1RGFA

Hydrolase, guanyloribonuclease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase (guanyloribonuclease)
total genus 21
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgfA00
1RN1A 1B2MA 1GMRA 1BRNL 4J5KA 1Q9EA 1GMQA 1BNGA 1GOYA 1RNBA 4RNTA 3BIRA 2KF4A 1I3FA 2AADA 7RNTA 2AAEA 1JBRA 1CH0A 1BAOA 1I2GA 1BANA 1I0XA 3WR2A 1YVSA 1BNFA 2GSPA 1T2HA 1X1UA 1X1XA 3AGNA 1RTUA 3RNTA 1BNIA 1LOVA 3WHOA 3AGOA 1BRHA 1BRKA 1YNVX 1GOVA 1HYFA 3SYUA 4GHOA 5HOHA 1MGRA 3D4AA 1BRSA 1RGFA 1RGGA 1B3SA 5BU4A 1SARA 6RNTA 1JBSA 1RGLA 1TRQA 3Q3FA 1C54A 1B2UA 1LOWA 1DE3A 4BIRA 1GSPA 2C4BA 1FYSA 1RCKA 1BRIA 3URPA 1IYYA 1A2PA 1RHLA 1GOUA 2RBIA 1LOYA 1AQZA 2SARA 3AHSA 4HAAA 3D5IA 1BSEA 1RGKA 7GSPA 1HZ1A 1BRJA 1BU4A 1UCKA 1RCLA 1RGAA 1BGSA 1BSAA 3DH2A 1GMPA 1I70A 5RNTA 3HOHA 1G02A 2BIRA 1RN4A 2HOHA 1BNSA 3A5EA 1UCJA 1ZGXA 1B21A 1RGCA 1UCLA 2KF6A 8RNTA 4BU4A 1BOXA 2KAAA 2F56A 5GSPA 1FUTA 2BU4A 1BSCA 3DGYA 1BIRA 1PYLA 2ZA4A 1B20A 1X1WA 9RNTA 2F4YA 1FUSA 1I0VA 2F5MA 1BNEA 2KF3A 1R4YA 1LRAA 4J5GA 1FW7A 1B2SA 1BSBA 3D5GA 1BSDA 1TTOA 3BU4A 1PY3A 1LNIA 2RNTA 1I8VA 2F5WA 3GSPA 1AY7A 1BUJA 1RSNA 1RMSA 1BVIA 1BNRA 1YGWA 6GSPA 1B2XA 1B27A 3AHWA 1JBTA 1T2IA 2KF5A 1RGEA 1DETA 1X1YA 1BNJA 1TRPA 3KCHA 1FZUA 1RDSA 1MGWA 1UCIA 5BIRA 1RGHA 1BRGA 1I3IA 1I2EA 4HOHA 1RLSA 1B2ZA 4GSPA 1I2FA 1RNTA
chains in the Genus database with same CATH superfamily
3KFQC 4FCJA 2IMJA 3O8YA 1BRNL 4ILFA 5EQLA 3VSYA 5D83A 4I5QA 3EBYA 1OPYA 1WMOA 1VQL3 3B4OA 2W56A 3NQYA 3KKGA 1Q7HA 5AI1A 3CMA3 1N8QA 1I3FA 3ECFA 2HMKB 3LMLA 4MMZB 1W4NA 1K28A 4OVMA 3VF1A 5IG5A 1JBRA 3KIIA 3PCRA 3K0ZA 2ML6A 2Z77A 3EN8A 3WR2A 1BNFA 3ER7A 1K734 2P38A 2K0MA 4NPBA 5M1AA 1AV4A 2BMRB 2K3DA 5IEPA 1S723 1LOVA 2V1LA 1UDII 3FG1A 4GB5A 4HM8B 4XBXA 1GY7A 2IYJA 3KN4A 4LSOA 4EBGA 1NDOB 3B7CA 1IVVA 1N9JA 1TIJA 1BRSA 1A2KA 3MG1A 2GU1A 3Q2PA 4J8TA 3S27A 3STDA 1LOXA 1JNQA 3CD63 5IENA 6RNTA 1JBSA 2RGQA 3EN1B 1FGRA 1M9GA 5G1LA 2XH9A 1TP6A 4EXRA 2QEX3 1RCKA 4KT3B 3URPA 1A2PA 2CG0A 3N54B 4FMDA 1DVDA 2J8XB 1ZX2A 1FA3A 4KFDA 2SARA 3X3XA 3SVAA 3CC73 1LQGC 3D5IA 3FF2A 3K5TA 1BSEA 2L4VA 2BHMA 1Q40A 4FCMA 3GZXB 2QA43 3BNBA 1L5GB 1HZ1A 4Q53A 7GSPA 3G713 1BU4A 3WMDA 1RGAA 4EC6A 1BGSA 3NM7A 1VQ73 1OHPA 2XRXB 2WGQA 1YJN3 4L8OA 2IY2A 3HOHA 1G02A 2BIRA 3CPOA 2QGUA 5TGNA 4BL2A 3G6E3 3A5EA 1IT8A 4XBTA 5IERA 2FGTA 1MNLA 1N5PA 1UCJA 1RGCA 4I4KA 1YIJ3 1GD3A 2BNGA 1BOXA 1V57A 5LC6A 2F56A 5GSPA 1YJ93 1BIRA 3LZAA 4AKZA 4R9KA 4XDWA 2PZVA 1RN7A 1ZO2A 1DYUA 3NX0A 1BNEA 2KF3A 1ULIB 3X42A 5IG3A 3CC43 1JZDA 1TFOA 3FKAA 3DM8A 1BSBA 2D1WA 2YFLB 4O2HA 1TTOA 3G4S3 4J9AA 3WA3A 1LNIA 2RNTA 3IPTA 3EB8A 3GZRA 4LYLB 1TJDA 1EKMA 2ZHXB 3KZTA 2BO9B 3RDEA 6GSPA 1JB5A 1OCVA 2GXFA 3S67A 3FG3A 4HM1B 4N6NB 1JBTA 3HI7A 1T2IA 3MYTA 5D81A 1K41A 3CCQ3 3CCL3 1DETA 1JB2A 1E3VA 1IU7A 2L1SA 5FW5A 1TRPA 3F40A 3KCHA 3NXJA 1FZUA 1A90A 1EA2A 1WTHA 4WFOA 3DMCA 4IT7A 1I2EA 3BLZA 4HOHA 1O7HB 5AEWB 1B2ZA 5AEUB 2OCTA 2OTL3 1HKXA 1DMQA 1B2MA 1GMRA 3WA2X 3K7CA 1GMQA 2F98A 4EYCA 1UUVB 2CFLA 1AVLA 2IUKA 4RNTA 4N6OB 3BIRA 4EV5A 1JN5A 1RNBA 2KF4A 1RJOA 1O7GB 1Z1SA 1I2GA 2F86B 3DUKA 3PGBA 2CKFB 1YVSA 1O7MB 1CEWI 2UGIA 3U97A 1YGEA 2IA7A 1T2HA 1JZOA 1U8CB 2XSHB 2Z6BA 3AGNA 3E99A 3EX9A 3MG2A 4HM5B 4L7KA 1W2B2 3GAXA 4H61A 1TUHA 2FXTA 4MEIA 3FCSB 3OXAA 1BRKA 1YNVX 3SYUA 3I563 2CFDA 1IDPA 1Q40B 3GWRA 5DREA 1NJI4 1GD4A 1YJW3 4R1KA 1VQ43 3DGLA 4R80A 4N6MA 3H51A 2XSOB 2YFIB 1Q814 2OOVC 4FMCA 1AR0A 1B3SA 1IQXA 3LH4A 1RGLA 2HMMB 3Q3FA 1LOWA 3GRDA 1T3BA 4IPBA 3V98A 1W00A 4CPKA 2P05A 1FYSA 2F99A 1QAKA 1SJWA 1JKGB 3PS8A 3IMAB 3DZLA 3CME3 1KSIA 3MHEA 1AQZA 1E3RA 3OWUA 2CH9A 3G16A 1FGQA 1JV2B 3DXOA 3K63A 1RRHA 2R41A 5AIIA 1IVUA 4MMXB 3X3ZA 1N5HA 3MPHA 4NHFA 4HM7B 5KP3A 1RCLA 3CC23 2ML5A 4HM6B 2CC3A 4EV2A 1EG9B 1GMPA 1NO3A 5RNTA 5AIFA 1QALA 1MWTA 2WOFA 1OHOA 1BNSA 2CX1A 2YFJB 3F9SA 1ZGXA 1VQ93 3N8BA 3ZG0A 2H0IA 3LYGA 4BU4A 3SX1A 2KAAA 5AYRB 5JPPA 2HMOB 2BMQB 2KCDA 1BSCA 3D79A 3MWZA 1PYLA 2ZA4A 4XDVA 1UUWB 1FUSA 1I0VA 2F5MA 3QK9A 3FH1A 1FGTA 1R4YA 4WYKB 2RSXA 1JJ22 4J5GA 1V58A 3NBBA 1FW7A 5ELUA 2Z7AA 3F8HA 1KWIA 2QIYA 4RZMA 2B24B 2Y74A 3BU4A 3J7Yd 1I8VA 2JQ5A 3KSPA 3EE1A 4R4KA 3JUMA 1AY7A 1NWWA 1RMSA 3ROBA 1JN5B 4QWTA 1O7WB 4N6V0 3I553 1VQM3 3UNLA 5KP1A 1B2XA 3UL6A 3AHWA 1NB5I 2RCDA 3UB1A 3H3HA 1RGEA 1JKGA 4HBRA 4HJLB 1W01A 3EQQB 4HM0B 1BNJA 4PEJA 2FNQA 1SPUA 1UCIA 3SOYA 2XR8B 2KXGA 3NBRA 4OK0A 3LTAA 2C10A 3FGYA 5IG0A 3JUQA 3UJMA 5CF2A 4XM4A 2H0HA 3HZPA 4J5KA 3FLJA 4ZM8A 2WOHA 1Q9EA 5FGOA 3WOEB 4EW5A 1GOYA 1OGZA 2CX0A 2LYXA 1KC84 3B8LA 1EUIC 2AADA 3I0YA 2AAEA 3ZFZA 1LXEA 1CH0A 1BAOA 4HM4B 1MWSA 1I0XA 4WWUC 2UUGC 1N9EA 1ROAA 1X1XA 1US1A 1RTUA 1GY5A 2GU3A 4KFEA 4N6UA 3RNTA 1VQO3 1K8A4 3N9HA 5CK6A 1G96A 2BMOB 3F7SA 3CCM3 4JF8A 2CWUA 3AMOB 1HYFA 3JUPA 2OQEA 4X2OA 5HOHA 2BT3A 1MGRA 2JDIH 1VQ53 1KQS2 4WYKA 1C7HA 3F7XA 4HM3B 4N6TA 4OUQA 3X41A 5CF1A 1EEJA 1W2ZA 5STDA 2GBWB 1M1K4 2YX9A 3EF8A 4H3UA 1J2BA 4MMYB 1RGGA 2XFTA 3KSED 5LC7A 1YIT3 2INXA 3HX8A 2CFWA 1SARA 5BU4A 3EJVA 1C54A 1Q42A 2CWVA 4RBNA 3WODG 1DE3A 3LOYA 4BIRA 1IK3A 3PXMA 3PCSA 2C4BA 1OHSA 3CCS3 1WQLB 4LZIA 2KRTA 3Q1CA 4GL6A 2O3OA 4X2HA 2UX0A 3CU3A 4ORLA 5D82A 1Y4KA 5IF6A 1A67A 3AHSA 4HAAA 3FG4A 2GEYA 2LQVA 5I97A 1VQN3 1JRQA 3WDGB 1A2VA 1RGKA 3B4PA 3LTCA 1BUQA 3QRDA 3GZBA 1VQ63 2R4IA 4HKVB 2GEXA 3V92A 1DMMA 3BNCA 3NUVA 5AIHA 1OACA 1GY6A 3DH2A 1I70A 3FSDA 1RN4A 2P0MA 3JVCA 1Q864 3CCR3 4AEQA 4LGQA 2KF6A 4BTYA 2HMLB 2W9QA 8RNTA 1M1XB 1MWRA 3SXXA 1IV7A 4KVHA 3WOFB 3RGRA 1B20A 1X1WA 1W6YA 1WNHA 2Q07A 1OGXA 3LXUX 4G1MB 4RNZA 4XB5A 2XEPA 4MJDA 9RNTA 4HVNA 2P0XA 2W6JH 2W9PA 1O7NB 1NNVA 1PFPA 3DGOA 4U13A 3AMOA 2XFSA 3TDGA 5BXQA 1PY3A 1UGIA 2O9UX 2ZDJA 4FR9A 3CXC2 3PZWA 3HIGA 1G0TA 1WMPA 4CCVA 3OW22 1BUJA 1RSNA 4N3VA 1BVIA 3ZG5A 3BNEA 3OWSA 1KD14 4L8PA 1K9M4 2ZL8A 1D6ZA 3A76A 3S29A 1T5YA 4HM2B 1BNRA 2PNCA 1UI7A 1Q7Y4 1LQMB 4JRFA 2KF5A 1TFKA 4XBYA 5JBSA 2RFRA 4O3VA 1X1YA 3DY5A 3OX9A 4BL3A 1RDSA 4BTXA 5BIRA 2E2VA 1SIIA 1RGHA 2MF7A 3Q90A 4IIAA 2W03A 2C11A 3JUOA 4BTWA 5IEOA 3SEDA 1RLSA 1GS3A 1WMNA 4GSPA 1RNTA 1RN1A 2W2CA 3OV4A 2OTJ3 3NHXA 1UW1A 1RRLA 2W04A 2XF3A 4K1UA 1QVF2 4O8SA 3V99A 3HIIA 1BNGA 3MKIA 4WHAA 2H0GA 3PYJA 1LNHA 4RNYA 5CXOA 3UL5A 1U5OA 1CYUA 1MWUA 1IV9A 7RNTA 1W6CA 1STFI 4WP5A 3G8ZA 2Z76A 2GBXB 5DRVA 1BANA 3X3YA 2GSPA 3NBJA 1OF5B 1X1UA 2CIUA 1SQWA 4STDA 1BNIA 4K1VA 3WHOA 5HGRA 5ELJA 4K90B 3CCV3 3AGOA 3CPW2 2CW9A 1BRHA 1DMNA 1ULJB 2STDA 1GOVA 3DGNA 5EEOA 3EC9A 4GHOA 5G1KA 1ASKA 3CCU3 2HMNB 5AIGA 3D4AA 1TU5A 5A0OB 1M904 5G2GA 1RGFA 3FF0A 4HZ9B 2B1XB 1E97A 3NQZA 1W02A 4AKYA 3VGNA 4HYZA 1TRQA 2XGNA 1B2UA 5IG4A 1QVG2 1YVBI 3JUNA 4K61A 1GSPA 3X40A 4LEHA 3D3LA 3NV0B 3IJEB 2I9WA 1BRIA 4O02B 1IYYA 3HK4A 5M18A 3M8CA 2RBIA 1RHLA 1GOUA 3DGMA 4DKIA 1LOYA 4N6LA 3G0KA 1F8NA 3NM2A 3MSOA 1W6GA 3LT9A 1VQQA 4CDLA 1N8R4 1EQKA 5AYSC 3LT8A 2CFKA 3T0UA 3T8NA 1BRJA 1IQYA 1ZS7A 1NU3A 2XGLA 2HMJB 1AVKA 1IVXA 1UCKA 1VQ83 3MG3A 4NREA 2M7OA 3SLUA 1NB3I 3CNXA 1BSAA 3BB9A 2W56B 4LMIA 3EBTA 1CYVA 3S5CA 2HOHA 4TX4A 1FUWA 1Q824 4FCZA 2CFGA 1VQK3 4FMBA 6STDA 1B21A 1UCLA 2OWPA 2CWTA 4KFFA 1D6UA 2SBLA 1FUTA 2OOVA 1W5ZA 1IQ8A 2BU4A 2CK3H 3DGYA 5KP4A 1DVCA 1OF5A 2K54A 2W0QA 3T8UA 3U1WA 1RKYA 1HU9A 2F4YA 1JB4A 2IUJA 1SIHA 1OUNA 1ISKA 1UUGB 3LTDA 3S28A 3ALAA 1IVWA 1PU4A 1LRAA 2D42A 3K9MC 3OWYA 1QAFA 3FZWA 1ROVA 1B2SA 1MOLA 1QJGA 2CG1A 2Y73A 3D5GA 4KZ1A 1BSDA 1S5AA 1D6YA 2MC8A 5M19A 1UI8A 4R9LA 8CHOA 3F14A 3KE7A 1V74A 2F5WA 1VZZA 3GSPA 1OH0A 2A15A 4CJNA 5IW9A 1O7PB 3EHCA 2WGOA 5BVBA 7STDA 3BNDA 5CLKA 3D9RA 1YGWA 2OQEC 3RGAA 3GZYB 1CQSA 1B27A 1UGHI 1W7CA 2CHCA 2P09A 3NV0A 1FGOA 4FMAA 3LTBA 3CCJ3 1STDA 3L0RA 3CNMA 3F8XA 1IT7A 1YHQ3 1MGWA 5JPUA 1LVNA 3CCE3 1VQP3 2WO0A 2E2UA 1BRGA 1QMAA 1YI23 1FGMA 1I3IA 3SOAA 1R4CA 4HZBB 5EVHA 2E2TA 1GYBA 1I2FA
chains in the Genus database with same CATH topology
1RN1A 1B2MA 1GMRA 1BRNL 4J5KA 1Q9EA 1GMQA 1BNGA 1GOYA 1RNBA 4RNTA 3BIRA 2KF4A 1I3FA 2AADA 7RNTA 2AAEA 1JBRA 1CH0A 1BAOA 1I2GA 1BANA 1I0XA 3WR2A 1YVSA 1BNFA 2GSPA 1T2HA 1X1UA 1X1XA 3AGNA 1RTUA 3RNTA 1BNIA 1LOVA 3WHOA 3AGOA 1BRHA 1BRKA 1YNVX 1GOVA 1HYFA 3SYUA 4GHOA 5HOHA 1MGRA 3D4AA 1BRSA 1RGFA 1RGGA 1B3SA 5BU4A 1SARA 6RNTA 1JBSA 1RGLA 1TRQA 3Q3FA 1C54A 1B2UA 1LOWA 1DE3A 4BIRA 1GSPA 2C4BA 1FYSA 1RCKA 1BRIA 3URPA 1IYYA 1A2PA 1RHLA 1GOUA 2RBIA 1LOYA 1AQZA 2SARA 3AHSA 4HAAA 3D5IA 1BSEA 1RGKA 7GSPA 1HZ1A 1BRJA 1BU4A 1UCKA 1RCLA 1RGAA 1BGSA 1BSAA 3DH2A 1GMPA 1I70A 5RNTA 3HOHA 1G02A 2BIRA 1RN4A 2HOHA 1BNSA 3A5EA 1UCJA 1ZGXA 1B21A 1RGCA 1UCLA 2KF6A 8RNTA 4BU4A 1BOXA 2KAAA 2F56A 5GSPA 1FUTA 2BU4A 1BSCA 3DGYA 1BIRA 1PYLA 2ZA4A 1B20A 1X1WA 9RNTA 2F4YA 1FUSA 1I0VA 2F5MA 1BNEA 2KF3A 1R4YA 1LRAA 4J5GA 1FW7A 1B2SA 1BSBA 3D5GA 1BSDA 1TTOA 3BU4A 1PY3A 1LNIA 2RNTA 1I8VA 2F5WA 3GSPA 1AY7A 1BUJA 1RSNA 1RMSA 1BVIA 1BNRA 1YGWA 6GSPA 1B2XA 1B27A 3AHWA 1JBTA 1T2IA 2KF5A 1RGEA 1DETA 1X1YA 1BNJA 1TRPA 3KCHA 1FZUA 1RDSA 1MGWA 1UCIA 5BIRA 1RGHA 1BRGA 1I3IA 1I2EA 4HOHA 1RLSA 1B2ZA 4GSPA 1I2FA 1RNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN1 A;  1B2M A;  1GMR A;  1BRN L;  4J5K A;  1Q9E A;  1GMQ A;  1BNG A;  1GOY A;  1RNB A;  4RNT A;  3BIR A;  2KF4 A;  1I3F A;  2AAD A;  7RNT A;  2AAE A;  1JBR A;  1CH0 A;  1BAO A;  1I2G A;  1BAN A;  1I0X A;  3WR2 A;  1YVS A;  1BNF A;  2GSP A;  1T2H A;  1X1U A;  1X1X A;  3AGN A;  1RTU A;  3RNT A;  1BNI A;  1LOV A;  3WHO A;  3AGO A;  1BRH A;  1BRK A;  1YNV X;  1GOV A;  1HYF A;  3SYU A;  4GHO A;  5HOH A;  1MGR A;  3D4A A;  1BRS A;  1RGF A;  1RGG A;  1B3S A;  5BU4 A;  1SAR A;  6RNT A;  1JBS A;  1RGL A;  1TRQ A;  3Q3F A;  1C54 A;  1B2U A;  1LOW A;  1DE3 A;  4BIR A;  1GSP A;  2C4B A;  1FYS A;  1RCK A;  1BRI A;  3URP A;  1IYY A;  1A2P A;  1RHL A;  1GOU A;  2RBI A;  1LOY A;  1AQZ A;  2SAR A;  3AHS A;  4HAA A;  3D5I A;  1BSE A;  1RGK A;  7GSP A;  1HZ1 A;  1BRJ A;  1BU4 A;  1UCK A;  1RCL A;  1RGA A;  1BGS A;  1BSA A;  3DH2 A;  1GMP A;  1I70 A;  5RNT A;  3HOH A;  1G02 A;  2BIR A;  1RN4 A;  2HOH A;  1BNS A;  3A5E A;  1UCJ A;  1ZGX A;  1B21 A;  1RGC A;  1UCL A;  2KF6 A;  8RNT A;  4BU4 A;  1BOX A;  2KAA A;  2F56 A;  5GSP A;  1FUT A;  2BU4 A;  1BSC A;  3DGY A;  1BIR A;  1PYL A;  2ZA4 A;  1B20 A;  1X1W A;  9RNT A;  2F4Y A;  1FUS A;  1I0V A;  2F5M A;  1BNE A;  2KF3 A;  1R4Y A;  1LRA A;  4J5G A;  1FW7 A;  1B2S A;  1BSB A;  3D5G A;  1BSD A;  1TTO A;  3BU4 A;  1PY3 A;  1LNI A;  2RNT A;  1I8V A;  2F5W A;  3GSP A;  1AY7 A;  1BUJ A;  1RSN A;  1RMS A;  1BVI A;  1BNR A;  1YGW A;  6GSP A;  1B2X A;  1B27 A;  3AHW A;  1JBT A;  1T2I A;  2KF5 A;  1RGE A;  1DET A;  1X1Y A;  1BNJ A;  1TRP A;  3KCH A;  1FZU A;  1RDS A;  1MGW A;  1UCI A;  5BIR A;  1RGH A;  1BRG A;  1I3I A;  1I2E A;  4HOH A;  1RLS A;  1B2Z A;  4GSP A;  1I2F A;  1RNT A; 
#chains in the Genus database with same CATH topology
 3KFQ C;  4FCJ A;  2IMJ A;  3O8Y A;  1BRN L;  4ILF A;  5EQL A;  3VSY A;  5D83 A;  4I5Q A;  3EBY A;  1OPY A;  1WMO A;  1VQL 3;  3B4O A;  2W56 A;  3NQY A;  3KKG A;  1Q7H A;  5AI1 A;  3CMA 3;  1N8Q A;  1I3F A;  3ECF A;  2HMK B;  3LML A;  4MMZ B;  1W4N A;  1K28 A;  4OVM A;  3VF1 A;  5IG5 A;  1JBR A;  3KII A;  3PCR A;  3K0Z A;  2ML6 A;  2Z77 A;  3EN8 A;  3WR2 A;  1BNF A;  3ER7 A;  1K73 4;  2P38 A;  2K0M A;  4NPB A;  5M1A A;  1AV4 A;  2BMR B;  2K3D A;  5IEP A;  1S72 3;  1LOV A;  2V1L A;  1UDI I;  3FG1 A;  4GB5 A;  4HM8 B;  4XBX A;  1GY7 A;  2IYJ A;  3KN4 A;  4LSO A;  4EBG A;  1NDO B;  3B7C A;  1IVV A;  1N9J A;  1TIJ A;  1BRS A;  1A2K A;  3MG1 A;  2GU1 A;  3Q2P A;  4J8T A;  3S27 A;  3STD A;  1LOX A;  1JNQ A;  3CD6 3;  5IEN A;  6RNT A;  1JBS A;  2RGQ A;  3EN1 B;  1FGR A;  1M9G A;  5G1L A;  2XH9 A;  1TP6 A;  4EXR A;  2QEX 3;  1RCK A;  4KT3 B;  3URP A;  1A2P A;  2CG0 A;  3N54 B;  4FMD A;  1DVD A;  2J8X B;  1ZX2 A;  1FA3 A;  4KFD A;  2SAR A;  3X3X A;  3SVA A;  3CC7 3;  1LQG C;  3D5I A;  3FF2 A;  3K5T A;  1BSE A;  2L4V A;  2BHM A;  1Q40 A;  4FCM A;  3GZX B;  2QA4 3;  3BNB A;  1L5G B;  1HZ1 A;  4Q53 A;  7GSP A;  3G71 3;  1BU4 A;  3WMD A;  1RGA A;  4EC6 A;  1BGS A;  3NM7 A;  1VQ7 3;  1OHP A;  2XRX B;  2WGQ A;  1YJN 3;  4L8O A;  2IY2 A;  3HOH A;  1G02 A;  2BIR A;  3CPO A;  2QGU A;  5TGN A;  4BL2 A;  3G6E 3;  3A5E A;  1IT8 A;  4XBT A;  5IER A;  2FGT A;  1MNL A;  1N5P A;  1UCJ A;  1RGC A;  4I4K A;  1YIJ 3;  1GD3 A;  2BNG A;  1BOX A;  1V57 A;  5LC6 A;  2F56 A;  5GSP A;  1YJ9 3;  1BIR A;  3LZA A;  4AKZ A;  4R9K A;  4XDW A;  2PZV A;  1RN7 A;  1ZO2 A;  1DYU A;  3NX0 A;  1BNE A;  2KF3 A;  1ULI B;  3X42 A;  5IG3 A;  3CC4 3;  1JZD A;  1TFO A;  3FKA A;  3DM8 A;  1BSB A;  2D1W A;  2YFL B;  4O2H A;  1TTO A;  3G4S 3;  4J9A A;  3WA3 A;  1LNI A;  2RNT A;  3IPT A;  3EB8 A;  3GZR A;  4LYL B;  1TJD A;  1EKM A;  2ZHX B;  3KZT A;  2BO9 B;  3RDE A;  6GSP A;  1JB5 A;  1OCV A;  2GXF A;  3S67 A;  3FG3 A;  4HM1 B;  4N6N B;  1JBT A;  3HI7 A;  1T2I A;  3MYT A;  5D81 A;  1K41 A;  3CCQ 3;  3CCL 3;  1DET A;  1JB2 A;  1E3V A;  1IU7 A;  2L1S A;  5FW5 A;  1TRP A;  3F40 A;  3KCH A;  3NXJ A;  1FZU A;  1A90 A;  1EA2 A;  1WTH A;  4WFO A;  3DMC A;  4IT7 A;  1I2E A;  3BLZ A;  4HOH A;  1O7H B;  5AEW B;  1B2Z A;  5AEU B;  2OCT A;  2OTL 3;  1HKX A;  1DMQ A;  1B2M A;  1GMR A;  3WA2 X;  3K7C A;  1GMQ A;  2F98 A;  4EYC A;  1UUV B;  2CFL A;  1AVL A;  2IUK A;  4RNT A;  4N6O B;  3BIR A;  4EV5 A;  1JN5 A;  1RNB A;  2KF4 A;  1RJO A;  1O7G B;  1Z1S A;  1I2G A;  2F86 B;  3DUK A;  3PGB A;  2CKF B;  1YVS A;  1O7M B;  1CEW I;  2UGI A;  3U97 A;  1YGE A;  2IA7 A;  1T2H A;  1JZO A;  1U8C B;  2XSH B;  2Z6B A;  3AGN A;  3E99 A;  3EX9 A;  3MG2 A;  4HM5 B;  4L7K A;  1W2B 2;  3GAX A;  4H61 A;  1TUH A;  2FXT A;  4MEI A;  3FCS B;  3OXA A;  1BRK A;  1YNV X;  3SYU A;  3I56 3;  2CFD A;  1IDP A;  1Q40 B;  3GWR A;  5DRE A;  1NJI 4;  1GD4 A;  1YJW 3;  4R1K A;  1VQ4 3;  3DGL A;  4R80 A;  4N6M A;  3H51 A;  2XSO B;  2YFI B;  1Q81 4;  2OOV C;  4FMC A;  1AR0 A;  1B3S A;  1IQX A;  3LH4 A;  1RGL A;  2HMM B;  3Q3F A;  1LOW A;  3GRD A;  1T3B A;  4IPB A;  3V98 A;  1W00 A;  4CPK A;  2P05 A;  1FYS A;  2F99 A;  1QAK A;  1SJW A;  1JKG B;  3PS8 A;  3IMA B;  3DZL A;  3CME 3;  1KSI A;  3MHE A;  1AQZ A;  1E3R A;  3OWU A;  2CH9 A;  3G16 A;  1FGQ A;  1JV2 B;  3DXO A;  3K63 A;  1RRH A;  2R41 A;  5AII A;  1IVU A;  4MMX B;  3X3Z A;  1N5H A;  3MPH A;  4NHF A;  4HM7 B;  5KP3 A;  1RCL A;  3CC2 3;  2ML5 A;  4HM6 B;  2CC3 A;  4EV2 A;  1EG9 B;  1GMP A;  1NO3 A;  5RNT A;  5AIF A;  1QAL A;  1MWT A;  2WOF A;  1OHO A;  1BNS A;  2CX1 A;  2YFJ B;  3F9S A;  1ZGX A;  1VQ9 3;  3N8B A;  3ZG0 A;  2H0I A;  3LYG A;  4BU4 A;  3SX1 A;  2KAA A;  5AYR B;  5JPP A;  2HMO B;  2BMQ B;  2KCD A;  1BSC A;  3D79 A;  3MWZ A;  1PYL A;  2ZA4 A;  4XDV A;  1UUW B;  1FUS A;  1I0V A;  2F5M A;  3QK9 A;  3FH1 A;  1FGT A;  1R4Y A;  4WYK B;  2RSX A;  1JJ2 2;  4J5G A;  1V58 A;  3NBB A;  1FW7 A;  5ELU A;  2Z7A A;  3F8H A;  1KWI A;  2QIY A;  4RZM A;  2B24 B;  2Y74 A;  3BU4 A;  3J7Y d;  1I8V A;  2JQ5 A;  3KSP A;  3EE1 A;  4R4K A;  3JUM A;  1AY7 A;  1NWW A;  1RMS A;  3ROB A;  1JN5 B;  4QWT A;  1O7W B;  4N6V 0;  3I55 3;  1VQM 3;  3UNL A;  5KP1 A;  1B2X A;  3UL6 A;  3AHW A;  1NB5 I;  2RCD A;  3UB1 A;  3H3H A;  1RGE A;  1JKG A;  4HBR A;  4HJL B;  1W01 A;  3EQQ B;  4HM0 B;  1BNJ A;  4PEJ A;  2FNQ A;  1SPU A;  1UCI A;  3SOY A;  2XR8 B;  2KXG A;  3NBR A;  4OK0 A;  3LTA A;  2C10 A;  3FGY A;  5IG0 A;  3JUQ A;  3UJM A;  5CF2 A;  4XM4 A;  2H0H A;  3HZP A;  4J5K A;  3FLJ A;  4ZM8 A;  2WOH A;  1Q9E A;  5FGO A;  3WOE B;  4EW5 A;  1GOY A;  1OGZ A;  2CX0 A;  2LYX A;  1KC8 4;  3B8L A;  1EUI C;  2AAD A;  3I0Y A;  2AAE A;  3ZFZ A;  1LXE A;  1CH0 A;  1BAO A;  4HM4 B;  1MWS A;  1I0X A;  4WWU C;  2UUG C;  1N9E A;  1ROA A;  1X1X A;  1US1 A;  1RTU A;  1GY5 A;  2GU3 A;  4KFE A;  4N6U A;  3RNT A;  1VQO 3;  1K8A 4;  3N9H A;  5CK6 A;  1G96 A;  2BMO B;  3F7S A;  3CCM 3;  4JF8 A;  2CWU A;  3AMO B;  1HYF A;  3JUP A;  2OQE A;  4X2O A;  5HOH A;  2BT3 A;  1MGR A;  2JDI H;  1VQ5 3;  1KQS 2;  4WYK A;  1C7H A;  3F7X A;  4HM3 B;  4N6T A;  4OUQ A;  3X41 A;  5CF1 A;  1EEJ A;  1W2Z A;  5STD A;  2GBW B;  1M1K 4;  2YX9 A;  3EF8 A;  4H3U A;  1J2B A;  4MMY B;  1RGG A;  2XFT A;  3KSE D;  5LC7 A;  1YIT 3;  2INX A;  3HX8 A;  2CFW A;  1SAR A;  5BU4 A;  3EJV A;  1C54 A;  1Q42 A;  2CWV A;  4RBN A;  3WOD G;  1DE3 A;  3LOY A;  4BIR A;  1IK3 A;  3PXM A;  3PCS A;  2C4B A;  1OHS A;  3CCS 3;  1WQL B;  4LZI A;  2KRT A;  3Q1C A;  4GL6 A;  2O3O A;  4X2H A;  2UX0 A;  3CU3 A;  4ORL A;  5D82 A;  1Y4K A;  5IF6 A;  1A67 A;  3AHS A;  4HAA A;  3FG4 A;  2GEY A;  2LQV A;  5I97 A;  1VQN 3;  1JRQ A;  3WDG B;  1A2V A;  1RGK A;  3B4P A;  3LTC A;  1BUQ A;  3QRD A;  3GZB A;  1VQ6 3;  2R4I A;  4HKV B;  2GEX A;  3V92 A;  1DMM A;  3BNC A;  3NUV A;  5AIH A;  1OAC A;  1GY6 A;  3DH2 A;  1I70 A;  3FSD A;  1RN4 A;  2P0M A;  3JVC A;  1Q86 4;  3CCR 3;  4AEQ A;  4LGQ A;  2KF6 A;  4BTY A;  2HML B;  2W9Q A;  8RNT A;  1M1X B;  1MWR A;  3SXX A;  1IV7 A;  4KVH A;  3WOF B;  3RGR A;  1B20 A;  1X1W A;  1W6Y A;  1WNH A;  2Q07 A;  1OGX A;  3LXU X;  4G1M B;  4RNZ A;  4XB5 A;  2XEP A;  4MJD A;  9RNT A;  4HVN A;  2P0X A;  2W6J H;  2W9P A;  1O7N B;  1NNV A;  1PFP A;  3DGO A;  4U13 A;  3AMO A;  2XFS A;  3TDG A;  5BXQ A;  1PY3 A;  1UGI A;  2O9U X;  2ZDJ A;  4FR9 A;  3CXC 2;  3PZW A;  3HIG A;  1G0T A;  1WMP A;  4CCV A;  3OW2 2;  1BUJ A;  1RSN A;  4N3V A;  1BVI A;  3ZG5 A;  3BNE A;  3OWS A;  1KD1 4;  4L8P A;  1K9M 4;  2ZL8 A;  1D6Z A;  3A76 A;  3S29 A;  1T5Y A;  4HM2 B;  1BNR A;  2PNC A;  1UI7 A;  1Q7Y 4;  1LQM B;  4JRF A;  2KF5 A;  1TFK A;  4XBY A;  5JBS A;  2RFR A;  4O3V A;  1X1Y A;  3DY5 A;  3OX9 A;  4BL3 A;  1RDS A;  4BTX A;  5BIR A;  2E2V A;  1SII A;  1RGH A;  2MF7 A;  3Q90 A;  4IIA A;  2W03 A;  2C11 A;  3JUO A;  4BTW A;  5IEO A;  3SED A;  1RLS A;  1GS3 A;  1WMN A;  4GSP A;  1RNT A;  1RN1 A;  2W2C A;  3OV4 A;  2OTJ 3;  3NHX A;  1UW1 A;  1RRL A;  2W04 A;  2XF3 A;  4K1U A;  1QVF 2;  4O8S A;  3V99 A;  3HII A;  1BNG A;  3MKI A;  4WHA A;  2H0G A;  3PYJ A;  1LNH A;  4RNY A;  5CXO A;  3UL5 A;  1U5O A;  1CYU A;  1MWU A;  1IV9 A;  7RNT A;  1W6C A;  1STF I;  4WP5 A;  3G8Z A;  2Z76 A;  2GBX B;  5DRV A;  1BAN A;  3X3Y A;  2GSP A;  3NBJ A;  1OF5 B;  1X1U A;  2CIU A;  1SQW A;  4STD A;  1BNI A;  4K1V A;  3WHO A;  5HGR A;  5ELJ A;  4K90 B;  3CCV 3;  3AGO A;  3CPW 2;  2CW9 A;  1BRH A;  1DMN A;  1ULJ B;  2STD A;  1GOV A;  3DGN A;  5EEO A;  3EC9 A;  4GHO A;  5G1K A;  1ASK A;  3CCU 3;  2HMN B;  5AIG A;  3D4A A;  1TU5 A;  5A0O B;  1M90 4;  5G2G A;  1RGF A;  3FF0 A;  4HZ9 B;  2B1X B;  1E97 A;  3NQZ A;  1W02 A;  4AKY A;  3VGN A;  4HYZ A;  1TRQ A;  2XGN A;  1B2U A;  5IG4 A;  1QVG 2;  1YVB I;  3JUN A;  4K61 A;  1GSP A;  3X40 A;  4LEH A;  3D3L A;  3NV0 B;  3IJE B;  2I9W A;  1BRI A;  4O02 B;  1IYY A;  3HK4 A;  5M18 A;  3M8C A;  2RBI A;  1RHL A;  1GOU A;  3DGM A;  4DKI A;  1LOY A;  4N6L A;  3G0K A;  1F8N A;  3NM2 A;  3MSO A;  1W6G A;  3LT9 A;  1VQQ A;  4CDL A;  1N8R 4;  1EQK A;  5AYS C;  3LT8 A;  2CFK A;  3T0U A;  3T8N A;  1BRJ A;  1IQY A;  1ZS7 A;  1NU3 A;  2XGL A;  2HMJ B;  1AVK A;  1IVX A;  1UCK A;  1VQ8 3;  3MG3 A;  4NRE A;  2M7O A;  3SLU A;  1NB3 I;  3CNX A;  1BSA A;  3BB9 A;  2W56 B;  4LMI A;  3EBT A;  1CYV A;  3S5C A;  2HOH A;  4TX4 A;  1FUW A;  1Q82 4;  4FCZ A;  2CFG A;  1VQK 3;  4FMB A;  6STD A;  1B21 A;  1UCL A;  2OWP A;  2CWT A;  4KFF A;  1D6U A;  2SBL A;  1FUT A;  2OOV A;  1W5Z A;  1IQ8 A;  2BU4 A;  2CK3 H;  3DGY A;  5KP4 A;  1DVC A;  1OF5 A;  2K54 A;  2W0Q A;  3T8U A;  3U1W A;  1RKY A;  1HU9 A;  2F4Y A;  1JB4 A;  2IUJ A;  1SIH A;  1OUN A;  1ISK A;  1UUG B;  3LTD A;  3S28 A;  3ALA A;  1IVW A;  1PU4 A;  1LRA A;  2D42 A;  3K9M C;  3OWY A;  1QAF A;  3FZW A;  1ROV A;  1B2S A;  1MOL A;  1QJG A;  2CG1 A;  2Y73 A;  3D5G A;  4KZ1 A;  1BSD A;  1S5A A;  1D6Y A;  2MC8 A;  5M19 A;  1UI8 A;  4R9L A;  8CHO A;  3F14 A;  3KE7 A;  1V74 A;  2F5W A;  1VZZ A;  3GSP A;  1OH0 A;  2A15 A;  4CJN A;  5IW9 A;  1O7P B;  3EHC A;  2WGO A;  5BVB A;  7STD A;  3BND A;  5CLK A;  3D9R A;  1YGW A;  2OQE C;  3RGA A;  3GZY B;  1CQS A;  1B27 A;  1UGH I;  1W7C A;  2CHC A;  2P09 A;  3NV0 A;  1FGO A;  4FMA A;  3LTB A;  3CCJ 3;  1STD A;  3L0R A;  3CNM A;  3F8X A;  1IT7 A;  1YHQ 3;  1MGW A;  5JPU A;  1LVN A;  3CCE 3;  1VQP 3;  2WO0 A;  2E2U A;  1BRG A;  1QMA A;  1YI2 3;  1FGM A;  1I3I A;  3SOA A;  1R4C A;  4HZB B;  5EVH A;  2E2T A;  1GYB A;  1I2F A; 
#chains in the Genus database with same CATH homology
 1RN1 A;  1B2M A;  1GMR A;  1BRN L;  4J5K A;  1Q9E A;  1GMQ A;  1BNG A;  1GOY A;  1RNB A;  4RNT A;  3BIR A;  2KF4 A;  1I3F A;  2AAD A;  7RNT A;  2AAE A;  1JBR A;  1CH0 A;  1BAO A;  1I2G A;  1BAN A;  1I0X A;  3WR2 A;  1YVS A;  1BNF A;  2GSP A;  1T2H A;  1X1U A;  1X1X A;  3AGN A;  1RTU A;  3RNT A;  1BNI A;  1LOV A;  3WHO A;  3AGO A;  1BRH A;  1BRK A;  1YNV X;  1GOV A;  1HYF A;  3SYU A;  4GHO A;  5HOH A;  1MGR A;  3D4A A;  1BRS A;  1RGF A;  1RGG A;  1B3S A;  5BU4 A;  1SAR A;  6RNT A;  1JBS A;  1RGL A;  1TRQ A;  3Q3F A;  1C54 A;  1B2U A;  1LOW A;  1DE3 A;  4BIR A;  1GSP A;  2C4B A;  1FYS A;  1RCK A;  1BRI A;  3URP A;  1IYY A;  1A2P A;  1RHL A;  1GOU A;  2RBI A;  1LOY A;  1AQZ A;  2SAR A;  3AHS A;  4HAA A;  3D5I A;  1BSE A;  1RGK A;  7GSP A;  1HZ1 A;  1BRJ A;  1BU4 A;  1UCK A;  1RCL A;  1RGA A;  1BGS A;  1BSA A;  3DH2 A;  1GMP A;  1I70 A;  5RNT A;  3HOH A;  1G02 A;  2BIR A;  1RN4 A;  2HOH A;  1BNS A;  3A5E A;  1UCJ A;  1ZGX A;  1B21 A;  1RGC A;  1UCL A;  2KF6 A;  8RNT A;  4BU4 A;  1BOX A;  2KAA A;  2F56 A;  5GSP A;  1FUT A;  2BU4 A;  1BSC A;  3DGY A;  1BIR A;  1PYL A;  2ZA4 A;  1B20 A;  1X1W A;  9RNT A;  2F4Y A;  1FUS A;  1I0V A;  2F5M A;  1BNE A;  2KF3 A;  1R4Y A;  1LRA A;  4J5G A;  1FW7 A;  1B2S A;  1BSB A;  3D5G A;  1BSD A;  1TTO A;  3BU4 A;  1PY3 A;  1LNI A;  2RNT A;  1I8V A;  2F5W A;  3GSP A;  1AY7 A;  1BUJ A;  1RSN A;  1RMS A;  1BVI A;  1BNR A;  1YGW A;  6GSP A;  1B2X A;  1B27 A;  3AHW A;  1JBT A;  1T2I A;  2KF5 A;  1RGE A;  1DET A;  1X1Y A;  1BNJ A;  1TRP A;  3KCH A;  1FZU A;  1RDS A;  1MGW A;  1UCI A;  5BIR A;  1RGH A;  1BRG A;  1I3I A;  1I2E A;  4HOH A;  1RLS A;  1B2Z A;  4GSP A;  1I2F A;  1RNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...