1RGFA

Hydrolase, guanyloribonuclease
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIITGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (guanyloribonuclease)
molecule keywords RIBONUCLEASE
publication title Ribonuclease from Streptomyces aureofaciens at atomic resolution.
pubmed doi rcsb
total genus 21
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1995-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1rgfA00
2HOHA 3HOHA 1SARA 1RCKA 1RLSA 1RGEA 3A5EA 1TRQA 1AQZA 1BNSA 1LOWA 2BU4A 9RNTA 1UCJA 1T2HA 1I0VA 1I3IA 1YNVX 1BSBA 1FW7A 1Q9EA 1YVSA 1I2GA 4J5GA 1B2ZA 1BANA 1I0XA 1DETA 4RNTA 1BSCA 1PY3A 1BRGA 1GOYA 2KF5A 7RNTA 1TTOA 2KAAA 3DH2A 1BNEA 1BRIA 1X1XA 1FYSA 1AY7A 2ZA4A 3BU4A 2F5WA 2F4YA 1RNBA 6GSPA 1GOUA 1UCLA 1BVIA 1GOVA 1I2FA 1A2PA 1G02A 1BIRA 1JBTA 4HAAA 3SYUA 1BGSA 1T2IA 1I70A 1RNTA 1BRNL 4HOHA 1RDSA 1TRPA 3DGYA 5GSPA 1BRJA 2AAEA 4J5KA 1RN4A 1I8VA 1IYYA 1GMPA 1HYFA 1LOVA 1B3SA 3URPA 4GSPA 2F56A 1HZ1A 1B27A 1BRSA 1LNIA 1B2SA 1BSDA 2F5MA 2KF3A 5BIRA 1RGCA 1B2XA 1FZUA 1YGWA 4BIRA 1MGRA 1BRHA 1GSPA 1MGWA 1RGFA 2AADA 3WR2A 7GSPA 1DE3A 1I3FA 5BU4A 1RTUA 2BIRA 1B2UA 1JBRA 3D5IA 2RBIA 5HOHA 1RGHA 8RNTA 3D4AA 1R4YA 1RCLA 1X1UA 1RN1A 2SARA 2KF4A 1LRAA 1RGAA 1BNFA 1BSEA 1JBSA 1B21A 1FUTA 1X1YA 3KCHA 4GHOA 1I2EA 1BU4A 3GSPA 1BAOA 1RHLA 2C4BA 1UCIA 1BNJA 1FUSA 1BRKA 1RGKA 1RSNA 1UCKA 1RGLA 1GMQA 1ZGXA 3AGOA 1GMRA 1LOYA 1C54A 2RNTA 3RNTA 1CH0A 4BU4A 1RGGA 6RNTA 1RMSA 1BNIA 3BIRA 3D5GA 1BNRA 1B20A 1X1WA 1BOXA 3AHSA 1BUJA 3AHWA 1PYLA 2KF6A 2GSPA 3AGNA 5RNTA 1B2MA 3WHOA 1BSAA 1BNGA 3Q3FA
chains in the Genus database with same CATH superfamily
2W0QA 3RDEA 3KFQC 2BMRB 3K7CA 2WGOA 3BNDA 4HZBB 2YX9A 1S5AA 3NBRA 1IVUA 1SPUA 2BU4A 3CU3A 4JF8A 3VF1A 4EV2A 9RNTA 4L8OA 3CNXA 2QEX3 1I0VA 1I3IA 5LC6A 3G8ZA 2GEYA 1YVSA 4J5GA 3EX9A 4N6LA 1BANA 3G6E3 3KN4A 5D83A 1A67A 2XFTA 4GL6A 4OUQA 1NJI4 1AVKA 1V74A 1EEJA 4EBGA 3F8XA 5EQLA 3DXOA 5EVHA 1RJOA 2KAAA 1LXEA 2W9PA 5AEWB 1JB5A 1ZX2A 1BNEA 3JUPA 5AIHA 3A76A 5IG0A 3L0RA 3CME3 3X3YA 3NQZA 3WDGB 1OF5A 3V92A 3DGMA 2W2CA 5KP1A 3OW22 5I97A 1RNBA 3G713 1GOUA 1FGOA 1FGRA 1UCLA 2CKFB 3KKGA 4R9LA 2J8XB 4RZMA 4K61A 3NX0A 4AKYA 3F7XA 1G02A 1VQM3 4CDLA 1BIRA 3LTDA 1G96A 1V57A 4HAAA 4HM7B 1T2IA 3EHCA 3K5TA 3GWRA 3Q2PA 4HOHA 4O3VA 5LC7A 1BRNL 2B24B 2V1LA 1UI7A 3N54B 1OPYA 1W4NA 1K734 4FCZA 1GMPA 5AI1A 1HYFA 1T3BA 3FSDA 4JRFA 3F8HA 1Q40B 4CJNA 1WMPA 5AYRB 1VQ63 5JBSA 2H0GA 4MMXB 1GY7A 2XSOB 2D42A 3PXMA 1BSDA 1GY5A 4ILFA 2JDIH 3AMOB 2BT3A 1D6YA 4XM4A 5IF6A 3CCL3 2KF3A 3UL5A 1IVWA 5IW9A 2IYJA 4WP5A 1YGWA 5IG5A 1VQQA 4WYKB 3SOYA 1MGWA 4NPBA 2LYXA 1EQKA 4R80A 1RGFA 4N6MA 3WR2A 1UUWB 1KSIA 1WNHA 4X2OA 3JUOA 3OV4A 2IUKA 3PCSA 3ZFZA 1IVVA 4HM3B 4MJDA 1N9JA 1GY6A 2MC8A 1KD14 2OTL3 3PGBA 2RCDA 3U1WA 1FUWA 2W03A 1RCLA 1N5PA 2BMQB 3MYTA 2INXA 3EN1B 1RN1A 3NQYA 2SARA 4HYZA 1WQLB 1RGAA 1JBSA 1TP6A 2Z6BA 2ZHXB 4HM5B 1VQ43 3GSPA 3CD63 2C4BA 1UCIA 3IJEB 1NNVA 2XGNA 4R4KA 1WMNA 3KE7A 1Z1SA 3NUVA 1DMMA 3UB1A 1HKXA 2BMOB 3CXC2 2FGTA 3CCM3 4FMCA 1E3VA 1QVG2 4GB5A 3I553 3ZG5A 3EE1A 3MHEA 1NDOB 1C54A 4OK0A 5DRVA 2YFLB 3X41A 1ASKA 1PFPA 1JRQA 3MKIA 4BL2A 1KWIA 1BNRA 4TX4A 3B8LA 3KSPA 2ZDJA 3FCSB 1VQ73 1VZZA 1WTHA 3AHWA 3CCS3 2GSPA 5IERA 1D6UA 3M8CA 6STDA 5CXOA 3WHOA 2O9UX 3TDGA 2HOHA 1YI23 1SARA 3V98A 5AIGA 3ER7A 1EA2A 1QAKA 1IDPA 1RCKA 1RLSA 2W6JH 3EN8A 3N8BA 4MMZB 1TRQA 5HGRA 3X3ZA 4N6TA 4LZIA 3WOFB 3DGLA 1LOWA 1UCJA 1W5ZA 2CX0A 1T2HA 2QIYA 3NM7A 4J9AA 3OX9A 4FCJA 1GD3A 2P0MA 2CH9A 3FG1A 3LT9A 3K0ZA 1VQN3 4RNTA 1I2GA 5IG4A 4NREA 3T8NA 1PY3A 3QRDA 2W04A 2F98A 3S29A 1NO3A 5AIIA 2P09A 3GZRA 3NBBA 5G2GA 4HM0B 3D9RA 1KQS2 1LVNA 1TTOA 3H51A 3CC73 1X1XA 1PU4A 2Q07A 4Q53A 2OQEA 3LYGA 1VQL3 1OACA 2GBWB 2H0HA 2H0IA 3NBJA 3CCJ3 4LMIA 3NV0A 3CPOA 6GSPA 2L4VA 3FGYA 3LH4A 1MWUA 1BVIA 1GOVA 1UUVB 1A2PA 2MF7A 1FGMA 3DY5A 3ALAA 5EEOA 4J8TA 4N6NB 3GAXA 3SYUA 3BLZA 2CG0A 1WMOA 1RNTA 2W9QA 2XFSA 5IEPA 5G1KA 1KC84 3DGYA 1TFKA 1W6CA 4L7KA 1N8R4 5GSPA 5ELJA 7STDA 1W00A 3EBYA 1Q824 1NB3I 4J5KA 1K8A4 1NU3A 5A0OB 2PZVA 5IEOA 8CHOA 4G1MB 1IYYA 4O2HA 2HMNB 1ROVA 2SBLA 2K3DA 3MG1A 1JKGB 3IPTA 2F56A 4FMBA 1HZ1A 2CFKA 4KT3B 3OWSA 4N6OB 1B27A 4O8SA 4WHAA 2K0MA 2OOVA 4WYKA 5FGOA 3FH1A 2QA43 5CF2A 1TIJA 4X2HA 3PYJA 5D82A 4ZM8A 3T8UA 2RGQA 2P05A 3RGAA 4H61A 1BRHA 1K41A 2OQEC 2CG1A 1LQGC 2AADA 4HM4B 1VQO3 4XBYA 1ISKA 1I3FA 2I9WA 1VQ83 2YFIB 2CFLA 2IUJA 3MWZA 2XF3A 4KFFA 2CIUA 3D5IA 1RRLA 3IMAB 4IPBA 4OVMA 1RGHA 1U5OA 3NXJA 3Q90A 4EW5A 3EF8A 8RNTA 3D4AA 3JUQA 3PZWA 1R4YA 3FF0A 2CFWA 4XB5A 1DMQA 1GD4A 1A2VA 1BSEA 3ECFA 3F7SA 4XDVA 2IMJA 4GHOA 3CMA3 3RGRA 2M7OA 2XRXB 1I2EA 1BU4A 4STDA 1GYBA 3PCRA 5AIFA 3JUMA 3FZWA 1RGKA 1RSNA 3S67A 4CPKA 2OOVC 1RGLA 1W6GA 2E2UA 5STDA 1GMRA 1LOYA 3GZXB 3RNTA 2BNGA 6RNTA 1RGGA 1RMSA 3BIRA 3I563 3D5GA 5G1LA 1OCVA 2STDA 1QMAA 2R41A 2CK3H 1BOXA 4L8PA 1QALA 2ML6A 3KSED 3HI7A 2KF6A 1US1A 3AGNA 3MPHA 3S28A 1N9EA 4KZ1A 3EB8A 1BSAA 1BNGA 2CWVA 2HMKB 1IT8A 3HOHA 3I0YA 3OWUA 4WWUC 4EV5A 1CEWI 4R1KA 2O3OA 1FGTA 3A5EA 4HM1B 3CCQ3 1AQZA 1Q814 5AEUB 3X3XA 3EBTA 2WO0A 1CQSA 3BB9A 1BNSA 1IT7A 1W6YA 4FMDA 5IENA 1STDA 2C10A 2P0XA 4HKVB 1J2BA 1OH0A 3LMLA 1C7HA 1BSBA 2CWUA 3GRDA 5M19A 1I0XA 3DM8A 1OGXA 1DETA 1BSCA 3CCV3 5JPUA 2KRTA 5JPPA 4H3UA 4AEQA 2QGUA 3HX8A 1GOYA 2CFGA 2KF5A 1STFI 1YGEA 2W56A 1SJWA 7RNTA 1JV2B 4N6V0 2WOHA 1NWWA 1O7NB 2XR8B 3DH2A 3O8YA 2WGQA 1FYSA 2ZA4A 3BU4A 4FMAA 4HJLB 1AV4A 4EYCA 4LYLB 3ZG0A 2R4IA 2F4YA 3X40A 3G0KA 1IQYA 4BTXA 1E3RA 3S27A 3F40A 1D6ZA 4XBXA 1FA3A 4HM2B 1LNHA 2OWPA 1UW1A 1JB4A 3HIIA 1K9M4 1O7MB 1I70A 3MG3A 1IQ8A 5BXQA 1RDSA 1TRPA 1LOXA 3J7Yd 5TGNA 1A90A 3UJMA 1MOLA 1RN4A 1S723 4MEIA 1RKYA 3JUNA 3LT8A 1LOVA 3FG4A 3EQQB 4GSPA 4FR9A 3G4S3 1M904 1BRSA 1LNIA 4HM6B 4K90B 1B2SA 2KCDA 4IT7A 4NHFA 1HU9A 2BO9B 3WA2X 1OUNA 2F5MA 1ULJB 3SEDA 4EC6A 5BIRA 1RGCA 1B2XA 1SQWA 1UGHI 1YIT3 1MGRA 1O7HB 1GSPA 2CWTA 1JN5B 3CCU3 2GU3A 2GEXA 1Q42A 7GSPA 4HBRA 3DUKA 3JVCA 2BIRA 1M1K4 2ZL8A 1JBRA 4WFOA 1Q40A 3EC9A 4HM8B 3SLUA 4BTWA 5HOHA 1G0TA 3STDA 1JJ22 2BHMA 4I5QA 3AMOA 1X1UA 1Q7Y4 3CCE3 1ULIB 2OCTA 3V99A 3NHXA 1BNFA 1IV7A 1F8NA 1B21A 5M1AA 3MG2A 1UI8A 1OGZA 3CC23 2WOFA 4HVNA 3E99A 1YIJ3 4K1VA 1YHQ3 1MWRA 1RHLA 2Y74A 3DGOA 5CLKA 2IA7A 1FUSA 1YJN3 1A2KA 1UCKA 1DMNA 1W7CA 1TFOA 1GMQA 3PS8A 1QVF2 3EJVA 1IK3A 2XSHB 4KFDA 3DMCA 3WODG 1VQ93 2E2TA 1IV9A 2RNTA 1BUQA 1CYUA 5ELUA 3H3HA 4R9KA 4RNYA 3B4PA 3S5CA 2CW9A 1B20A 1BUJA 1YVBI 2CX1A 5RNTA 2XEPA 4HZ9B 1B2MA 3CC43 1UUGB 4PEJA 4DKIA 3Q3FA 1GS3A 2HMJB 3G16A 4BL3A 1VQ53 3U97A 1RGEA 2CC3A 2ML5A 3MSOA 1U8CB 2CHCA 2GXFA 3BNEA 3NV0B 3VGNA 4N3VA 3DGNA 3LTBA 1JB2A 1O7PB 3LTAA 3LXUX 4XDWA 1YNVX 3DZLA 1FW7A 1Q9EA 4RNZA 1W01A 1B2ZA 3CCR3 3GZBA 3K63A 4BTYA 1BRGA 1YJ93 4QWTA 2YFJB 4ORLA 2K54A 2PNCA 1EG9B 1W2ZA 3BNCA 3WMDA 1ZS7A 1BRIA 1T5YA 1UDII 2Z76A 1AY7A 1Y4KA 2B1XB 1TUHA 2F5WA 3HK4A 4KFEA 1E97A 1QJGA 3UNLA 1Q864 1JZOA 3D79A 5KP4A 1I2FA 3SX1A 2LQVA 1OF5B 3OXAA 2FNQA 1JBTA 1BGSA 4K1UA 3NM2A 2FXTA 3N9HA 4U13A 3KIIA 1TJDA 1FGQA 5CF1A 4RBNA 4EXRA 1JNQA 1BRJA 2UX0A 3HIGA 2AAEA 2JQ5A 3KZTA 1V58A 5KP3A 1I8VA 1N8QA 3SVAA 2RFRA 4I4KA 1B3SA 1OHOA 4LGQA 1LQMB 3URPA 3VSYA 2L1SA 3SXXA 4AKZA 5BVBA 1N5HA 1O7WB 3FKAA 1R4CA 3GZYB 1DYUA 1JN5A 1AR0A 2UUGC 3FLJA 2UGIA 1RN7A 1FZUA 3SOAA 2A15A 2HMOB 4BIRA 2E2VA 1MWTA 4LSOA 1ZO2A 1RRHA 5DREA 5FW5A 1MWSA 3B4OA 1DE3A 5BU4A 1VQK3 1RTUA 3X42A 1B2UA 1QAFA 1IU7A 1JKGA 1OHPA 1W02A 2RBIA 1M9GA 2RSXA 3K9MC 1CYVA 3FF2A 2GBXB 2IY2A 1SIHA 3D3LA 2OTJ3 3QK9A 5M18A 3LZAA 3Q1CA 1M1XB 1Q7HA 1DVCA 2F99A 2XGLA 3BNBA 3WA3A 1IVXA 5CK6A 2KF4A 5AYSC 1LRAA 1MNLA 1EKMA 3WOEB 1UGIA 5D81A 1JZDA 1ROAA 1X1YA 1FUTA 3KCHA 4XBTA 2F86B 1DVDA 1OHSA 1O7GB 1BAOA 3CPW2 2GU1A 3B7CA 3T0UA 2KXGA 1BNJA 1YJW3 4LEHA 1BRKA 2D1WA 2P38A 1SIIA 3LTCA 3CNMA 1NB5I 4KVHA 1ZGXA 2C11A 2Z77A 3AGOA 3OWYA 3ROBA 3FG3A 1CH0A 2Y73A 4BU4A 1W2B2 1BNIA 1TU5A 2HMLB 3LOYA 4MMYB 1L5GB 2CFDA 1AVLA 1X1WA 3AHSA 3F9SA 2HMMB 3UL6A 4N6UA 1PYLA 5IG3A 3HZPA 1K28A 1EUIC 4FCMA 2XH9A 3F14A 4O02B 1VQP3 2Z7AA 1IQXA 4IIAA 2W56B 4CCVA
chains in the Genus database with same CATH topology
2HOHA 3HOHA 1SARA 1RCKA 1RLSA 1RGEA 3A5EA 1TRQA 1AQZA 1BNSA 1LOWA 2BU4A 9RNTA 1UCJA 1T2HA 1I0VA 1I3IA 1YNVX 1BSBA 1FW7A 1Q9EA 1YVSA 1I2GA 4J5GA 1B2ZA 1BANA 1I0XA 1DETA 4RNTA 1BSCA 1PY3A 1BRGA 1GOYA 2KF5A 7RNTA 1TTOA 2KAAA 3DH2A 1BNEA 1BRIA 1X1XA 1FYSA 1AY7A 2ZA4A 3BU4A 2F5WA 2F4YA 1RNBA 6GSPA 1GOUA 1UCLA 1BVIA 1GOVA 1I2FA 1A2PA 1G02A 1BIRA 1JBTA 4HAAA 3SYUA 1BGSA 1T2IA 1I70A 1RNTA 1BRNL 4HOHA 1RDSA 1TRPA 3DGYA 5GSPA 1BRJA 2AAEA 4J5KA 1RN4A 1I8VA 1IYYA 1GMPA 1HYFA 1LOVA 1B3SA 3URPA 4GSPA 2F56A 1HZ1A 1B27A 1BRSA 1LNIA 1B2SA 1BSDA 2F5MA 2KF3A 5BIRA 1RGCA 1B2XA 1FZUA 1YGWA 4BIRA 1MGRA 1BRHA 1GSPA 1MGWA 1RGFA 2AADA 3WR2A 7GSPA 1DE3A 1I3FA 5BU4A 1RTUA 2BIRA 1B2UA 1JBRA 3D5IA 2RBIA 5HOHA 1RGHA 8RNTA 3D4AA 1R4YA 1RCLA 1X1UA 1RN1A 2SARA 2KF4A 1LRAA 1RGAA 1BNFA 1BSEA 1JBSA 1B21A 1FUTA 1X1YA 3KCHA 4GHOA 1I2EA 1BU4A 3GSPA 1BAOA 1RHLA 2C4BA 1UCIA 1BNJA 1FUSA 1BRKA 1RGKA 1RSNA 1UCKA 1RGLA 1GMQA 1ZGXA 3AGOA 1GMRA 1LOYA 1C54A 2RNTA 3RNTA 1CH0A 4BU4A 1RGGA 6RNTA 1RMSA 1BNIA 3BIRA 3D5GA 1BNRA 1B20A 1X1WA 1BOXA 3AHSA 1BUJA 3AHWA 1PYLA 2KF6A 2GSPA 3AGNA 5RNTA 1B2MA 3WHOA 1BSAA 1BNGA 3Q3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOH A;  3HOH A;  1SAR A;  1RCK A;  1RLS A;  1RGE A;  3A5E A;  1TRQ A;  1AQZ A;  1BNS A;  1LOW A;  2BU4 A;  9RNT A;  1UCJ A;  1T2H A;  1I0V A;  1I3I A;  1YNV X;  1BSB A;  1FW7 A;  1Q9E A;  1YVS A;  1I2G A;  4J5G A;  1B2Z A;  1BAN A;  1I0X A;  1DET A;  4RNT A;  1BSC A;  1PY3 A;  1BRG A;  1GOY A;  2KF5 A;  7RNT A;  1TTO A;  2KAA A;  3DH2 A;  1BNE A;  1BRI A;  1X1X A;  1FYS A;  1AY7 A;  2ZA4 A;  3BU4 A;  2F5W A;  2F4Y A;  1RNB A;  6GSP A;  1GOU A;  1UCL A;  1BVI A;  1GOV A;  1I2F A;  1A2P A;  1G02 A;  1BIR A;  1JBT A;  4HAA A;  3SYU A;  1BGS A;  1T2I A;  1I70 A;  1RNT A;  1BRN L;  4HOH A;  1RDS A;  1TRP A;  3DGY A;  5GSP A;  1BRJ A;  2AAE A;  4J5K A;  1RN4 A;  1I8V A;  1IYY A;  1GMP A;  1HYF A;  1LOV A;  1B3S A;  3URP A;  4GSP A;  2F56 A;  1HZ1 A;  1B27 A;  1BRS A;  1LNI A;  1B2S A;  1BSD A;  2F5M A;  2KF3 A;  5BIR A;  1RGC A;  1B2X A;  1FZU A;  1YGW A;  4BIR A;  1MGR A;  1BRH A;  1GSP A;  1MGW A;  1RGF A;  2AAD A;  3WR2 A;  7GSP A;  1DE3 A;  1I3F A;  5BU4 A;  1RTU A;  2BIR A;  1B2U A;  1JBR A;  3D5I A;  2RBI A;  5HOH A;  1RGH A;  8RNT A;  3D4A A;  1R4Y A;  1RCL A;  1X1U A;  1RN1 A;  2SAR A;  2KF4 A;  1LRA A;  1RGA A;  1BNF A;  1BSE A;  1JBS A;  1B21 A;  1FUT A;  1X1Y A;  3KCH A;  4GHO A;  1I2E A;  1BU4 A;  3GSP A;  1BAO A;  1RHL A;  2C4B A;  1UCI A;  1BNJ A;  1FUS A;  1BRK A;  1RGK A;  1RSN A;  1UCK A;  1RGL A;  1GMQ A;  1ZGX A;  3AGO A;  1GMR A;  1LOY A;  1C54 A;  2RNT A;  3RNT A;  1CH0 A;  4BU4 A;  1RGG A;  6RNT A;  1RMS A;  1BNI A;  3BIR A;  3D5G A;  1BNR A;  1B20 A;  1X1W A;  1BOX A;  3AHS A;  1BUJ A;  3AHW A;  1PYL A;  2KF6 A;  2GSP A;  3AGN A;  5RNT A;  1B2M A;  3WHO A;  1BSA A;  1BNG A;  3Q3F A; 
#chains in the Genus database with same CATH topology
 2W0Q A;  3RDE A;  3KFQ C;  2BMR B;  3K7C A;  2WGO A;  3BND A;  4HZB B;  2YX9 A;  1S5A A;  3NBR A;  1IVU A;  1SPU A;  2BU4 A;  3CU3 A;  4JF8 A;  3VF1 A;  4EV2 A;  9RNT A;  4L8O A;  3CNX A;  2QEX 3;  1I0V A;  1I3I A;  5LC6 A;  3G8Z A;  2GEY A;  1YVS A;  4J5G A;  3EX9 A;  4N6L A;  1BAN A;  3G6E 3;  3KN4 A;  5D83 A;  1A67 A;  2XFT A;  4GL6 A;  4OUQ A;  1NJI 4;  1AVK A;  1V74 A;  1EEJ A;  4EBG A;  3F8X A;  5EQL A;  3DXO A;  5EVH A;  1RJO A;  2KAA A;  1LXE A;  2W9P A;  5AEW B;  1JB5 A;  1ZX2 A;  1BNE A;  3JUP A;  5AIH A;  3A76 A;  5IG0 A;  3L0R A;  3CME 3;  3X3Y A;  3NQZ A;  3WDG B;  1OF5 A;  3V92 A;  3DGM A;  2W2C A;  5KP1 A;  3OW2 2;  5I97 A;  1RNB A;  3G71 3;  1GOU A;  1FGO A;  1FGR A;  1UCL A;  2CKF B;  3KKG A;  4R9L A;  2J8X B;  4RZM A;  4K61 A;  3NX0 A;  4AKY A;  3F7X A;  1G02 A;  1VQM 3;  4CDL A;  1BIR A;  3LTD A;  1G96 A;  1V57 A;  4HAA A;  4HM7 B;  1T2I A;  3EHC A;  3K5T A;  3GWR A;  3Q2P A;  4HOH A;  4O3V A;  5LC7 A;  1BRN L;  2B24 B;  2V1L A;  1UI7 A;  3N54 B;  1OPY A;  1W4N A;  1K73 4;  4FCZ A;  1GMP A;  5AI1 A;  1HYF A;  1T3B A;  3FSD A;  4JRF A;  3F8H A;  1Q40 B;  4CJN A;  1WMP A;  5AYR B;  1VQ6 3;  5JBS A;  2H0G A;  4MMX B;  1GY7 A;  2XSO B;  2D42 A;  3PXM A;  1BSD A;  1GY5 A;  4ILF A;  2JDI H;  3AMO B;  2BT3 A;  1D6Y A;  4XM4 A;  5IF6 A;  3CCL 3;  2KF3 A;  3UL5 A;  1IVW A;  5IW9 A;  2IYJ A;  4WP5 A;  1YGW A;  5IG5 A;  1VQQ A;  4WYK B;  3SOY A;  1MGW A;  4NPB A;  2LYX A;  1EQK A;  4R80 A;  1RGF A;  4N6M A;  3WR2 A;  1UUW B;  1KSI A;  1WNH A;  4X2O A;  3JUO A;  3OV4 A;  2IUK A;  3PCS A;  3ZFZ A;  1IVV A;  4HM3 B;  4MJD A;  1N9J A;  1GY6 A;  2MC8 A;  1KD1 4;  2OTL 3;  3PGB A;  2RCD A;  3U1W A;  1FUW A;  2W03 A;  1RCL A;  1N5P A;  2BMQ B;  3MYT A;  2INX A;  3EN1 B;  1RN1 A;  3NQY A;  2SAR A;  4HYZ A;  1WQL B;  1RGA A;  1JBS A;  1TP6 A;  2Z6B A;  2ZHX B;  4HM5 B;  1VQ4 3;  3GSP A;  3CD6 3;  2C4B A;  1UCI A;  3IJE B;  1NNV A;  2XGN A;  4R4K A;  1WMN A;  3KE7 A;  1Z1S A;  3NUV A;  1DMM A;  3UB1 A;  1HKX A;  2BMO B;  3CXC 2;  2FGT A;  3CCM 3;  4FMC A;  1E3V A;  1QVG 2;  4GB5 A;  3I55 3;  3ZG5 A;  3EE1 A;  3MHE A;  1NDO B;  1C54 A;  4OK0 A;  5DRV A;  2YFL B;  3X41 A;  1ASK A;  1PFP A;  1JRQ A;  3MKI A;  4BL2 A;  1KWI A;  1BNR A;  4TX4 A;  3B8L A;  3KSP A;  2ZDJ A;  3FCS B;  1VQ7 3;  1VZZ A;  1WTH A;  3AHW A;  3CCS 3;  2GSP A;  5IER A;  1D6U A;  3M8C A;  6STD A;  5CXO A;  3WHO A;  2O9U X;  3TDG A;  2HOH A;  1YI2 3;  1SAR A;  3V98 A;  5AIG A;  3ER7 A;  1EA2 A;  1QAK A;  1IDP A;  1RCK A;  1RLS A;  2W6J H;  3EN8 A;  3N8B A;  4MMZ B;  1TRQ A;  5HGR A;  3X3Z A;  4N6T A;  4LZI A;  3WOF B;  3DGL A;  1LOW A;  1UCJ A;  1W5Z A;  2CX0 A;  1T2H A;  2QIY A;  3NM7 A;  4J9A A;  3OX9 A;  4FCJ A;  1GD3 A;  2P0M A;  2CH9 A;  3FG1 A;  3LT9 A;  3K0Z A;  1VQN 3;  4RNT A;  1I2G A;  5IG4 A;  4NRE A;  3T8N A;  1PY3 A;  3QRD A;  2W04 A;  2F98 A;  3S29 A;  1NO3 A;  5AII A;  2P09 A;  3GZR A;  3NBB A;  5G2G A;  4HM0 B;  3D9R A;  1KQS 2;  1LVN A;  1TTO A;  3H51 A;  3CC7 3;  1X1X A;  1PU4 A;  2Q07 A;  4Q53 A;  2OQE A;  3LYG A;  1VQL 3;  1OAC A;  2GBW B;  2H0H A;  2H0I A;  3NBJ A;  3CCJ 3;  4LMI A;  3NV0 A;  3CPO A;  6GSP A;  2L4V A;  3FGY A;  3LH4 A;  1MWU A;  1BVI A;  1GOV A;  1UUV B;  1A2P A;  2MF7 A;  1FGM A;  3DY5 A;  3ALA A;  5EEO A;  4J8T A;  4N6N B;  3GAX A;  3SYU A;  3BLZ A;  2CG0 A;  1WMO A;  1RNT A;  2W9Q A;  2XFS A;  5IEP A;  5G1K A;  1KC8 4;  3DGY A;  1TFK A;  1W6C A;  4L7K A;  1N8R 4;  5GSP A;  5ELJ A;  7STD A;  1W00 A;  3EBY A;  1Q82 4;  1NB3 I;  4J5K A;  1K8A 4;  1NU3 A;  5A0O B;  2PZV A;  5IEO A;  8CHO A;  4G1M B;  1IYY A;  4O2H A;  2HMN B;  1ROV A;  2SBL A;  2K3D A;  3MG1 A;  1JKG B;  3IPT A;  2F56 A;  4FMB A;  1HZ1 A;  2CFK A;  4KT3 B;  3OWS A;  4N6O B;  1B27 A;  4O8S A;  4WHA A;  2K0M A;  2OOV A;  4WYK A;  5FGO A;  3FH1 A;  2QA4 3;  5CF2 A;  1TIJ A;  4X2H A;  3PYJ A;  5D82 A;  4ZM8 A;  3T8U A;  2RGQ A;  2P05 A;  3RGA A;  4H61 A;  1BRH A;  1K41 A;  2OQE C;  2CG1 A;  1LQG C;  2AAD A;  4HM4 B;  1VQO 3;  4XBY A;  1ISK A;  1I3F A;  2I9W A;  1VQ8 3;  2YFI B;  2CFL A;  2IUJ A;  3MWZ A;  2XF3 A;  4KFF A;  2CIU A;  3D5I A;  1RRL A;  3IMA B;  4IPB A;  4OVM A;  1RGH A;  1U5O A;  3NXJ A;  3Q90 A;  4EW5 A;  3EF8 A;  8RNT A;  3D4A A;  3JUQ A;  3PZW A;  1R4Y A;  3FF0 A;  2CFW A;  4XB5 A;  1DMQ A;  1GD4 A;  1A2V A;  1BSE A;  3ECF A;  3F7S A;  4XDV A;  2IMJ A;  4GHO A;  3CMA 3;  3RGR A;  2M7O A;  2XRX B;  1I2E A;  1BU4 A;  4STD A;  1GYB A;  3PCR A;  5AIF A;  3JUM A;  3FZW A;  1RGK A;  1RSN A;  3S67 A;  4CPK A;  2OOV C;  1RGL A;  1W6G A;  2E2U A;  5STD A;  1GMR A;  1LOY A;  3GZX B;  3RNT A;  2BNG A;  6RNT A;  1RGG A;  1RMS A;  3BIR A;  3I56 3;  3D5G A;  5G1L A;  1OCV A;  2STD A;  1QMA A;  2R41 A;  2CK3 H;  1BOX A;  4L8P A;  1QAL A;  2ML6 A;  3KSE D;  3HI7 A;  2KF6 A;  1US1 A;  3AGN A;  3MPH A;  3S28 A;  1N9E A;  4KZ1 A;  3EB8 A;  1BSA A;  1BNG A;  2CWV A;  2HMK B;  1IT8 A;  3HOH A;  3I0Y A;  3OWU A;  4WWU C;  4EV5 A;  1CEW I;  4R1K A;  2O3O A;  1FGT A;  3A5E A;  4HM1 B;  3CCQ 3;  1AQZ A;  1Q81 4;  5AEU B;  3X3X A;  3EBT A;  2WO0 A;  1CQS A;  3BB9 A;  1BNS A;  1IT7 A;  1W6Y A;  4FMD A;  5IEN A;  1STD A;  2C10 A;  2P0X A;  4HKV B;  1J2B A;  1OH0 A;  3LML A;  1C7H A;  1BSB A;  2CWU A;  3GRD A;  5M19 A;  1I0X A;  3DM8 A;  1OGX A;  1DET A;  1BSC A;  3CCV 3;  5JPU A;  2KRT A;  5JPP A;  4H3U A;  4AEQ A;  2QGU A;  3HX8 A;  1GOY A;  2CFG A;  2KF5 A;  1STF I;  1YGE A;  2W56 A;  1SJW A;  7RNT A;  1JV2 B;  4N6V 0;  2WOH A;  1NWW A;  1O7N B;  2XR8 B;  3DH2 A;  3O8Y A;  2WGQ A;  1FYS A;  2ZA4 A;  3BU4 A;  4FMA A;  4HJL B;  1AV4 A;  4EYC A;  4LYL B;  3ZG0 A;  2R4I A;  2F4Y A;  3X40 A;  3G0K A;  1IQY A;  4BTX A;  1E3R A;  3S27 A;  3F40 A;  1D6Z A;  4XBX A;  1FA3 A;  4HM2 B;  1LNH A;  2OWP A;  1UW1 A;  1JB4 A;  3HII A;  1K9M 4;  1O7M B;  1I70 A;  3MG3 A;  1IQ8 A;  5BXQ A;  1RDS A;  1TRP A;  1LOX A;  3J7Y d;  5TGN A;  1A90 A;  3UJM A;  1MOL A;  1RN4 A;  1S72 3;  4MEI A;  1RKY A;  3JUN A;  3LT8 A;  1LOV A;  3FG4 A;  3EQQ B;  4GSP A;  4FR9 A;  3G4S 3;  1M90 4;  1BRS A;  1LNI A;  4HM6 B;  4K90 B;  1B2S A;  2KCD A;  4IT7 A;  4NHF A;  1HU9 A;  2BO9 B;  3WA2 X;  1OUN A;  2F5M A;  1ULJ B;  3SED A;  4EC6 A;  5BIR A;  1RGC A;  1B2X A;  1SQW A;  1UGH I;  1YIT 3;  1MGR A;  1O7H B;  1GSP A;  2CWT A;  1JN5 B;  3CCU 3;  2GU3 A;  2GEX A;  1Q42 A;  7GSP A;  4HBR A;  3DUK A;  3JVC A;  2BIR A;  1M1K 4;  2ZL8 A;  1JBR A;  4WFO A;  1Q40 A;  3EC9 A;  4HM8 B;  3SLU A;  4BTW A;  5HOH A;  1G0T A;  3STD A;  1JJ2 2;  2BHM A;  4I5Q A;  3AMO A;  1X1U A;  1Q7Y 4;  3CCE 3;  1ULI B;  2OCT A;  3V99 A;  3NHX A;  1BNF A;  1IV7 A;  1F8N A;  1B21 A;  5M1A A;  3MG2 A;  1UI8 A;  1OGZ A;  3CC2 3;  2WOF A;  4HVN A;  3E99 A;  1YIJ 3;  4K1V A;  1YHQ 3;  1MWR A;  1RHL A;  2Y74 A;  3DGO A;  5CLK A;  2IA7 A;  1FUS A;  1YJN 3;  1A2K A;  1UCK A;  1DMN A;  1W7C A;  1TFO A;  1GMQ A;  3PS8 A;  1QVF 2;  3EJV A;  1IK3 A;  2XSH B;  4KFD A;  3DMC A;  3WOD G;  1VQ9 3;  2E2T A;  1IV9 A;  2RNT A;  1BUQ A;  1CYU A;  5ELU A;  3H3H A;  4R9K A;  4RNY A;  3B4P A;  3S5C A;  2CW9 A;  1B20 A;  1BUJ A;  1YVB I;  2CX1 A;  5RNT A;  2XEP A;  4HZ9 B;  1B2M A;  3CC4 3;  1UUG B;  4PEJ A;  4DKI A;  3Q3F A;  1GS3 A;  2HMJ B;  3G16 A;  4BL3 A;  1VQ5 3;  3U97 A;  1RGE A;  2CC3 A;  2ML5 A;  3MSO A;  1U8C B;  2CHC A;  2GXF A;  3BNE A;  3NV0 B;  3VGN A;  4N3V A;  3DGN A;  3LTB A;  1JB2 A;  1O7P B;  3LTA A;  3LXU X;  4XDW A;  1YNV X;  3DZL A;  1FW7 A;  1Q9E A;  4RNZ A;  1W01 A;  1B2Z A;  3CCR 3;  3GZB A;  3K63 A;  4BTY A;  1BRG A;  1YJ9 3;  4QWT A;  2YFJ B;  4ORL A;  2K54 A;  2PNC A;  1EG9 B;  1W2Z A;  3BNC A;  3WMD A;  1ZS7 A;  1BRI A;  1T5Y A;  1UDI I;  2Z76 A;  1AY7 A;  1Y4K A;  2B1X B;  1TUH A;  2F5W A;  3HK4 A;  4KFE A;  1E97 A;  1QJG A;  3UNL A;  1Q86 4;  1JZO A;  3D79 A;  5KP4 A;  1I2F A;  3SX1 A;  2LQV A;  1OF5 B;  3OXA A;  2FNQ A;  1JBT A;  1BGS A;  4K1U A;  3NM2 A;  2FXT A;  3N9H A;  4U13 A;  3KII A;  1TJD A;  1FGQ A;  5CF1 A;  4RBN A;  4EXR A;  1JNQ A;  1BRJ A;  2UX0 A;  3HIG A;  2AAE A;  2JQ5 A;  3KZT A;  1V58 A;  5KP3 A;  1I8V A;  1N8Q A;  3SVA A;  2RFR A;  4I4K A;  1B3S A;  1OHO A;  4LGQ A;  1LQM B;  3URP A;  3VSY A;  2L1S A;  3SXX A;  4AKZ A;  5BVB A;  1N5H A;  1O7W B;  3FKA A;  1R4C A;  3GZY B;  1DYU A;  1JN5 A;  1AR0 A;  2UUG C;  3FLJ A;  2UGI A;  1RN7 A;  1FZU A;  3SOA A;  2A15 A;  2HMO B;  4BIR A;  2E2V A;  1MWT A;  4LSO A;  1ZO2 A;  1RRH A;  5DRE A;  5FW5 A;  1MWS A;  3B4O A;  1DE3 A;  5BU4 A;  1VQK 3;  1RTU A;  3X42 A;  1B2U A;  1QAF A;  1IU7 A;  1JKG A;  1OHP A;  1W02 A;  2RBI A;  1M9G A;  2RSX A;  3K9M C;  1CYV A;  3FF2 A;  2GBX B;  2IY2 A;  1SIH A;  3D3L A;  2OTJ 3;  3QK9 A;  5M18 A;  3LZA A;  3Q1C A;  1M1X B;  1Q7H A;  1DVC A;  2F99 A;  2XGL A;  3BNB A;  3WA3 A;  1IVX A;  5CK6 A;  2KF4 A;  5AYS C;  1LRA A;  1MNL A;  1EKM A;  3WOE B;  1UGI A;  5D81 A;  1JZD A;  1ROA A;  1X1Y A;  1FUT A;  3KCH A;  4XBT A;  2F86 B;  1DVD A;  1OHS A;  1O7G B;  1BAO A;  3CPW 2;  2GU1 A;  3B7C A;  3T0U A;  2KXG A;  1BNJ A;  1YJW 3;  4LEH A;  1BRK A;  2D1W A;  2P38 A;  1SII A;  3LTC A;  3CNM A;  1NB5 I;  4KVH A;  1ZGX A;  2C11 A;  2Z77 A;  3AGO A;  3OWY A;  3ROB A;  3FG3 A;  1CH0 A;  2Y73 A;  4BU4 A;  1W2B 2;  1BNI A;  1TU5 A;  2HML B;  3LOY A;  4MMY B;  1L5G B;  2CFD A;  1AVL A;  1X1W A;  3AHS A;  3F9S A;  2HMM B;  3UL6 A;  4N6U A;  1PYL A;  5IG3 A;  3HZP A;  1K28 A;  1EUI C;  4FCM A;  2XH9 A;  3F14 A;  4O02 B;  1VQP 3;  2Z7A A;  1IQX A;  4IIA A;  2W56 B;  4CCV A; 
#chains in the Genus database with same CATH homology
 2HOH A;  3HOH A;  1SAR A;  1RCK A;  1RLS A;  1RGE A;  3A5E A;  1TRQ A;  1AQZ A;  1BNS A;  1LOW A;  2BU4 A;  9RNT A;  1UCJ A;  1T2H A;  1I0V A;  1I3I A;  1YNV X;  1BSB A;  1FW7 A;  1Q9E A;  1YVS A;  1I2G A;  4J5G A;  1B2Z A;  1BAN A;  1I0X A;  1DET A;  4RNT A;  1BSC A;  1PY3 A;  1BRG A;  1GOY A;  2KF5 A;  7RNT A;  1TTO A;  2KAA A;  3DH2 A;  1BNE A;  1BRI A;  1X1X A;  1FYS A;  1AY7 A;  2ZA4 A;  3BU4 A;  2F5W A;  2F4Y A;  1RNB A;  6GSP A;  1GOU A;  1UCL A;  1BVI A;  1GOV A;  1I2F A;  1A2P A;  1G02 A;  1BIR A;  1JBT A;  4HAA A;  3SYU A;  1BGS A;  1T2I A;  1I70 A;  1RNT A;  1BRN L;  4HOH A;  1RDS A;  1TRP A;  3DGY A;  5GSP A;  1BRJ A;  2AAE A;  4J5K A;  1RN4 A;  1I8V A;  1IYY A;  1GMP A;  1HYF A;  1LOV A;  1B3S A;  3URP A;  4GSP A;  2F56 A;  1HZ1 A;  1B27 A;  1BRS A;  1LNI A;  1B2S A;  1BSD A;  2F5M A;  2KF3 A;  5BIR A;  1RGC A;  1B2X A;  1FZU A;  1YGW A;  4BIR A;  1MGR A;  1BRH A;  1GSP A;  1MGW A;  1RGF A;  2AAD A;  3WR2 A;  7GSP A;  1DE3 A;  1I3F A;  5BU4 A;  1RTU A;  2BIR A;  1B2U A;  1JBR A;  3D5I A;  2RBI A;  5HOH A;  1RGH A;  8RNT A;  3D4A A;  1R4Y A;  1RCL A;  1X1U A;  1RN1 A;  2SAR A;  2KF4 A;  1LRA A;  1RGA A;  1BNF A;  1BSE A;  1JBS A;  1B21 A;  1FUT A;  1X1Y A;  3KCH A;  4GHO A;  1I2E A;  1BU4 A;  3GSP A;  1BAO A;  1RHL A;  2C4B A;  1UCI A;  1BNJ A;  1FUS A;  1BRK A;  1RGK A;  1RSN A;  1UCK A;  1RGL A;  1GMQ A;  1ZGX A;  3AGO A;  1GMR A;  1LOY A;  1C54 A;  2RNT A;  3RNT A;  1CH0 A;  4BU4 A;  1RGG A;  6RNT A;  1RMS A;  1BNI A;  3BIR A;  3D5G A;  1BNR A;  1B20 A;  1X1W A;  1BOX A;  3AHS A;  1BUJ A;  3AHW A;  1PYL A;  2KF6 A;  2GSP A;  3AGN A;  5RNT A;  1B2M A;  3WHO A;  1BSA A;  1BNG A;  3Q3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...