2BO9B

Human carboxypeptidase a4 in complex with human latexin.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE A4
total genus 64
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06907 Latexin Latexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B01
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B02
4TX4A 5A0OB 1PFPA 3GAXA 1STFI 3IMAB 1CYVA 1KWIA 1MOLA 1A67A 3LH4A 1LXEA 1GD3A 1MNLA 5ELUA 2W9PA 4N6LA 3SVAA 1NB5I 1DVDA 1CYUA 5LC6A 2OCTA 1N5PA 3KFQC 1G96A 2BO9B 4LZIA 3Q2PA 2KXGA 5LC7A 3S67A 1GD4A 1CEWI 3L0RA 4IT7A 1IV9A 5ELJA 3K9MC 1A90A 4ZM8A 3QRDA 4N6UA 2CH9A 5EQLA 1RN7A 3PXMA 4CCVA 4EYCA 1FA3A 1FUWA 1M9GA 1ROAA 3NX0A 3PYJA 1R4CA 1YVBI 3KSED 3MWZA 4N6OB 2O9UX 1N5HA 2W9QA 4N6V0 3UL6A 1NB3I 1IV7A 3PS8A 4N6MA 1TIJA 3UL5A 4N6NB 4N6TA 1EQKA 1N9JA 1WNHA 1DVCA
chains in the Genus database with same CATH superfamily
2GU1A 2IY2A 3B8LA 1NO3A 3CNMA 3KCHA 4I4KA 4CDLA 1B2SA 4HAAA 1BUJA 3BNDA 1ULIB 2SARA 4O8SA 1MWTA 1GY5A 1TFOA 3VGNA 5RNTA 1DVDA 2XF3A 3Q2PA 1B2UA 2M7OA 1U5OA 2Z76A 3MG1A 2FXTA 1GOYA 5CK6A 3CCE3 2GEXA 4EYCA 1Q7Y4 4L8PA 2I9WA 3K63A 1WMNA 3F7SA 5EVHA 2P0MA 3JUPA 5STDA 1YJ93 4R4KA 2JQ5A 1KC84 1MGWA 2W0QA 3NQYA 4N6MA 1DYUA 1OF5A 1IVUA 4O3VA 3MHEA 4WHAA 4XDWA 2FNQA 4QWTA 1V57A 2E2UA 1DMQA 1YJN3 1JBRA 1RRHA 3EC9A 4AKZA 1BANA 1QALA 2CC3A 2CK3H 2BIRA 2RBIA 3IJEB 3DMCA 1CYUA 1SQWA 3LTAA 3LZAA 3ZFZA 1VQM3 5IENA 1YIJ3 1W6GA 5G2GA 3X40A 1RRLA 2HMLB 3GZXB 5IERA 1BOXA 1M1XB 2P05A 4I5QA 2V1LA 1EUIC 1IK3A 2XEPA 5AEWB 2CFGA 4EV2A 2CWVA 3G0KA 1Q7HA 3H51A 2RFRA 3WA2X 2XFTA 1F8NA 1YI23 1IT7A 4JRFA 4EC6A 4HM1B 5CF2A 4MJDA 1NU3A 1DVCA 1IT8A 1BRJA 1TRPA 5A0OB 2F5MA 1S5AA 2KF5A 1RGLA 1SJWA 3OXAA 1BRNL 1TFKA 3MYTA 1IQ8A 1JN5A 3CPW2 1QAFA 1JBSA 1YJW3 1FUTA 1N5PA 1T5YA 2IMJA 5GSPA 3KZTA 2KXGA 3JUOA 1TU5A 1OHPA 1Q814 1LQGC 4XBXA 1Q824 1Z1SA 3HI7A 1RN7A 5AIHA 3ROBA 1FA3A 1M9GA 2C11A 2GBXB 4KFFA 1YNVX 3F40A 2CFKA 2QIYA 1YVBI 5KP1A 3T8UA 1C54A 1HYFA 2W9QA 2XFSA 3FG3A 3MG3A 3CD63 3CCV3 3LTBA 1IVWA 1W7CA 3BB9A 3AMOA 4N6NB 3UJMA 6GSPA 3A76A 1I0VA 1V74A 1ZGXA 1CQSA 3DGOA 4GSPA 1IQXA 4HJLB 2H0GA 4FMDA 1O7NB 4CPKA 4LMIA 1KQS2 2OQEA 1Y4KA 1FUSA 4WWUC 5ELJA 3HOHA 3SYUA 2CFLA 5IW9A 1NNVA 1MWSA 3WDGB 4HM0B 1FUWA 1JKGB 3FSDA 3KN4A 1W5ZA 3OX9A 3WOFB 3PS8A 1JB4A 3CPOA 3K0ZA 1TJDA 4N6TA 3T8NA 1BSDA 1S723 4HZ9B 3X3XA 3EX9A 4O02B 1GY7A 3F14A 1STFI 2OOVC 4HOHA 3U1WA 3MSOA 3CME3 5IG0A 1E97A 2AADA 3GSPA 3EHCA 1L5GB 1OACA 3EJVA 2XGLA 3B7CA 1QVF2 1C7HA 1OCVA 1UDII 4ILFA 5ELUA 3Q3FA 1UCLA 3HIIA 4KVHA 2H0HA 1UUVB 1X1YA 3H3HA 3KFQC 1JB5A 3I563 4XDVA 3X3YA 2QGUA 5D83A 3CCL3 3DZLA 1DETA 3EE1A 3LT9A 2HMKB 1BNJA 1LNHA 1BRGA 2ML6A 2ZDJA 1FYSA 1UGHI 3LOYA 2F98A 1SIIA 4R9KA 5BVBA 1N8QA 1W4NA 3KSPA 2E2TA 3EF8A 1NB3I 3A5EA 2F86B 1TIJA 1JV2B 4XBYA 3RNTA 2P0XA 5CF1A 1O7HB 1ZO2A 3JUNA 5FGOA 4HM3B 1JRQA 3TDGA 2KAAA 1T2IA 5AEUB 4LYLB 3BNEA 5EEOA 1OGXA 4NREA 3EN1B 3S67A 8CHOA 2W56A 2WOFA 3O8YA 5LC7A 1GD4A 1I0XA 1E3RA 2ML5A 1BSBA 1AVKA 1BRKA 3G6E3 1LVNA 1LOWA 3DXOA 1LNIA 1GOVA 1LQMB 2UGIA 1Q42A 3AMOB 4H61A 3S5CA 5BXQA 2F99A 3HIGA 3PYJA 3K7CA 2INXA 4N6V0 2L4VA 3CC43 3N54B 1I2EA 1U8CB 4GB5A 1RHLA 2PZVA 1V58A 1RNBA 3X3ZA 1BSAA 4X2OA 2YFJB 1B2ZA 1RGCA 1BGSA 3IMAB 1VQ83 1AV4A 2YFLB 3G16A 3WR2A 3X41A 1KWIA 1RSNA 2Z6BA 1VQQA 3SOAA 2RSXA 2BMRB 2Z77A 2HMNB 3G8ZA 3RDEA 4N6LA 1OUNA 3EN8A 1STDA 1HZ1A 1IQYA 1OGZA 1B27A 1AY7A 2XGNA 3GWRA 1A90A 1Q40A 3EQQB 3FGYA 4KFDA 2BNGA 1IU7A 3NM7A 1RCKA 1YVSA 4N6UA 1KD14 2K3DA 2R4IA 1Q40B 3HZPA 5AIGA 3SEDA 1BNSA 1SIHA 3CCR3 1TRQA 3STDA 6RNTA 1Q864 1N8R4 1ASKA 3MWZA 1VQ93 3NBJA 2GXFA 2KF4A 3GZRA 1OPYA 3LMLA 3JUQA 8RNTA 4RNTA 2C4BA 2KRTA 1AQZA 1CEWI 1VQO3 1K28A 1VQ73 3GAXA 3NQZA 1QJGA 2Y74A 1A67A 1BNEA 1K9M4 2W9PA 1TP6A 1I3IA 3BNCA 4EBGA 1ROVA 1MWUA 1BIRA 2Y73A 3FG1A 3NBBA 5TGNA 2E2VA 2UUGC 1NWWA 1UI7A 3G713 2CX1A 3KE7A 2SBLA 1GSPA 3PCRA 2BMQB 1OF5B 2W56B 3LXUX 5AI1A 2ZL8A 5M18A 4LEHA 1YHQ3 1T3BA 3EB8A 4N6OB 5AIIA 3DGNA 2O9UX 1B21A 2WO0A 2KF3A 7RNTA 2BMOB 1EQKA 4OUQA 4AKYA 4J5GA 1O7GB 1B2XA 1GYBA 5KP4A 5IG5A 5JPPA 5AYRB 4BTWA 1MOLA 1UCJA 2HMJB 3LYGA 3J7Yd 1B3SA 3SVAA 3N9HA 1B2MA 2OTL3 4HM6B 2BHMA 3OV4A 4HM5B 1O7PB 1DE3A 3KKGA 2CX0A 2BU4A 1SARA 4H3UA 1RGGA 4IT7A 3MPHA 1TUHA 2MC8A 4RNZA 2LQVA 2AAEA 1JBTA 1US1A 3LT8A 4K61A 5EQLA 2IUKA 4CCVA 4EXRA 3FF0A 4U13A 1E3VA 1I3FA 1VZZA 2XSOB 3OWYA 5D81A 4K1VA 1R4CA 5CXOA 3KSED 3UB1A 1W6YA 1VQK3 4WFOA 1RCLA 1RJOA 3OWSA 3D5GA 1RGAA 1GY6A 1LOXA 3S28A 1RN1A 4GHOA 4HM8B 1PFPA 2RNTA 4RZMA 1VQ53 1FW7A 5FW5A 2IYJA 4J9AA 3T0UA 2CW9A 1KSIA 1EEJA 3K5TA 4BIRA 1M904 1JN5B 2O3OA 2UX0A 5LC6A 1A2PA 1EKMA 2PNCA 7STDA 4XBTA 4ZM8A 4HM2B 2GEYA 3NM2A 3F7XA 4EW5A 2L1SA 1BRHA 4HM7B 2OOVA 3I0YA 3NX0A 5G1LA 2XRXB 4N3VA 3NV0A 1UCKA 3WOEB 4X2HA 3ZG5A 4MMZB 1PU4A 2YFIB 4MMXB 3FF2A 3UL5A 5M1AA 1FZUA 1WMOA 3Q90A 3CU3A 1QAKA 3EBTA 2GBWB 2R41A 1Q9EA 2W6JH 1W6CA 1QVG2 2CFDA 3AHWA 3NBRA 3LH4A 1T2HA 1MNLA 2CHCA 1A2KA 2CG0A 4HM4B 3NXJA 1I2FA 4L7KA 3I553 3HK4A 3DM8A 1UCIA 1PYLA 1G02A 1D6ZA 3K9MC 3QK9A 5IEOA 1YIT3 3PGBA 3CXC2 5AYSC 4FMAA 2D1WA 1N5HA 1FGRA 1JZOA 3SX1A 5I97A 3IPTA 4FR9A 3U97A 3FKAA 2W03A 1VQL3 2KF6A 5M19A 4WYKB 2MF7A 2BT3A 3AHSA 1TTOA 4AEQA 1K41A 1BNFA 1UW1A 3UNLA 1RN4A 2GU3A 6STDA 1LXEA 2HMMB 1FGOA 5DREA 5HOHA 2J8XB 2W04A 5DRVA 2LYXA 3CCU3 3FH1A 4LZIA 1VQ43 9RNTA 1UUWB 1GS3A 1IV9A 3AGOA 1K8A4 3F8HA 3CCJ3 3SOYA 2WGQA 3DUKA 3CCM3 4NPBA 3ER7A 1W2B2 1AVLA 4BTXA 1ROAA 3HX8A 1WMPA 3JUMA 2OWPA 1GMQA 4IPBA 1ZS7A 3DY5A 3E99A 2CFWA 1R4YA 2C10A 3D79A 1DMNA 1IDPA 3S27A 2CG1A 1X1UA 3GZBA 1BSEA 5IF6A 2IUJA 2KCDA 2CIUA 4WP5A 4RNYA 1UGIA 1M1K4 2STDA 1W00A 3ECFA 1ISKA 3BLZA 1NB5I 4XM4A 1G0TA 2OCTA 2BO9B 4PEJA 1JKGA 3NHXA 4L8OA 1JB2A 3X42A 1BAOA 2CWUA 2OQEC 3F8XA 3NUVA 4RBNA 1X1WA 4MMYB 1K734 2Z7AA 1LRAA 2HMOB 3F9SA 3QRDA 2QEX3 2CH9A 1I8VA 4R9LA 5HGRA 1O7WB 2HOHA 4FCJA 4HZBB 3V98A 4GL6A 1UI8A 1YGWA 3PCSA 2P38A 5IG3A 2K0MA 4K90B 3WA3A 5JPUA 1VQP3 4KZ1A 3UL6A 3EBYA 1IV7A 2QA43 1RGFA 3AGNA 1J2BA 1W01A 1B20A 1NJI4 2B1XB 2B24B 1BNGA 1I2GA 2WGOA 3Q1CA 1A2VA 2D42A 1HU9A 1GD3A 2W2CA 1BRIA 3NV0B 1RKYA 1MGRA 4G1MB 4OK0A 2FGTA 2XR8B 5KP3A 4XB5A 1RDSA 3ALAA 1FGTA 5D82A 4WYKA 1RMSA 1RLSA 3LTCA 4FCMA 4NHFA 1AR0A 3PXMA 4HVNA 4LSOA 1VQN3 3CCS3 1YGEA 2WOHA 3VF1A 1GMPA 1ULJB 4K1UA 4O2HA 1FGQA 1W2ZA 1IYYA 1SPUA 3OW22 1N9EA 3CNXA 1PY3A 1FGMA 4R1KA 1N9JA 1WTHA 7GSPA 1OH0A 3BNBA 3S29A 3VSYA 4TX4A 1IVXA 2RCDA 2OTJ3 4JF8A 4BU4A 4HBRA 1GMRA 3KIIA 3SLUA 3SXXA 1GOUA 1D6YA 3RGRA 3WODG 3N8BA 4BTYA 3MKIA 4CJNA 1OHSA 1OHOA 5G1KA 1O7MB 3FCSB 2RGQA 1BSCA 1ZX2A 2XSHB 1BU4A 1RGHA 3V92A 3DH2A 2A15A 4BL2A 1RNTA 1JZDA 1VQ63 3FZWA 5CLKA 1IVVA 3GRDA 3D4AA 4J5KA 4MEIA 5BIRA 4DKIA 5IEPA 3CC23 4R80A 2Q07A 4FMBA 1BRSA 2F5WA 1D6UA 3FG4A 3GZYB 4FMCA 2XH9A 2K54A 3BU4A 3WMDA 2YX9A 2JDIH 3DGLA 4KT3B 2ZA4A 4OVMA 4HYZA 5BU4A 1WQLB 3FLJA 1RGKA 2CKFB 3M8CA 3PZWA 1CYVA 4J8TA 4KFEA 2P09A 3BIRA 1BNRA 3D9RA 1JNQA 3OWUA 3URPA 1W02A 1NDOB 1LOYA 2CWTA 3JVCA 3LTDA 3B4PA 1G96A 1UUGB 1DMMA 2F56A 2GSPA 2F4YA 2IA7A 3L0RA 1X1XA 3WHOA 1EA2A 2ZHXB 3B4OA 3DGMA 4HKVB 4LGQA 5JBSA 4Q53A 1BVIA 3ZG0A 3CC73 2H0IA 1BUQA 3V99A 3G4S3 3CMA3 1EG9B 1RTUA 1HKXA 4FCZA 1CH0A 4STDA 1JJ22 3D3LA 3MG2A 3RGAA 1BNIA 4IIAA 4BL3A 1MWRA 3CCQ3 3D5IA 5AIFA 1LOVA 1RGEA 1QMAA 1WNHA 3DGYA 4ORLA 1I70A 4EV5A 5IG4A
chains in the Genus database with same CATH topology
2GU1A 3B8LA 3CNMA 1NO3A 4I4KA 4CDLA 3BNDA 1ULIB 4O8SA 1GY5A 1TFOA 3VGNA 1DVDA 2XF3A 3Q2PA 2M7OA 1U5OA 2Z76A 3MG1A 2FXTA 5CK6A 3CCE3 2GEXA 4EYCA 1Q7Y4 4L8PA 2I9WA 3K63A 1WMNA 3F7SA 5EVHA 2P0MA 3JUPA 5STDA 1YJ93 4R4KA 2JQ5A 1KC84 2W0QA 3NQYA 4N6MA 1DYUA 1OF5A 1IVUA 4O3VA 3MHEA 4WHAA 4XDWA 2FNQA 4QWTA 2E2UA 1DMQA 1YJN3 1RRHA 3EC9A 4AKZA 1QALA 2CC3A 2CK3H 3IJEB 3DMCA 1CYUA 1SQWA 3LTAA 3LZAA 1VQM3 5IENA 1YIJ3 1W6GA 5G2GA 3X40A 1RRLA 2HMLB 3GZXB 5IERA 1M1XB 2P05A 2V1LA 1IK3A 2XEPA 2CFGA 4EV2A 2CWVA 3G0KA 3H51A 2RFRA 3WA2X 2XFTA 1F8NA 1YI23 1IT7A 4JRFA 4EC6A 4HM1B 5CF2A 4MJDA 1NU3A 1DVCA 1IT8A 5A0OB 1S5AA 3OXAA 1SJWA 1TFKA 3MYTA 1IQ8A 1JN5A 3CPW2 1QAFA 1YJW3 1N5PA 1T5YA 2IMJA 3KZTA 2KXGA 3JUOA 1TU5A 1OHPA 1Q814 4XBXA 1Q824 1Z1SA 3HI7A 1RN7A 5AIHA 3ROBA 1FA3A 1M9GA 2C11A 2GBXB 4KFFA 3F40A 5KP1A 2CFKA 2QIYA 1YVBI 3T8UA 2W9QA 2XFSA 3FG3A 3MG3A 3CD63 3CCV3 3LTBA 1IVWA 1W7CA 3BB9A 3AMOA 4N6NB 3UJMA 3A76A 1V74A 1CQSA 3DGOA 1IQXA 4HJLB 4FMDA 1O7NB 1KQS2 4LMIA 2OQEA 1Y4KA 4WWUC 5ELJA 2CFLA 5IW9A 3WDGB 4HM0B 1FUWA 1JKGB 3FSDA 3KN4A 1W5ZA 3OX9A 3WOFB 3PS8A 1JB4A 3CPOA 3K0ZA 4N6TA 3T8NA 1S723 4HZ9B 3X3XA 3EX9A 4O02B 1GY7A 3F14A 1STFI 2OOVC 3U1WA 3CME3 3MSOA 5IG0A 1E97A 3EHCA 1L5GB 1OACA 3EJVA 2XGLA 3B7CA 1QVF2 1C7HA 1OCVA 5ELUA 4KVHA 3HIIA 1UUVB 3H3HA 3KFQC 1JB5A 3I563 4XDVA 3X3YA 2QGUA 5D83A 3CCL3 3DZLA 3EE1A 3LT9A 2HMKB 1LNHA 2ML6A 2ZDJA 3LOYA 5BVBA 2F98A 1SIIA 4R9KA 1N8QA 1W4NA 3KSPA 2E2TA 3EF8A 1NB3I 2F86B 1TIJA 1JV2B 4XBYA 2P0XA 5CF1A 1O7HB 1ZO2A 3JUNA 5FGOA 4HM3B 1JRQA 3TDGA 5AEUB 3BNEA 5EEOA 1OGXA 4NREA 3EN1B 3S67A 8CHOA 2W56A 2WOFA 3O8YA 5LC7A 1GD4A 1E3RA 2ML5A 1AVKA 3G6E3 1LVNA 3DXOA 3AMOB 5BXQA 1Q42A 4H61A 3S5CA 2F99A 3HIGA 3PYJA 3K7CA 2INXA 4N6V0 2L4VA 3CC43 3N54B 1U8CB 4GB5A 2PZVA 3X3ZA 4X2OA 2YFJB 1VQ83 3IMAB 1AV4A 2YFLB 3G16A 3X41A 1KWIA 2Z6BA 3SOAA 2RSXA 2BMRB 2Z77A 2HMNB 3G8ZA 3RDEA 4N6LA 1OUNA 3EN8A 1STDA 1IQYA 1OGZA 2XGNA 3GWRA 1A90A 1Q40A 3EQQB 3FGYA 4KFDA 2BNGA 1IU7A 3NM7A 1KD14 4N6UA 2R4IA 1Q40B 3HZPA 5AIGA 3SEDA 1SIHA 1N8R4 3CCR3 1Q864 3STDA 1ASKA 3MWZA 1VQ93 3NBJA 2GXFA 3GZRA 1OPYA 3LMLA 3JUQA 2KRTA 1CEWI 1VQO3 1K28A 1VQ73 3GAXA 3NQZA 1QJGA 2Y74A 1A67A 1K9M4 2W9PA 1TP6A 3BNCA 4EBGA 1ROVA 2Y73A 3FG1A 3NBBA 5TGNA 2E2VA 1NWWA 1UI7A 3G713 3KE7A 2SBLA 3PCRA 2BMQB 1OF5B 2W56B 3LXUX 5AI1A 2ZL8A 1YHQ3 4LEHA 3EB8A 4N6OB 5AIIA 3DGNA 2O9UX 2WO0A 2BMOB 1EQKA 4OUQA 4AKYA 1O7GB 5KP4A 1GYBA 5IG5A 5AYRB 4BTWA 1MOLA 2HMJB 3LYGA 3J7Yd 3SVAA 3N9HA 2OTL3 4HM6B 2BHMA 3OV4A 4HM5B 1O7PB 3KKGA 4H3UA 4IT7A 3MPHA 1TUHA 2MC8A 4RNZA 2LQVA 1US1A 3LT8A 4K61A 5EQLA 2IUKA 4CCVA 4EXRA 3FF0A 4U13A 1E3VA 1VZZA 2XSOB 3OWYA 5D81A 3UB1A 4K1VA 1R4CA 5CXOA 3KSED 1W6YA 1VQK3 4WFOA 1RJOA 3OWSA 1GY6A 1LOXA 3S28A 4RZMA 4HM8B 1PFPA 1VQ53 5FW5A 4J9AA 3T0UA 2CW9A 1KSIA 3K5TA 1M904 1JN5B 2O3OA 2UX0A 5LC6A 1EKMA 2PNCA 7STDA 4XBTA 4ZM8A 4HM2B 2GEYA 3NM2A 3F7XA 4HM7B 2OOVA 3I0YA 3NX0A 2XRXB 4N3VA 3NV0A 3WOEB 4X2HA 4MMZB 1PU4A 2YFIB 4MMXB 3FF2A 3UL5A 1WMOA 3Q90A 3CU3A 1QAKA 3EBTA 2GBWB 2W6JH 1W6CA 1QVG2 2CFDA 3NBRA 4HM4B 3LH4A 1MNLA 2CHCA 1A2KA 2CG0A 4L7KA 3NXJA 3I553 3HK4A 3DM8A 1D6ZA 3K9MC 3QK9A 5IEOA 1YIT3 3PGBA 3CXC2 5AYSC 4FMAA 2D1WA 1N5HA 1FGRA 3SX1A 5I97A 3IPTA 4FR9A 3U97A 3FKAA 2W03A 1VQL3 4WYKB 2MF7A 2BT3A 4AEQA 1K41A 1UW1A 3UNLA 2GU3A 6STDA 1LXEA 2HMMB 1FGOA 5DREA 2W04A 5DRVA 2LYXA 3CCU3 3FH1A 4LZIA 1VQ43 1UUWB 1GS3A 1IV9A 1K8A4 3F8HA 3CCJ3 3SOYA 2WGQA 3DUKA 3CCM3 3ER7A 1W2B2 1AVLA 4BTXA 1ROAA 3HX8A 1WMPA 3JUMA 2OWPA 4IPBA 3DY5A 3E99A 2CFWA 2C10A 3S27A 1DMNA 1IDPA 2CG1A 3GZBA 5IF6A 2IUJA 2KCDA 2CIUA 4WP5A 4RNYA 1M1K4 2STDA 1W00A 3ECFA 1ISKA 3BLZA 1NB5I 4XM4A 2OCTA 2BO9B 4PEJA 1JKGA 3NHXA 4L8OA 1JB2A 3X42A 2CWUA 2OQEC 3F8XA 3NUVA 4RBNA 1K734 4MMYB 2Z7AA 3F9SA 2HMOB 3QRDA 2QEX3 2CH9A 4R9LA 5HGRA 3V98A 1O7WB 4FCJA 4HZBB 5AEWB 5JPPA 4GL6A 1UI8A 3PCSA 5IG3A 2P38A 2K0MA 4K90B 3WA3A 5JPUA 1VQP3 4KZ1A 3UL6A 3EBYA 1IV7A 2QA43 1J2BA 1W01A 1NJI4 2B1XB 2B24B 2WGOA 3Q1CA 1A2VA 2D42A 1HU9A 1GD3A 2W2CA 3NV0B 1RKYA 4G1MB 4OK0A 2FGTA 2XR8B 5KP3A 4XB5A 3ALAA 1FGTA 5D82A 4WYKA 3LTCA 4FCMA 4NHFA 1AR0A 3PXMA 4HVNA 4LSOA 1VQN3 3CCS3 1YGEA 2WOHA 3VF1A 4K1UA 1ULJB 4O2HA 1FGQA 1W2ZA 1SPUA 3OW22 1N9EA 3CNXA 1FGMA 4R1KA 1N9JA 1WTHA 1OH0A 3BNBA 3S29A 3VSYA 4TX4A 1IVXA 2RCDA 2OTJ3 4JF8A 4HBRA 3KIIA 3SLUA 3SXXA 1D6YA 3RGRA 3WODG 3N8BA 4BTYA 3MKIA 1OHSA 1OHOA 1O7MB 3FCSB 2RGQA 1ZX2A 2XSHB 3V92A 2A15A 1VQ63 3FZWA 5CLKA 1IVVA 3GRDA 4MEIA 3CC23 5IEPA 4R80A 2Q07A 4FMBA 1D6UA 3FG4A 3GZYB 4FMCA 2XH9A 2K54A 3WMDA 2YX9A 2JDIH 3DGLA 4OVMA 4HYZA 1WQLB 3FLJA 3M8CA 2CKFB 3PZWA 4KFEA 1CYVA 4J8TA 2P09A 3D9RA 1JNQA 3OWUA 1W02A 1NDOB 2CWTA 3JVCA 3LTDA 3B4PA 1G96A 1DMMA 3L0RA 2IA7A 1EA2A 3B4OA 3DGMA 4HKVB 4LGQA 5JBSA 4Q53A 3CC73 1BUQA 3V99A 3G4S3 3CMA3 1EG9B 1JJ22 1HKXA 4FCZA 4STDA 3D3LA 3MG2A 3RGAA 4IIAA 3CCQ3 5AIFA 4ORLA 4EV5A 1QMAA 1WNHA 5IG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  5A0O B;  1PFP A;  3GAX A;  1STF I;  3IMA B;  1CYV A;  1KWI A;  1MOL A;  1A67 A;  3LH4 A;  1LXE A;  1GD3 A;  1MNL A;  5ELU A;  2W9P A;  4N6L A;  3SVA A;  1NB5 I;  1DVD A;  1CYU A;  5LC6 A;  2OCT A;  1N5P A;  3KFQ C;  1G96 A;  2BO9 B;  4LZI A;  3Q2P A;  2KXG A;  5LC7 A;  3S67 A;  1GD4 A;  1CEW I;  3L0R A;  4IT7 A;  1IV9 A;  5ELJ A;  3K9M C;  1A90 A;  4ZM8 A;  3QRD A;  4N6U A;  2CH9 A;  5EQL A;  1RN7 A;  3PXM A;  4CCV A;  4EYC A;  1FA3 A;  1FUW A;  1M9G A;  1ROA A;  3NX0 A;  3PYJ A;  1R4C A;  1YVB I;  3KSE D;  3MWZ A;  4N6O B;  2O9U X;  1N5H A;  2W9Q A;  4N6V 0;  3UL6 A;  1NB3 I;  1IV7 A;  3PS8 A;  4N6M A;  1TIJ A;  3UL5 A;  4N6N B;  4N6T A;  1EQK A;  1N9J A;  1WNH A;  1DVC A; 
#chains in the Genus database with same CATH topology
 2GU1 A;  2IY2 A;  3B8L A;  1NO3 A;  3CNM A;  3KCH A;  4I4K A;  4CDL A;  1B2S A;  4HAA A;  1BUJ A;  3BND A;  1ULI B;  2SAR A;  4O8S A;  1MWT A;  1GY5 A;  1TFO A;  3VGN A;  5RNT A;  1DVD A;  2XF3 A;  3Q2P A;  1B2U A;  2M7O A;  1U5O A;  2Z76 A;  3MG1 A;  2FXT A;  1GOY A;  5CK6 A;  3CCE 3;  2GEX A;  4EYC A;  1Q7Y 4;  4L8P A;  2I9W A;  3K63 A;  1WMN A;  3F7S A;  5EVH A;  2P0M A;  3JUP A;  5STD A;  1YJ9 3;  4R4K A;  2JQ5 A;  1KC8 4;  1MGW A;  2W0Q A;  3NQY A;  4N6M A;  1DYU A;  1OF5 A;  1IVU A;  4O3V A;  3MHE A;  4WHA A;  4XDW A;  2FNQ A;  4QWT A;  1V57 A;  2E2U A;  1DMQ A;  1YJN 3;  1JBR A;  1RRH A;  3EC9 A;  4AKZ A;  1BAN A;  1QAL A;  2CC3 A;  2CK3 H;  2BIR A;  2RBI A;  3IJE B;  3DMC A;  1CYU A;  1SQW A;  3LTA A;  3LZA A;  3ZFZ A;  1VQM 3;  5IEN A;  1YIJ 3;  1W6G A;  5G2G A;  3X40 A;  1RRL A;  2HML B;  3GZX B;  5IER A;  1BOX A;  1M1X B;  2P05 A;  4I5Q A;  2V1L A;  1EUI C;  1IK3 A;  2XEP A;  5AEW B;  2CFG A;  4EV2 A;  2CWV A;  3G0K A;  1Q7H A;  3H51 A;  2RFR A;  3WA2 X;  2XFT A;  1F8N A;  1YI2 3;  1IT7 A;  4JRF A;  4EC6 A;  4HM1 B;  5CF2 A;  4MJD A;  1NU3 A;  1DVC A;  1IT8 A;  1BRJ A;  1TRP A;  5A0O B;  2F5M A;  1S5A A;  2KF5 A;  1RGL A;  1SJW A;  3OXA A;  1BRN L;  1TFK A;  3MYT A;  1IQ8 A;  1JN5 A;  3CPW 2;  1QAF A;  1JBS A;  1YJW 3;  1FUT A;  1N5P A;  1T5Y A;  2IMJ A;  5GSP A;  3KZT A;  2KXG A;  3JUO A;  1TU5 A;  1OHP A;  1Q81 4;  1LQG C;  4XBX A;  1Q82 4;  1Z1S A;  3HI7 A;  1RN7 A;  5AIH A;  3ROB A;  1FA3 A;  1M9G A;  2C11 A;  2GBX B;  4KFF A;  1YNV X;  3F40 A;  2CFK A;  2QIY A;  1YVB I;  5KP1 A;  3T8U A;  1C54 A;  1HYF A;  2W9Q A;  2XFS A;  3FG3 A;  3MG3 A;  3CD6 3;  3CCV 3;  3LTB A;  1IVW A;  1W7C A;  3BB9 A;  3AMO A;  4N6N B;  3UJM A;  6GSP A;  3A76 A;  1I0V A;  1V74 A;  1ZGX A;  1CQS A;  3DGO A;  4GSP A;  1IQX A;  4HJL B;  2H0G A;  4FMD A;  1O7N B;  4CPK A;  4LMI A;  1KQS 2;  2OQE A;  1Y4K A;  1FUS A;  4WWU C;  5ELJ A;  3HOH A;  3SYU A;  2CFL A;  5IW9 A;  1NNV A;  1MWS A;  3WDG B;  4HM0 B;  1FUW A;  1JKG B;  3FSD A;  3KN4 A;  1W5Z A;  3OX9 A;  3WOF B;  3PS8 A;  1JB4 A;  3CPO A;  3K0Z A;  1TJD A;  4N6T A;  3T8N A;  1BSD A;  1S72 3;  4HZ9 B;  3X3X A;  3EX9 A;  4O02 B;  1GY7 A;  3F14 A;  1STF I;  2OOV C;  4HOH A;  3U1W A;  3MSO A;  3CME 3;  5IG0 A;  1E97 A;  2AAD A;  3GSP A;  3EHC A;  1L5G B;  1OAC A;  3EJV A;  2XGL A;  3B7C A;  1QVF 2;  1C7H A;  1OCV A;  1UDI I;  4ILF A;  5ELU A;  3Q3F A;  1UCL A;  3HII A;  4KVH A;  2H0H A;  1UUV B;  1X1Y A;  3H3H A;  3KFQ C;  1JB5 A;  3I56 3;  4XDV A;  3X3Y A;  2QGU A;  5D83 A;  3CCL 3;  3DZL A;  1DET A;  3EE1 A;  3LT9 A;  2HMK B;  1BNJ A;  1LNH A;  1BRG A;  2ML6 A;  2ZDJ A;  1FYS A;  1UGH I;  3LOY A;  2F98 A;  1SII A;  4R9K A;  5BVB A;  1N8Q A;  1W4N A;  3KSP A;  2E2T A;  3EF8 A;  1NB3 I;  3A5E A;  2F86 B;  1TIJ A;  1JV2 B;  4XBY A;  3RNT A;  2P0X A;  5CF1 A;  1O7H B;  1ZO2 A;  3JUN A;  5FGO A;  4HM3 B;  1JRQ A;  3TDG A;  2KAA A;  1T2I A;  5AEU B;  4LYL B;  3BNE A;  5EEO A;  1OGX A;  4NRE A;  3EN1 B;  3S67 A;  8CHO A;  2W56 A;  2WOF A;  3O8Y A;  5LC7 A;  1GD4 A;  1I0X A;  1E3R A;  2ML5 A;  1BSB A;  1AVK A;  1BRK A;  3G6E 3;  1LVN A;  1LOW A;  3DXO A;  1LNI A;  1GOV A;  1LQM B;  2UGI A;  1Q42 A;  3AMO B;  4H61 A;  3S5C A;  5BXQ A;  2F99 A;  3HIG A;  3PYJ A;  3K7C A;  2INX A;  4N6V 0;  2L4V A;  3CC4 3;  3N54 B;  1I2E A;  1U8C B;  4GB5 A;  1RHL A;  2PZV A;  1V58 A;  1RNB A;  3X3Z A;  1BSA A;  4X2O A;  2YFJ B;  1B2Z A;  1RGC A;  1BGS A;  3IMA B;  1VQ8 3;  1AV4 A;  2YFL B;  3G16 A;  3WR2 A;  3X41 A;  1KWI A;  1RSN A;  2Z6B A;  1VQQ A;  3SOA A;  2RSX A;  2BMR B;  2Z77 A;  2HMN B;  3G8Z A;  3RDE A;  4N6L A;  1OUN A;  3EN8 A;  1STD A;  1HZ1 A;  1IQY A;  1OGZ A;  1B27 A;  1AY7 A;  2XGN A;  3GWR A;  1A90 A;  1Q40 A;  3EQQ B;  3FGY A;  4KFD A;  2BNG A;  1IU7 A;  3NM7 A;  1RCK A;  1YVS A;  4N6U A;  1KD1 4;  2K3D A;  2R4I A;  1Q40 B;  3HZP A;  5AIG A;  3SED A;  1BNS A;  1SIH A;  3CCR 3;  1TRQ A;  3STD A;  6RNT A;  1Q86 4;  1N8R 4;  1ASK A;  3MWZ A;  1VQ9 3;  3NBJ A;  2GXF A;  2KF4 A;  3GZR A;  1OPY A;  3LML A;  3JUQ A;  8RNT A;  4RNT A;  2C4B A;  2KRT A;  1AQZ A;  1CEW I;  1VQO 3;  1K28 A;  1VQ7 3;  3GAX A;  3NQZ A;  1QJG A;  2Y74 A;  1A67 A;  1BNE A;  1K9M 4;  2W9P A;  1TP6 A;  1I3I A;  3BNC A;  4EBG A;  1ROV A;  1MWU A;  1BIR A;  2Y73 A;  3FG1 A;  3NBB A;  5TGN A;  2E2V A;  2UUG C;  1NWW A;  1UI7 A;  3G71 3;  2CX1 A;  3KE7 A;  2SBL A;  1GSP A;  3PCR A;  2BMQ B;  1OF5 B;  2W56 B;  3LXU X;  5AI1 A;  2ZL8 A;  5M18 A;  4LEH A;  1YHQ 3;  1T3B A;  3EB8 A;  4N6O B;  5AII A;  3DGN A;  2O9U X;  1B21 A;  2WO0 A;  2KF3 A;  7RNT A;  2BMO B;  1EQK A;  4OUQ A;  4AKY A;  4J5G A;  1O7G B;  1B2X A;  1GYB A;  5KP4 A;  5IG5 A;  5JPP A;  5AYR B;  4BTW A;  1MOL A;  1UCJ A;  2HMJ B;  3LYG A;  3J7Y d;  1B3S A;  3SVA A;  3N9H A;  1B2M A;  2OTL 3;  4HM6 B;  2BHM A;  3OV4 A;  4HM5 B;  1O7P B;  1DE3 A;  3KKG A;  2CX0 A;  2BU4 A;  1SAR A;  4H3U A;  1RGG A;  4IT7 A;  3MPH A;  1TUH A;  2MC8 A;  4RNZ A;  2LQV A;  2AAE A;  1JBT A;  1US1 A;  3LT8 A;  4K61 A;  5EQL A;  2IUK A;  4CCV A;  4EXR A;  3FF0 A;  4U13 A;  1E3V A;  1I3F A;  1VZZ A;  2XSO B;  3OWY A;  5D81 A;  4K1V A;  1R4C A;  5CXO A;  3KSE D;  3UB1 A;  1W6Y A;  1VQK 3;  4WFO A;  1RCL A;  1RJO A;  3OWS A;  3D5G A;  1RGA A;  1GY6 A;  1LOX A;  3S28 A;  1RN1 A;  4GHO A;  4HM8 B;  1PFP A;  2RNT A;  4RZM A;  1VQ5 3;  1FW7 A;  5FW5 A;  2IYJ A;  4J9A A;  3T0U A;  2CW9 A;  1KSI A;  1EEJ A;  3K5T A;  4BIR A;  1M90 4;  1JN5 B;  2O3O A;  2UX0 A;  5LC6 A;  1A2P A;  1EKM A;  2PNC A;  7STD A;  4XBT A;  4ZM8 A;  4HM2 B;  2GEY A;  3NM2 A;  3F7X A;  4EW5 A;  2L1S A;  1BRH A;  4HM7 B;  2OOV A;  3I0Y A;  3NX0 A;  5G1L A;  2XRX B;  4N3V A;  3NV0 A;  1UCK A;  3WOE B;  4X2H A;  3ZG5 A;  4MMZ B;  1PU4 A;  2YFI B;  4MMX B;  3FF2 A;  3UL5 A;  5M1A A;  1FZU A;  1WMO A;  3Q90 A;  3CU3 A;  1QAK A;  3EBT A;  2GBW B;  2R41 A;  1Q9E A;  2W6J H;  1W6C A;  1QVG 2;  2CFD A;  3AHW A;  3NBR A;  3LH4 A;  1T2H A;  1MNL A;  2CHC A;  1A2K A;  2CG0 A;  4HM4 B;  3NXJ A;  1I2F A;  4L7K A;  3I55 3;  3HK4 A;  3DM8 A;  1UCI A;  1PYL A;  1G02 A;  1D6Z A;  3K9M C;  3QK9 A;  5IEO A;  1YIT 3;  3PGB A;  3CXC 2;  5AYS C;  4FMA A;  2D1W A;  1N5H A;  1FGR A;  1JZO A;  3SX1 A;  5I97 A;  3IPT A;  4FR9 A;  3U97 A;  3FKA A;  2W03 A;  1VQL 3;  2KF6 A;  5M19 A;  4WYK B;  2MF7 A;  2BT3 A;  3AHS A;  1TTO A;  4AEQ A;  1K41 A;  1BNF A;  1UW1 A;  3UNL A;  1RN4 A;  2GU3 A;  6STD A;  1LXE A;  2HMM B;  1FGO A;  5DRE A;  5HOH A;  2J8X B;  2W04 A;  5DRV A;  2LYX A;  3CCU 3;  3FH1 A;  4LZI A;  1VQ4 3;  9RNT A;  1UUW B;  1GS3 A;  1IV9 A;  3AGO A;  1K8A 4;  3F8H A;  3CCJ 3;  3SOY A;  2WGQ A;  3DUK A;  3CCM 3;  4NPB A;  3ER7 A;  1W2B 2;  1AVL A;  4BTX A;  1ROA A;  3HX8 A;  1WMP A;  3JUM A;  2OWP A;  1GMQ A;  4IPB A;  1ZS7 A;  3DY5 A;  3E99 A;  2CFW A;  1R4Y A;  2C10 A;  3D79 A;  1DMN A;  1IDP A;  3S27 A;  2CG1 A;  1X1U A;  3GZB A;  1BSE A;  5IF6 A;  2IUJ A;  2KCD A;  2CIU A;  4WP5 A;  4RNY A;  1UGI A;  1M1K 4;  2STD A;  1W00 A;  3ECF A;  1ISK A;  3BLZ A;  1NB5 I;  4XM4 A;  1G0T A;  2OCT A;  2BO9 B;  4PEJ A;  1JKG A;  3NHX A;  4L8O A;  1JB2 A;  3X42 A;  1BAO A;  2CWU A;  2OQE C;  3F8X A;  3NUV A;  4RBN A;  1X1W A;  4MMY B;  1K73 4;  2Z7A A;  1LRA A;  2HMO B;  3F9S A;  3QRD A;  2QEX 3;  2CH9 A;  1I8V A;  4R9L A;  5HGR A;  1O7W B;  2HOH A;  4FCJ A;  4HZB B;  3V98 A;  4GL6 A;  1UI8 A;  1YGW A;  3PCS A;  2P38 A;  5IG3 A;  2K0M A;  4K90 B;  3WA3 A;  5JPU A;  1VQP 3;  4KZ1 A;  3UL6 A;  3EBY A;  1IV7 A;  2QA4 3;  1RGF A;  3AGN A;  1J2B A;  1W01 A;  1B20 A;  1NJI 4;  2B1X B;  2B24 B;  1BNG A;  1I2G A;  2WGO A;  3Q1C A;  1A2V A;  2D42 A;  1HU9 A;  1GD3 A;  2W2C A;  1BRI A;  3NV0 B;  1RKY A;  1MGR A;  4G1M B;  4OK0 A;  2FGT A;  2XR8 B;  5KP3 A;  4XB5 A;  1RDS A;  3ALA A;  1FGT A;  5D82 A;  4WYK A;  1RMS A;  1RLS A;  3LTC A;  4FCM A;  4NHF A;  1AR0 A;  3PXM A;  4HVN A;  4LSO A;  1VQN 3;  3CCS 3;  1YGE A;  2WOH A;  3VF1 A;  1GMP A;  1ULJ B;  4K1U A;  4O2H A;  1FGQ A;  1W2Z A;  1IYY A;  1SPU A;  3OW2 2;  1N9E A;  3CNX A;  1PY3 A;  1FGM A;  4R1K A;  1N9J A;  1WTH A;  7GSP A;  1OH0 A;  3BNB A;  3S29 A;  3VSY A;  4TX4 A;  1IVX A;  2RCD A;  2OTJ 3;  4JF8 A;  4BU4 A;  4HBR A;  1GMR A;  3KII A;  3SLU A;  3SXX A;  1GOU A;  1D6Y A;  3RGR A;  3WOD G;  3N8B A;  4BTY A;  3MKI A;  4CJN A;  1OHS A;  1OHO A;  5G1K A;  1O7M B;  3FCS B;  2RGQ A;  1BSC A;  1ZX2 A;  2XSH B;  1BU4 A;  1RGH A;  3V92 A;  3DH2 A;  2A15 A;  4BL2 A;  1RNT A;  1JZD A;  1VQ6 3;  3FZW A;  5CLK A;  1IVV A;  3GRD A;  3D4A A;  4J5K A;  4MEI A;  5BIR A;  4DKI A;  5IEP A;  3CC2 3;  4R80 A;  2Q07 A;  4FMB A;  1BRS A;  2F5W A;  1D6U A;  3FG4 A;  3GZY B;  4FMC A;  2XH9 A;  2K54 A;  3BU4 A;  3WMD A;  2YX9 A;  2JDI H;  3DGL A;  4KT3 B;  2ZA4 A;  4OVM A;  4HYZ A;  5BU4 A;  1WQL B;  3FLJ A;  1RGK A;  2CKF B;  3M8C A;  3PZW A;  1CYV A;  4J8T A;  4KFE A;  2P09 A;  3BIR A;  1BNR A;  3D9R A;  1JNQ A;  3OWU A;  3URP A;  1W02 A;  1NDO B;  1LOY A;  2CWT A;  3JVC A;  3LTD A;  3B4P A;  1G96 A;  1UUG B;  1DMM A;  2F56 A;  2GSP A;  2F4Y A;  2IA7 A;  3L0R A;  1X1X A;  3WHO A;  1EA2 A;  2ZHX B;  3B4O A;  3DGM A;  4HKV B;  4LGQ A;  5JBS A;  4Q53 A;  1BVI A;  3ZG0 A;  3CC7 3;  2H0I A;  1BUQ A;  3V99 A;  3G4S 3;  3CMA 3;  1EG9 B;  1RTU A;  1HKX A;  4FCZ A;  1CH0 A;  4STD A;  1JJ2 2;  3D3L A;  3MG2 A;  3RGA A;  1BNI A;  4IIA A;  4BL3 A;  1MWR A;  3CCQ 3;  3D5I A;  5AIF A;  1LOV A;  1RGE A;  1QMA A;  1WNH A;  3DGY A;  4ORL A;  1I70 A;  4EV5 A;  5IG4 A; 
#chains in the Genus database with same CATH homology
 2GU1 A;  3B8L A;  3CNM A;  1NO3 A;  4I4K A;  4CDL A;  3BND A;  1ULI B;  4O8S A;  1GY5 A;  1TFO A;  3VGN A;  1DVD A;  2XF3 A;  3Q2P A;  2M7O A;  1U5O A;  2Z76 A;  3MG1 A;  2FXT A;  5CK6 A;  3CCE 3;  2GEX A;  4EYC A;  1Q7Y 4;  4L8P A;  2I9W A;  3K63 A;  1WMN A;  3F7S A;  5EVH A;  2P0M A;  3JUP A;  5STD A;  1YJ9 3;  4R4K A;  2JQ5 A;  1KC8 4;  2W0Q A;  3NQY A;  4N6M A;  1DYU A;  1OF5 A;  1IVU A;  4O3V A;  3MHE A;  4WHA A;  4XDW A;  2FNQ A;  4QWT A;  2E2U A;  1DMQ A;  1YJN 3;  1RRH A;  3EC9 A;  4AKZ A;  1QAL A;  2CC3 A;  2CK3 H;  3IJE B;  3DMC A;  1CYU A;  1SQW A;  3LTA A;  3LZA A;  1VQM 3;  5IEN A;  1YIJ 3;  1W6G A;  5G2G A;  3X40 A;  1RRL A;  2HML B;  3GZX B;  5IER A;  1M1X B;  2P05 A;  2V1L A;  1IK3 A;  2XEP A;  2CFG A;  4EV2 A;  2CWV A;  3G0K A;  3H51 A;  2RFR A;  3WA2 X;  2XFT A;  1F8N A;  1YI2 3;  1IT7 A;  4JRF A;  4EC6 A;  4HM1 B;  5CF2 A;  4MJD A;  1NU3 A;  1DVC A;  1IT8 A;  5A0O B;  1S5A A;  3OXA A;  1SJW A;  1TFK A;  3MYT A;  1IQ8 A;  1JN5 A;  3CPW 2;  1QAF A;  1YJW 3;  1N5P A;  1T5Y A;  2IMJ A;  3KZT A;  2KXG A;  3JUO A;  1TU5 A;  1OHP A;  1Q81 4;  4XBX A;  1Q82 4;  1Z1S A;  3HI7 A;  1RN7 A;  5AIH A;  3ROB A;  1FA3 A;  1M9G A;  2C11 A;  2GBX B;  4KFF A;  3F40 A;  5KP1 A;  2CFK A;  2QIY A;  1YVB I;  3T8U A;  2W9Q A;  2XFS A;  3FG3 A;  3MG3 A;  3CD6 3;  3CCV 3;  3LTB A;  1IVW A;  1W7C A;  3BB9 A;  3AMO A;  4N6N B;  3UJM A;  3A76 A;  1V74 A;  1CQS A;  3DGO A;  1IQX A;  4HJL B;  4FMD A;  1O7N B;  1KQS 2;  4LMI A;  2OQE A;  1Y4K A;  4WWU C;  5ELJ A;  2CFL A;  5IW9 A;  3WDG B;  4HM0 B;  1FUW A;  1JKG B;  3FSD A;  3KN4 A;  1W5Z A;  3OX9 A;  3WOF B;  3PS8 A;  1JB4 A;  3CPO A;  3K0Z A;  4N6T A;  3T8N A;  1S72 3;  4HZ9 B;  3X3X A;  3EX9 A;  4O02 B;  1GY7 A;  3F14 A;  1STF I;  2OOV C;  3U1W A;  3CME 3;  3MSO A;  5IG0 A;  1E97 A;  3EHC A;  1L5G B;  1OAC A;  3EJV A;  2XGL A;  3B7C A;  1QVF 2;  1C7H A;  1OCV A;  5ELU A;  4KVH A;  3HII A;  1UUV B;  3H3H A;  3KFQ C;  1JB5 A;  3I56 3;  4XDV A;  3X3Y A;  2QGU A;  5D83 A;  3CCL 3;  3DZL A;  3EE1 A;  3LT9 A;  2HMK B;  1LNH A;  2ML6 A;  2ZDJ A;  3LOY A;  5BVB A;  2F98 A;  1SII A;  4R9K A;  1N8Q A;  1W4N A;  3KSP A;  2E2T A;  3EF8 A;  1NB3 I;  2F86 B;  1TIJ A;  1JV2 B;  4XBY A;  2P0X A;  5CF1 A;  1O7H B;  1ZO2 A;  3JUN A;  5FGO A;  4HM3 B;  1JRQ A;  3TDG A;  5AEU B;  3BNE A;  5EEO A;  1OGX A;  4NRE A;  3EN1 B;  3S67 A;  8CHO A;  2W56 A;  2WOF A;  3O8Y A;  5LC7 A;  1GD4 A;  1E3R A;  2ML5 A;  1AVK A;  3G6E 3;  1LVN A;  3DXO A;  3AMO B;  5BXQ A;  1Q42 A;  4H61 A;  3S5C A;  2F99 A;  3HIG A;  3PYJ A;  3K7C A;  2INX A;  4N6V 0;  2L4V A;  3CC4 3;  3N54 B;  1U8C B;  4GB5 A;  2PZV A;  3X3Z A;  4X2O A;  2YFJ B;  1VQ8 3;  3IMA B;  1AV4 A;  2YFL B;  3G16 A;  3X41 A;  1KWI A;  2Z6B A;  3SOA A;  2RSX A;  2BMR B;  2Z77 A;  2HMN B;  3G8Z A;  3RDE A;  4N6L A;  1OUN A;  3EN8 A;  1STD A;  1IQY A;  1OGZ A;  2XGN A;  3GWR A;  1A90 A;  1Q40 A;  3EQQ B;  3FGY A;  4KFD A;  2BNG A;  1IU7 A;  3NM7 A;  1KD1 4;  4N6U A;  2R4I A;  1Q40 B;  3HZP A;  5AIG A;  3SED A;  1SIH A;  1N8R 4;  3CCR 3;  1Q86 4;  3STD A;  1ASK A;  3MWZ A;  1VQ9 3;  3NBJ A;  2GXF A;  3GZR A;  1OPY A;  3LML A;  3JUQ A;  2KRT A;  1CEW I;  1VQO 3;  1K28 A;  1VQ7 3;  3GAX A;  3NQZ A;  1QJG A;  2Y74 A;  1A67 A;  1K9M 4;  2W9P A;  1TP6 A;  3BNC A;  4EBG A;  1ROV A;  2Y73 A;  3FG1 A;  3NBB A;  5TGN A;  2E2V A;  1NWW A;  1UI7 A;  3G71 3;  3KE7 A;  2SBL A;  3PCR A;  2BMQ B;  1OF5 B;  2W56 B;  3LXU X;  5AI1 A;  2ZL8 A;  1YHQ 3;  4LEH A;  3EB8 A;  4N6O B;  5AII A;  3DGN A;  2O9U X;  2WO0 A;  2BMO B;  1EQK A;  4OUQ A;  4AKY A;  1O7G B;  5KP4 A;  1GYB A;  5IG5 A;  5AYR B;  4BTW A;  1MOL A;  2HMJ B;  3LYG A;  3J7Y d;  3SVA A;  3N9H A;  2OTL 3;  4HM6 B;  2BHM A;  3OV4 A;  4HM5 B;  1O7P B;  3KKG A;  4H3U A;  4IT7 A;  3MPH A;  1TUH A;  2MC8 A;  4RNZ A;  2LQV A;  1US1 A;  3LT8 A;  4K61 A;  5EQL A;  2IUK A;  4CCV A;  4EXR A;  3FF0 A;  4U13 A;  1E3V A;  1VZZ A;  2XSO B;  3OWY A;  5D81 A;  3UB1 A;  4K1V A;  1R4C A;  5CXO A;  3KSE D;  1W6Y A;  1VQK 3;  4WFO A;  1RJO A;  3OWS A;  1GY6 A;  1LOX A;  3S28 A;  4RZM A;  4HM8 B;  1PFP A;  1VQ5 3;  5FW5 A;  4J9A A;  3T0U A;  2CW9 A;  1KSI A;  3K5T A;  1M90 4;  1JN5 B;  2O3O A;  2UX0 A;  5LC6 A;  1EKM A;  2PNC A;  7STD A;  4XBT A;  4ZM8 A;  4HM2 B;  2GEY A;  3NM2 A;  3F7X A;  4HM7 B;  2OOV A;  3I0Y A;  3NX0 A;  2XRX B;  4N3V A;  3NV0 A;  3WOE B;  4X2H A;  4MMZ B;  1PU4 A;  2YFI B;  4MMX B;  3FF2 A;  3UL5 A;  1WMO A;  3Q90 A;  3CU3 A;  1QAK A;  3EBT A;  2GBW B;  2W6J H;  1W6C A;  1QVG 2;  2CFD A;  3NBR A;  4HM4 B;  3LH4 A;  1MNL A;  2CHC A;  1A2K A;  2CG0 A;  4L7K A;  3NXJ A;  3I55 3;  3HK4 A;  3DM8 A;  1D6Z A;  3K9M C;  3QK9 A;  5IEO A;  1YIT 3;  3PGB A;  3CXC 2;  5AYS C;  4FMA A;  2D1W A;  1N5H A;  1FGR A;  3SX1 A;  5I97 A;  3IPT A;  4FR9 A;  3U97 A;  3FKA A;  2W03 A;  1VQL 3;  4WYK B;  2MF7 A;  2BT3 A;  4AEQ A;  1K41 A;  1UW1 A;  3UNL A;  2GU3 A;  6STD A;  1LXE A;  2HMM B;  1FGO A;  5DRE A;  2W04 A;  5DRV A;  2LYX A;  3CCU 3;  3FH1 A;  4LZI A;  1VQ4 3;  1UUW B;  1GS3 A;  1IV9 A;  1K8A 4;  3F8H A;  3CCJ 3;  3SOY A;  2WGQ A;  3DUK A;  3CCM 3;  3ER7 A;  1W2B 2;  1AVL A;  4BTX A;  1ROA A;  3HX8 A;  1WMP A;  3JUM A;  2OWP A;  4IPB A;  3DY5 A;  3E99 A;  2CFW A;  2C10 A;  3S27 A;  1DMN A;  1IDP A;  2CG1 A;  3GZB A;  5IF6 A;  2IUJ A;  2KCD A;  2CIU A;  4WP5 A;  4RNY A;  1M1K 4;  2STD A;  1W00 A;  3ECF A;  1ISK A;  3BLZ A;  1NB5 I;  4XM4 A;  2OCT A;  2BO9 B;  4PEJ A;  1JKG A;  3NHX A;  4L8O A;  1JB2 A;  3X42 A;  2CWU A;  2OQE C;  3F8X A;  3NUV A;  4RBN A;  1K73 4;  4MMY B;  2Z7A A;  3F9S A;  2HMO B;  3QRD A;  2QEX 3;  2CH9 A;  4R9L A;  5HGR A;  3V98 A;  1O7W B;  4FCJ A;  4HZB B;  5AEW B;  5JPP A;  4GL6 A;  1UI8 A;  3PCS A;  5IG3 A;  2P38 A;  2K0M A;  4K90 B;  3WA3 A;  5JPU A;  1VQP 3;  4KZ1 A;  3UL6 A;  3EBY A;  1IV7 A;  2QA4 3;  1J2B A;  1W01 A;  1NJI 4;  2B1X B;  2B24 B;  2WGO A;  3Q1C A;  1A2V A;  2D42 A;  1HU9 A;  1GD3 A;  2W2C A;  3NV0 B;  1RKY A;  4G1M B;  4OK0 A;  2FGT A;  2XR8 B;  5KP3 A;  4XB5 A;  3ALA A;  1FGT A;  5D82 A;  4WYK A;  3LTC A;  4FCM A;  4NHF A;  1AR0 A;  3PXM A;  4HVN A;  4LSO A;  1VQN 3;  3CCS 3;  1YGE A;  2WOH A;  3VF1 A;  4K1U A;  1ULJ B;  4O2H A;  1FGQ A;  1W2Z A;  1SPU A;  3OW2 2;  1N9E A;  3CNX A;  1FGM A;  4R1K A;  1N9J A;  1WTH A;  1OH0 A;  3BNB A;  3S29 A;  3VSY A;  4TX4 A;  1IVX A;  2RCD A;  2OTJ 3;  4JF8 A;  4HBR A;  3KII A;  3SLU A;  3SXX A;  1D6Y A;  3RGR A;  3WOD G;  3N8B A;  4BTY A;  3MKI A;  1OHS A;  1OHO A;  1O7M B;  3FCS B;  2RGQ A;  1ZX2 A;  2XSH B;  3V92 A;  2A15 A;  1VQ6 3;  3FZW A;  5CLK A;  1IVV A;  3GRD A;  4MEI A;  3CC2 3;  5IEP A;  4R80 A;  2Q07 A;  4FMB A;  1D6U A;  3FG4 A;  3GZY B;  4FMC A;  2XH9 A;  2K54 A;  3WMD A;  2YX9 A;  2JDI H;  3DGL A;  4OVM A;  4HYZ A;  1WQL B;  3FLJ A;  3M8C A;  2CKF B;  3PZW A;  4KFE A;  1CYV A;  4J8T A;  2P09 A;  3D9R A;  1JNQ A;  3OWU A;  1W02 A;  1NDO B;  2CWT A;  3JVC A;  3LTD A;  3B4P A;  1G96 A;  1DMM A;  3L0R A;  2IA7 A;  1EA2 A;  3B4O A;  3DGM A;  4HKV B;  4LGQ A;  5JBS A;  4Q53 A;  3CC7 3;  1BUQ A;  3V99 A;  3G4S 3;  3CMA 3;  1EG9 B;  1JJ2 2;  1HKX A;  4FCZ A;  4STD A;  3D3L A;  3MG2 A;  3RGA A;  4IIA A;  3CCQ 3;  5AIF A;  4ORL A;  4EV5 A;  1QMA A;  1WNH A;  5IG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...