2BO9B

Human carboxypeptidase a4 in complex with human latexin.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE A4
publication title Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06907 Latexin Latexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B01
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B02
5ELUA 3PS8A 3PYJA 4ZM8A 1WNHA 3Q2PA 4N6LA 2OCTA 1LXEA 1RN7A 3KFQC 2CH9A 1PFPA 3LH4A 5LC6A 1M9GA 3SVAA 3UL5A 1DVCA 5A0OB 4CCVA 3MWZA 1YVBI 4EYCA 1CEWI 1N9JA 1NB3I 3K9MC 1DVDA 1N5PA 1CYUA 4N6UA 1CYVA 1R4CA 1GD3A 1EQKA 1N5HA 1NB5I 1A90A 5EQLA 1MNLA 4N6TA 3IMAB 3L0RA 4LZIA 2BO9B 1A67A 3KSED 4N6NB 4N6V0 2O9UX 2W9QA 3NX0A 1IV7A 1MOLA 3PXMA 4N6OB 4TX4A 1TIJA 4IT7A 4N6MA 5ELJA 3GAXA 1KWIA 1FUWA 5LC7A 1FA3A 3S67A 1GD4A 1G96A 1IV9A 2KXGA 1ROAA 3UL6A 2W9PA 3QRDA 1STFI
chains in the Genus database with same CATH superfamily
3CXC2 1OUNA 3F8HA 2MC8A 1AQZA 1T2IA 5JPUA 4ZM8A 1GMPA 1YJN3 3CCE3 4ORLA 5TGNA 3T8UA 4HZ9B 1W02A 4HM0B 1EEJA 1X1XA 3EHCA 4R9KA 4EXRA 2ZDJA 3NHXA 3PZWA 2R4IA 3B4OA 1TRPA 1GSPA 5AI1A 4L8PA 3DGYA 3SXXA 1M9GA 1RCLA 1BANA 3Q3FA 1EKMA 1S5AA 3SEDA 1QMAA 2LYXA 3A76A 1ZO2A 1Y4KA 3CMA3 5IG0A 4KT3B 2KAAA 3UNLA 1YIJ3 3U1WA 1BGSA 1RN1A 4K1UA 4XDWA 3MWZA 3KIIA 2YFIB 1UDII 4K61A 1VQ43 2P0XA 1HYFA 2J8XB 3KKGA 4LEHA 3VF1A 5BVBA 1VQ93 1UW1A 2Y74A 5BIRA 4XM4A 1OHPA 4HM3B 1Q9EA 2FNQA 1BRIA 1NU3A 5CLKA 2F56A 3FH1A 1N8R4 3K9MC 2GSPA 3GWRA 1BVIA 4R80A 3V99A 3WDGB 3EN8A 1CYUA 2INXA 1LQMB 1W01A 4L8OA 4O02B 5FW5A 2C11A 2RNTA 1OHOA 2ML5A 3F14A 4IIAA 1E3RA 1JZOA 1VZZA 1IVWA 1R4CA 2CFLA 4MMYB 1JN5B 1N5HA 1YI23 5I97A 3V98A 3JUOA 1GY5A 3M8CA 5DREA 1STDA 3K0ZA 1YJ93 1MNLA 3N9HA 3BLZA 1GY6A 1VQ63 3HK4A 1UCKA 3L0RA 4XBXA 4H61A 2IMJA 1YIT3 1M1K4 1IYYA 4HVNA 1BRSA 1RNBA 1VQP3 1B2SA 1W2ZA 1MGRA 1JB4A 7GSPA 1JN5A 1AR0A 4LMIA 3ROBA 2KF5A 5AIGA 1A67A 1NDOB 1WMNA 2F4YA 3LZAA 3FZWA 2IYJA 1VQ53 1BRHA 2SARA 2WOHA 3DGMA 4MEIA 4N6V0 3NX0A 1BSAA 2CWTA 1QAKA 1O7WB 1OGXA 1SQWA 1JNQA 1B2XA 1AVLA 5G2GA 1TUHA 1JBRA 2GEYA 2H0IA 5GSPA 4RNZA 1V58A 3MKIA 3NXJA 2UUGC 3V92A 2L1SA 1LOWA 1IVVA 2W03A 1BRGA 1GOVA 1F8NA 3MHEA 4KFDA 3BNBA 4HM1B 1TP6A 3FLJA 1DMNA 5AIHA 9RNTA 3SLUA 2QIYA 4HOHA 1LOVA 4WWUC 3VSYA 1N8QA 1X1UA 5IG4A 3G16A 1LOXA 1NWWA 2STDA 1O7HB 4EC6A 1K9M4 1BNGA 2E2VA 1GD4A 3HIGA 4U13A 1UCLA 1W6YA 3BU4A 2IA7A 3S5CA 2QEX3 1ROAA 1O7PB 1OPYA 3F9SA 3WA2X 1GY7A 3WOFB 2WGQA 3SX1A 3ZFZA 1UI8A 2Z6BA 1STFI 4HM6B 1PU4A 2HMOB 2GU3A 1W7CA 3PYJA 4HKVB 1SIIA 4BTXA 1QVF2 3BB9A 1WNHA 2C10A 1KQS2 1LNHA 1LOYA 2BMOB 3S28A 3WMDA 3Q2PA 1B27A 4N6LA 2OCTA 5IENA 1E3VA 1GMRA 2CKFB 4HBRA 4JF8A 1UUVB 3FG3A 2CH9A 3JVCA 3G6E3 4XDVA 1RLSA 2W04A 5LC6A 1BSDA 5JPPA 5IERA 1YGEA 4WYKB 3A5EA 3FCSB 2XFSA 3SVAA 4OVMA 3WA3A 3AHSA 1OCVA 3NBRA 3UB1A 2L4VA 4GL6A 3DXOA 1K41A 1Q824 2CHCA 2I9WA 3CC43 3X42A 1DE3A 1ZGXA 2UX0A 1W5ZA 4FR9A 1FGRA 4WYKA 1ASKA 3CNXA 1RGKA 1MWUA 3B4PA 3X41A 4OUQA 5KP1A 2K0MA 1GS3A 5AIIA 2XGNA 1JB5A 1FGQA 1I0VA 1T2HA 4HJLB 4LGQA 1DVDA 3CCM3 3WOEB 1RTUA 3DGLA 1BSEA 3RGAA 1K28A 3JUMA 1BSBA 2B24B 5EVHA 1DMQA 3GZBA 3NM2A 3CCS3 3U97A 1ROVA 1X1YA 2XSOB 3ZG0A 3FSDA 3J7Yd 1I3FA 3N8BA 1LNIA 2W0QA 2BT3A 3CNMA 4EW5A 1VQQA 1D6UA 3UJMA 3X40A 2XRXB 4GSPA 1BNSA 3EN1B 5EQLA 2O3OA 3MPHA 4MMZB 4N6TA 1RGCA 1S723 3ALAA 1V57A 4R4KA 4AEQA 3F7XA 4QWTA 1VQ73 3MYTA 4EBGA 2KF3A 3EF8A 1FW7A 3URPA 1EUIC 1IDPA 3G8ZA 4I4KA 3VGNA 3CD63 1UUGB 3F7SA 3I563 4RZMA 4CDLA 1Q40B 1IVUA 2KRTA 3FF0A 2RGQA 1KC84 2CW9A 2SBLA 3KSED 4EV5A 4NHFA 4R9LA 1HU9A 3OWUA 2A15A 1BOXA 1W00A 2O9UX 5IEOA 1YGWA 4BTYA 1A2PA 2CFWA 3ER7A 3NV0B 1JV2B 3JUNA 5D81A 1BIRA 1ISKA 4AKZA 3S27A 2H0GA 4J5KA 4N6OB 1FGOA 1NO3A 1Q40A 1TIJA 2JQ5A 1MWSA 2XGLA 2BIRA 3EC9A 3LOYA 2FGTA 5ELJA 3DGOA 1I0XA 1WMPA 2CFKA 4BU4A 2Z76A 2F5MA 3GAXA 2K54A 1KWIA 1UCIA 2QGUA 1OGZA 4DKIA 3NV0A 3K63A 3AGNA 1FUTA 2OQEC 1Q7Y4 5LC7A 1Q42A 3S29A 3PCSA 6STDA 1RN4A 3SYUA 1B2ZA 1GOUA 2XR8B 2UGIA 5KP3A 1KSIA 4XBTA 1IV9A 1TRQA 1AV4A 4BIRA 2WO0A 1U8CB 2W9PA 4NPBA 8RNTA 3JUQA 1G02A 1Q864 3CU3A 3PGBA 5ELUA 2PZVA 1LRAA 1DMMA 2YFJB 1CQSA 1E97A 3F8XA 4G1MB 2KF6A 1PYLA 2Y73A 4OK0A 5D83A 1EG9B 3KN4A 3LTCA 1B20A 4HM2B 4J9AA 4PEJA 2ZL8A 1ULJB 4J5GA 4MJDA 3RDEA 3OW22 1KD14 1B3SA 3DGNA 2IY2A 1PFPA 2HMLB 3LH4A 5HGRA 5IW9A 1RJOA 3BIRA 2R41A 2CC3A 1TFOA 3MG1A 1N9EA 1DVCA 3D3LA 5BXQA 1ZX2A 3E99A 2WGOA 1GMQA 3HOHA 1RGHA 3KSPA 2D1WA 2K3DA 2C4BA 4CCVA 1EA2A 1FGMA 2W2CA 1SPUA 1FGTA 2HOHA 4FCMA 3DUKA 4EYCA 1OF5B 4RNYA 1CEWI 1N9JA 3I553 1T5YA 4BTWA 1QVG2 3SOAA 2Q07A 1V74A 2GEXA 1JJ22 3RNTA 4GB5A 1VQO3 1MWRA 1JBSA 2B1XB 1Q7HA 1RMSA 2ML6A 2OOVC 1D6YA 3LTDA 1IVXA 4FCJA 1BRNL 4KZ1A 1IQ8A 1N5PA 1OHSA 3MSOA 3X3XA 2OWPA 1OF5A 1LQGC 1BU4A 3EB8A 4BL3A 1RSNA 4N6UA 3NBJA 1HZ1A 3DZLA 3TDGA 1D6ZA 1DYUA 3D79A 4I5QA 1GD3A 2WOFA 1US1A 3FKAA 2F86B 1NB5I 1A90A 3GRDA 1W2B2 2AADA 1T3BA 2CX0A 1PY3A 1RRHA 2ZHXB 1TFKA 3D4AA 3KCHA 5BU4A 2RCDA 1DETA 1OH0A 1QJGA 4AKYA 3ECFA 4LZIA 3PCRA 3HIIA 2KF4A 3N54B 4X2HA 5M18A 1QALA 1O7NB 2XEPA 4X2OA 2W6JH 4FMAA 4XB5A 1BUJA 3EE1A 4H3UA 4O2HA 2OTJ3 2CWVA 2XSHB 2P38A 1RGFA 4MMXB 2RBIA 4O8SA 1QAFA 4N6NB 2F99A 2W9QA 2IUKA 3KZTA 2Z77A 1IV7A 3AMOA 3OX9A 3CC73 5IG5A 1NJI4 1G0TA 1NNVA 3DY5A 5DRVA 2QA43 1FUSA 3G0KA 1FZUA 1BNJA 2P05A 4WFOA 5M1AA 4O3VA 2JDIH 1YJW3 1VQL3 2E2TA 4CJNA 7STDA 2CFDA 4KVHA 2BHMA 3GSPA 1AVKA 2AAEA 1K8A4 3O8YA 1RGGA 5CF2A 1RDSA 3AGOA 3CCU3 3BNEA 3GZXB 1FUWA 3K5TA 1ULIB 2D42A 2BMRB 3FG1A 1TU5A 1BAOA 1RCKA 1TJDA 1BNFA 3QK9A 4STDA 2HMMB 5AEUB 1R4YA 1IK3A 3B7CA 1HKXA 2BNGA 3JUPA 4WP5A 1IQYA 1RGAA 1VQM3 1A2VA 4WHAA 1BRKA 1W4NA 4HM7B 1UGIA 1L5GB 3QRDA 1IT7A 1JB2A 3RGRA 3EBTA 2OQEA 1AY7A 1IU7A 4FMDA 3FF2A 3BNCA 3PS8A 4K1VA 3K7CA 1C7HA 1Z1SA 2XH9A 3T0UA 1UUWB 3IPTA 2P0MA 3GZRA 3LT8A 3H3HA 3LTBA 4HM4B 3DMCA 1OACA 1I2EA 3FGYA 1RKYA 1B2MA 1SARA 4CPKA 2P09A 1LXEA 2CFGA 3CCR3 3WHOA 2ZA4A 1UI7A 2YFLB 5HOHA 1JKGB 1RN7A 3NM7A 3KFQC 4HM5B 5IG3A 5CK6A 5AYRB 2FXTA 2KCDA 3EJVA 3D9RA 1MWTA 3G4S3 3UL5A 1YNVX 3MG3A 1RNTA 4HYZA 1IQXA 3DM8A 3GZYB 3OWSA 4LSOA 5A0OB 3CPW2 1K734 1RGLA 3MG2A 4JRFA 4K90B 4FMCA 4BL2A 5RNTA 3T8NA 1W6GA 1W6CA 2CWUA 1M1XB 2V1LA 2W56B 1LVNA 1ZS7A 8CHOA 4R1KA 3ZG5A 4N3VA 1YVBI 1JKGA 2CIUA 1I8VA 4KFEA 6GSPA 2PNCA 1NB3I 2XF3A 4HZBB 3CCQ3 3X3YA 1WTHA 4KFFA 1RGEA 2HMNB 1SIHA 2RSXA 1UGHI 1FYSA 3IJEB 2LQVA 2MF7A 3NQYA 1B21A 3CME3 2W56A 1SJWA 1Q814 3HZPA 1I2FA 1M904 1I3IA 3OWYA 1BUQA 3HX8A 1I70A 3EQQB 4ILFA 5IEPA 2YX9A 3D5GA 1YVSA 3OV4A 3KE7A 5CXOA 1CYVA 1GYBA 5EEOA 1VQ83 6RNTA 1EQKA 1BRJA 1VQK3 1C54A 2OOVA 5AEWB 2Z7AA 7RNTA 2CX1A 2GBXB 3CCL3 1YHQ3 2GXFA 3B8LA 1JZDA 1MGWA 1TTOA 5IF6A 3AHWA 1RRLA 3LT9A 1BNRA 2GBWB 3IMAB 1BNIA 5G1LA 3CCJ3 3HI7A 3NQZA 3Q90A 1JBTA 3I0YA 1WMOA 3STDA 1UCJA 3DH2A 4FCZA 2BO9B 2CK3H 3CPOA 2M7OA 1X1WA 2CG1A 2H0HA 2RFRA 3LTAA 2BU4A 2F98A 2IUJA 4IPBA 2GU1A 1BSCA 3OXAA 3LYGA 1MOLA 3LXUX 4Q53A 1A2KA 3H51A 2BMQB 3WR2A 2OTL3 4HAAA 1IT8A 5D82A 3PXMA 3Q1CA 2E2UA 2F5WA 1B2UA 4LYLB 3BNDA 4TX4A 3X3ZA 4EV2A 5M19A 4IT7A 4N6MA 1J2BA 4L7KA 4RNTA 3CCV3 4J8TA 5G1KA 2CG0A 5JBSA 3G713 2HMKB 1VQN3 3CC23 3NBBA 3F40A 1BNEA 3FG4A 4XBYA 3EX9A 5AYSC 3AMOB 1O7MB 4RBNA 5CF1A 1I2GA 1FA3A 4GHOA 4FMBA 3D5IA 3NUVA 3LMLA 1WQLB 3S67A 1JRQA 2HMJB 4HM8B 5STDA 1GOYA 1O7GB 1G96A 5FGOA 2KXGA 2XFTA 5AIFA 3UL6A 3SOYA 1RHLA 1CH0A 3EBYA 1U5OA 5KP4A 4NREA 3WODG
chains in the Genus database with same CATH topology
3CXC2 1OUNA 3F8HA 2MC8A 5JPUA 4ZM8A 1YJN3 3CCE3 4ORLA 5TGNA 3T8UA 4HZ9B 1W02A 4HM0B 3EHCA 4R9KA 4EXRA 2ZDJA 3NHXA 3PZWA 2R4IA 3B4OA 5AI1A 4L8PA 3SXXA 1M9GA 1EKMA 1S5AA 3SEDA 1QMAA 2LYXA 3A76A 1ZO2A 1Y4KA 3CMA3 5IG0A 3UNLA 1YIJ3 3U1WA 4K1UA 4XDWA 3MWZA 3KIIA 2YFIB 4K61A 1VQ43 2P0XA 4LEHA 3KKGA 3VF1A 5BVBA 1VQ93 1UW1A 2Y74A 4XM4A 1OHPA 4HM3B 2FNQA 1NU3A 5CLKA 3FH1A 1N8R4 3K9MC 3GWRA 4R80A 3V99A 3WDGB 3EN8A 1CYUA 2INXA 1W01A 4L8OA 4O02B 5FW5A 2C11A 1OHOA 2ML5A 3F14A 4IIAA 1E3RA 1VZZA 1IVWA 1R4CA 2CFLA 4MMYB 1JN5B 1N5HA 1YI23 5I97A 3V98A 3JUOA 1GY5A 3M8CA 5DREA 1STDA 3K0ZA 1YJ93 1MNLA 3N9HA 3BLZA 1GY6A 1VQ63 3HK4A 3L0RA 4XBXA 4H61A 2IMJA 1YIT3 1M1K4 4HVNA 1VQP3 1W2ZA 1JB4A 1JN5A 1AR0A 4LMIA 3ROBA 1A67A 5AIGA 1NDOB 1WMNA 3LZAA 3FZWA 1VQ53 3DGMA 2WOHA 4MEIA 4N6V0 3NX0A 2CWTA 1QAKA 1O7WB 1OGXA 1SQWA 1JNQA 1AVLA 5G2GA 1TUHA 2GEYA 4RNZA 3MKIA 3NXJA 3V92A 1IVVA 2W03A 1F8NA 3MHEA 4KFDA 3BNBA 4HM1B 1TP6A 3FLJA 1DMNA 5AIHA 3SLUA 2QIYA 4WWUC 3VSYA 1N8QA 5IG4A 3G16A 1LOXA 1NWWA 2STDA 1O7HB 4EC6A 1K9M4 2E2VA 1GD4A 3HIGA 4U13A 1W6YA 3S5CA 2IA7A 2QEX3 1ROAA 1O7PB 1OPYA 3F9SA 3WA2X 1GY7A 3WOFB 2WGQA 3SX1A 1PU4A 2Z6BA 1UI8A 1STFI 4HM6B 2HMOB 2GU3A 1W7CA 3PYJA 4HKVB 1SIIA 4BTXA 1QVF2 3BB9A 1WNHA 2C10A 1KQS2 1LNHA 2BMOB 3S28A 3WMDA 3Q2PA 4N6LA 2OCTA 5IENA 1E3VA 2CKFB 4HBRA 4JF8A 1UUVB 3FG3A 2CH9A 3JVCA 3G6E3 4XDVA 2W04A 5LC6A 5JPPA 5IERA 1YGEA 4WYKB 3FCSB 3SVAA 2XFSA 3WA3A 4OVMA 1OCVA 3NBRA 3UB1A 2L4VA 4GL6A 3DXOA 1K41A 1Q824 2CHCA 2I9WA 3CC43 3X42A 2UX0A 1W5ZA 4FR9A 1FGRA 4WYKA 1ASKA 3CNXA 3B4PA 3X41A 4OUQA 5KP1A 2K0MA 1GS3A 5AIIA 2XGNA 1JB5A 1FGQA 4HJLB 4LGQA 1DVDA 3CCM3 3WOEB 3DGLA 3RGAA 1K28A 3JUMA 2B24B 5EVHA 1DMQA 3GZBA 3NM2A 3CCS3 3U97A 1ROVA 2XSOB 3FSDA 3J7Yd 3N8BA 2W0QA 2BT3A 3CNMA 3UJMA 1D6UA 3X40A 2XRXB 3EN1B 5EQLA 2O3OA 3MPHA 4MMZB 4N6TA 1S723 3ALAA 4R4KA 4AEQA 3F7XA 4QWTA 1VQ73 3MYTA 4EBGA 3EF8A 3G8ZA 1IDPA 4I4KA 3VGNA 3CD63 3F7SA 3I563 4RZMA 4CDLA 1Q40B 1IVUA 2KRTA 3FF0A 2RGQA 1KC84 2CW9A 2SBLA 3KSED 4EV5A 4NHFA 4R9LA 1HU9A 3OWUA 2A15A 1W00A 2O9UX 5IEOA 4BTYA 2CFWA 3ER7A 3NV0B 1JV2B 3JUNA 5D81A 1ISKA 4AKZA 3S27A 4N6OB 1FGOA 1NO3A 1Q40A 1TIJA 2JQ5A 2XGLA 3EC9A 3LOYA 2FGTA 5ELJA 3DGOA 1WMPA 2CFKA 2Z76A 3GAXA 2K54A 1KWIA 2QGUA 1OGZA 3NV0A 3K63A 2OQEC 1Q7Y4 5LC7A 1Q42A 3S29A 3PCSA 6STDA 2XR8B 5KP3A 1KSIA 4XBTA 1IV9A 1AV4A 2WO0A 1U8CB 2W9PA 3JUQA 1Q864 3CU3A 3PGBA 5ELUA 2PZVA 1DMMA 2YFJB 1CQSA 1E97A 3F8XA 4G1MB 2Y73A 4OK0A 5D83A 1EG9B 3KN4A 3LTCA 4HM2B 4J9AA 4PEJA 2ZL8A 1ULJB 4MJDA 3RDEA 3OW22 1KD14 3DGNA 1PFPA 2HMLB 3LH4A 5HGRA 5IW9A 1RJOA 2CC3A 1TFOA 3MG1A 1N9EA 1DVCA 3D3LA 5BXQA 1ZX2A 3E99A 2WGOA 3KSPA 2D1WA 4CCVA 1EA2A 1FGMA 2W2CA 1SPUA 1FGTA 4FCMA 3DUKA 4EYCA 1OF5B 4RNYA 1CEWI 1N9JA 3I553 1T5YA 4BTWA 1QVG2 3SOAA 2Q07A 1V74A 2GEXA 1JJ22 1VQO3 4GB5A 2B1XB 2OOVC 2ML6A 3LTDA 1D6YA 1IVXA 4FCJA 4KZ1A 1IQ8A 1N5PA 1OHSA 3MSOA 3X3XA 2OWPA 1OF5A 3EB8A 4N6UA 3NBJA 3DZLA 3TDGA 1D6ZA 1DYUA 1GD3A 2WOFA 1US1A 3FKAA 2F86B 1NB5I 1A90A 3GRDA 1W2B2 1RRHA 1TFKA 2RCDA 1OH0A 1QJGA 4AKYA 3ECFA 4LZIA 3PCRA 3HIIA 3N54B 4X2HA 1QALA 1O7NB 2XEPA 4X2OA 2W6JH 4FMAA 4XB5A 3EE1A 4H3UA 4O2HA 2OTJ3 2CWVA 2XSHB 2P38A 4MMXB 4O8SA 1QAFA 4N6NB 2F99A 2W9QA 2IUKA 3KZTA 2Z77A 1IV7A 3OX9A 3CC73 5IG5A 1NJI4 3DY5A 5DRVA 2QA43 3G0KA 2P05A 4WFOA 4O3VA 2JDIH 1YJW3 1VQL3 2E2TA 7STDA 2CFDA 4KVHA 2BHMA 1AVKA 1K8A4 3O8YA 5CF2A 3CCU3 3BNEA 3GZXB 1FUWA 3K5TA 1ULIB 2D42A 2BMRB 3FG1A 1TU5A 3QK9A 4STDA 2HMMB 5AEUB 1IK3A 3B7CA 1HKXA 2BNGA 1U5OA 3JUPA 1IQYA 4WP5A 1VQM3 1A2VA 4WHAA 1W4NA 4HM7B 1L5GB 3QRDA 1IT7A 1JB2A 3RGRA 3EBTA 2OQEA 1IU7A 4FMDA 3FF2A 3BNCA 3PS8A 4K1VA 3K7CA 1C7HA 1Z1SA 2XH9A 3T0UA 1UUWB 3IPTA 2P0MA 3GZRA 3LT8A 3H3HA 3LTBA 4HM4B 3DMCA 1OACA 3FGYA 1RKYA 2P09A 1LXEA 2CFGA 3CCR3 1UI7A 2YFLB 1JKGB 1RN7A 3NM7A 3KFQC 4HM5B 5IG3A 5CK6A 5AYRB 2FXTA 2KCDA 3EJVA 3D9RA 3G4S3 3UL5A 3MG3A 4HYZA 1IQXA 3DM8A 3GZYB 3OWSA 4LSOA 5A0OB 3CPW2 1K734 4JRFA 3MG2A 4K90B 4FMCA 3T8NA 1W6GA 1W6CA 2CWUA 1M1XB 2V1LA 2W56B 1LVNA 8CHOA 4R1KA 4N3VA 1YVBI 1JKGA 2CIUA 4KFEA 2PNCA 1NB3I 2XF3A 4HZBB 3CCQ3 3X3YA 1WTHA 4KFFA 2HMNB 1SIHA 2RSXA 3NQYA 3IJEB 2LQVA 2MF7A 3CME3 2W56A 1SJWA 1Q814 3HZPA 1M904 3OWYA 1BUQA 3HX8A 3EQQB 5IEPA 2YX9A 3OV4A 3KE7A 5CXOA 1CYVA 1GYBA 5EEOA 1VQ83 1EQKA 1VQK3 2OOVA 5AEWB 2Z7AA 1YHQ3 2GBXB 3CCL3 2GXFA 3B8LA 5IF6A 1RRLA 3LT9A 2GBWB 3IMAB 3CCJ3 3HI7A 3NQZA 3Q90A 3I0YA 1WMOA 3STDA 4FCZA 2BO9B 2CK3H 3CPOA 2M7OA 2CG1A 2RFRA 3LTAA 2F98A 2IUJA 4IPBA 2GU1A 3OXAA 3LYGA 1MOLA 3LXUX 4Q53A 1A2KA 3H51A 2BMQB 2OTL3 1IT8A 5D82A 3PXMA 3Q1CA 2E2UA 4TX4A 3X3ZA 4EV2A 3BNDA 1J2BA 4IT7A 4N6MA 4L7KA 3CCV3 4J8TA 1VQN3 2CG0A 5JBSA 3G713 2HMKB 3CC23 3NBBA 3F40A 3FG4A 4XBYA 3EX9A 5AYSC 3AMOB 1O7MB 4RBNA 5CF1A 1FA3A 4FMBA 3NUVA 3LMLA 1WQLB 3S67A 1JRQA 2HMJB 4HM8B 5STDA 1O7GB 1G96A 5FGOA 2KXGA 2XFTA 5AIFA 3UL6A 3SOYA 3EBYA 3AMOA 5KP4A 4NREA 3WODG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELU A;  3PS8 A;  3PYJ A;  4ZM8 A;  1WNH A;  3Q2P A;  4N6L A;  2OCT A;  1LXE A;  1RN7 A;  3KFQ C;  2CH9 A;  1PFP A;  3LH4 A;  5LC6 A;  1M9G A;  3SVA A;  3UL5 A;  1DVC A;  5A0O B;  4CCV A;  3MWZ A;  1YVB I;  4EYC A;  1CEW I;  1N9J A;  1NB3 I;  3K9M C;  1DVD A;  1N5P A;  1CYU A;  4N6U A;  1CYV A;  1R4C A;  1GD3 A;  1EQK A;  1N5H A;  1NB5 I;  1A90 A;  5EQL A;  1MNL A;  4N6T A;  3IMA B;  3L0R A;  4LZI A;  2BO9 B;  1A67 A;  3KSE D;  4N6N B;  4N6V 0;  2O9U X;  2W9Q A;  3NX0 A;  1IV7 A;  1MOL A;  3PXM A;  4N6O B;  4TX4 A;  1TIJ A;  4IT7 A;  4N6M A;  5ELJ A;  3GAX A;  1KWI A;  1FUW A;  5LC7 A;  1FA3 A;  3S67 A;  1GD4 A;  1G96 A;  1IV9 A;  2KXG A;  1ROA A;  3UL6 A;  2W9P A;  3QRD A;  1STF I; 
#chains in the Genus database with same CATH topology
 3CXC 2;  1OUN A;  3F8H A;  2MC8 A;  1AQZ A;  1T2I A;  5JPU A;  4ZM8 A;  1GMP A;  1YJN 3;  3CCE 3;  4ORL A;  5TGN A;  3T8U A;  4HZ9 B;  1W02 A;  4HM0 B;  1EEJ A;  1X1X A;  3EHC A;  4R9K A;  4EXR A;  2ZDJ A;  3NHX A;  3PZW A;  2R4I A;  3B4O A;  1TRP A;  1GSP A;  5AI1 A;  4L8P A;  3DGY A;  3SXX A;  1M9G A;  1RCL A;  1BAN A;  3Q3F A;  1EKM A;  1S5A A;  3SED A;  1QMA A;  2LYX A;  3A76 A;  1ZO2 A;  1Y4K A;  3CMA 3;  5IG0 A;  4KT3 B;  2KAA A;  3UNL A;  1YIJ 3;  3U1W A;  1BGS A;  1RN1 A;  4K1U A;  4XDW A;  3MWZ A;  3KII A;  2YFI B;  1UDI I;  4K61 A;  1VQ4 3;  2P0X A;  1HYF A;  2J8X B;  3KKG A;  4LEH A;  3VF1 A;  5BVB A;  1VQ9 3;  1UW1 A;  2Y74 A;  5BIR A;  4XM4 A;  1OHP A;  4HM3 B;  1Q9E A;  2FNQ A;  1BRI A;  1NU3 A;  5CLK A;  2F56 A;  3FH1 A;  1N8R 4;  3K9M C;  2GSP A;  3GWR A;  1BVI A;  4R80 A;  3V99 A;  3WDG B;  3EN8 A;  1CYU A;  2INX A;  1LQM B;  1W01 A;  4L8O A;  4O02 B;  5FW5 A;  2C11 A;  2RNT A;  1OHO A;  2ML5 A;  3F14 A;  4IIA A;  1E3R A;  1JZO A;  1VZZ A;  1IVW A;  1R4C A;  2CFL A;  4MMY B;  1JN5 B;  1N5H A;  1YI2 3;  5I97 A;  3V98 A;  3JUO A;  1GY5 A;  3M8C A;  5DRE A;  1STD A;  3K0Z A;  1YJ9 3;  1MNL A;  3N9H A;  3BLZ A;  1GY6 A;  1VQ6 3;  3HK4 A;  1UCK A;  3L0R A;  4XBX A;  4H61 A;  2IMJ A;  1YIT 3;  1M1K 4;  1IYY A;  4HVN A;  1BRS A;  1RNB A;  1VQP 3;  1B2S A;  1W2Z A;  1MGR A;  1JB4 A;  7GSP A;  1JN5 A;  1AR0 A;  4LMI A;  3ROB A;  2KF5 A;  5AIG A;  1A67 A;  1NDO B;  1WMN A;  2F4Y A;  3LZA A;  3FZW A;  2IYJ A;  1VQ5 3;  1BRH A;  2SAR A;  2WOH A;  3DGM A;  4MEI A;  4N6V 0;  3NX0 A;  1BSA A;  2CWT A;  1QAK A;  1O7W B;  1OGX A;  1SQW A;  1JNQ A;  1B2X A;  1AVL A;  5G2G A;  1TUH A;  1JBR A;  2GEY A;  2H0I A;  5GSP A;  4RNZ A;  1V58 A;  3MKI A;  3NXJ A;  2UUG C;  3V92 A;  2L1S A;  1LOW A;  1IVV A;  2W03 A;  1BRG A;  1GOV A;  1F8N A;  3MHE A;  4KFD A;  3BNB A;  4HM1 B;  1TP6 A;  3FLJ A;  1DMN A;  5AIH A;  9RNT A;  3SLU A;  2QIY A;  4HOH A;  1LOV A;  4WWU C;  3VSY A;  1N8Q A;  1X1U A;  5IG4 A;  3G16 A;  1LOX A;  1NWW A;  2STD A;  1O7H B;  4EC6 A;  1K9M 4;  1BNG A;  2E2V A;  1GD4 A;  3HIG A;  4U13 A;  1UCL A;  1W6Y A;  3BU4 A;  2IA7 A;  3S5C A;  2QEX 3;  1ROA A;  1O7P B;  1OPY A;  3F9S A;  3WA2 X;  1GY7 A;  3WOF B;  2WGQ A;  3SX1 A;  3ZFZ A;  1UI8 A;  2Z6B A;  1STF I;  4HM6 B;  1PU4 A;  2HMO B;  2GU3 A;  1W7C A;  3PYJ A;  4HKV B;  1SII A;  4BTX A;  1QVF 2;  3BB9 A;  1WNH A;  2C10 A;  1KQS 2;  1LNH A;  1LOY A;  2BMO B;  3S28 A;  3WMD A;  3Q2P A;  1B27 A;  4N6L A;  2OCT A;  5IEN A;  1E3V A;  1GMR A;  2CKF B;  4HBR A;  4JF8 A;  1UUV B;  3FG3 A;  2CH9 A;  3JVC A;  3G6E 3;  4XDV A;  1RLS A;  2W04 A;  5LC6 A;  1BSD A;  5JPP A;  5IER A;  1YGE A;  4WYK B;  3A5E A;  3FCS B;  2XFS A;  3SVA A;  4OVM A;  3WA3 A;  3AHS A;  1OCV A;  3NBR A;  3UB1 A;  2L4V A;  4GL6 A;  3DXO A;  1K41 A;  1Q82 4;  2CHC A;  2I9W A;  3CC4 3;  3X42 A;  1DE3 A;  1ZGX A;  2UX0 A;  1W5Z A;  4FR9 A;  1FGR A;  4WYK A;  1ASK A;  3CNX A;  1RGK A;  1MWU A;  3B4P A;  3X41 A;  4OUQ A;  5KP1 A;  2K0M A;  1GS3 A;  5AII A;  2XGN A;  1JB5 A;  1FGQ A;  1I0V A;  1T2H A;  4HJL B;  4LGQ A;  1DVD A;  3CCM 3;  3WOE B;  1RTU A;  3DGL A;  1BSE A;  3RGA A;  1K28 A;  3JUM A;  1BSB A;  2B24 B;  5EVH A;  1DMQ A;  3GZB A;  3NM2 A;  3CCS 3;  3U97 A;  1ROV A;  1X1Y A;  2XSO B;  3ZG0 A;  3FSD A;  3J7Y d;  1I3F A;  3N8B A;  1LNI A;  2W0Q A;  2BT3 A;  3CNM A;  4EW5 A;  1VQQ A;  1D6U A;  3UJM A;  3X40 A;  2XRX B;  4GSP A;  1BNS A;  3EN1 B;  5EQL A;  2O3O A;  3MPH A;  4MMZ B;  4N6T A;  1RGC A;  1S72 3;  3ALA A;  1V57 A;  4R4K A;  4AEQ A;  3F7X A;  4QWT A;  1VQ7 3;  3MYT A;  4EBG A;  2KF3 A;  3EF8 A;  1FW7 A;  3URP A;  1EUI C;  1IDP A;  3G8Z A;  4I4K A;  3VGN A;  3CD6 3;  1UUG B;  3F7S A;  3I56 3;  4RZM A;  4CDL A;  1Q40 B;  1IVU A;  2KRT A;  3FF0 A;  2RGQ A;  1KC8 4;  2CW9 A;  2SBL A;  3KSE D;  4EV5 A;  4NHF A;  4R9L A;  1HU9 A;  3OWU A;  2A15 A;  1BOX A;  1W00 A;  2O9U X;  5IEO A;  1YGW A;  4BTY A;  1A2P A;  2CFW A;  3ER7 A;  3NV0 B;  1JV2 B;  3JUN A;  5D81 A;  1BIR A;  1ISK A;  4AKZ A;  3S27 A;  2H0G A;  4J5K A;  4N6O B;  1FGO A;  1NO3 A;  1Q40 A;  1TIJ A;  2JQ5 A;  1MWS A;  2XGL A;  2BIR A;  3EC9 A;  3LOY A;  2FGT A;  5ELJ A;  3DGO A;  1I0X A;  1WMP A;  2CFK A;  4BU4 A;  2Z76 A;  2F5M A;  3GAX A;  2K54 A;  1KWI A;  1UCI A;  2QGU A;  1OGZ A;  4DKI A;  3NV0 A;  3K63 A;  3AGN A;  1FUT A;  2OQE C;  1Q7Y 4;  5LC7 A;  1Q42 A;  3S29 A;  3PCS A;  6STD A;  1RN4 A;  3SYU A;  1B2Z A;  1GOU A;  2XR8 B;  2UGI A;  5KP3 A;  1KSI A;  4XBT A;  1IV9 A;  1TRQ A;  1AV4 A;  4BIR A;  2WO0 A;  1U8C B;  2W9P A;  4NPB A;  8RNT A;  3JUQ A;  1G02 A;  1Q86 4;  3CU3 A;  3PGB A;  5ELU A;  2PZV A;  1LRA A;  1DMM A;  2YFJ B;  1CQS A;  1E97 A;  3F8X A;  4G1M B;  2KF6 A;  1PYL A;  2Y73 A;  4OK0 A;  5D83 A;  1EG9 B;  3KN4 A;  3LTC A;  1B20 A;  4HM2 B;  4J9A A;  4PEJ A;  2ZL8 A;  1ULJ B;  4J5G A;  4MJD A;  3RDE A;  3OW2 2;  1KD1 4;  1B3S A;  3DGN A;  2IY2 A;  1PFP A;  2HML B;  3LH4 A;  5HGR A;  5IW9 A;  1RJO A;  3BIR A;  2R41 A;  2CC3 A;  1TFO A;  3MG1 A;  1N9E A;  1DVC A;  3D3L A;  5BXQ A;  1ZX2 A;  3E99 A;  2WGO A;  1GMQ A;  3HOH A;  1RGH A;  3KSP A;  2D1W A;  2K3D A;  2C4B A;  4CCV A;  1EA2 A;  1FGM A;  2W2C A;  1SPU A;  1FGT A;  2HOH A;  4FCM A;  3DUK A;  4EYC A;  1OF5 B;  4RNY A;  1CEW I;  1N9J A;  3I55 3;  1T5Y A;  4BTW A;  1QVG 2;  3SOA A;  2Q07 A;  1V74 A;  2GEX A;  1JJ2 2;  3RNT A;  4GB5 A;  1VQO 3;  1MWR A;  1JBS A;  2B1X B;  1Q7H A;  1RMS A;  2ML6 A;  2OOV C;  1D6Y A;  3LTD A;  1IVX A;  4FCJ A;  1BRN L;  4KZ1 A;  1IQ8 A;  1N5P A;  1OHS A;  3MSO A;  3X3X A;  2OWP A;  1OF5 A;  1LQG C;  1BU4 A;  3EB8 A;  4BL3 A;  1RSN A;  4N6U A;  3NBJ A;  1HZ1 A;  3DZL A;  3TDG A;  1D6Z A;  1DYU A;  3D79 A;  4I5Q A;  1GD3 A;  2WOF A;  1US1 A;  3FKA A;  2F86 B;  1NB5 I;  1A90 A;  3GRD A;  1W2B 2;  2AAD A;  1T3B A;  2CX0 A;  1PY3 A;  1RRH A;  2ZHX B;  1TFK A;  3D4A A;  3KCH A;  5BU4 A;  2RCD A;  1DET A;  1OH0 A;  1QJG A;  4AKY A;  3ECF A;  4LZI A;  3PCR A;  3HII A;  2KF4 A;  3N54 B;  4X2H A;  5M18 A;  1QAL A;  1O7N B;  2XEP A;  4X2O A;  2W6J H;  4FMA A;  4XB5 A;  1BUJ A;  3EE1 A;  4H3U A;  4O2H A;  2OTJ 3;  2CWV A;  2XSH B;  2P38 A;  1RGF A;  4MMX B;  2RBI A;  4O8S A;  1QAF A;  4N6N B;  2F99 A;  2W9Q A;  2IUK A;  3KZT A;  2Z77 A;  1IV7 A;  3AMO A;  3OX9 A;  3CC7 3;  5IG5 A;  1NJI 4;  1G0T A;  1NNV A;  3DY5 A;  5DRV A;  2QA4 3;  1FUS A;  3G0K A;  1FZU A;  1BNJ A;  2P05 A;  4WFO A;  5M1A A;  4O3V A;  2JDI H;  1YJW 3;  1VQL 3;  2E2T A;  4CJN A;  7STD A;  2CFD A;  4KVH A;  2BHM A;  3GSP A;  1AVK A;  2AAE A;  1K8A 4;  3O8Y A;  1RGG A;  5CF2 A;  1RDS A;  3AGO A;  3CCU 3;  3BNE A;  3GZX B;  1FUW A;  3K5T A;  1ULI B;  2D42 A;  2BMR B;  3FG1 A;  1TU5 A;  1BAO A;  1RCK A;  1TJD A;  1BNF A;  3QK9 A;  4STD A;  2HMM B;  5AEU B;  1R4Y A;  1IK3 A;  3B7C A;  1HKX A;  2BNG A;  3JUP A;  4WP5 A;  1IQY A;  1RGA A;  1VQM 3;  1A2V A;  4WHA A;  1BRK A;  1W4N A;  4HM7 B;  1UGI A;  1L5G B;  3QRD A;  1IT7 A;  1JB2 A;  3RGR A;  3EBT A;  2OQE A;  1AY7 A;  1IU7 A;  4FMD A;  3FF2 A;  3BNC A;  3PS8 A;  4K1V A;  3K7C A;  1C7H A;  1Z1S A;  2XH9 A;  3T0U A;  1UUW B;  3IPT A;  2P0M A;  3GZR A;  3LT8 A;  3H3H A;  3LTB A;  4HM4 B;  3DMC A;  1OAC A;  1I2E A;  3FGY A;  1RKY A;  1B2M A;  1SAR A;  4CPK A;  2P09 A;  1LXE A;  2CFG A;  3CCR 3;  3WHO A;  2ZA4 A;  1UI7 A;  2YFL B;  5HOH A;  1JKG B;  1RN7 A;  3NM7 A;  3KFQ C;  4HM5 B;  5IG3 A;  5CK6 A;  5AYR B;  2FXT A;  2KCD A;  3EJV A;  3D9R A;  1MWT A;  3G4S 3;  3UL5 A;  1YNV X;  3MG3 A;  1RNT A;  4HYZ A;  1IQX A;  3DM8 A;  3GZY B;  3OWS A;  4LSO A;  5A0O B;  3CPW 2;  1K73 4;  1RGL A;  3MG2 A;  4JRF A;  4K90 B;  4FMC A;  4BL2 A;  5RNT A;  3T8N A;  1W6G A;  1W6C A;  2CWU A;  1M1X B;  2V1L A;  2W56 B;  1LVN A;  1ZS7 A;  8CHO A;  4R1K A;  3ZG5 A;  4N3V A;  1YVB I;  1JKG A;  2CIU A;  1I8V A;  4KFE A;  6GSP A;  2PNC A;  1NB3 I;  2XF3 A;  4HZB B;  3CCQ 3;  3X3Y A;  1WTH A;  4KFF A;  1RGE A;  2HMN B;  1SIH A;  2RSX A;  1UGH I;  1FYS A;  3IJE B;  2LQV A;  2MF7 A;  3NQY A;  1B21 A;  3CME 3;  2W56 A;  1SJW A;  1Q81 4;  3HZP A;  1I2F A;  1M90 4;  1I3I A;  3OWY A;  1BUQ A;  3HX8 A;  1I70 A;  3EQQ B;  4ILF A;  5IEP A;  2YX9 A;  3D5G A;  1YVS A;  3OV4 A;  3KE7 A;  5CXO A;  1CYV A;  1GYB A;  5EEO A;  1VQ8 3;  6RNT A;  1EQK A;  1BRJ A;  1VQK 3;  1C54 A;  2OOV A;  5AEW B;  2Z7A A;  7RNT A;  2CX1 A;  2GBX B;  3CCL 3;  1YHQ 3;  2GXF A;  3B8L A;  1JZD A;  1MGW A;  1TTO A;  5IF6 A;  3AHW A;  1RRL A;  3LT9 A;  1BNR A;  2GBW B;  3IMA B;  1BNI A;  5G1L A;  3CCJ 3;  3HI7 A;  3NQZ A;  3Q90 A;  1JBT A;  3I0Y A;  1WMO A;  3STD A;  1UCJ A;  3DH2 A;  4FCZ A;  2BO9 B;  2CK3 H;  3CPO A;  2M7O A;  1X1W A;  2CG1 A;  2H0H A;  2RFR A;  3LTA A;  2BU4 A;  2F98 A;  2IUJ A;  4IPB A;  2GU1 A;  1BSC A;  3OXA A;  3LYG A;  1MOL A;  3LXU X;  4Q53 A;  1A2K A;  3H51 A;  2BMQ B;  3WR2 A;  2OTL 3;  4HAA A;  1IT8 A;  5D82 A;  3PXM A;  3Q1C A;  2E2U A;  2F5W A;  1B2U A;  4LYL B;  3BND A;  4TX4 A;  3X3Z A;  4EV2 A;  5M19 A;  4IT7 A;  4N6M A;  1J2B A;  4L7K A;  4RNT A;  3CCV 3;  4J8T A;  5G1K A;  2CG0 A;  5JBS A;  3G71 3;  2HMK B;  1VQN 3;  3CC2 3;  3NBB A;  3F40 A;  1BNE A;  3FG4 A;  4XBY A;  3EX9 A;  5AYS C;  3AMO B;  1O7M B;  4RBN A;  5CF1 A;  1I2G A;  1FA3 A;  4GHO A;  4FMB A;  3D5I A;  3NUV A;  3LML A;  1WQL B;  3S67 A;  1JRQ A;  2HMJ B;  4HM8 B;  5STD A;  1GOY A;  1O7G B;  1G96 A;  5FGO A;  2KXG A;  2XFT A;  5AIF A;  3UL6 A;  3SOY A;  1RHL A;  1CH0 A;  3EBY A;  1U5O A;  5KP4 A;  4NRE A;  3WOD G; 
#chains in the Genus database with same CATH homology
 3CXC 2;  1OUN A;  3F8H A;  2MC8 A;  5JPU A;  4ZM8 A;  1YJN 3;  3CCE 3;  4ORL A;  5TGN A;  3T8U A;  4HZ9 B;  1W02 A;  4HM0 B;  3EHC A;  4R9K A;  4EXR A;  2ZDJ A;  3NHX A;  3PZW A;  2R4I A;  3B4O A;  5AI1 A;  4L8P A;  3SXX A;  1M9G A;  1EKM A;  1S5A A;  3SED A;  1QMA A;  2LYX A;  3A76 A;  1ZO2 A;  1Y4K A;  3CMA 3;  5IG0 A;  3UNL A;  1YIJ 3;  3U1W A;  4K1U A;  4XDW A;  3MWZ A;  3KII A;  2YFI B;  4K61 A;  1VQ4 3;  2P0X A;  4LEH A;  3KKG A;  3VF1 A;  5BVB A;  1VQ9 3;  1UW1 A;  2Y74 A;  4XM4 A;  1OHP A;  4HM3 B;  2FNQ A;  1NU3 A;  5CLK A;  3FH1 A;  1N8R 4;  3K9M C;  3GWR A;  4R80 A;  3V99 A;  3WDG B;  3EN8 A;  1CYU A;  2INX A;  1W01 A;  4L8O A;  4O02 B;  5FW5 A;  2C11 A;  1OHO A;  2ML5 A;  3F14 A;  4IIA A;  1E3R A;  1VZZ A;  1IVW A;  1R4C A;  2CFL A;  4MMY B;  1JN5 B;  1N5H A;  1YI2 3;  5I97 A;  3V98 A;  3JUO A;  1GY5 A;  3M8C A;  5DRE A;  1STD A;  3K0Z A;  1YJ9 3;  1MNL A;  3N9H A;  3BLZ A;  1GY6 A;  1VQ6 3;  3HK4 A;  3L0R A;  4XBX A;  4H61 A;  2IMJ A;  1YIT 3;  1M1K 4;  4HVN A;  1VQP 3;  1W2Z A;  1JB4 A;  1JN5 A;  1AR0 A;  4LMI A;  3ROB A;  1A67 A;  5AIG A;  1NDO B;  1WMN A;  3LZA A;  3FZW A;  1VQ5 3;  3DGM A;  2WOH A;  4MEI A;  4N6V 0;  3NX0 A;  2CWT A;  1QAK A;  1O7W B;  1OGX A;  1SQW A;  1JNQ A;  1AVL A;  5G2G A;  1TUH A;  2GEY A;  4RNZ A;  3MKI A;  3NXJ A;  3V92 A;  1IVV A;  2W03 A;  1F8N A;  3MHE A;  4KFD A;  3BNB A;  4HM1 B;  1TP6 A;  3FLJ A;  1DMN A;  5AIH A;  3SLU A;  2QIY A;  4WWU C;  3VSY A;  1N8Q A;  5IG4 A;  3G16 A;  1LOX A;  1NWW A;  2STD A;  1O7H B;  4EC6 A;  1K9M 4;  2E2V A;  1GD4 A;  3HIG A;  4U13 A;  1W6Y A;  3S5C A;  2IA7 A;  2QEX 3;  1ROA A;  1O7P B;  1OPY A;  3F9S A;  3WA2 X;  1GY7 A;  3WOF B;  2WGQ A;  3SX1 A;  1PU4 A;  2Z6B A;  1UI8 A;  1STF I;  4HM6 B;  2HMO B;  2GU3 A;  1W7C A;  3PYJ A;  4HKV B;  1SII A;  4BTX A;  1QVF 2;  3BB9 A;  1WNH A;  2C10 A;  1KQS 2;  1LNH A;  2BMO B;  3S28 A;  3WMD A;  3Q2P A;  4N6L A;  2OCT A;  5IEN A;  1E3V A;  2CKF B;  4HBR A;  4JF8 A;  1UUV B;  3FG3 A;  2CH9 A;  3JVC A;  3G6E 3;  4XDV A;  2W04 A;  5LC6 A;  5JPP A;  5IER A;  1YGE A;  4WYK B;  3FCS B;  3SVA A;  2XFS A;  3WA3 A;  4OVM A;  1OCV A;  3NBR A;  3UB1 A;  2L4V A;  4GL6 A;  3DXO A;  1K41 A;  1Q82 4;  2CHC A;  2I9W A;  3CC4 3;  3X42 A;  2UX0 A;  1W5Z A;  4FR9 A;  1FGR A;  4WYK A;  1ASK A;  3CNX A;  3B4P A;  3X41 A;  4OUQ A;  5KP1 A;  2K0M A;  1GS3 A;  5AII A;  2XGN A;  1JB5 A;  1FGQ A;  4HJL B;  4LGQ A;  1DVD A;  3CCM 3;  3WOE B;  3DGL A;  3RGA A;  1K28 A;  3JUM A;  2B24 B;  5EVH A;  1DMQ A;  3GZB A;  3NM2 A;  3CCS 3;  3U97 A;  1ROV A;  2XSO B;  3FSD A;  3J7Y d;  3N8B A;  2W0Q A;  2BT3 A;  3CNM A;  3UJM A;  1D6U A;  3X40 A;  2XRX B;  3EN1 B;  5EQL A;  2O3O A;  3MPH A;  4MMZ B;  4N6T A;  1S72 3;  3ALA A;  4R4K A;  4AEQ A;  3F7X A;  4QWT A;  1VQ7 3;  3MYT A;  4EBG A;  3EF8 A;  3G8Z A;  1IDP A;  4I4K A;  3VGN A;  3CD6 3;  3F7S A;  3I56 3;  4RZM A;  4CDL A;  1Q40 B;  1IVU A;  2KRT A;  3FF0 A;  2RGQ A;  1KC8 4;  2CW9 A;  2SBL A;  3KSE D;  4EV5 A;  4NHF A;  4R9L A;  1HU9 A;  3OWU A;  2A15 A;  1W00 A;  2O9U X;  5IEO A;  4BTY A;  2CFW A;  3ER7 A;  3NV0 B;  1JV2 B;  3JUN A;  5D81 A;  1ISK A;  4AKZ A;  3S27 A;  4N6O B;  1FGO A;  1NO3 A;  1Q40 A;  1TIJ A;  2JQ5 A;  2XGL A;  3EC9 A;  3LOY A;  2FGT A;  5ELJ A;  3DGO A;  1WMP A;  2CFK A;  2Z76 A;  3GAX A;  2K54 A;  1KWI A;  2QGU A;  1OGZ A;  3NV0 A;  3K63 A;  2OQE C;  1Q7Y 4;  5LC7 A;  1Q42 A;  3S29 A;  3PCS A;  6STD A;  2XR8 B;  5KP3 A;  1KSI A;  4XBT A;  1IV9 A;  1AV4 A;  2WO0 A;  1U8C B;  2W9P A;  3JUQ A;  1Q86 4;  3CU3 A;  3PGB A;  5ELU A;  2PZV A;  1DMM A;  2YFJ B;  1CQS A;  1E97 A;  3F8X A;  4G1M B;  2Y73 A;  4OK0 A;  5D83 A;  1EG9 B;  3KN4 A;  3LTC A;  4HM2 B;  4J9A A;  4PEJ A;  2ZL8 A;  1ULJ B;  4MJD A;  3RDE A;  3OW2 2;  1KD1 4;  3DGN A;  1PFP A;  2HML B;  3LH4 A;  5HGR A;  5IW9 A;  1RJO A;  2CC3 A;  1TFO A;  3MG1 A;  1N9E A;  1DVC A;  3D3L A;  5BXQ A;  1ZX2 A;  3E99 A;  2WGO A;  3KSP A;  2D1W A;  4CCV A;  1EA2 A;  1FGM A;  2W2C A;  1SPU A;  1FGT A;  4FCM A;  3DUK A;  4EYC A;  1OF5 B;  4RNY A;  1CEW I;  1N9J A;  3I55 3;  1T5Y A;  4BTW A;  1QVG 2;  3SOA A;  2Q07 A;  1V74 A;  2GEX A;  1JJ2 2;  1VQO 3;  4GB5 A;  2B1X B;  2OOV C;  2ML6 A;  3LTD A;  1D6Y A;  1IVX A;  4FCJ A;  4KZ1 A;  1IQ8 A;  1N5P A;  1OHS A;  3MSO A;  3X3X A;  2OWP A;  1OF5 A;  3EB8 A;  4N6U A;  3NBJ A;  3DZL A;  3TDG A;  1D6Z A;  1DYU A;  1GD3 A;  2WOF A;  1US1 A;  3FKA A;  2F86 B;  1NB5 I;  1A90 A;  3GRD A;  1W2B 2;  1RRH A;  1TFK A;  2RCD A;  1OH0 A;  1QJG A;  4AKY A;  3ECF A;  4LZI A;  3PCR A;  3HII A;  3N54 B;  4X2H A;  1QAL A;  1O7N B;  2XEP A;  4X2O A;  2W6J H;  4FMA A;  4XB5 A;  3EE1 A;  4H3U A;  4O2H A;  2OTJ 3;  2CWV A;  2XSH B;  2P38 A;  4MMX B;  4O8S A;  1QAF A;  4N6N B;  2F99 A;  2W9Q A;  2IUK A;  3KZT A;  2Z77 A;  1IV7 A;  3OX9 A;  3CC7 3;  5IG5 A;  1NJI 4;  3DY5 A;  5DRV A;  2QA4 3;  3G0K A;  2P05 A;  4WFO A;  4O3V A;  2JDI H;  1YJW 3;  1VQL 3;  2E2T A;  7STD A;  2CFD A;  4KVH A;  2BHM A;  1AVK A;  1K8A 4;  3O8Y A;  5CF2 A;  3CCU 3;  3BNE A;  3GZX B;  1FUW A;  3K5T A;  1ULI B;  2D42 A;  2BMR B;  3FG1 A;  1TU5 A;  3QK9 A;  4STD A;  2HMM B;  5AEU B;  1IK3 A;  3B7C A;  1HKX A;  2BNG A;  1U5O A;  3JUP A;  1IQY A;  4WP5 A;  1VQM 3;  1A2V A;  4WHA A;  1W4N A;  4HM7 B;  1L5G B;  3QRD A;  1IT7 A;  1JB2 A;  3RGR A;  3EBT A;  2OQE A;  1IU7 A;  4FMD A;  3FF2 A;  3BNC A;  3PS8 A;  4K1V A;  3K7C A;  1C7H A;  1Z1S A;  2XH9 A;  3T0U A;  1UUW B;  3IPT A;  2P0M A;  3GZR A;  3LT8 A;  3H3H A;  3LTB A;  4HM4 B;  3DMC A;  1OAC A;  3FGY A;  1RKY A;  2P09 A;  1LXE A;  2CFG A;  3CCR 3;  1UI7 A;  2YFL B;  1JKG B;  1RN7 A;  3NM7 A;  3KFQ C;  4HM5 B;  5IG3 A;  5CK6 A;  5AYR B;  2FXT A;  2KCD A;  3EJV A;  3D9R A;  3G4S 3;  3UL5 A;  3MG3 A;  4HYZ A;  1IQX A;  3DM8 A;  3GZY B;  3OWS A;  4LSO A;  5A0O B;  3CPW 2;  1K73 4;  4JRF A;  3MG2 A;  4K90 B;  4FMC A;  3T8N A;  1W6G A;  1W6C A;  2CWU A;  1M1X B;  2V1L A;  2W56 B;  1LVN A;  8CHO A;  4R1K A;  4N3V A;  1YVB I;  1JKG A;  2CIU A;  4KFE A;  2PNC A;  1NB3 I;  2XF3 A;  4HZB B;  3CCQ 3;  3X3Y A;  1WTH A;  4KFF A;  2HMN B;  1SIH A;  2RSX A;  3NQY A;  3IJE B;  2LQV A;  2MF7 A;  3CME 3;  2W56 A;  1SJW A;  1Q81 4;  3HZP A;  1M90 4;  3OWY A;  1BUQ A;  3HX8 A;  3EQQ B;  5IEP A;  2YX9 A;  3OV4 A;  3KE7 A;  5CXO A;  1CYV A;  1GYB A;  5EEO A;  1VQ8 3;  1EQK A;  1VQK 3;  2OOV A;  5AEW B;  2Z7A A;  1YHQ 3;  2GBX B;  3CCL 3;  2GXF A;  3B8L A;  5IF6 A;  1RRL A;  3LT9 A;  2GBW B;  3IMA B;  3CCJ 3;  3HI7 A;  3NQZ A;  3Q90 A;  3I0Y A;  1WMO A;  3STD A;  4FCZ A;  2BO9 B;  2CK3 H;  3CPO A;  2M7O A;  2CG1 A;  2RFR A;  3LTA A;  2F98 A;  2IUJ A;  4IPB A;  2GU1 A;  3OXA A;  3LYG A;  1MOL A;  3LXU X;  4Q53 A;  1A2K A;  3H51 A;  2BMQ B;  2OTL 3;  1IT8 A;  5D82 A;  3PXM A;  3Q1C A;  2E2U A;  4TX4 A;  3X3Z A;  4EV2 A;  3BND A;  1J2B A;  4IT7 A;  4N6M A;  4L7K A;  3CCV 3;  4J8T A;  1VQN 3;  2CG0 A;  5JBS A;  3G71 3;  2HMK B;  3CC2 3;  3NBB A;  3F40 A;  3FG4 A;  4XBY A;  3EX9 A;  5AYS C;  3AMO B;  1O7M B;  4RBN A;  5CF1 A;  1FA3 A;  4FMB A;  3NUV A;  3LML A;  1WQL B;  3S67 A;  1JRQ A;  2HMJ B;  4HM8 B;  5STD A;  1O7G B;  1G96 A;  5FGO A;  2KXG A;  2XFT A;  5AIF A;  3UL6 A;  3SOY A;  3EBY A;  3AMO A;  5KP4 A;  4NRE A;  3WOD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...