1RGFA

Hydrolase, guanyloribonuclease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
total genus 21
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgfA00
3DH2A 1DETA 1LNIA 1YGWA 1BNGA 1BNSA 3AGOA 1BNIA 1I0XA 1BNFA 1MGWA 2KF4A 3AHSA 1GMQA 1RGHA 1UCJA 1BUJA 2F5WA 2AAEA 1RGKA 1T2IA 3SYUA 3WR2A 1B2MA 4J5GA 4GSPA 1BSCA 1FUTA 1BU4A 1LRAA 4GHOA 1TRQA 1AQZA 1T2HA 1JBTA 1I3IA 1BVIA 1I3FA 5BU4A 4BU4A 2F4YA 2F5MA 6GSPA 3BIRA 1BRNL 1BRGA 1A2PA 3DGYA 1JBRA 1FUSA 2ZA4A 1B20A 1LOYA 1FZUA 3A5EA 1RNBA 3WHOA 3GSPA 1RGGA 1BNEA 1BSEA 6RNTA 1R4YA 1B2XA 1BSDA 1TTOA 3D5IA 3HOHA 3URPA 5RNTA 1RGFA 2RNTA 2KF6A 1SARA 1BSBA 1HYFA 1RGEA 1TRPA 1GSPA 2AADA 1YVSA 1PY3A 1BGSA 1BRIA 1FYSA 1RGLA 1RCKA 2KF3A 1MGRA 2GSPA 4BIRA 1B3SA 1FW7A 1UCKA 1RLSA 1B2UA 1BAOA 1RMSA 1RSNA 1BSAA 2HOHA 1JBSA 1RGCA 1B2ZA 1X1XA 1I0VA 1RCLA 3BU4A 2SARA 1RNTA 1CH0A 1UCLA 2F56A 3D4AA 4J5KA 1BOXA 3AHWA 1GOVA 4HAAA 3KCHA 1LOWA 1G02A 1B21A 1RN4A 2C4BA 1I70A 1I2FA 1BRJA 1ZGXA 1DE3A 1GMRA 1X1WA 3Q3FA 3AGNA 2RBIA 1X1YA 1HZ1A 1BNRA 1AY7A 7RNTA 1C54A 1PYLA 3RNTA 1GOUA 2BIRA 1BRHA 5HOHA 1RDSA 8RNTA 1RTUA 1X1UA 4HOHA 1I2EA 1GMPA 7GSPA 1RN1A 2BU4A 5BIRA 1BIRA 1LOVA 1YNVX 1B27A 1BANA 1IYYA 1BRKA 1I8VA 9RNTA 5GSPA 4RNTA 1BNJA 1B2SA 1I2GA 1Q9EA 3D5GA 2KF5A 2KAAA 1BRSA 1UCIA 1GOYA 1RHLA 1RGAA
chains in the Genus database with same CATH superfamily
1W6GA 5CLKA 3ZFZA 1IT8A 1LOXA 4H3UA 1RJOA 3DM8A 4LMIA 3JUOA 2XFTA 1W6YA 5IG0A 2CFGA 1TFKA 4MMXB 3CME3 2BMQB 1VQO3 1I0XA 1YJ93 2KF4A 5M19A 4AKZA 3I553 2FXTA 2WOFA 1W4NA 1RGHA 1WMPA 1UCJA 3ALAA 1BUJA 1ROAA 2CW9A 2F5WA 4EXRA 1RGKA 1T2IA 1YIJ3 1QVF2 3FCSB 2R41A 4N6LA 2GBXB 3NBJA 1GYBA 4GHOA 1IT7A 1AQZA 1RN7A 2YFIB 2YX9A 3FG1A 5AYRB 3VF1A 3WA3A 1I3FA 3B7CA 1OHSA 2OTL3 1FGOA 1GY5A 3F8HA 3F9SA 3LYGA 4HBRA 4WP5A 1IQXA 1JV2B 1BRNL 1QMAA 4O3VA 1EQKA 2W2CA 1D6ZA 2ZA4A 1LOYA 2OCTA 3RGAA 2PNCA 1N9EA 1O7HB 2CX1A 3NBBA 6STDA 1W00A 3MG3A 1VQP3 2XH9A 3K5TA 5HGRA 3FF2A 3SX1A 2P0XA 2F99A 1S5AA 4FCZA 3CU3A 3SLUA 1TU5A 1BSDA 2BNGA 2KRTA 3EBYA 5IG3A 3B4OA 2MC8A 2STDA 3URPA 1RGFA 2IUJA 1HYFA 3CNXA 1RGEA 2W9QA 4J9AA 4BTYA 3GZYB 4EC6A 1ISKA 3OWUA 1RGLA 1V74A 5CF1A 3ECFA 1VQQA 3O8YA 3G6E3 3OXAA 1M1XB 3D79A 1B3SA 4GB5A 4NPBA 2Z6BA 4IT7A 2CWTA 4EBGA 1Q40B 3L0RA 4JRFA 3G4S3 1BAOA 3FF0A 3CC23 4N6UA 4RZMA 3CC73 3DGOA 1RGCA 1B2ZA 1ROVA 2GXFA 5TGNA 1ULIB 2O9UX 2P0MA 4FMBA 3V99A 3BU4A 1RCLA 4MMZB 1W02A 2E2VA 3DY5A 3LMLA 1LXEA 1GD3A 3M8CA 2F56A 3D4AA 2BT3A 4Q53A 4J5KA 1RRHA 2CWUA 2MF7A 1M9GA 2GU1A 2BO9B 5DREA 3V98A 5BXQA 5IERA 3G8ZA 3Q90A 2OTJ3 1PFPA 4KT3B 3IJEB 1GMRA 5JBSA 3CCV3 3T8NA 1CEWI 1MWRA 4DKIA 1E3VA 2RSXA 3BNEA 1D6UA 4XBYA 1BNRA 3MG1A 5CXOA 4AKYA 1PYLA 3I563 1S723 1FGRA 1NO3A 3NV0B 1RDSA 8RNTA 3CCU3 3NQYA 4HOHA 1I2EA 4EV5A 4X2OA 1HU9A 2BU4A 4BTXA 1YNVX 3CD63 2RFRA 1BANA 3N9HA 4N6V0 3X3XA 4OVMA 4STDA 9RNTA 1UUVB 2W56B 2XSHB 3BNDA 3KSPA 5ELUA 1VQM3 5CF2A 1BNJA 2CK3H 1IK3A 1OCVA 3NQZA 4R80A 1UCIA 3NM7A 3ROBA 1GOYA 5AIHA 1FGQA 3DUKA 2C11A 1RGAA 1SQWA 4FR9A 3F14A 2CWVA 4IIAA 3DH2A 1Q824 1LNIA 1Y4KA 4O02B 3DGNA 5JPPA 1BNIA 1C7HA 4FMCA 3LTBA 3S28A 3J7Yd 1VQ53 1OHOA 2CG1A 2OQEC 1B2MA 3OW22 1CQSA 1N8QA 2P05A 3LT8A 4R9LA 3JUQA 3NBRA 4GSPA 1VQ93 1N5HA 2HMKB 2FGTA 3VGNA 1BU4A 4HZ9B 3CPOA 1NDOB 1OGZA 5FGOA 1Q864 1IVVA 4PEJA 4HM8B 2CFLA 5AYSC 4BU4A 3CCS3 2F5MA 6GSPA 5AIIA 1E3RA 1YJW3 1NU3A 2HMMB 1DMMA 3AMOA 4HM1B 1OGXA 4K1VA 4FCMA 1JNQA 3S67A 1FZUA 4XBTA 5D82A 1RNBA 2UX0A 1YJN3 4XDWA 1U5OA 3F40A 5EEOA 1RGGA 2CFKA 1NNVA 1W6CA 3MPHA 2QEX3 2M7OA 1R4YA 3OWSA 1KWIA 4R1KA 3ZG5A 1O7NB 2Y74A 2WO0A 3FG4A 4EV2A 2L1SA 3FZWA 1M904 5RNTA 1K28A 2RCDA 2GBWB 1A90A 2KF6A 3EE1A 4LEHA 3QK9A 2OQEA 1EKMA 1OH0A 2XSOB 1YVSA 3IMAB 1PY3A 1BGSA 3NUVA 2XEPA 1ULJB 4I4KA 1IVWA 1UGHI 1JB4A 1M1K4 1IDPA 1R4CA 3SVAA 1CYUA 1HKXA 1IQYA 4O2HA 1T5YA 4WYKA 1MWSA 2CFDA 2ZDJA 1G96A 4FMAA 4XM4A 3HI7A 1JBSA 4AEQA 5AEUB 3TDGA 2OWPA 2Z7AA 2QA43 3JUPA 5CK6A 1RNTA 3PCSA 3CCM3 1UCLA 4XBXA 3UJMA 2H0IA 3X40A 1J2BA 8CHOA 3ZG0A 3LOYA 3SXXA 1GOVA 1STFI 4WHAA 2HMJB 4HZBB 1B21A 5AI1A 3V92A 1Q814 5G1KA 1KQS2 1BRJA 1ZGXA 2CFWA 3HZPA 3F7SA 1DE3A 2KXGA 2OOVC 1SJWA 1X1WA 2IA7A 3E99A 4EW5A 1X1YA 2GEYA 1HZ1A 2CX0A 2Z77A 5I97A 2CG0A 1C54A 3UL5A 5KP4A 1U8CB 1UI7A 5HOHA 1RTUA 3KN4A 3U97A 5BIRA 1BIRA 2Q07A 2IYJA 3PS8A 3WOEB 1B27A 3EQQB 2XGNA 4BTWA 2CH9A 1JJ22 1BRKA 1IYYA 2ZL8A 3KIIA 5BVBA 4MMYB 1NB3I 1JN5B 5JPUA 3K9MC 3D5GA 1Q9EA 5EVHA 1YGEA 2KF5A 4HJLB 1BRSA 2CHCA 2W03A 1RHLA 3EN1B 1DVCA 1YVBI 1Q7HA 2ML6A 1O7PB 1Q40A 2XRXB 4KFDA 3KE7A 4RBNA 4NHFA 3CC43 3Q2PA 3VSYA 1YGWA 2CC3A 3AGOA 1DMNA 3MWZA 1JKGB 4K90B 5M18A 1MWTA 1O7GB 3AHSA 4CJNA 2XF3A 3DMCA 1KD14 3K63A 2AAEA 1ZX2A 2D42A 1GD4A 5KP3A 1LRAA 4RNZA 1TRQA 5G1LA 1WMOA 1K734 1T2HA 2H0GA 1I3IA 3EHCA 1DYUA 3F7XA 3UNLA 1N8R4 5BU4A 2F4YA 3HX8A 4U13A 3S5CA 3JUMA 1YI23 1BRGA 1A2PA 1WTHA 3DGYA 1FA3A 1OACA 3PCRA 1SIHA 2C10A 3DZLA 3UB1A 1FUSA 1G0TA 3Q1CA 1B20A 3DGLA 3LXUX 1LVNA 2Z76A 2BHMA 4KFEA 3A5EA 2JQ5A 1UDII 4TX4A 5AEWB 3MYTA 1OF5A 1LQGC 1BNEA 4HKVB 2IUKA 2BMRB 5D81A 2O3OA 4L8OA 6RNTA 3I0YA 1NJI4 1LNHA 1TTOA 3HOHA 2UGIA 3X42A 3EBTA 2IMJA 2GEXA 4HM5B 3G713 1W5ZA 3KSED 5A0OB 4HM0B 2RNTA 1N9JA 4RNYA 1TRPA 2YFJB 3OV4A 1DMQA 1VQN3 1NWWA 1RCKA 4ILFA 2P38A 4R9KA 2GSPA 3DXOA 2FNQA 4WWUC 3K0ZA 4LGQA 3MHEA 3BNCA 1N5PA 3NXJA 3UL6A 1UCKA 3FH1A 3D3LA 1B2UA 4XB5A 1WNHA 3AMOB 5EQLA 1K8A4 1RMSA 2K0MA 4HVNA 1FGTA 1JB5A 2HOHA 5DRVA 1YIT3 1VQ43 1SIIA 4K61A 1K9M4 2CKFB 3N54B 4KVHA 4MEIA 3KFQC 1X1XA 4N3VA 1US1A 1EG9B 2E2UA 2L4VA 3GZBA 3LT9A 3PGBA 3HK4A 1TUHA 3NX0A 3AHWA 4BL2A 1ZO2A 1W2ZA 3KCHA 3MG2A 4NREA 3G16A 1G02A 1RRLA 3CMA3 2RGQA 1I2FA 3FLJA 3T8UA 1JB2A 2LQVA 3EC9A 4N6MA 3FGYA 4HM7B 5IEOA 3AGNA 3QRDA 1FGMA 4K1UA 3JUNA 2XR8B 3RNTA 1F8NA 2PZVA 2CIUA 1QAKA 1STDA 1X1UA 2W0QA 3F8XA 3HIIA 4LZIA 7GSPA 2UUGC 3WODG 4CCVA 3OWYA 1A2KA 1MWUA 1RN1A 2WGQA 1EEJA 1UW1A 2ZHXB 1O7MB 1EUIC 1IQ8A 4WYKB 3X3YA 1UUWB 4HM6B 1Z1SA 3PZWA 1I8VA 1VQK3 4N6NB 1UGIA 2W04A 4HYZA 1B2SA 1I2GA 3LTAA 3X41A 1D6YA 2KAAA 4J8TA 4IPBA 4JF8A 1QVG2 5LC6A 1A2VA 2JDIH 3H51A 1A67A 4FMDA 4R4KA 4CDLA 3A76A 2W9PA 1K41A 4XDVA 3NHXA 3T0UA 1AVLA 4OUQA 3X3ZA 1ASKA 1AV4A 3CXC2 1ZS7A 1DETA 1UI8A 1NB5I 2XGLA 1BNGA 1BNSA 3RDEA 5M1AA 3MKIA 1W01A 1BNFA 1MGWA 2W6JH 2R4IA 4ORLA 1GMQA 2BMOB 5IW9A 2GU3A 1IU7A 3ER7A 1QAFA 1WQLB 2I9WA 3SYUA 3WR2A 3CCL3 3LH4A 3U1WA 3GZXB 1FUWA 4J5GA 2J8XB 1BSCA 1FUTA 3BNBA 4HM4B 2KCDA 3NM2A 2QGUA 1KC84 1JBTA 1TP6A 1W7CA 1BVIA 1WMNA 2XFSA 3BIRA 1GS3A 4KFFA 3JVCA 3CCJ3 1JBRA 1OUNA 4CPKA 1QALA 3EB8A 5KP1A 2E2TA 4H61A 3GAXA 1V58A 2INXA 3FG3A 5IF6A 1IVXA 1BUQA 3CCE3 1OPYA 3FSDA 3WHOA 1IVUA 2YFLB 3GSPA 3CCQ3 3EN8A 3N8BA 1BSEA 1AVKA 5AIFA 3GRDA 4LYLB 1JN5A 1B2XA 4O8SA 2OOVA 3WDGB 1PU4A 1DVDA 1MOLA 3G0KA 3WA2X 3D5IA 5ELJA 3LTCA 4L8PA 3LZAA 2HMLB 3SOYA 1JZDA 3RGRA 1VQ73 1SARA 1BSBA 3BLZA 2A15A 3S27A 1GSPA 2AADA 2H0HA 1E97A 1BRIA 1FYSA 1JZOA 2WGOA 3GZRA 3CPW2 3SEDA 3SOAA 2KF3A 1MGRA 1RKYA 4BIRA 4GL6A 1JKGA 5G2GA 4MJDA 3WOFB 1VZZA 1FW7A 3MSOA 2K3DA 2B1XB 5LC7A 3NV0A 1RLSA 1W2B2 4OK0A 1QJGA 5D83A 2WOHA 1RSNA 1KSIA 1BSAA 3S29A 2K54A 1TJDA 1OF5B 1I0VA 2W56A 1MNLA 2SARA 3K7CA 4X2HA 1LQMB 2QIYA 1VQL3 5IENA 1CH0A 4FCJA 3STDA 1BOXA 4LSOA 1GY6A 4HAAA 2V1LA 1LOWA 4N6OB 4QWTA 5IG5A 1OHPA 1T3BA 1RN4A 3KZTA 4EYCA 2C4BA 1I70A 2IY2A 3CNMA 2LYXA 3GWRA 1Q42A 5STDA 3D9RA 5FW5A 5IEPA 1TIJA 4L7KA 2ML5A 3Q3FA 2RBIA 3H3HA 1AY7A 7RNTA 5AIGA 1L5GB 1TFOA 4G1MB 2BIRA 1GOUA 1BRHA 3B4PA 3EJVA 3IPTA 4KZ1A 3BB9A 3LTDA 1SPUA 1GMPA 4I5QA 1Q7Y4 2F86B 4N6TA 4WFOA 1CYVA 1V57A 1GY7A 1LOVA 3FKAA 2P09A 1IV7A 5IG4A 1AR0A 1JRQA 1YHQ3 1IV9A 3PXMA 7STDA 2B24B 2F98A 4HM2B 3OX9A 4HM3B 3KKGA 3DGMA 3B8LA 3PYJA 4RNTA 5GSPA 1VQ83 4ZM8A 3HIGA 1O7WB 1VQ63 1UUGB 3EX9A 3EF8A 2Y73A 2D1WA 2HMOB 2SBLA 3CCR3 2HMNB 4BL3A 3WMDA 1EA2A
chains in the Genus database with same CATH topology
3DH2A 1DETA 1LNIA 1YGWA 1BNGA 1BNSA 3AGOA 1BNIA 1I0XA 1BNFA 1MGWA 2KF4A 3AHSA 1GMQA 1RGHA 1UCJA 1BUJA 2F5WA 2AAEA 1RGKA 1T2IA 3SYUA 3WR2A 1B2MA 4J5GA 4GSPA 1BSCA 1FUTA 1BU4A 1LRAA 4GHOA 1TRQA 1AQZA 1T2HA 1JBTA 1I3IA 1BVIA 1I3FA 5BU4A 4BU4A 2F4YA 2F5MA 6GSPA 3BIRA 1BRNL 1BRGA 1A2PA 3DGYA 1JBRA 1FUSA 2ZA4A 1B20A 1LOYA 1FZUA 3A5EA 1RNBA 3WHOA 3GSPA 1RGGA 1BNEA 1BSEA 6RNTA 1R4YA 1B2XA 1BSDA 1TTOA 3D5IA 3HOHA 3URPA 5RNTA 1RGFA 2RNTA 2KF6A 1SARA 1BSBA 1HYFA 1RGEA 1TRPA 1GSPA 2AADA 1YVSA 1PY3A 1BGSA 1BRIA 1FYSA 1RGLA 1RCKA 2KF3A 1MGRA 2GSPA 4BIRA 1B3SA 1FW7A 1UCKA 1RLSA 1B2UA 1BAOA 1RMSA 1RSNA 1BSAA 2HOHA 1JBSA 1RGCA 1B2ZA 1X1XA 1I0VA 1RCLA 3BU4A 2SARA 1RNTA 1CH0A 1UCLA 2F56A 3D4AA 4J5KA 1BOXA 3AHWA 1GOVA 4HAAA 3KCHA 1LOWA 1G02A 1B21A 1RN4A 2C4BA 1I70A 1I2FA 1BRJA 1ZGXA 1DE3A 1GMRA 1X1WA 3Q3FA 3AGNA 2RBIA 1X1YA 1HZ1A 1BNRA 1AY7A 7RNTA 1C54A 1PYLA 3RNTA 1GOUA 2BIRA 1BRHA 5HOHA 1RDSA 8RNTA 1RTUA 1X1UA 4HOHA 1I2EA 1GMPA 7GSPA 1RN1A 2BU4A 5BIRA 1BIRA 1LOVA 1YNVX 1B27A 1BANA 1IYYA 1BRKA 1I8VA 9RNTA 5GSPA 4RNTA 1BNJA 1B2SA 1I2GA 1Q9EA 3D5GA 2KF5A 2KAAA 1BRSA 1UCIA 1GOYA 1RHLA 1RGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DH2 A;  1DET A;  1LNI A;  1YGW A;  1BNG A;  1BNS A;  3AGO A;  1BNI A;  1I0X A;  1BNF A;  1MGW A;  2KF4 A;  3AHS A;  1GMQ A;  1RGH A;  1UCJ A;  1BUJ A;  2F5W A;  2AAE A;  1RGK A;  1T2I A;  3SYU A;  3WR2 A;  1B2M A;  4J5G A;  4GSP A;  1BSC A;  1FUT A;  1BU4 A;  1LRA A;  4GHO A;  1TRQ A;  1AQZ A;  1T2H A;  1JBT A;  1I3I A;  1BVI A;  1I3F A;  5BU4 A;  4BU4 A;  2F4Y A;  2F5M A;  6GSP A;  3BIR A;  1BRN L;  1BRG A;  1A2P A;  3DGY A;  1JBR A;  1FUS A;  2ZA4 A;  1B20 A;  1LOY A;  1FZU A;  3A5E A;  1RNB A;  3WHO A;  3GSP A;  1RGG A;  1BNE A;  1BSE A;  6RNT A;  1R4Y A;  1B2X A;  1BSD A;  1TTO A;  3D5I A;  3HOH A;  3URP A;  5RNT A;  1RGF A;  2RNT A;  2KF6 A;  1SAR A;  1BSB A;  1HYF A;  1RGE A;  1TRP A;  1GSP A;  2AAD A;  1YVS A;  1PY3 A;  1BGS A;  1BRI A;  1FYS A;  1RGL A;  1RCK A;  2KF3 A;  1MGR A;  2GSP A;  4BIR A;  1B3S A;  1FW7 A;  1UCK A;  1RLS A;  1B2U A;  1BAO A;  1RMS A;  1RSN A;  1BSA A;  2HOH A;  1JBS A;  1RGC A;  1B2Z A;  1X1X A;  1I0V A;  1RCL A;  3BU4 A;  2SAR A;  1RNT A;  1CH0 A;  1UCL A;  2F56 A;  3D4A A;  4J5K A;  1BOX A;  3AHW A;  1GOV A;  4HAA A;  3KCH A;  1LOW A;  1G02 A;  1B21 A;  1RN4 A;  2C4B A;  1I70 A;  1I2F A;  1BRJ A;  1ZGX A;  1DE3 A;  1GMR A;  1X1W A;  3Q3F A;  3AGN A;  2RBI A;  1X1Y A;  1HZ1 A;  1BNR A;  1AY7 A;  7RNT A;  1C54 A;  1PYL A;  3RNT A;  1GOU A;  2BIR A;  1BRH A;  5HOH A;  1RDS A;  8RNT A;  1RTU A;  1X1U A;  4HOH A;  1I2E A;  1GMP A;  7GSP A;  1RN1 A;  2BU4 A;  5BIR A;  1BIR A;  1LOV A;  1YNV X;  1B27 A;  1BAN A;  1IYY A;  1BRK A;  1I8V A;  9RNT A;  5GSP A;  4RNT A;  1BNJ A;  1B2S A;  1I2G A;  1Q9E A;  3D5G A;  2KF5 A;  2KAA A;  1BRS A;  1UCI A;  1GOY A;  1RHL A;  1RGA A; 
#chains in the Genus database with same CATH topology
 1W6G A;  5CLK A;  3ZFZ A;  1IT8 A;  1LOX A;  4H3U A;  1RJO A;  3DM8 A;  4LMI A;  3JUO A;  2XFT A;  1W6Y A;  5IG0 A;  2CFG A;  1TFK A;  4MMX B;  3CME 3;  2BMQ B;  1VQO 3;  1I0X A;  1YJ9 3;  2KF4 A;  5M19 A;  4AKZ A;  3I55 3;  2FXT A;  2WOF A;  1W4N A;  1RGH A;  1WMP A;  1UCJ A;  3ALA A;  1BUJ A;  1ROA A;  2CW9 A;  2F5W A;  4EXR A;  1RGK A;  1T2I A;  1YIJ 3;  1QVF 2;  3FCS B;  2R41 A;  4N6L A;  2GBX B;  3NBJ A;  1GYB A;  4GHO A;  1IT7 A;  1AQZ A;  1RN7 A;  2YFI B;  2YX9 A;  3FG1 A;  5AYR B;  3VF1 A;  3WA3 A;  1I3F A;  3B7C A;  1OHS A;  2OTL 3;  1FGO A;  1GY5 A;  3F8H A;  3F9S A;  3LYG A;  4HBR A;  4WP5 A;  1IQX A;  1JV2 B;  1BRN L;  1QMA A;  4O3V A;  1EQK A;  2W2C A;  1D6Z A;  2ZA4 A;  1LOY A;  2OCT A;  3RGA A;  2PNC A;  1N9E A;  1O7H B;  2CX1 A;  3NBB A;  6STD A;  1W00 A;  3MG3 A;  1VQP 3;  2XH9 A;  3K5T A;  5HGR A;  3FF2 A;  3SX1 A;  2P0X A;  2F99 A;  1S5A A;  4FCZ A;  3CU3 A;  3SLU A;  1TU5 A;  1BSD A;  2BNG A;  2KRT A;  3EBY A;  5IG3 A;  3B4O A;  2MC8 A;  2STD A;  3URP A;  1RGF A;  2IUJ A;  1HYF A;  3CNX A;  1RGE A;  2W9Q A;  4J9A A;  4BTY A;  3GZY B;  4EC6 A;  1ISK A;  3OWU A;  1RGL A;  1V74 A;  5CF1 A;  3ECF A;  1VQQ A;  3O8Y A;  3G6E 3;  3OXA A;  1M1X B;  3D79 A;  1B3S A;  4GB5 A;  4NPB A;  2Z6B A;  4IT7 A;  2CWT A;  4EBG A;  1Q40 B;  3L0R A;  4JRF A;  3G4S 3;  1BAO A;  3FF0 A;  3CC2 3;  4N6U A;  4RZM A;  3CC7 3;  3DGO A;  1RGC A;  1B2Z A;  1ROV A;  2GXF A;  5TGN A;  1ULI B;  2O9U X;  2P0M A;  4FMB A;  3V99 A;  3BU4 A;  1RCL A;  4MMZ B;  1W02 A;  2E2V A;  3DY5 A;  3LML A;  1LXE A;  1GD3 A;  3M8C A;  2F56 A;  3D4A A;  2BT3 A;  4Q53 A;  4J5K A;  1RRH A;  2CWU A;  2MF7 A;  1M9G A;  2GU1 A;  2BO9 B;  5DRE A;  3V98 A;  5BXQ A;  5IER A;  3G8Z A;  3Q90 A;  2OTJ 3;  1PFP A;  4KT3 B;  3IJE B;  1GMR A;  5JBS A;  3CCV 3;  3T8N A;  1CEW I;  1MWR A;  4DKI A;  1E3V A;  2RSX A;  3BNE A;  1D6U A;  4XBY A;  1BNR A;  3MG1 A;  5CXO A;  4AKY A;  1PYL A;  3I56 3;  1S72 3;  1FGR A;  1NO3 A;  3NV0 B;  1RDS A;  8RNT A;  3CCU 3;  3NQY A;  4HOH A;  1I2E A;  4EV5 A;  4X2O A;  1HU9 A;  2BU4 A;  4BTX A;  1YNV X;  3CD6 3;  2RFR A;  1BAN A;  3N9H A;  4N6V 0;  3X3X A;  4OVM A;  4STD A;  9RNT A;  1UUV B;  2W56 B;  2XSH B;  3BND A;  3KSP A;  5ELU A;  1VQM 3;  5CF2 A;  1BNJ A;  2CK3 H;  1IK3 A;  1OCV A;  3NQZ A;  4R80 A;  1UCI A;  3NM7 A;  3ROB A;  1GOY A;  5AIH A;  1FGQ A;  3DUK A;  2C11 A;  1RGA A;  1SQW A;  4FR9 A;  3F14 A;  2CWV A;  4IIA A;  3DH2 A;  1Q82 4;  1LNI A;  1Y4K A;  4O02 B;  3DGN A;  5JPP A;  1BNI A;  1C7H A;  4FMC A;  3LTB A;  3S28 A;  3J7Y d;  1VQ5 3;  1OHO A;  2CG1 A;  2OQE C;  1B2M A;  3OW2 2;  1CQS A;  1N8Q A;  2P05 A;  3LT8 A;  4R9L A;  3JUQ A;  3NBR A;  4GSP A;  1VQ9 3;  1N5H A;  2HMK B;  2FGT A;  3VGN A;  1BU4 A;  4HZ9 B;  3CPO A;  1NDO B;  1OGZ A;  5FGO A;  1Q86 4;  1IVV A;  4PEJ A;  4HM8 B;  2CFL A;  5AYS C;  4BU4 A;  3CCS 3;  2F5M A;  6GSP A;  5AII A;  1E3R A;  1YJW 3;  1NU3 A;  2HMM B;  1DMM A;  3AMO A;  4HM1 B;  1OGX A;  4K1V A;  4FCM A;  1JNQ A;  3S67 A;  1FZU A;  4XBT A;  5D82 A;  1RNB A;  2UX0 A;  1YJN 3;  4XDW A;  1U5O A;  3F40 A;  5EEO A;  1RGG A;  2CFK A;  1NNV A;  1W6C A;  3MPH A;  2QEX 3;  2M7O A;  1R4Y A;  3OWS A;  1KWI A;  4R1K A;  3ZG5 A;  1O7N B;  2Y74 A;  2WO0 A;  3FG4 A;  4EV2 A;  2L1S A;  3FZW A;  1M90 4;  5RNT A;  1K28 A;  2RCD A;  2GBW B;  1A90 A;  2KF6 A;  3EE1 A;  4LEH A;  3QK9 A;  2OQE A;  1EKM A;  1OH0 A;  2XSO B;  1YVS A;  3IMA B;  1PY3 A;  1BGS A;  3NUV A;  2XEP A;  1ULJ B;  4I4K A;  1IVW A;  1UGH I;  1JB4 A;  1M1K 4;  1IDP A;  1R4C A;  3SVA A;  1CYU A;  1HKX A;  1IQY A;  4O2H A;  1T5Y A;  4WYK A;  1MWS A;  2CFD A;  2ZDJ A;  1G96 A;  4FMA A;  4XM4 A;  3HI7 A;  1JBS A;  4AEQ A;  5AEU B;  3TDG A;  2OWP A;  2Z7A A;  2QA4 3;  3JUP A;  5CK6 A;  1RNT A;  3PCS A;  3CCM 3;  1UCL A;  4XBX A;  3UJM A;  2H0I A;  3X40 A;  1J2B A;  8CHO A;  3ZG0 A;  3LOY A;  3SXX A;  1GOV A;  1STF I;  4WHA A;  2HMJ B;  4HZB B;  1B21 A;  5AI1 A;  3V92 A;  1Q81 4;  5G1K A;  1KQS 2;  1BRJ A;  1ZGX A;  2CFW A;  3HZP A;  3F7S A;  1DE3 A;  2KXG A;  2OOV C;  1SJW A;  1X1W A;  2IA7 A;  3E99 A;  4EW5 A;  1X1Y A;  2GEY A;  1HZ1 A;  2CX0 A;  2Z77 A;  5I97 A;  2CG0 A;  1C54 A;  3UL5 A;  5KP4 A;  1U8C B;  1UI7 A;  5HOH A;  1RTU A;  3KN4 A;  3U97 A;  5BIR A;  1BIR A;  2Q07 A;  2IYJ A;  3PS8 A;  3WOE B;  1B27 A;  3EQQ B;  2XGN A;  4BTW A;  2CH9 A;  1JJ2 2;  1BRK A;  1IYY A;  2ZL8 A;  3KII A;  5BVB A;  4MMY B;  1NB3 I;  1JN5 B;  5JPU A;  3K9M C;  3D5G A;  1Q9E A;  5EVH A;  1YGE A;  2KF5 A;  4HJL B;  1BRS A;  2CHC A;  2W03 A;  1RHL A;  3EN1 B;  1DVC A;  1YVB I;  1Q7H A;  2ML6 A;  1O7P B;  1Q40 A;  2XRX B;  4KFD A;  3KE7 A;  4RBN A;  4NHF A;  3CC4 3;  3Q2P A;  3VSY A;  1YGW A;  2CC3 A;  3AGO A;  1DMN A;  3MWZ A;  1JKG B;  4K90 B;  5M18 A;  1MWT A;  1O7G B;  3AHS A;  4CJN A;  2XF3 A;  3DMC A;  1KD1 4;  3K63 A;  2AAE A;  1ZX2 A;  2D42 A;  1GD4 A;  5KP3 A;  1LRA A;  4RNZ A;  1TRQ A;  5G1L A;  1WMO A;  1K73 4;  1T2H A;  2H0G A;  1I3I A;  3EHC A;  1DYU A;  3F7X A;  3UNL A;  1N8R 4;  5BU4 A;  2F4Y A;  3HX8 A;  4U13 A;  3S5C A;  3JUM A;  1YI2 3;  1BRG A;  1A2P A;  1WTH A;  3DGY A;  1FA3 A;  1OAC A;  3PCR A;  1SIH A;  2C10 A;  3DZL A;  3UB1 A;  1FUS A;  1G0T A;  3Q1C A;  1B20 A;  3DGL A;  3LXU X;  1LVN A;  2Z76 A;  2BHM A;  4KFE A;  3A5E A;  2JQ5 A;  1UDI I;  4TX4 A;  5AEW B;  3MYT A;  1OF5 A;  1LQG C;  1BNE A;  4HKV B;  2IUK A;  2BMR B;  5D81 A;  2O3O A;  4L8O A;  6RNT A;  3I0Y A;  1NJI 4;  1LNH A;  1TTO A;  3HOH A;  2UGI A;  3X42 A;  3EBT A;  2IMJ A;  2GEX A;  4HM5 B;  3G71 3;  1W5Z A;  3KSE D;  5A0O B;  4HM0 B;  2RNT A;  1N9J A;  4RNY A;  1TRP A;  2YFJ B;  3OV4 A;  1DMQ A;  1VQN 3;  1NWW A;  1RCK A;  4ILF A;  2P38 A;  4R9K A;  2GSP A;  3DXO A;  2FNQ A;  4WWU C;  3K0Z A;  4LGQ A;  3MHE A;  3BNC A;  1N5P A;  3NXJ A;  3UL6 A;  1UCK A;  3FH1 A;  3D3L A;  1B2U A;  4XB5 A;  1WNH A;  3AMO B;  5EQL A;  1K8A 4;  1RMS A;  2K0M A;  4HVN A;  1FGT A;  1JB5 A;  2HOH A;  5DRV A;  1YIT 3;  1VQ4 3;  1SII A;  4K61 A;  1K9M 4;  2CKF B;  3N54 B;  4KVH A;  4MEI A;  3KFQ C;  1X1X A;  4N3V A;  1US1 A;  1EG9 B;  2E2U A;  2L4V A;  3GZB A;  3LT9 A;  3PGB A;  3HK4 A;  1TUH A;  3NX0 A;  3AHW A;  4BL2 A;  1ZO2 A;  1W2Z A;  3KCH A;  3MG2 A;  4NRE A;  3G16 A;  1G02 A;  1RRL A;  3CMA 3;  2RGQ A;  1I2F A;  3FLJ A;  3T8U A;  1JB2 A;  2LQV A;  3EC9 A;  4N6M A;  3FGY A;  4HM7 B;  5IEO A;  3AGN A;  3QRD A;  1FGM A;  4K1U A;  3JUN A;  2XR8 B;  3RNT A;  1F8N A;  2PZV A;  2CIU A;  1QAK A;  1STD A;  1X1U A;  2W0Q A;  3F8X A;  3HII A;  4LZI A;  7GSP A;  2UUG C;  3WOD G;  4CCV A;  3OWY A;  1A2K A;  1MWU A;  1RN1 A;  2WGQ A;  1EEJ A;  1UW1 A;  2ZHX B;  1O7M B;  1EUI C;  1IQ8 A;  4WYK B;  3X3Y A;  1UUW B;  4HM6 B;  1Z1S A;  3PZW A;  1I8V A;  1VQK 3;  4N6N B;  1UGI A;  2W04 A;  4HYZ A;  1B2S A;  1I2G A;  3LTA A;  3X41 A;  1D6Y A;  2KAA A;  4J8T A;  4IPB A;  4JF8 A;  1QVG 2;  5LC6 A;  1A2V A;  2JDI H;  3H51 A;  1A67 A;  4FMD A;  4R4K A;  4CDL A;  3A76 A;  2W9P A;  1K41 A;  4XDV A;  3NHX A;  3T0U A;  1AVL A;  4OUQ A;  3X3Z A;  1ASK A;  1AV4 A;  3CXC 2;  1ZS7 A;  1DET A;  1UI8 A;  1NB5 I;  2XGL A;  1BNG A;  1BNS A;  3RDE A;  5M1A A;  3MKI A;  1W01 A;  1BNF A;  1MGW A;  2W6J H;  2R4I A;  4ORL A;  1GMQ A;  2BMO B;  5IW9 A;  2GU3 A;  1IU7 A;  3ER7 A;  1QAF A;  1WQL B;  2I9W A;  3SYU A;  3WR2 A;  3CCL 3;  3LH4 A;  3U1W A;  3GZX B;  1FUW A;  4J5G A;  2J8X B;  1BSC A;  1FUT A;  3BNB A;  4HM4 B;  2KCD A;  3NM2 A;  2QGU A;  1KC8 4;  1JBT A;  1TP6 A;  1W7C A;  1BVI A;  1WMN A;  2XFS A;  3BIR A;  1GS3 A;  4KFF A;  3JVC A;  3CCJ 3;  1JBR A;  1OUN A;  4CPK A;  1QAL A;  3EB8 A;  5KP1 A;  2E2T A;  4H61 A;  3GAX A;  1V58 A;  2INX A;  3FG3 A;  5IF6 A;  1IVX A;  1BUQ A;  3CCE 3;  1OPY A;  3FSD A;  3WHO A;  1IVU A;  2YFL B;  3GSP A;  3CCQ 3;  3EN8 A;  3N8B A;  1BSE A;  1AVK A;  5AIF A;  3GRD A;  4LYL B;  1JN5 A;  1B2X A;  4O8S A;  2OOV A;  3WDG B;  1PU4 A;  1DVD A;  1MOL A;  3G0K A;  3WA2 X;  3D5I A;  5ELJ A;  3LTC A;  4L8P A;  3LZA A;  2HML B;  3SOY A;  1JZD A;  3RGR A;  1VQ7 3;  1SAR A;  1BSB A;  3BLZ A;  2A15 A;  3S27 A;  1GSP A;  2AAD A;  2H0H A;  1E97 A;  1BRI A;  1FYS A;  1JZO A;  2WGO A;  3GZR A;  3CPW 2;  3SED A;  3SOA A;  2KF3 A;  1MGR A;  1RKY A;  4BIR A;  4GL6 A;  1JKG A;  5G2G A;  4MJD A;  3WOF B;  1VZZ A;  1FW7 A;  3MSO A;  2K3D A;  2B1X B;  5LC7 A;  3NV0 A;  1RLS A;  1W2B 2;  4OK0 A;  1QJG A;  5D83 A;  2WOH A;  1RSN A;  1KSI A;  1BSA A;  3S29 A;  2K54 A;  1TJD A;  1OF5 B;  1I0V A;  2W56 A;  1MNL A;  2SAR A;  3K7C A;  4X2H A;  1LQM B;  2QIY A;  1VQL 3;  5IEN A;  1CH0 A;  4FCJ A;  3STD A;  1BOX A;  4LSO A;  1GY6 A;  4HAA A;  2V1L A;  1LOW A;  4N6O B;  4QWT A;  5IG5 A;  1OHP A;  1T3B A;  1RN4 A;  3KZT A;  4EYC A;  2C4B A;  1I70 A;  2IY2 A;  3CNM A;  2LYX A;  3GWR A;  1Q42 A;  5STD A;  3D9R A;  5FW5 A;  5IEP A;  1TIJ A;  4L7K A;  2ML5 A;  3Q3F A;  2RBI A;  3H3H A;  1AY7 A;  7RNT A;  5AIG A;  1L5G B;  1TFO A;  4G1M B;  2BIR A;  1GOU A;  1BRH A;  3B4P A;  3EJV A;  3IPT A;  4KZ1 A;  3BB9 A;  3LTD A;  1SPU A;  1GMP A;  4I5Q A;  1Q7Y 4;  2F86 B;  4N6T A;  4WFO A;  1CYV A;  1V57 A;  1GY7 A;  1LOV A;  3FKA A;  2P09 A;  1IV7 A;  5IG4 A;  1AR0 A;  1JRQ A;  1YHQ 3;  1IV9 A;  3PXM A;  7STD A;  2B24 B;  2F98 A;  4HM2 B;  3OX9 A;  4HM3 B;  3KKG A;  3DGM A;  3B8L A;  3PYJ A;  4RNT A;  5GSP A;  1VQ8 3;  4ZM8 A;  3HIG A;  1O7W B;  1VQ6 3;  1UUG B;  3EX9 A;  3EF8 A;  2Y73 A;  2D1W A;  2HMO B;  2SBL A;  3CCR 3;  2HMN B;  4BL3 A;  3WMD A;  1EA2 A; 
#chains in the Genus database with same CATH homology
 3DH2 A;  1DET A;  1LNI A;  1YGW A;  1BNG A;  1BNS A;  3AGO A;  1BNI A;  1I0X A;  1BNF A;  1MGW A;  2KF4 A;  3AHS A;  1GMQ A;  1RGH A;  1UCJ A;  1BUJ A;  2F5W A;  2AAE A;  1RGK A;  1T2I A;  3SYU A;  3WR2 A;  1B2M A;  4J5G A;  4GSP A;  1BSC A;  1FUT A;  1BU4 A;  1LRA A;  4GHO A;  1TRQ A;  1AQZ A;  1T2H A;  1JBT A;  1I3I A;  1BVI A;  1I3F A;  5BU4 A;  4BU4 A;  2F4Y A;  2F5M A;  6GSP A;  3BIR A;  1BRN L;  1BRG A;  1A2P A;  3DGY A;  1JBR A;  1FUS A;  2ZA4 A;  1B20 A;  1LOY A;  1FZU A;  3A5E A;  1RNB A;  3WHO A;  3GSP A;  1RGG A;  1BNE A;  1BSE A;  6RNT A;  1R4Y A;  1B2X A;  1BSD A;  1TTO A;  3D5I A;  3HOH A;  3URP A;  5RNT A;  1RGF A;  2RNT A;  2KF6 A;  1SAR A;  1BSB A;  1HYF A;  1RGE A;  1TRP A;  1GSP A;  2AAD A;  1YVS A;  1PY3 A;  1BGS A;  1BRI A;  1FYS A;  1RGL A;  1RCK A;  2KF3 A;  1MGR A;  2GSP A;  4BIR A;  1B3S A;  1FW7 A;  1UCK A;  1RLS A;  1B2U A;  1BAO A;  1RMS A;  1RSN A;  1BSA A;  2HOH A;  1JBS A;  1RGC A;  1B2Z A;  1X1X A;  1I0V A;  1RCL A;  3BU4 A;  2SAR A;  1RNT A;  1CH0 A;  1UCL A;  2F56 A;  3D4A A;  4J5K A;  1BOX A;  3AHW A;  1GOV A;  4HAA A;  3KCH A;  1LOW A;  1G02 A;  1B21 A;  1RN4 A;  2C4B A;  1I70 A;  1I2F A;  1BRJ A;  1ZGX A;  1DE3 A;  1GMR A;  1X1W A;  3Q3F A;  3AGN A;  2RBI A;  1X1Y A;  1HZ1 A;  1BNR A;  1AY7 A;  7RNT A;  1C54 A;  1PYL A;  3RNT A;  1GOU A;  2BIR A;  1BRH A;  5HOH A;  1RDS A;  8RNT A;  1RTU A;  1X1U A;  4HOH A;  1I2E A;  1GMP A;  7GSP A;  1RN1 A;  2BU4 A;  5BIR A;  1BIR A;  1LOV A;  1YNV X;  1B27 A;  1BAN A;  1IYY A;  1BRK A;  1I8V A;  9RNT A;  5GSP A;  4RNT A;  1BNJ A;  1B2S A;  1I2G A;  1Q9E A;  3D5G A;  2KF5 A;  2KAA A;  1BRS A;  1UCI A;  1GOY A;  1RHL A;  1RGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...