2BO9B

Human carboxypeptidase a4 in complex with human latexin.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
217
Chain Sequence
MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A4
publication title Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 217
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06907 Latexin Latexin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B01
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2bo9B02
1YVBI 1IV7A 1NB5I 3LH4A 5LC6A 3UL5A 3PS8A 2CH9A 1DVDA 4N6OB 1DVCA 1PFPA 1STFI 1N5HA 1R4CA 3Q2PA 5EQLA 2W9PA 5A0OB 1MOLA 4ZM8A 4N6UA 2BO9B 1CYUA 1FA3A 1NB3I 4TX4A 3KSED 1CYVA 2OCTA 4LZIA 3SVAA 1GD4A 4EYCA 5LC7A 1IV9A 3PXMA 1A67A 1TIJA 3IMAB 3L0RA 1ROAA 1LXEA 1MNLA 1GD3A 2KXGA 5ELJA 3GAXA 2W9QA 4CCVA 3QRDA 4N6MA 3S67A 3PYJA 1G96A 4N6LA 3MWZA 4N6TA 1M9GA 1N5PA 1FUWA 1RN7A 3UL6A 4IT7A 4N6NB 1CEWI 3K9MC 3KFQC 1KWIA 1WNHA 1N9JA 2O9UX 1A90A 3NX0A 4N6V0 5ELUA 1EQKA
chains in the Genus database with same CATH superfamily
5D83A 3SYUA 1GY7A 3N54B 1KC84 4KFEA 1VQ53 1NB5I 3KZTA 2CW9A 5CF1A 2IYJA 2F99A 1YIJ3 3F8HA 1FUSA 2O3OA 3JUNA 1BNJA 1OCVA 1IT7A 3OV4A 1UUVB 3DGYA 1UGIA 3EF8A 1B2UA 3K63A 1FUTA 1BAOA 2IY2A 3NBBA 3F9SA 4R9LA 1OGZA 3FLJA 1OF5B 3S28A 5AEUB 1CH0A 1W00A 3I553 3G6E3 4N6OB 1DVCA 1OGXA 1VQ93 3JUMA 1IQ8A 3EQQB 2CKFB 2XSHB 7GSPA 1JBTA 5G1LA 2XSOB 4BTWA 1IU7A 3MG2A 4STDA 1RN4A 1R4CA 3WODG 2XR8B 2KF3A 1JJ22 1TU5A 2CFDA 2OOVC 1E97A 3EE1A 1IK3A 2L1SA 1F8NA 2W9PA 3LT9A 1OHOA 3ECFA 1QALA 3QK9A 2H0IA 1JB5A 3WR2A 1EG9B 3BNEA 8RNTA 1N8QA 1PY3A 3BNBA 3K0ZA 4RBNA 3SEDA 1VQM3 3V99A 1BNRA 4TX4A 2OWPA 1MGRA 1CYVA 1HU9A 2ZA4A 4RNZA 1UCIA 3NQYA 3MG3A 1UGHI 2HMKB 5DRVA 3VSYA 2XGNA 1SQWA 1CQSA 3MYTA 1B2SA 1GD4A 4I4KA 4DKIA 4RNYA 1FGTA 2K3DA 1MWRA 1RNBA 2F56A 2BU4A 1A2PA 1TFKA 2W03A 3SOAA 1IVUA 1TIJA 1IDPA 4LYLB 2P0MA 5CF2A 5AEWB 2FGTA 4WWUC 2B1XB 1QAKA 1Q40A 1O7HB 4HJLB 4AKZA 4BL3A 3N9HA 4KT3B 1V58A 1STDA 1JZOA 2H0GA 3ZG0A 4BTXA 1VQN3 1BOXA 1E3VA 3V98A 1AV4A 1BNSA 2RSXA 3LTAA 5EEOA 3KN4A 5JBSA 2CX1A 2PNCA 3DM8A 2HMLB 3K5TA 2ZDJA 4BL2A 1I3FA 3CCQ3 3X3ZA 5BXQA 1T5YA 2Z77A 3AMOB 4R4KA 1M1K4 3KCHA 2BIRA 1O7MB 5TGNA 2CFGA 3SX1A 4WFOA 1B21A 4XM4A 1V57A 2CK3H 1W6GA 3A5EA 1RJOA 3AHWA 3SOYA 1W02A 3DH2A 1BIRA 3FH1A 1BSEA 2OQEA 4NPBA 1M9GA 3DGMA 1RN7A 1RGGA 1RTUA 2RCDA 4IT7A 1JB2A 3FF0A 3NBJA 2GEYA 1JN5A 2ML6A 1G02A 3WMDA 1RGFA 1CEWI 1Y4KA 3KFQC 4HKVB 1WNHA 1JNQA 1N9JA 3X3YA 3D4AA 4HM4B 5JPPA 3PCRA 2MC8A 2V1LA 3NM7A 4MJDA 1U5OA 1VQL3 2BNGA 1EEJA 3FKAA 5EVHA 2CC3A 1I0VA 4H3UA 5KP1A 1B3SA 1JKGB 1RN1A 1UUGB 2I9WA 2GXFA 4KVHA 5CLKA 3G4S3 1NDOB 2QEX3 4JF8A 3NV0A 3X40A 3D9RA 1YNVX 3LOYA 4H61A 2W2CA 3FG1A 5M19A 1BRGA 2RFRA 4NHFA 4HOHA 4J9AA 4RNTA 1MWSA 3F14A 3FGYA 1IV7A 2CWTA 7RNTA 3BLZA 5LC6A 5AIFA 3JUQA 3B4PA 1BRSA 2GEXA 3GZBA 1IVVA 4FMAA 3HOHA 1YJW3 3E99A 3EJVA 4FCJA 1RRHA 1JBSA 1O7PB 1BSAA 2R41A 2HMNB 1ZGXA 5CK6A 4CJNA 1TUHA 2CX0A 1I3IA 3KKGA 1FGOA 1B2ZA 3NUVA 4GHOA 4HM1B 5AYSC 3CCS3 2CFKA 1GMPA 2KRTA 2W6JH 3Q1CA 2F4YA 2GSPA 1N5HA 2Z76A 5KP3A 5IW9A 1R4YA 3AGOA 4U13A 1RGKA 1AQZA 1BNIA 2F98A 2ML5A 3CPOA 1OH0A 3Q2PA 4O3VA 3X3XA 4IPBA 2LYXA 3LZAA 1LOWA 3OX9A 2AADA 3BU4A 1MOLA 1YGEA 5EQLA 8CHOA 1X1XA 5HOHA 3A76A 1BUQA 5AIGA 1HZ1A 2BMOB 4N6UA 4GL6A 1IQXA 5G1KA 3RNTA 1OPYA 1RDSA 1UCLA 2W56A 3GRDA 4HAAA 3CC23 3DGLA 1O7NB 2YFLB 4OK0A 3CD63 6RNTA 3UNLA 1UW1A 1QJGA 2J8XB 1C7HA 1WMNA 5BU4A 3D79A 1QMAA 2UGIA 1QVF2 3STDA 4HM3B 3ZG5A 4EC6A 4LZIA 3NXJA 3BIRA 1LRAA 4LSOA 1B27A 3VGNA 1T3BA 3DUKA 3EB8A 1N8R4 3Q90A 1ULJB 1IV9A 4I5QA 1X1WA 5IG4A 1WQLB 2C11A 1KSIA 1ROVA 1W2ZA 2A15A 3DGNA 5M18A 3NBRA 1SPUA 1LNIA 1BVIA 3L0RA 1BUJA 1W01A 3CMA3 1BRIA 3LTDA 1OF5A 3GZYB 4HM6B 1W2B2 1UCKA 5AIIA 2SARA 1JBRA 1MNLA 2W0QA 1GD3A 3OXAA 1O7WB 2KXGA 1Q7HA 3Q3FA 2BT3A 1Q7Y4 1BNGA 3V92A 2W9QA 3QRDA 1BANA 4NREA 3MPHA 2P38A 1RHLA 1ULIB 3BNDA 1BGSA 1SJWA 3DMCA 4R1KA 4QWTA 4MEIA 3CNXA 5STDA 1FGMA 1RCKA 2Y74A 1K41A 1A2KA 1D6YA 2R4IA 1PYLA 4AEQA 5BVBA 4FMCA 1Z1SA 1T2HA 2GU1A 2WOHA 3SLUA 1MWUA 2CFLA 1K8A4 4KFDA 1B2MA 3EN8A 4MMYB 4XBYA 4X2HA 3EHCA 4WYKA 1UDII 4K1UA 1W6YA 4LEHA 1DE3A 1Q40B 3GWRA 1D6UA 3WA3A 6STDA 3CCM3 1BRNL 2E2TA 2CHCA 1VQK3 1KQS2 4N3VA 2WGQA 3I563 1BRKA 4O8SA 3H51A 1C54A 1Q814 3NX0A 4N6V0 1YJ93 3ZFZA 1HKXA 3DGOA 3F7XA 3D3LA 5ELUA 4EV2A 3LMLA 1ZS7A 3KIIA 1UCJA 3CCR3 1VZZA 2QGUA 4L7KA 3EN1B 3T8NA 1RKYA 3URPA 3UL5A 4RZMA 2BHMA 5BIRA 1JN5B 2Q07A 3LTCA 1GYBA 4R9KA 2CH9A 1LOXA 2P09A 3EX9A 3ER7A 1I2FA 3B8LA 1PFPA 1STFI 1IT8A 4CPKA 1RNTA 2RGQA 3IJEB 3PZWA 1B20A 5IG0A 2AAEA 5GSPA 2H0HA 1I8VA 3U97A 1G0TA 1WMPA 1LOVA 2ZL8A 2BMRB 3F8XA 1GS3A 3NV0B 5A0OB 2PZVA 1K734 3T0UA 3CCV3 3NHXA 1RRLA 1VQP3 4KFFA 2UX0A 1SIIA 9RNTA 3PGBA 5M1AA 1RLSA 3G0KA 2BO9B 3CCL3 1YI23 1CYUA 1SARA 1EUIC 1ISKA 2XF3A 3GZRA 3TDGA 4EBGA 4GSPA 2C4BA 1JKGA 4HM5B 1YVSA 1DYUA 2D42A 4FMBA 2F5MA 3FF2A 2OCTA 1YHQ3 1RMSA 2M7OA 3M8CA 3HIIA 4XBXA 5JPUA 1S723 3MG1A 4EYCA 1K9M4 2WGOA 2RNTA 2XFTA 2KCDA 3JUPA 3CCJ3 4MMXB 3DXOA 2OOVA 2CIUA 2CG0A 3CNMA 1TFOA 4HZBB 1GOYA 2CFWA 1PU4A 1Q824 2HOHA 2QIYA 2OQEC 2CG1A 1Q9EA 3I0YA 1VQ73 1RGHA 2KF5A 3IMAB 5FGOA 1BNFA 5IEOA 3RGAA 6GSPA 5IG5A 1VQ63 1E3RA 2Z7AA 1X1UA 4MMZB 1N9EA 4R80A 3AGNA 1JRQA 1Q42A 1BSCA 3F7SA 1LXEA 4O2HA 3CU3A 4BTYA 2IA7A 3B4OA 5ELJA 1BSDA 2XFSA 3GAXA 3WA2X 2BMQB 2XEPA 2FXTA 4N6MA 1WMOA 5KP4A 3OWYA 1L5GB 1BRHA 2L4VA 3S67A 3U1WA 3PYJA 3HK4A 1G96A 1IQYA 4HZ9B 4X2OA 3O8YA 3GSPA 1JB4A 4XDWA 1EKMA 3KSPA 1UI7A 4N6TA 4LMIA 2GBXB 3G16A 3GZXB 2IUKA 3JUOA 3J7Yd 3N8BA 1N5PA 3HI7A 3EBTA 3UL6A 1V74A 1RSNA 5AYRB 2JQ5A 1IVXA 3T8UA 1RGAA 2XH9A 4EW5A 1QVG2 1TP6A 4OVMA 2D1WA 4GB5A 1OUNA 1M904 1TRQA 1GY5A 5DREA 1I2EA 2CWUA 1KWIA 3F40A 3SXXA 1I2GA 3RGRA 5RNTA 3OWSA 2C10A 1DETA 1TJDA 1LNHA 1VQQA 2XRXB 3JVCA 4HYZA 4O02B 3RDEA 1VQO3 3VF1A 3D5GA 3HX8A 4HM2B 2MF7A 4WP5A 3CXC2 1VQ43 1NWWA 1BSBA 5G2GA 4FMDA 1U8CB 2K0MA 1AY7A 3EC9A 4XBTA 4WHAA 1GY6A 1DMMA 2E2VA 3K7CA 4Q53A 1AVLA 1Q864 2OTL3 2RBIA 1NU3A 3HZPA 4KZ1A 4BIRA 3G713 3CPW2 3S27A 1YVBI 3AHSA 2W04A 1TRPA 2UUGC 1GOUA 3LH4A 1YIT3 4BU4A 1QAFA 3LTBA 2K54A 2STDA 4J5GA 2INXA 2XGLA 4WYKB 3CC73 1OHPA 3PS8A 2P0XA 4CDLA 1W6CA 2B24B 4L8PA 1FZUA 4XDVA 3FG3A 1DMNA 3S5CA 1DVDA 2Z6BA 1BNEA 2HMJB 3FSDA 1RGLA 3FCSB 2KAAA 1AVKA 3D5IA 3H3HA 1AR0A 2CWVA 3WDGB 1GSPA 2GU3A 1IVWA 2F5WA 1VQ83 3MSOA 5AI1A 4ZM8A 1X1YA 4PEJA 3DZLA 5IEPA 2YFIB 3DY5A 1A2VA 2LQVA 1GMRA 2P05A 5IG3A 3AMOA 1LVNA 1NB3I 1FA3A 1BRJA 3KSED 1UI8A 3NQZA 4K90B 4HVNA 1W4NA 1T2IA 4FCZA 1RGEA 1LQGC 4HM0B 4K61A 3SVAA 3X41A 2KF4A 1LOYA 1GOVA 1I70A 4K1VA 1NNVA 5LC7A 3UJMA 1OHSA 1S5AA 3CME3 3BNCA 1O7GB 1NO3A 4FR9A 2WO0A 4J8TA 4IIAA 1M1XB 3CCE3 3PXMA 1A67A 1EA2A 1BU4A 1W5ZA 3HIGA 4AKYA 1US1A 1I0XA 1LQMB 5HGRA 3WOEB 2YFJB 4JRFA 1K28A 2E2UA 1JZDA 2HMMB 1DMQA 5IENA 1RCLA 4HBRA 1ROAA 2GBWB 3LYGA 3OWUA 1GMQA 2HMOB 3KE7A 2KF6A 2IMJA 5D81A 4J5KA 3PCSA 2SBLA 4CCVA 1MGWA 3LT8A 2FNQA 3LXUX 2JDIH 2QA43 4OUQA 4G1MB 5IERA 1TTOA 1JV2B 4L8OA 1HYFA 4LGQA 3WHOA 4EV5A 3BB9A 4N6LA 3MHEA 3MWZA 1FYSA 2YX9A 4ILFA 1UUWB 1RGCA 3UB1A 1SIHA 1FUWA 5D82A 1FW7A 4HM7B 1ZO2A 1YJN3 4N6NB 1W7CA 3MKIA 4HM8B 5I97A 1WTHA 3K9MC 3IPTA 4EXRA 1NJI4 1J2BA 1D6ZA 1IYYA 1OACA 4XB5A 1FGQA 2O9UX 2IUJA 3OW22 3EBYA 1ASKA 2W56B 3FZWA 3S29A 5AIHA 1A90A 3ALAA 2WOFA 2ZHXB 3CC43 2Y73A 5IF6A 4ORLA 5FW5A 7STDA 3G8ZA 3WOFB 5CXOA 4FCMA 3FG4A 2F86B 1B2XA 3ROBA 1MWTA 1FGRA 1KD14 1YGWA 3B7CA 3NM2A 3CCU3 3X42A 1ZX2A 2OTJ3 1EQKA
chains in the Genus database with same CATH topology
5D83A 1KC84 1GY7A 3N54B 4KFEA 1VQ53 1NB5I 3KZTA 2CW9A 5CF1A 1YIJ3 2F99A 3F8HA 2O3OA 3JUNA 3OV4A 1OCVA 1IT7A 5D81A 1UUVB 3NBBA 3EF8A 3K63A 5AEUB 3F9SA 4R9LA 1OGZA 3FLJA 1OF5B 3S28A 3I553 1W00A 3G6E3 4N6OB 1DVCA 1OGXA 1VQ93 3JUMA 1IQ8A 3EQQB 2CKFB 2XSHB 4BTWA 2XSOB 1IU7A 3MG2A 4STDA 1R4CA 3WODG 2XR8B 1JJ22 1TU5A 2CFDA 2OOVC 1E97A 3EE1A 1IK3A 1F8NA 2W9PA 3LT9A 1OHOA 3ECFA 1QALA 3QK9A 1JB5A 1EG9B 3BNEA 1N8QA 3BNBA 3K0ZA 4RBNA 3SEDA 1VQM3 3V99A 4TX4A 2OWPA 1CYVA 1HU9A 4RNZA 3NQYA 3MG3A 2HMKB 5DRVA 3VSYA 2XGNA 1SQWA 1CQSA 3MYTA 1GD4A 4I4KA 4RNYA 1FGTA 2W03A 4BTYA 1TFKA 3SOAA 5CF2A 1IVUA 1TIJA 1IDPA 2P0MA 5AEWB 2FGTA 4WWUC 2B1XB 1QAKA 1Q40A 1O7HB 4HJLB 4AKZA 3N9HA 1VQN3 1STDA 4BTXA 3V98A 1E3VA 1AV4A 3LTAA 2RSXA 5EEOA 5JBSA 3KN4A 2PNCA 3DM8A 2HMLB 3K5TA 2ZDJA 3CCQ3 3X3ZA 5BXQA 1T5YA 2Z77A 3AMOB 4R4KA 1M1K4 1O7MB 5TGNA 2CFGA 3SX1A 4WFOA 4XM4A 2CK3H 1W6GA 1RJOA 3SOYA 1W02A 3FH1A 2OQEA 1M9GA 3DGMA 1RN7A 4IT7A 2RCDA 1JB2A 3FF0A 3NBJA 2GEYA 1JN5A 2ML6A 3WMDA 1CEWI 1Y4KA 3KFQC 4HKVB 1WNHA 1JNQA 1N9JA 3X3YA 5JPPA 4HM4B 3PCRA 2MC8A 2V1LA 3NM7A 4MJDA 1U5OA 1VQL3 2BNGA 3FKAA 5EVHA 2CC3A 4H3UA 5KP1A 2I9WA 1JKGB 4KVHA 2GXFA 5CLKA 3G4S3 1NDOB 2QEX3 4JF8A 3NV0A 3X40A 3D9RA 3LOYA 4H61A 2W2CA 3FG1A 2RFRA 4NHFA 4J9AA 3F14A 3FGYA 1IV7A 2CWTA 3BLZA 5LC6A 5AIFA 3JUQA 3B4PA 2GEXA 1YJW3 3GZBA 1IVVA 4FMAA 3E99A 3EJVA 4FCJA 1RRHA 1O7PB 2HMNB 5CK6A 1TUHA 3CCS3 3KKGA 1FGOA 3NUVA 4HM1B 5AYSC 2CFKA 2KRTA 2W6JH 3Q1CA 5KP3A 5IW9A 1N5HA 2Z76A 4U13A 2F98A 2ML5A 3CPOA 1OH0A 3Q2PA 4O3VA 3X3XA 4IPBA 2LYXA 3LZAA 5EQLA 3OX9A 8CHOA 1YI23 1MOLA 1YGEA 1BUQA 3A76A 5AIGA 2BMOB 4N6UA 4GL6A 1IQXA 1OPYA 2W56A 3GRDA 3CC23 3DGLA 1O7NB 2YFLB 4OK0A 3CD63 3UNLA 1UW1A 1QJGA 1C7HA 1WMNA 1QMAA 1QVF2 3STDA 4HM3B 4EC6A 4LZIA 3NXJA 4LSOA 3VGNA 3DUKA 3EB8A 1N8R4 3Q90A 1ULJB 1IV9A 5IG4A 1WQLB 2C11A 1KSIA 1ROVA 1W2ZA 2A15A 3DGNA 3NBRA 1SPUA 3L0RA 1W01A 3CMA3 3LTDA 1OF5A 3GZYB 4HM6B 1W2B2 5AIIA 1MNLA 2W0QA 1GD3A 3OXAA 1O7WB 2KXGA 2BT3A 1Q7Y4 3V92A 2W9QA 3QRDA 4NREA 3MPHA 2P38A 1ULIB 3BNDA 1SJWA 3DMCA 4R1KA 4QWTA 4MEIA 3CNXA 5STDA 1FGMA 2Y74A 1K41A 1A2KA 1D6YA 2R4IA 4AEQA 5BVBA 4FMCA 1Z1SA 2GU1A 3SLUA 2WOHA 2CFLA 1K8A4 4KFDA 3EN8A 4MMYB 4XBYA 4X2HA 3EHCA 4WYKA 4K1UA 1W6YA 4LEHA 1Q40B 3GWRA 1D6UA 3WA3A 6STDA 3CCM3 2E2TA 2CHCA 1VQK3 1KQS2 4N3VA 2WGQA 3I563 4O8SA 3H51A 1Q814 3NX0A 4N6V0 1YJ93 1HKXA 3DGOA 3F7XA 3D3LA 5ELUA 4EV2A 3LMLA 3KIIA 3CCR3 1VZZA 2QGUA 4L7KA 3EN1B 3T8NA 1RKYA 3UL5A 4RZMA 2BHMA 1JN5B 2Q07A 3LTCA 1GYBA 4R9KA 2CH9A 1LOXA 2P09A 3EX9A 3ER7A 3B8LA 1PFPA 1STFI 1IT8A 2RGQA 3IJEB 3PZWA 5IG0A 3U97A 1WMPA 2ZL8A 2BMRB 3F8XA 1GS3A 3NV0B 5A0OB 2PZVA 1K734 3T0UA 3CCV3 3NHXA 1RRLA 1VQP3 4KFFA 2UX0A 1SIIA 3PGBA 3G0KA 2BO9B 3CCL3 1CYUA 1ISKA 2XF3A 3GZRA 3TDGA 4EBGA 1JKGA 4HM5B 1DYUA 2D42A 4FMBA 3FF2A 1YHQ3 2OCTA 2M7OA 3M8CA 3HIIA 4XBXA 5JPUA 1S723 3MG1A 4EYCA 1K9M4 2WGOA 2XFTA 2KCDA 3JUPA 3CCJ3 4MMXB 3DXOA 2OOVA 2CIUA 2CG0A 3CNMA 1TFOA 4HZBB 2CFWA 1PU4A 1Q824 2CG1A 2QIYA 2OQEC 1VQ73 3I0YA 3IMAB 5FGOA 5IEOA 3RGAA 1VQ63 5IG5A 1E3RA 2Z7AA 4MMZB 1N9EA 4R80A 1JRQA 1Q42A 3F7SA 1LXEA 4O2HA 3CU3A 2IA7A 3B4OA 5ELJA 2XFSA 3GAXA 5KP4A 3WA2X 2BMQB 2XEPA 2FXTA 4N6MA 1WMOA 3OWYA 1L5GB 2L4VA 3S67A 3U1WA 3PYJA 3HK4A 1G96A 1IQYA 4HZ9B 4X2OA 3O8YA 1JB4A 4XDWA 1EKMA 3KSPA 1UI7A 4N6TA 4LMIA 2GBXB 3G16A 3GZXB 2IUKA 3JUOA 3J7Yd 3N8BA 1N5PA 3HI7A 3EBTA 3UL6A 1V74A 5AYRB 2JQ5A 1IVXA 3T8UA 2XH9A 1QVG2 1TP6A 4OVMA 2D1WA 4GB5A 1OUNA 1M904 1GY5A 5DREA 2CWUA 1KWIA 3F40A 3SXXA 3RGRA 3OWSA 2C10A 1LNHA 2XRXB 3JVCA 3RDEA 4HYZA 4O02B 1VQO3 3VF1A 3HX8A 4HM2B 2MF7A 4WP5A 3CXC2 1VQ43 1NWWA 5G2GA 4FMDA 1U8CB 2K0MA 3EC9A 4XBTA 4WHAA 1GY6A 1DMMA 2E2VA 3K7CA 4Q53A 1AVLA 1Q864 2OTL3 1NU3A 3HZPA 4KZ1A 3CPW2 3G713 3S27A 1YVBI 2W04A 1YIT3 3LH4A 1QAFA 3LTBA 2K54A 2STDA 2INXA 2XGLA 4WYKB 3CC73 1OHPA 3PS8A 2P0XA 4CDLA 1W6CA 2B24B 4L8PA 4XDVA 3FG3A 1DMNA 3S5CA 1DVDA 2Z6BA 2HMJB 3FSDA 3FCSB 1AVKA 3H3HA 1AR0A 2CWVA 3WDGB 2GU3A 1IVWA 1VQ83 3MSOA 5AI1A 4ZM8A 4PEJA 3DZLA 5IEPA 2YFIB 3DY5A 1A2VA 2LQVA 2P05A 5IG3A 3AMOA 1LVNA 1NB3I 1FA3A 3KSED 1UI8A 3NQZA 4K90B 4HVNA 1W4NA 4FCZA 4K61A 3SVAA 4HM0B 3X41A 5LC7A 3CME3 4K1VA 3UJMA 1OHSA 1S5AA 3BNCA 1O7GB 1NO3A 4FR9A 2WO0A 4J8TA 4IIAA 1M1XB 3CCE3 3PXMA 1A67A 1EA2A 3HIGA 1W5ZA 4AKYA 1US1A 5HGRA 3WOEB 2YFJB 4JRFA 1K28A 2E2UA 2HMMB 1DMQA 5IENA 4HBRA 1ROAA 2GBWB 3LYGA 3OWUA 2HMOB 3KE7A 2IMJA 3PCSA 2SBLA 4CCVA 3LT8A 2FNQA 3LXUX 2JDIH 2QA43 4OUQA 4G1MB 5IERA 1JV2B 4L8OA 4LGQA 4EV5A 3BB9A 4N6LA 3MHEA 3MWZA 2YX9A 1UUWB 3UB1A 1SIHA 1FUWA 5D82A 4HM7B 1ZO2A 1YJN3 4N6NB 1W7CA 3MKIA 4HM8B 5I97A 1WTHA 3K9MC 3IPTA 4EXRA 1NJI4 1J2BA 1D6ZA 1OACA 4XB5A 1FGQA 2O9UX 2IUJA 3OW22 3EBYA 1ASKA 2W56B 3FZWA 3S29A 5AIHA 1A90A 3ALAA 2WOFA 3CC43 2Y73A 5IF6A 4ORLA 5FW5A 7STDA 3G8ZA 3WOFB 5CXOA 4FCMA 3FG4A 2F86B 3ROBA 1KD14 1FGRA 3B7CA 3NM2A 3CCU3 3X42A 1ZX2A 2OTJ3 1EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB I;  1IV7 A;  1NB5 I;  3LH4 A;  5LC6 A;  3UL5 A;  3PS8 A;  2CH9 A;  1DVD A;  4N6O B;  1DVC A;  1PFP A;  1STF I;  1N5H A;  1R4C A;  3Q2P A;  5EQL A;  2W9P A;  5A0O B;  1MOL A;  4ZM8 A;  4N6U A;  2BO9 B;  1CYU A;  1FA3 A;  1NB3 I;  4TX4 A;  3KSE D;  1CYV A;  2OCT A;  4LZI A;  3SVA A;  1GD4 A;  4EYC A;  5LC7 A;  1IV9 A;  3PXM A;  1A67 A;  1TIJ A;  3IMA B;  3L0R A;  1ROA A;  1LXE A;  1MNL A;  1GD3 A;  2KXG A;  5ELJ A;  3GAX A;  2W9Q A;  4CCV A;  3QRD A;  4N6M A;  3S67 A;  3PYJ A;  1G96 A;  4N6L A;  3MWZ A;  4N6T A;  1M9G A;  1N5P A;  1FUW A;  1RN7 A;  3UL6 A;  4IT7 A;  4N6N B;  1CEW I;  3K9M C;  3KFQ C;  1KWI A;  1WNH A;  1N9J A;  2O9U X;  1A90 A;  3NX0 A;  4N6V 0;  5ELU A;  1EQK A; 
#chains in the Genus database with same CATH topology
 5D83 A;  3SYU A;  1GY7 A;  3N54 B;  1KC8 4;  4KFE A;  1VQ5 3;  1NB5 I;  3KZT A;  2CW9 A;  5CF1 A;  2IYJ A;  2F99 A;  1YIJ 3;  3F8H A;  1FUS A;  2O3O A;  3JUN A;  1BNJ A;  1OCV A;  1IT7 A;  3OV4 A;  1UUV B;  3DGY A;  1UGI A;  3EF8 A;  1B2U A;  3K63 A;  1FUT A;  1BAO A;  2IY2 A;  3NBB A;  3F9S A;  4R9L A;  1OGZ A;  3FLJ A;  1OF5 B;  3S28 A;  5AEU B;  1CH0 A;  1W00 A;  3I55 3;  3G6E 3;  4N6O B;  1DVC A;  1OGX A;  1VQ9 3;  3JUM A;  1IQ8 A;  3EQQ B;  2CKF B;  2XSH B;  7GSP A;  1JBT A;  5G1L A;  2XSO B;  4BTW A;  1IU7 A;  3MG2 A;  4STD A;  1RN4 A;  1R4C A;  3WOD G;  2XR8 B;  2KF3 A;  1JJ2 2;  1TU5 A;  2CFD A;  2OOV C;  1E97 A;  3EE1 A;  1IK3 A;  2L1S A;  1F8N A;  2W9P A;  3LT9 A;  1OHO A;  3ECF A;  1QAL A;  3QK9 A;  2H0I A;  1JB5 A;  3WR2 A;  1EG9 B;  3BNE A;  8RNT A;  1N8Q A;  1PY3 A;  3BNB A;  3K0Z A;  4RBN A;  3SED A;  1VQM 3;  3V99 A;  1BNR A;  4TX4 A;  2OWP A;  1MGR A;  1CYV A;  1HU9 A;  2ZA4 A;  4RNZ A;  1UCI A;  3NQY A;  3MG3 A;  1UGH I;  2HMK B;  5DRV A;  3VSY A;  2XGN A;  1SQW A;  1CQS A;  3MYT A;  1B2S A;  1GD4 A;  4I4K A;  4DKI A;  4RNY A;  1FGT A;  2K3D A;  1MWR A;  1RNB A;  2F56 A;  2BU4 A;  1A2P A;  1TFK A;  2W03 A;  3SOA A;  1IVU A;  1TIJ A;  1IDP A;  4LYL B;  2P0M A;  5CF2 A;  5AEW B;  2FGT A;  4WWU C;  2B1X B;  1QAK A;  1Q40 A;  1O7H B;  4HJL B;  4AKZ A;  4BL3 A;  3N9H A;  4KT3 B;  1V58 A;  1STD A;  1JZO A;  2H0G A;  3ZG0 A;  4BTX A;  1VQN 3;  1BOX A;  1E3V A;  3V98 A;  1AV4 A;  1BNS A;  2RSX A;  3LTA A;  5EEO A;  3KN4 A;  5JBS A;  2CX1 A;  2PNC A;  3DM8 A;  2HML B;  3K5T A;  2ZDJ A;  4BL2 A;  1I3F A;  3CCQ 3;  3X3Z A;  5BXQ A;  1T5Y A;  2Z77 A;  3AMO B;  4R4K A;  1M1K 4;  3KCH A;  2BIR A;  1O7M B;  5TGN A;  2CFG A;  3SX1 A;  4WFO A;  1B21 A;  4XM4 A;  1V57 A;  2CK3 H;  1W6G A;  3A5E A;  1RJO A;  3AHW A;  3SOY A;  1W02 A;  3DH2 A;  1BIR A;  3FH1 A;  1BSE A;  2OQE A;  4NPB A;  1M9G A;  3DGM A;  1RN7 A;  1RGG A;  1RTU A;  2RCD A;  4IT7 A;  1JB2 A;  3FF0 A;  3NBJ A;  2GEY A;  1JN5 A;  2ML6 A;  1G02 A;  3WMD A;  1RGF A;  1CEW I;  1Y4K A;  3KFQ C;  4HKV B;  1WNH A;  1JNQ A;  1N9J A;  3X3Y A;  3D4A A;  4HM4 B;  5JPP A;  3PCR A;  2MC8 A;  2V1L A;  3NM7 A;  4MJD A;  1U5O A;  1VQL 3;  2BNG A;  1EEJ A;  3FKA A;  5EVH A;  2CC3 A;  1I0V A;  4H3U A;  5KP1 A;  1B3S A;  1JKG B;  1RN1 A;  1UUG B;  2I9W A;  2GXF A;  4KVH A;  5CLK A;  3G4S 3;  1NDO B;  2QEX 3;  4JF8 A;  3NV0 A;  3X40 A;  3D9R A;  1YNV X;  3LOY A;  4H61 A;  2W2C A;  3FG1 A;  5M19 A;  1BRG A;  2RFR A;  4NHF A;  4HOH A;  4J9A A;  4RNT A;  1MWS A;  3F14 A;  3FGY A;  1IV7 A;  2CWT A;  7RNT A;  3BLZ A;  5LC6 A;  5AIF A;  3JUQ A;  3B4P A;  1BRS A;  2GEX A;  3GZB A;  1IVV A;  4FMA A;  3HOH A;  1YJW 3;  3E99 A;  3EJV A;  4FCJ A;  1RRH A;  1JBS A;  1O7P B;  1BSA A;  2R41 A;  2HMN B;  1ZGX A;  5CK6 A;  4CJN A;  1TUH A;  2CX0 A;  1I3I A;  3KKG A;  1FGO A;  1B2Z A;  3NUV A;  4GHO A;  4HM1 B;  5AYS C;  3CCS 3;  2CFK A;  1GMP A;  2KRT A;  2W6J H;  3Q1C A;  2F4Y A;  2GSP A;  1N5H A;  2Z76 A;  5KP3 A;  5IW9 A;  1R4Y A;  3AGO A;  4U13 A;  1RGK A;  1AQZ A;  1BNI A;  2F98 A;  2ML5 A;  3CPO A;  1OH0 A;  3Q2P A;  4O3V A;  3X3X A;  4IPB A;  2LYX A;  3LZA A;  1LOW A;  3OX9 A;  2AAD A;  3BU4 A;  1MOL A;  1YGE A;  5EQL A;  8CHO A;  1X1X A;  5HOH A;  3A76 A;  1BUQ A;  5AIG A;  1HZ1 A;  2BMO B;  4N6U A;  4GL6 A;  1IQX A;  5G1K A;  3RNT A;  1OPY A;  1RDS A;  1UCL A;  2W56 A;  3GRD A;  4HAA A;  3CC2 3;  3DGL A;  1O7N B;  2YFL B;  4OK0 A;  3CD6 3;  6RNT A;  3UNL A;  1UW1 A;  1QJG A;  2J8X B;  1C7H A;  1WMN A;  5BU4 A;  3D79 A;  1QMA A;  2UGI A;  1QVF 2;  3STD A;  4HM3 B;  3ZG5 A;  4EC6 A;  4LZI A;  3NXJ A;  3BIR A;  1LRA A;  4LSO A;  1B27 A;  3VGN A;  1T3B A;  3DUK A;  3EB8 A;  1N8R 4;  3Q90 A;  1ULJ B;  1IV9 A;  4I5Q A;  1X1W A;  5IG4 A;  1WQL B;  2C11 A;  1KSI A;  1ROV A;  1W2Z A;  2A15 A;  3DGN A;  5M18 A;  3NBR A;  1SPU A;  1LNI A;  1BVI A;  3L0R A;  1BUJ A;  1W01 A;  3CMA 3;  1BRI A;  3LTD A;  1OF5 A;  3GZY B;  4HM6 B;  1W2B 2;  1UCK A;  5AII A;  2SAR A;  1JBR A;  1MNL A;  2W0Q A;  1GD3 A;  3OXA A;  1O7W B;  2KXG A;  1Q7H A;  3Q3F A;  2BT3 A;  1Q7Y 4;  1BNG A;  3V92 A;  2W9Q A;  3QRD A;  1BAN A;  4NRE A;  3MPH A;  2P38 A;  1RHL A;  1ULI B;  3BND A;  1BGS A;  1SJW A;  3DMC A;  4R1K A;  4QWT A;  4MEI A;  3CNX A;  5STD A;  1FGM A;  1RCK A;  2Y74 A;  1K41 A;  1A2K A;  1D6Y A;  2R4I A;  1PYL A;  4AEQ A;  5BVB A;  4FMC A;  1Z1S A;  1T2H A;  2GU1 A;  2WOH A;  3SLU A;  1MWU A;  2CFL A;  1K8A 4;  4KFD A;  1B2M A;  3EN8 A;  4MMY B;  4XBY A;  4X2H A;  3EHC A;  4WYK A;  1UDI I;  4K1U A;  1W6Y A;  4LEH A;  1DE3 A;  1Q40 B;  3GWR A;  1D6U A;  3WA3 A;  6STD A;  3CCM 3;  1BRN L;  2E2T A;  2CHC A;  1VQK 3;  1KQS 2;  4N3V A;  2WGQ A;  3I56 3;  1BRK A;  4O8S A;  3H51 A;  1C54 A;  1Q81 4;  3NX0 A;  4N6V 0;  1YJ9 3;  3ZFZ A;  1HKX A;  3DGO A;  3F7X A;  3D3L A;  5ELU A;  4EV2 A;  3LML A;  1ZS7 A;  3KII A;  1UCJ A;  3CCR 3;  1VZZ A;  2QGU A;  4L7K A;  3EN1 B;  3T8N A;  1RKY A;  3URP A;  3UL5 A;  4RZM A;  2BHM A;  5BIR A;  1JN5 B;  2Q07 A;  3LTC A;  1GYB A;  4R9K A;  2CH9 A;  1LOX A;  2P09 A;  3EX9 A;  3ER7 A;  1I2F A;  3B8L A;  1PFP A;  1STF I;  1IT8 A;  4CPK A;  1RNT A;  2RGQ A;  3IJE B;  3PZW A;  1B20 A;  5IG0 A;  2AAE A;  5GSP A;  2H0H A;  1I8V A;  3U97 A;  1G0T A;  1WMP A;  1LOV A;  2ZL8 A;  2BMR B;  3F8X A;  1GS3 A;  3NV0 B;  5A0O B;  2PZV A;  1K73 4;  3T0U A;  3CCV 3;  3NHX A;  1RRL A;  1VQP 3;  4KFF A;  2UX0 A;  1SII A;  9RNT A;  3PGB A;  5M1A A;  1RLS A;  3G0K A;  2BO9 B;  3CCL 3;  1YI2 3;  1CYU A;  1SAR A;  1EUI C;  1ISK A;  2XF3 A;  3GZR A;  3TDG A;  4EBG A;  4GSP A;  2C4B A;  1JKG A;  4HM5 B;  1YVS A;  1DYU A;  2D42 A;  4FMB A;  2F5M A;  3FF2 A;  2OCT A;  1YHQ 3;  1RMS A;  2M7O A;  3M8C A;  3HII A;  4XBX A;  5JPU A;  1S72 3;  3MG1 A;  4EYC A;  1K9M 4;  2WGO A;  2RNT A;  2XFT A;  2KCD A;  3JUP A;  3CCJ 3;  4MMX B;  3DXO A;  2OOV A;  2CIU A;  2CG0 A;  3CNM A;  1TFO A;  4HZB B;  1GOY A;  2CFW A;  1PU4 A;  1Q82 4;  2HOH A;  2QIY A;  2OQE C;  2CG1 A;  1Q9E A;  3I0Y A;  1VQ7 3;  1RGH A;  2KF5 A;  3IMA B;  5FGO A;  1BNF A;  5IEO A;  3RGA A;  6GSP A;  5IG5 A;  1VQ6 3;  1E3R A;  2Z7A A;  1X1U A;  4MMZ B;  1N9E A;  4R80 A;  3AGN A;  1JRQ A;  1Q42 A;  1BSC A;  3F7S A;  1LXE A;  4O2H A;  3CU3 A;  4BTY A;  2IA7 A;  3B4O A;  5ELJ A;  1BSD A;  2XFS A;  3GAX A;  3WA2 X;  2BMQ B;  2XEP A;  2FXT A;  4N6M A;  1WMO A;  5KP4 A;  3OWY A;  1L5G B;  1BRH A;  2L4V A;  3S67 A;  3U1W A;  3PYJ A;  3HK4 A;  1G96 A;  1IQY A;  4HZ9 B;  4X2O A;  3O8Y A;  3GSP A;  1JB4 A;  4XDW A;  1EKM A;  3KSP A;  1UI7 A;  4N6T A;  4LMI A;  2GBX B;  3G16 A;  3GZX B;  2IUK A;  3JUO A;  3J7Y d;  3N8B A;  1N5P A;  3HI7 A;  3EBT A;  3UL6 A;  1V74 A;  1RSN A;  5AYR B;  2JQ5 A;  1IVX A;  3T8U A;  1RGA A;  2XH9 A;  4EW5 A;  1QVG 2;  1TP6 A;  4OVM A;  2D1W A;  4GB5 A;  1OUN A;  1M90 4;  1TRQ A;  1GY5 A;  5DRE A;  1I2E A;  2CWU A;  1KWI A;  3F40 A;  3SXX A;  1I2G A;  3RGR A;  5RNT A;  3OWS A;  2C10 A;  1DET A;  1TJD A;  1LNH A;  1VQQ A;  2XRX B;  3JVC A;  4HYZ A;  4O02 B;  3RDE A;  1VQO 3;  3VF1 A;  3D5G A;  3HX8 A;  4HM2 B;  2MF7 A;  4WP5 A;  3CXC 2;  1VQ4 3;  1NWW A;  1BSB A;  5G2G A;  4FMD A;  1U8C B;  2K0M A;  1AY7 A;  3EC9 A;  4XBT A;  4WHA A;  1GY6 A;  1DMM A;  2E2V A;  3K7C A;  4Q53 A;  1AVL A;  1Q86 4;  2OTL 3;  2RBI A;  1NU3 A;  3HZP A;  4KZ1 A;  4BIR A;  3G71 3;  3CPW 2;  3S27 A;  1YVB I;  3AHS A;  2W04 A;  1TRP A;  2UUG C;  1GOU A;  3LH4 A;  1YIT 3;  4BU4 A;  1QAF A;  3LTB A;  2K54 A;  2STD A;  4J5G A;  2INX A;  2XGL A;  4WYK B;  3CC7 3;  1OHP A;  3PS8 A;  2P0X A;  4CDL A;  1W6C A;  2B24 B;  4L8P A;  1FZU A;  4XDV A;  3FG3 A;  1DMN A;  3S5C A;  1DVD A;  2Z6B A;  1BNE A;  2HMJ B;  3FSD A;  1RGL A;  3FCS B;  2KAA A;  1AVK A;  3D5I A;  3H3H A;  1AR0 A;  2CWV A;  3WDG B;  1GSP A;  2GU3 A;  1IVW A;  2F5W A;  1VQ8 3;  3MSO A;  5AI1 A;  4ZM8 A;  1X1Y A;  4PEJ A;  3DZL A;  5IEP A;  2YFI B;  3DY5 A;  1A2V A;  2LQV A;  1GMR A;  2P05 A;  5IG3 A;  3AMO A;  1LVN A;  1NB3 I;  1FA3 A;  1BRJ A;  3KSE D;  1UI8 A;  3NQZ A;  4K90 B;  4HVN A;  1W4N A;  1T2I A;  4FCZ A;  1RGE A;  1LQG C;  4HM0 B;  4K61 A;  3SVA A;  3X41 A;  2KF4 A;  1LOY A;  1GOV A;  1I70 A;  4K1V A;  1NNV A;  5LC7 A;  3UJM A;  1OHS A;  1S5A A;  3CME 3;  3BNC A;  1O7G B;  1NO3 A;  4FR9 A;  2WO0 A;  4J8T A;  4IIA A;  1M1X B;  3CCE 3;  3PXM A;  1A67 A;  1EA2 A;  1BU4 A;  1W5Z A;  3HIG A;  4AKY A;  1US1 A;  1I0X A;  1LQM B;  5HGR A;  3WOE B;  2YFJ B;  4JRF A;  1K28 A;  2E2U A;  1JZD A;  2HMM B;  1DMQ A;  5IEN A;  1RCL A;  4HBR A;  1ROA A;  2GBW B;  3LYG A;  3OWU A;  1GMQ A;  2HMO B;  3KE7 A;  2KF6 A;  2IMJ A;  5D81 A;  4J5K A;  3PCS A;  2SBL A;  4CCV A;  1MGW A;  3LT8 A;  2FNQ A;  3LXU X;  2JDI H;  2QA4 3;  4OUQ A;  4G1M B;  5IER A;  1TTO A;  1JV2 B;  4L8O A;  1HYF A;  4LGQ A;  3WHO A;  4EV5 A;  3BB9 A;  4N6L A;  3MHE A;  3MWZ A;  1FYS A;  2YX9 A;  4ILF A;  1UUW B;  1RGC A;  3UB1 A;  1SIH A;  1FUW A;  5D82 A;  1FW7 A;  4HM7 B;  1ZO2 A;  1YJN 3;  4N6N B;  1W7C A;  3MKI A;  4HM8 B;  5I97 A;  1WTH A;  3K9M C;  3IPT A;  4EXR A;  1NJI 4;  1J2B A;  1D6Z A;  1IYY A;  1OAC A;  4XB5 A;  1FGQ A;  2O9U X;  2IUJ A;  3OW2 2;  3EBY A;  1ASK A;  2W56 B;  3FZW A;  3S29 A;  5AIH A;  1A90 A;  3ALA A;  2WOF A;  2ZHX B;  3CC4 3;  2Y73 A;  5IF6 A;  4ORL A;  5FW5 A;  7STD A;  3G8Z A;  3WOF B;  5CXO A;  4FCM A;  3FG4 A;  2F86 B;  1B2X A;  3ROB A;  1MWT A;  1FGR A;  1KD1 4;  1YGW A;  3B7C A;  3NM2 A;  3CCU 3;  3X42 A;  1ZX2 A;  2OTJ 3;  1EQK A; 
#chains in the Genus database with same CATH homology
 5D83 A;  1KC8 4;  1GY7 A;  3N54 B;  4KFE A;  1VQ5 3;  1NB5 I;  3KZT A;  2CW9 A;  5CF1 A;  1YIJ 3;  2F99 A;  3F8H A;  2O3O A;  3JUN A;  3OV4 A;  1OCV A;  1IT7 A;  5D81 A;  1UUV B;  3NBB A;  3EF8 A;  3K63 A;  5AEU B;  3F9S A;  4R9L A;  1OGZ A;  3FLJ A;  1OF5 B;  3S28 A;  3I55 3;  1W00 A;  3G6E 3;  4N6O B;  1DVC A;  1OGX A;  1VQ9 3;  3JUM A;  1IQ8 A;  3EQQ B;  2CKF B;  2XSH B;  4BTW A;  2XSO B;  1IU7 A;  3MG2 A;  4STD A;  1R4C A;  3WOD G;  2XR8 B;  1JJ2 2;  1TU5 A;  2CFD A;  2OOV C;  1E97 A;  3EE1 A;  1IK3 A;  1F8N A;  2W9P A;  3LT9 A;  1OHO A;  3ECF A;  1QAL A;  3QK9 A;  1JB5 A;  1EG9 B;  3BNE A;  1N8Q A;  3BNB A;  3K0Z A;  4RBN A;  3SED A;  1VQM 3;  3V99 A;  4TX4 A;  2OWP A;  1CYV A;  1HU9 A;  4RNZ A;  3NQY A;  3MG3 A;  2HMK B;  5DRV A;  3VSY A;  2XGN A;  1SQW A;  1CQS A;  3MYT A;  1GD4 A;  4I4K A;  4RNY A;  1FGT A;  2W03 A;  4BTY A;  1TFK A;  3SOA A;  5CF2 A;  1IVU A;  1TIJ A;  1IDP A;  2P0M A;  5AEW B;  2FGT A;  4WWU C;  2B1X B;  1QAK A;  1Q40 A;  1O7H B;  4HJL B;  4AKZ A;  3N9H A;  1VQN 3;  1STD A;  4BTX A;  3V98 A;  1E3V A;  1AV4 A;  3LTA A;  2RSX A;  5EEO A;  5JBS A;  3KN4 A;  2PNC A;  3DM8 A;  2HML B;  3K5T A;  2ZDJ A;  3CCQ 3;  3X3Z A;  5BXQ A;  1T5Y A;  2Z77 A;  3AMO B;  4R4K A;  1M1K 4;  1O7M B;  5TGN A;  2CFG A;  3SX1 A;  4WFO A;  4XM4 A;  2CK3 H;  1W6G A;  1RJO A;  3SOY A;  1W02 A;  3FH1 A;  2OQE A;  1M9G A;  3DGM A;  1RN7 A;  4IT7 A;  2RCD A;  1JB2 A;  3FF0 A;  3NBJ A;  2GEY A;  1JN5 A;  2ML6 A;  3WMD A;  1CEW I;  1Y4K A;  3KFQ C;  4HKV B;  1WNH A;  1JNQ A;  1N9J A;  3X3Y A;  5JPP A;  4HM4 B;  3PCR A;  2MC8 A;  2V1L A;  3NM7 A;  4MJD A;  1U5O A;  1VQL 3;  2BNG A;  3FKA A;  5EVH A;  2CC3 A;  4H3U A;  5KP1 A;  2I9W A;  1JKG B;  4KVH A;  2GXF A;  5CLK A;  3G4S 3;  1NDO B;  2QEX 3;  4JF8 A;  3NV0 A;  3X40 A;  3D9R A;  3LOY A;  4H61 A;  2W2C A;  3FG1 A;  2RFR A;  4NHF A;  4J9A A;  3F14 A;  3FGY A;  1IV7 A;  2CWT A;  3BLZ A;  5LC6 A;  5AIF A;  3JUQ A;  3B4P A;  2GEX A;  1YJW 3;  3GZB A;  1IVV A;  4FMA A;  3E99 A;  3EJV A;  4FCJ A;  1RRH A;  1O7P B;  2HMN B;  5CK6 A;  1TUH A;  3CCS 3;  3KKG A;  1FGO A;  3NUV A;  4HM1 B;  5AYS C;  2CFK A;  2KRT A;  2W6J H;  3Q1C A;  5KP3 A;  5IW9 A;  1N5H A;  2Z76 A;  4U13 A;  2F98 A;  2ML5 A;  3CPO A;  1OH0 A;  3Q2P A;  4O3V A;  3X3X A;  4IPB A;  2LYX A;  3LZA A;  5EQL A;  3OX9 A;  8CHO A;  1YI2 3;  1MOL A;  1YGE A;  1BUQ A;  3A76 A;  5AIG A;  2BMO B;  4N6U A;  4GL6 A;  1IQX A;  1OPY A;  2W56 A;  3GRD A;  3CC2 3;  3DGL A;  1O7N B;  2YFL B;  4OK0 A;  3CD6 3;  3UNL A;  1UW1 A;  1QJG A;  1C7H A;  1WMN A;  1QMA A;  1QVF 2;  3STD A;  4HM3 B;  4EC6 A;  4LZI A;  3NXJ A;  4LSO A;  3VGN A;  3DUK A;  3EB8 A;  1N8R 4;  3Q90 A;  1ULJ B;  1IV9 A;  5IG4 A;  1WQL B;  2C11 A;  1KSI A;  1ROV A;  1W2Z A;  2A15 A;  3DGN A;  3NBR A;  1SPU A;  3L0R A;  1W01 A;  3CMA 3;  3LTD A;  1OF5 A;  3GZY B;  4HM6 B;  1W2B 2;  5AII A;  1MNL A;  2W0Q A;  1GD3 A;  3OXA A;  1O7W B;  2KXG A;  2BT3 A;  1Q7Y 4;  3V92 A;  2W9Q A;  3QRD A;  4NRE A;  3MPH A;  2P38 A;  1ULI B;  3BND A;  1SJW A;  3DMC A;  4R1K A;  4QWT A;  4MEI A;  3CNX A;  5STD A;  1FGM A;  2Y74 A;  1K41 A;  1A2K A;  1D6Y A;  2R4I A;  4AEQ A;  5BVB A;  4FMC A;  1Z1S A;  2GU1 A;  3SLU A;  2WOH A;  2CFL A;  1K8A 4;  4KFD A;  3EN8 A;  4MMY B;  4XBY A;  4X2H A;  3EHC A;  4WYK A;  4K1U A;  1W6Y A;  4LEH A;  1Q40 B;  3GWR A;  1D6U A;  3WA3 A;  6STD A;  3CCM 3;  2E2T A;  2CHC A;  1VQK 3;  1KQS 2;  4N3V A;  2WGQ A;  3I56 3;  4O8S A;  3H51 A;  1Q81 4;  3NX0 A;  4N6V 0;  1YJ9 3;  1HKX A;  3DGO A;  3F7X A;  3D3L A;  5ELU A;  4EV2 A;  3LML A;  3KII A;  3CCR 3;  1VZZ A;  2QGU A;  4L7K A;  3EN1 B;  3T8N A;  1RKY A;  3UL5 A;  4RZM A;  2BHM A;  1JN5 B;  2Q07 A;  3LTC A;  1GYB A;  4R9K A;  2CH9 A;  1LOX A;  2P09 A;  3EX9 A;  3ER7 A;  3B8L A;  1PFP A;  1STF I;  1IT8 A;  2RGQ A;  3IJE B;  3PZW A;  5IG0 A;  3U97 A;  1WMP A;  2ZL8 A;  2BMR B;  3F8X A;  1GS3 A;  3NV0 B;  5A0O B;  2PZV A;  1K73 4;  3T0U A;  3CCV 3;  3NHX A;  1RRL A;  1VQP 3;  4KFF A;  2UX0 A;  1SII A;  3PGB A;  3G0K A;  2BO9 B;  3CCL 3;  1CYU A;  1ISK A;  2XF3 A;  3GZR A;  3TDG A;  4EBG A;  1JKG A;  4HM5 B;  1DYU A;  2D42 A;  4FMB A;  3FF2 A;  1YHQ 3;  2OCT A;  2M7O A;  3M8C A;  3HII A;  4XBX A;  5JPU A;  1S72 3;  3MG1 A;  4EYC A;  1K9M 4;  2WGO A;  2XFT A;  2KCD A;  3JUP A;  3CCJ 3;  4MMX B;  3DXO A;  2OOV A;  2CIU A;  2CG0 A;  3CNM A;  1TFO A;  4HZB B;  2CFW A;  1PU4 A;  1Q82 4;  2CG1 A;  2QIY A;  2OQE C;  1VQ7 3;  3I0Y A;  3IMA B;  5FGO A;  5IEO A;  3RGA A;  1VQ6 3;  5IG5 A;  1E3R A;  2Z7A A;  4MMZ B;  1N9E A;  4R80 A;  1JRQ A;  1Q42 A;  3F7S A;  1LXE A;  4O2H A;  3CU3 A;  2IA7 A;  3B4O A;  5ELJ A;  2XFS A;  3GAX A;  5KP4 A;  3WA2 X;  2BMQ B;  2XEP A;  2FXT A;  4N6M A;  1WMO A;  3OWY A;  1L5G B;  2L4V A;  3S67 A;  3U1W A;  3PYJ A;  3HK4 A;  1G96 A;  1IQY A;  4HZ9 B;  4X2O A;  3O8Y A;  1JB4 A;  4XDW A;  1EKM A;  3KSP A;  1UI7 A;  4N6T A;  4LMI A;  2GBX B;  3G16 A;  3GZX B;  2IUK A;  3JUO A;  3J7Y d;  3N8B A;  1N5P A;  3HI7 A;  3EBT A;  3UL6 A;  1V74 A;  5AYR B;  2JQ5 A;  1IVX A;  3T8U A;  2XH9 A;  1QVG 2;  1TP6 A;  4OVM A;  2D1W A;  4GB5 A;  1OUN A;  1M90 4;  1GY5 A;  5DRE A;  2CWU A;  1KWI A;  3F40 A;  3SXX A;  3RGR A;  3OWS A;  2C10 A;  1LNH A;  2XRX B;  3JVC A;  3RDE A;  4HYZ A;  4O02 B;  1VQO 3;  3VF1 A;  3HX8 A;  4HM2 B;  2MF7 A;  4WP5 A;  3CXC 2;  1VQ4 3;  1NWW A;  5G2G A;  4FMD A;  1U8C B;  2K0M A;  3EC9 A;  4XBT A;  4WHA A;  1GY6 A;  1DMM A;  2E2V A;  3K7C A;  4Q53 A;  1AVL A;  1Q86 4;  2OTL 3;  1NU3 A;  3HZP A;  4KZ1 A;  3CPW 2;  3G71 3;  3S27 A;  1YVB I;  2W04 A;  1YIT 3;  3LH4 A;  1QAF A;  3LTB A;  2K54 A;  2STD A;  2INX A;  2XGL A;  4WYK B;  3CC7 3;  1OHP A;  3PS8 A;  2P0X A;  4CDL A;  1W6C A;  2B24 B;  4L8P A;  4XDV A;  3FG3 A;  1DMN A;  3S5C A;  1DVD A;  2Z6B A;  2HMJ B;  3FSD A;  3FCS B;  1AVK A;  3H3H A;  1AR0 A;  2CWV A;  3WDG B;  2GU3 A;  1IVW A;  1VQ8 3;  3MSO A;  5AI1 A;  4ZM8 A;  4PEJ A;  3DZL A;  5IEP A;  2YFI B;  3DY5 A;  1A2V A;  2LQV A;  2P05 A;  5IG3 A;  3AMO A;  1LVN A;  1NB3 I;  1FA3 A;  3KSE D;  1UI8 A;  3NQZ A;  4K90 B;  4HVN A;  1W4N A;  4FCZ A;  4K61 A;  3SVA A;  4HM0 B;  3X41 A;  5LC7 A;  3CME 3;  4K1V A;  3UJM A;  1OHS A;  1S5A A;  3BNC A;  1O7G B;  1NO3 A;  4FR9 A;  2WO0 A;  4J8T A;  4IIA A;  1M1X B;  3CCE 3;  3PXM A;  1A67 A;  1EA2 A;  3HIG A;  1W5Z A;  4AKY A;  1US1 A;  5HGR A;  3WOE B;  2YFJ B;  4JRF A;  1K28 A;  2E2U A;  2HMM B;  1DMQ A;  5IEN A;  4HBR A;  1ROA A;  2GBW B;  3LYG A;  3OWU A;  2HMO B;  3KE7 A;  2IMJ A;  3PCS A;  2SBL A;  4CCV A;  3LT8 A;  2FNQ A;  3LXU X;  2JDI H;  2QA4 3;  4OUQ A;  4G1M B;  5IER A;  1JV2 B;  4L8O A;  4LGQ A;  4EV5 A;  3BB9 A;  4N6L A;  3MHE A;  3MWZ A;  2YX9 A;  1UUW B;  3UB1 A;  1SIH A;  1FUW A;  5D82 A;  4HM7 B;  1ZO2 A;  1YJN 3;  4N6N B;  1W7C A;  3MKI A;  4HM8 B;  5I97 A;  1WTH A;  3K9M C;  3IPT A;  4EXR A;  1NJI 4;  1J2B A;  1D6Z A;  1OAC A;  4XB5 A;  1FGQ A;  2O9U X;  2IUJ A;  3OW2 2;  3EBY A;  1ASK A;  2W56 B;  3FZW A;  3S29 A;  5AIH A;  1A90 A;  3ALA A;  2WOF A;  3CC4 3;  2Y73 A;  5IF6 A;  4ORL A;  5FW5 A;  7STD A;  3G8Z A;  3WOF B;  5CXO A;  4FCM A;  3FG4 A;  2F86 B;  3ROB A;  1KD1 4;  1FGR A;  3B7C A;  3NM2 A;  3CCU 3;  3X42 A;  1ZX2 A;  2OTJ 3;  1EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...