RNT A;  4MJD A;  2BNG A;  1J2B A;  2STD A;  2PNC A;  3DGL A;  4BU4 A;  1RHL A;  1B2U A;  4HM2 B;  1GOV A;  1IQ8 A;  1VQM 3;  1Q81 4;  2BMQ B;  3FCS B;  1SQW A;  1A2V A;  1W01 A;  1K8A 4;  1G96 A;  3MG1 A;  3VGN A;  1AVL A;  3DGM A;  3NBR A;  4XDV A;  1BNR A;  4N6O B;  3SVA A;  3VSY A;  4AEQ A;  3X42 A;  1Q82 4;  4HM6 B;  2CX1 A;  1NB5 I;  1UI8 A;  2BU4 A;  1LNI A;  1W4N A;  2AAD A;  3KZT A;  3CCQ 3;  3OWU A;  3Q90 A;  5AI1 A;  3CC2 3;  7STD A;  5AIF A;  4FCM A;  4EYC A;  3BIR A;  1Q40 B;  2CX0 A;  1I0V A;  2KF6 A;  3AMO B;  3WA2 X;  1RMS A;  1VZZ A;  1X1Y A;  4RNY A;  3BNE A;  5HOH A;  1S72 3;  4WWU C;  1EQK A;  2ZL8 A;  1RNB A;  1GMP A;  5IEO A;  1Z1S A;  2J8X B;  1O7N B;  1LNH A;  6STD A;  1BRK A;  2OOV A;  1V74 A;  1ISK A;  3WDG B;  2XFT A;  2GEX A;  3QK9 A;  1IQY A;  4EXR A;  5D83 A;  5CF1 A;  7GSP A;  4GHO A;  2RCD A;  2RNT A;  3DUK A;  1OCV A;  1NB3 I;  2V1L A;  3K7C A;  3UL6 A;  1OPY A;  3SLU A;  2CH9 A;  3WA3 A;  1HYF A;  1UCJ A;  2CK3 H;  1X1X A;  3MHE A;  1A90 A;  1N9E A;  1I3I A;  1D6U A;  4OK0 A;  1FGM A;  1FGO A;  1BVI A;  2F4Y A;  1OHP A;  3EQQ B;  5CLK A;  3X40 A;  4TX4 A;  6RNT A;  2L4V A;  1YIT 3;  1FUW A;  3OWY A;  4MMX B;  3CCE 3;  3MKI A;  2INX A;  2GBW B;  2CFG A;  1Q7H A;  2CW9 A;  3MPH A;  4WFO A;  2JQ5 A;  1SII A;  4CPK A;  4R80 A;  2XGL A;  5G1K A;  3O8Y A;  3S5C A;  1ZO2 A;  4H3U A;  2F5M A;  3AHS A;  2RGQ A;  3EJV A;  2KAA A;  4N3V A;  1FGR A;  3UNL A;  5GSP A;  1BRN L;  1B2S A;  2KF3 A;  4JF8 A;  2XF3 A;  5EQL A;  1RRL A;  1Y4K A;  4BTX A;  1JNQ A;  1EA2 A;  1W2Z A;  1IT7 A;  2WGO A;  3PCS A;  1LOW A;  5TGN A;  1OF5 B;  5RNT A;  1LOV A;  1FGT A;  1D6Z A;  1JZO A;  4PEJ A;  3CCV 3;  3N54 B;  1BRJ A;  3ALA A;  1RGK A;  1NDO B;  2W56 B;  3RNT A;  1O7M B;  1C54 A;  3N8B A;  3S67 A;  1EG9 B;  1FUS A;  4LZI A;  1JB4 A;  2IA7 A;  2ML6 A;  1JB5 A;  1AQZ A;  1JN5 A;  1OGZ A;  3HK4 A;  3K0Z A;  3GSP A;  4FMC A;  2P0M A;  2IUK A;  3G0K A;  4I5Q A;  1ROA A;  4NRE A;  2H0I A;  3MYT A;  4AKZ A;  1DMM A;  2IYJ A;  3SED A;  2W9P A;  4IT7 A;  3S27 A;  1DMQ A;  2GU1 A;  1RLS A;  2GSP A;  4N6U A;  1BRI A;  3JUM A;  1YVB I;  3LOY A;  3NUV A;  3F7S A;  4HOH A;  3D5G A;  3CCU 3;  1RN4 A;  2CHC A;  4K1U A;  5IEP A;  3NBB A;  4X2O A;  3SOY A;  3M8C A;  3HX8 A;  3EE1 A;  1QAL A;  4WP5 A;  3KKG A;  1NJI 4;  3OV4 A;  3WMD A;  5LC7 A;  5ELJ A;  1ROV A;  5LC6 A;  1E3V A;  3FH1 A;  1LRA A;  2GEY A;  3EB8 A;  3FF0 A;  2CWT A;  3PGB A;  4O2H A;  4ZM8 A;  2FXT A;  3A76 A;  3KII A;  2XFS A;  3D79 A;  2ZDJ A;  4XB5 A;  2PZV A;  1BRG A;  1B20 A;  3G16 A;  3IJE B;  4BL3 A;  4R4K A;  3NV0 B;  2HMK B;  3EN1 B;  1N5P A;  2QEX 3;  6GSP A;  2F86 B;  2R41 A;  1QVG 2;  1BSC A;  3MG2 A;  3S29 A;  2OTJ 3;  4O8S A;  2BIR A;  7RNT A;  1DMN A;  1JBT A;  1VQK 3;  1QVF 2;  3HZP A;  1TRP A;  5AYS C;  2QGU A;  8RNT A;  1I2E A;  2XEP A;  2CFW A;  5CK6 A;  3UB1 A;  1TFO A;  5D81 A;  3SOA A;  4L7K A;  1YHQ 3;  1LVN A;  1TUH A;  3CCR 3;  3MG3 A;  3NX0 A;  2LQV A;  1VQP 3;  2SBL A;  1VQ8 3;  1SPU A;  4GB5 A; 
#chains in the Genus database with same CATH homology
 3OXA A;  4U13 A;  2ML5 A;  4BTY A;  3LTA A;  1K9M 4;  4N6M A;  1JJ2 2;  5ELU A;  3HIG A;  4RBN A;  2OQE A;  4HBR A;  1JKG B;  3LT9 A;  2YFI B;  1TIJ A;  1L5G B;  1GD4 A;  4XBT A;  3PXM A;  1W6C A;  3FZW A;  2B24 B;  1OAC A;  4EV2 A;  3EBT A;  4XM4 A;  1MNL A;  5AEW B;  5BVB A;  4FMB A;  1YI2 3;  3J7Y d;  1WQL B;  2YFJ B;  3FG4 A;  3NQZ A;  1O7H B;  1IVU A;  4STD A;  3D9R A;  1KSI A;  3K9M C;  2I9W A;  3EX9 A;  5HGR A;  1Q40 A;  3JUP A;  5IG3 A;  3AMO A;  5AYR B;  4H61 A;  2Z6B A;  4LMI A;  1IU7 A;  1TFK A;  3CCS 3;  3CCL 3;  2FGT A;  4HZ9 B;  4OVM A;  4WHA A;  2CFL A;  5CF2 A;  1HKX A;  1TU5 A;  1GYB A;  2CC3 A;  1GD3 A;  1KQS 2;  3F8H A;  3GZR A;  5EVH A;  1AVK A;  1WMP A;  1IVX A;  1A2K A;  3CNX A;  1W5Z A;  1CYV A;  4FCZ A;  3S28 A;  3KSE D;  2OWP A;  3LYG A;  1R4C A;  2GU3 A;  1UW1 A;  3PZW A;  1W7C A;  3IPT A;  3T8N A;  1C7H A;  2BO9 B;  2UX0 A;  3LTD A;  3V98 A;  1N9J A;  1CYU A;  2W2C A;  5D82 A;  5AEU B;  4HYZ A;  4HZB B;  2P38 A;  4BTW A;  1W6G A;  3OW2 2;  1VQ5 3;  4CCV A;  3KSP A;  4R9L A;  1EKM A;  2BMO B;  3NXJ A;  4KFE A;  2M7O A;  1OF5 A;  2XSO B;  2XR8 B;  1FGQ A;  3LTC A;  3FLJ A;  3LXU X;  3U97 A;  3CME 3;  2W56 A;  1VQ7 3;  2P05 A;  2BHM A;  4J8T A;  4K90 B;  2OOV C;  4O02 B;  2W04 A;  4FR9 A;  1ZX2 A;  3GAX A;  1YJW 3;  1N8Q A;  3G4S 3;  3HI7 A;  3CNM A;  3V99 A;  2E2T A;  1CEW I;  1UI7 A;  1W6Y A;  3GZB A;  3F7X A;  2LYX A;  3LTB A;  1O7P B;  1IT8 A;  2FNQ A;  3F14 A;  3DGO A;  3G71 3;  8CHO A;  1AV4 A;  1IV9 A;  2OCT A;  2E2V A;  1NO3 A;  3CMA 3;  1K41 A;  4CDL A;  2D1W A;  3KN4 A;  4J9A A;  4EBG A;  1DVC A;  1M9G A;  1GY7 A;  3I56 3;  3CC7 3;  4HM1 B;  2BT3 A;  1WMN A;  2BMR B;  1IDP A;  2F98 A;  1U5O A;  1KD1 4;  3X3Y A;  1Q7Y 4;  1ULI B;  1UUV B;  2K0M A;  3NV0 A;  3MSO A;  1RN7 A;  3CC4 3;  2WO0 A;  4AKY A;  3BLZ A;  1FA3 A;  5IEN A;  1CQS A;  5IW9 A;  4GL6 A;  2K54 A;  5CXO A;  4KFF A;  1SIH A;  2R4I A;  3K63 A;  1GS3 A;  2C10 A;  5IG5 A;  1SJW A;  3B4O A;  4HM7 B;  5KP4 A;  5G2G A;  3JUN A;  3UL5 A;  3CD6 3;  3PCR A;  2YFL B;  2Z7A A;  5IF6 A;  3BB9 A;  4WYK B;  2O9U X;  1Q86 4;  1JV2 B;  4Q53 A;  1M1X B;  1K73 4;  4KFD A;  1VQO 3;  3EC9 A;  1O7G B;  2HML B;  3GRD A;  2QA4 3;  2HMM B;  2RFR A;  1JKG A;  3RGR A;  2KCD A;  2WGQ A;  4KVH A;  1S5A A;  2YX9 A;  5I97 A;  1AR0 A;  2XRX B;  3JUO A;  3U1W A;  2CFD A;  2QIY A;  1N5H A;  2F99 A;  2GXF A;  4FCJ A;  2MC8 A;  1YJN 3;  1NU3 A;  3F9S A;  3CPW 2;  2RSX A;  4EV5 A;  1W2B 2;  1HU9 A;  2WOH A;  1OUN A;  5FW5 A;  3QRD A;  3Q1C A;  1US1 A;  4N6L A;  3SXX A;  3DXO A;  2WOF A;  3F8X A;  3VF1 A;  3WOE B;  3X41 A;  4HM8 B;  1STD A;  5KP3 A;  1U8C B;  1GY5 A;  1F8N A;  4ORL A;  3BND A;  3KFQ C;  1A67 A;  3DZL A;  3ROB A;  2W0Q A;  5JPU A;  3D3L A;  3B8L A;  1TP6 A;  4HM0 B;  4K1V A;  3BNB A;  3UNL A;  5AIG A;  4HM3 B;  1VQ9 3;  3NM2 A;  5KP1 A;  4HKV B;  2B1X B;  1KWI A;  5AII A;  4I4K A;  4X2H A;  3WOD G;  1KC8 4;  1IV7 A;  3CU3 A;  3H3H A;  2E2U A;  2Z76 A;  1QAK A;  5FGO A;  3T0U A;  5EEO A;  3LML A;  3PS8 A;  3DM8 A;  2IUJ A;  2JDI H;  3TDG A;  1K28 A;  3G8Z A;  2HMJ B;  2Y73 A;  1E3R A;  1YGE A;  1STF I;  3LZA A;  3I0Y A;  4RNZ A;  2OQE C;  1IK3 A;  4L8O A;  3FGY A;  1M1K 4;  1LOX A;  5DRE A;  1RRH A;  3BNC A;  3OWS A;  2Q07 A;  5IG4 A;  3X3Z A;  2CG1 A;  3I55 3;  3NBJ A;  3STD A;  3SX1 A;  1DVD A;  2O3O A;  1OGX A;  3B7C A;  2HMN B;  3ER7 A;  3V92 A;  2W9Q A;  2CWU A;  4OUQ A;  3EHC A;  1PU4 A;  3GZX B;  4IIA A;  1IQX A;  3KE7 A;  3MWZ A;  4XBY A;  3WOF B;  3K5T A;  3Q2P A;  5JPP A;  1UUW B;  4FMD A;  4IPB A;  5JBS A;  2GBX B;  1MOL A;  1N8R 4;  2CG0 A;  3EBY A;  3FF2 A;  4LGQ A;  1BUQ A;  5IER A;  4FMA A;  3CXC 2;  2W03 A;  3CPO A;  5AIH A;  3JUQ A;  1O7W B;  4R9K A;  1M90 4;  4N6V 0;  1JB2 A;  4MMZ B;  2D42 A;  4XBX A;  1RJO A;  3FG3 A;  1T5Y A;  3T8U A;  1RKY A;  3G6E 3;  2OTL 3;  3FG1 A;  1W00 A;  3CCM 3;  5BXQ A;  1OHO A;  3NM7 A;  2XGN A;  1ULJ B;  3F40 A;  4N6T A;  4N6N B;  1YJ9 3;  2CWV A;  1VQL 3;  1WTH A;  5STD A;  1JN5 B;  3N9H A;  3FKA A;  1NWW A;  3L0R A;  2CKF B;  3EF8 A;  3JVC A;  2Y74 A;  5DRV A;  3RGA A;  4RZM A;  1W02 A;  2KXG A;  4HM5 B;  1QJG A;  4R1K A;  3H51 A;  3B4P A;  3LT8 A;  4KZ1 A;  1E97 A;  1QMA A;  1OH0 A;  2A15 A;  2W6J H;  3ECF A;  4HJL B;  2KRT A;  2P09 A;  3EN8 A;  2C11 A;  2MF7 A;  4JRF A;  3RDE A;  1ASK A;  3E99 A;  1VQ4 3;  4O3V A;  4MEI A;  3CCJ 3;  3DMC A;  2XSH B;  3NHX A;  2Z77 A;  4HVN A;  2P0X A;  1VQ6 3;  4QWT A;  1GY6 A;  1JRQ A;  4WYK A;  1IVW A;  4EC6 A;  1YIJ 3;  4LSO A;  3GWR A;  1PFP A;  2CFK A;  2HMO B;  1LXE A;  4G1M B;  1WMO A;  3X3X A;  3LH4 A;  1DYU A;  3GZY B;  1VQN 3;  5A0O B;  3OX9 A;  3FSD A;  2XH9 A;  1D6Y A;  1OHS A;  4HM4 B;  1WNH A;  1Q42 A;  4LEH A;  3IMA B;  3UJM A;  5IG0 A;  4L8P A;  4MMY B;  1IVV A;  1QAF A;  4XDW A;  3PYJ A;  2IMJ A;  3NQY A;  3HII A;  3DGN A;  3DY5 A;  4K61 A;  4NHF A;  2CIU A;  4MJD A;  2BNG A;  1J2B A;  2STD A;  2PNC A;  3DGL A;  4HM2 B;  1VQM 3;  1IQ8 A;  1Q81 4;  2BMQ B;  3FCS B;  1SQW A;  1A2V A;  1W01 A;  1K8A 4;  1G96 A;  3MG1 A;  3VGN A;  1AVL A;  3DGM A;  3NBR A;  4XDV A;  4N6O B;  3SVA A;  3VSY A;  4AEQ A;  3X42 A;  1Q82 4;  4HM6 B;  1NB5 I;  1UI8 A;  3KZT A;  1W4N A;  3CCQ 3;  3OWU A;  3Q90 A;  5AI1 A;  3CC2 3;  7STD A;  5AIF A;  4FCM A;  4EYC A;  1Q40 B;  3WA2 X;  3AMO B;  1VZZ A;  4RNY A;  3BNE A;  1S72 3;  4WWU C;  1EQK A;  2ZL8 A;  5IEO A;  1Z1S A;  1O7N B;  1LNH A;  6STD A;  2OOV A;  1V74 A;  1ISK A;  3WDG B;  2XFT A;  2GEX A;  3QK9 A;  1IQY A;  4EXR A;  5D83 A;  5CF1 A;  2RCD A;  3DUK A;  1OCV A;  1NB3 I;  2V1L A;  3K7C A;  3UL6 A;  1OPY A;  3SLU A;  2CH9 A;  3WA3 A;  2CK3 H;  3MHE A;  1A90 A;  1N9E A;  1D6U A;  4OK0 A;  1FGM A;  1FGO A;  1OHP A;  3EQQ B;  5CLK A;  3X40 A;  4TX4 A;  2L4V A;  1YIT 3;  1FUW A;  3OWY A;  4MMX B;  3CCE 3;  3MKI A;  2INX A;  2GBW B;  2CFG A;  2CW9 A;  3MPH A;  4WFO A;  2JQ5 A;  1SII A;  4R80 A;  2XGL A;  3O8Y A;  3S5C A;  1ZO2 A;  4H3U A;  2RGQ A;  3EJV A;  4N3V A;  1FGR A;  4JF8 A;  2XF3 A;  5EQL A;  1RRL A;  1Y4K A;  4BTX A;  1JNQ A;  1EA2 A;  1W2Z A;  1IT7 A;  2WGO A;  3PCS A;  5TGN A;  1OF5 B;  1FGT A;  1D6Z A;  4PEJ A;  3CCV 3;  3N54 B;  3ALA A;  1NDO B;  2W56 B;  1O7M B;  3N8B A;  3S67 A;  1EG9 B;  4LZI A;  1JB4 A;  2IA7 A;  2ML6 A;  1JB5 A;  1JN5 A;  1OGZ A;  3HK4 A;  3K0Z A;  4FMC A;  2P0M A;  2IUK A;  3G0K A;  4NRE A;  1ROA A;  3MYT A;  4AKZ A;  1DMM A;  3SED A;  2W9P A;  4IT7 A;  3S27 A;  1DMQ A;  2GU1 A;  4N6U A;  3JUM A;  1YVB I;  3LOY A;  3NUV A;  3F7S A;  3CCU 3;  2CHC A;  4K1U A;  5IEP A;  3NBB A;  4X2O A;  3SOY A;  3M8C A;  3HX8 A;  3EE1 A;  1QAL A;  4WP5 A;  3KKG A;  1NJI 4;  3OV4 A;  3WMD A;  5LC7 A;  5ELJ A;  1ROV A;  5LC6 A;  1E3V A;  3FH1 A;  2GEY A;  3EB8 A;  3FF0 A;  2CWT A;  3PGB A;  4O2H A;  4ZM8 A;  2FXT A;  3A76 A;  3KII A;  2XFS A;  4XB5 A;  2ZDJ A;  2PZV A;  3G16 A;  3IJE B;  4R4K A;  3NV0 B;  2HMK B;  3EN1 B;  1N5P A;  2QEX 3;  2F86 B;  1QVG 2;  3MG2 A;  3S29 A;  2OTJ 3;  4O8S A;  1DMN A;  1VQK 3;  1QVF 2;  3HZP A;  5AYS C;  2QGU A;  2XEP A;  2CFW A;  5CK6 A;  3UB1 A;  1TFO A;  5D81 A;  3SOA A;  4L7K A;  1YHQ 3;  1LVN A;  1TUH A;  3CCR 3;  3MG3 A;  3NX0 A;  2LQV A;  1VQP 3;  2SBL A;  1VQ8 3;  1SPU A;  4GB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...