1A2PA

Barnase wildtype structure at 1.5 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Refinement and structural analysis of barnase at 1.5 A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Ribonuclease
total genus 36
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1a2pA00
4J5GA 3URPA 1RHLA 3AHSA 1B2ZA 3HOHA 1UCJA 1BUJA 1GSPA 1DETA 1I8VA 1BNIA 1I2EA 1TTOA 2KF4A 3DH2A 3AGNA 3BU4A 1B2XA 1MGRA 5BIRA 1BNRA 1BSEA 1PYLA 2F56A 1I2GA 2SARA 2KAAA 2C4BA 3WHOA 3WR2A 3AHWA 1FYSA 1BRSA 1BNFA 1RGGA 1DE3A 6GSPA 2F5WA 1BSBA 2KF3A 1B2MA 1B21A 2RBIA 1IYYA 4J5KA 1RGKA 1GOVA 1GMPA 1B2UA 1RGAA 6RNTA 1JBTA 1BRIA 1UCKA 1BRGA 1I70A 1X1UA 1T2IA 3D4AA 2HOHA 1RMSA 4RNTA 1BRHA 3SYUA 1CH0A 1RGHA 1BRKA 4HOHA 2ZA4A 3RNTA 1A2PA 1GOUA 1AY7A 1RGLA 1X1XA 1JBSA 3D5IA 1BNJA 2KF6A 2AAEA 1B2SA 1RGEA 1TRQA 1LNIA 2BIRA 2RNTA 1RCLA 1BNSA 1BVIA 1FUTA 1RN1A 1Q9EA 1I3FA 1BSDA 5BU4A 8RNTA 1SARA 3AGOA 1X1WA 1BSCA 1RNTA 3DGYA 1C54A 4HAAA 1BSAA 1RDSA 9RNTA 1FZUA 5HOHA 1BNGA 1T2HA 1B3SA 7RNTA 4GHOA 5RNTA 1GOYA 1RLSA 1MGWA 7GSPA 1BU4A 1I0XA 1RCKA 1LOWA 1BANA 1RTUA 1B27A 1YVSA 3D5GA 1LOVA 5GSPA 1BNEA 1G02A 1RGFA 1UCLA 1FW7A 1LOYA 1TRPA 3Q3FA 2F5MA 2AADA 1BAOA 1BIRA 3BIRA 1I2FA 1R4YA 1HZ1A 1RGCA 1HYFA 1YGWA 2F4YA 1FUSA 1AQZA 1YNVX 1I0VA 1ZGXA 1BGSA 1RNBA 1JBRA 3GSPA 1UCIA 4BU4A 3KCHA 1RSNA 4GSPA 2GSPA 1LRAA 1PY3A 1BOXA 2KF5A 1X1YA 4BIRA 1BRNL 2BU4A 1BRJA 1GMQA 1GMRA 1B20A 1RN4A 1I3IA 3A5EA
chains in the Genus database with same CATH superfamily
1DVCA 1WMNA 1W7CA 1GY7A 4J5GA 1RHLA 5AYSC 3URPA 1O7GB 3KIIA 2FGTA 5AIFA 3S5CA 4EYCA 1QAKA 3HOHA 1KQS2 3OWYA 1KWIA 4XDWA 2YFJB 1OHSA 1JV2B 3CC43 3CCU3 3SOAA 4N6V0 2K0MA 2F98A 3DH2A 1TTOA 2Z76A 4MJDA 2ML5A 2R41A 4HKVB 3BU4A 5AIGA 1DVDA 3JUPA 1MGRA 1W5ZA 3CPOA 4K1VA 1YIT3 1QMAA 4N6TA 1BSEA 3FSDA 1A90A 3KSED 1U8CB 2C4BA 4IPBA 3NHXA 4O3VA 1OF5A 4NPBA 1FYSA 1CYVA 3WR2A 3CC23 2ZL8A 1DE3A 3FLJA 2F5WA 2CFDA 3LOYA 1PU4A 5A0OB 3GRDA 1IYYA 2SBLA 4X2OA 1NNVA 1GOVA 1DYUA 1B2UA 1NB3I 1RGAA 3B4PA 1BRIA 1JB2A 3UL6A 1EKMA 4IT7A 4U13A 1HU9A 3N8BA 2MF7A 3O8YA 1Q864 3D4AA 1MWSA 3IJEB 1GD3A 3LYGA 1J2BA 3RGRA 1RMSA 1UUVB 1NDOB 3PXMA 1CYUA 5D83A 1OCVA 4HOHA 5JPUA 2HMLB 1A2PA 1W00A 1AVLA 2CFWA 5DRVA 2BMRB 1AY7A 4KT3B 3B8LA 1AR0A 5AIIA 3LH4A 3DGOA 4RNYA 3FG3A 1O7WB 1RCLA 2ML6A 1BNSA 2CG0A 2RNTA 3Q2PA 3GAXA 2W9QA 4N6OB 1Q9EA 3SX1A 1L5GB 3OX9A 4XB5A 8RNTA 1FGTA 2XH9A 4CPKA 3AGOA 1NWWA 4R9KA 4FMAA 4HJLB 1BSCA 1DMNA 3DGYA 1OHOA 4RBNA 5JPPA 1FZUA 2P0MA 7RNTA 2OCTA 3JUQA 5FW5A 2CH9A 1W02A 5AYRB 3E99A 5G2GA 2O9UX 1RKYA 4BTWA 4IIAA 1JB4A 1RCKA 1GD4A 2Y74A 4HVNA 4NHFA 1KD14 1UW1A 3D79A 4L8OA 1FUWA 2C10A 1LOVA 3LTCA 1KSIA 2GEYA 4LMIA 3AMOB 5GSPA 3X3YA 4STDA 1BNEA 5JBSA 1W2ZA 2R4IA 3NBRA 3K0ZA 4H61A 1VQ73 1G02A 5AI1A 4GB5A 4XM4A 3WA2X 3S27A 2OOVA 5KP1A 2YFLB 1Q7Y4 4NREA 4N6UA 1D6ZA 1TUHA 1W6CA 2CC3A 2AADA 2F5MA 2CWUA 1S5AA 3BIRA 4QWTA 1I2FA 3A76A 1N5HA 2F4YA 2H0HA 4HM1B 1AQZA 1Q42A 6STDA 1G96A 1NU3A 1ZGXA 4BTYA 3GSPA 4XBYA 3DGLA 7STDA 1V74A 5AEUB 2QEX3 1SIHA 1G0TA 4R80A 2OTL3 4MEIA 5IG0A 1OUNA 2GU1A 1IU7A 3EBTA 3SOYA 3WOFB 2IUKA 2KF5A 1X1YA 3PZWA 4N6LA 4EC6A 1K41A 1LNHA 3V98A 2P05A 2PNCA 3B7CA 2OOVC 3KZTA 1K734 1YVBI 3UJMA 3KE7A 1GY5A 3BNCA 3F40A 4I4KA 2HMOB 2IYJA 2E2VA 2XSHB 1B2ZA 3M8CA 5KP4A 5BVBA 1DETA 1OGZA 2Z6BA 1I8VA 1NB5I 2D1WA 1TJDA 2UX0A 3SXXA 2Q07A 4TX4A 1I2EA 3WODG 1YJ93 4R1KA 4WHAA 5BIRA 3FCSB 2M7OA 1SPUA 2P38A 3EX9A 2SARA 4H3UA 4L7KA 1IK3A 3CCM3 2OTJ3 4AKZA 1LOXA 1W4NA 4DKIA 3MYTA 2H0GA 1RGGA 5G1LA 6GSPA 1B2MA 4JF8A 1B21A 3LT8A 4FMDA 3B4OA 2W0QA 2XFTA 2STDA 3BNDA 2OQEA 3JUNA 4CDLA 6RNTA 3LTBA 3MKIA 1JBTA 4AEQA 1VQ63 4LGQA 4KFDA 1T2IA 2XR8B 3VSYA 1M1K4 4RNTA 1OF5B 3SYUA 1US1A 1RGHA 3VF1A 5IF6A 1BRKA 4FR9A 2WOHA 4FMCA 3UL5A 1JN5A 5EVHA 3EQQB 5EQLA 1LQGC 1RGLA 4G1MB 3STDA 4FCMA 3HK4A 4XBTA 4HZBB 1B2SA 1E97A 1NJI4 3MG2A 1Z1SA 4HM2B 1LVNA 3S67A 3MPHA 1RJOA 4EV2A 4LSOA 1FUTA 1VQK3 1I3FA 2INXA 2OQEC 3K63A 5IEPA 4FCJA 4BL3A 2IY2A 1UI7A 2L4VA 3EC9A 1X1WA 3D3LA 1IV7A 3J7Yd 4HAAA 1RDSA 9RNTA 4BTXA 1BNGA 1T2HA 5CXOA 3CPW2 4ORLA 1ISKA 2KCDA 1EA2A 4FMBA 4JRFA 4XDVA 2GEXA 4N6NB 4KZ1A 1OGXA 7GSPA 3H3HA 4HM7B 1RTUA 1UUGB 3I563 2F99A 1B27A 1YVSA 1OH0A 5CLKA 3D5GA 1BUQA 2LYXA 1IVUA 2YFIB 3CCV3 4KFFA 1OACA 4WP5A 4XBXA 3FGYA 5D82A 3UB1A 2W2CA 1TU5A 3OW22 1UCLA 3EN8A 1YJW3 1DMMA 3G0KA 1RN7A 1Y4KA 1FGMA 1TRPA 3Q3FA 1JB5A 3G8ZA 3CCL3 4X2HA 4LEHA 2CFKA 5STDA 3NM7A 1BIRA 5HGRA 2CK3H 1VQO3 3DMCA 1FA3A 1HZ1A 1HYFA 1YGWA 3FH1A 3WOEB 1A2KA 3LXUX 1C7HA 1EQKA 1JBRA 1VQ83 3HI7A 3UNLA 1UCIA 1A2VA 3KCHA 1RSNA 1O7HB 1MWUA 1F8NA 5AEWB 3X3XA 4MMXB 2P09A 2QA43 2CWTA 2B1XB 1BOXA 3EB8A 3NXJA 4HYZA 1D6YA 2CW9A 3CC73 2BU4A 4RZMA 3F9SA 1GMQA 2F86B 2LQVA 4ZM8A 5M19A 4HZ9B 8CHOA 3T0UA 1GYBA 3CMA3 3A5EA 4R9LA 2ZHXB 1IVXA 3LZAA 3PGBA 5IEOA 3HIGA 2KRTA 3HIIA 3N9HA 1PFPA 1UCJA 2FNQA 3ER7A 4OUQA 1VQ53 4WYKB 3SVAA 3I553 1BUJA 1GSPA 1IDPA 2RSXA 2JQ5A 3OWUA 3GWRA 2KXGA 2KF4A 1JJ22 2UUGC 4EW5A 4O8SA 3JVCA 1ULJB 2GBWB 3AGNA 2J8XB 1RRLA 1B2XA 1LQMB 4HM0B 3EHCA 1YJN3 1EG9B 1BNRA 4O2HA 3LTAA 1N9JA 3NQZA 1PYLA 3CNMA 4WYKA 2WO0A 1MWTA 2QIYA 2HMKB 1NO3A 4CJNA 1BNFA 4WWUC 1YHQ3 4ILFA 1MWRA 3G6E3 3V99A 4J5KA 3NM2A 2I9WA 2RCDA 2BNGA 3LT9A 4I5QA 1IQ8A 1UCKA 1WMPA 2D42A 3G16A 3H51A 2FXTA 5TGNA 3BNEA 1M904 1ZX2A 3DZLA 3CCS3 1VQN3 1BRHA 1CH0A 1FGRA 3LMLA 1R4CA 4R4KA 1SQWA 2ZA4A 1KC84 4LYLB 1QAFA 2GU3A 2OWPA 1OPYA 3F8XA 3PCRA 5ELUA 3GZRA 3JUOA 1HKXA 1QVF2 1JBSA 2H0IA 3PS8A 2AAEA 1TRQA 1ZO2A 2BIRA 2E2UA 3I0YA 1VQL3 4N3VA 1W6GA 3NX0A 1BVIA 3NQYA 1RN1A 1TFKA 5BU4A 2CWVA 3KSPA 1VZZA 1JN5B 1ASKA 4K1UA 1Q824 1DMQA 3T8UA 1RNTA 1E3VA 3HZPA 2WGQA 2K54A 4FCZA 1BSAA 4WFOA 3K9MC 3CXC2 3IPTA 5RNTA 1N5PA 1GOYA 1GS3A 1RLSA 2MC8A 3DY5A 3ROBA 1BU4A 4CCVA 2BMOB 1T3BA 1BANA 1FGQA 2RGQA 1QVG2 3ECFA 1JNQA 3WA3A 5D81A 1N9EA 1WTHA 1LXEA 1ROVA 1MOLA 3FF0A 1IT8A 1RGFA 2A15A 1UGIA 1N8R4 2W9PA 3ZG5A 1LOYA 1JKGA 1T5YA 1JZOA 1ULIB 3MWZA 1BAOA 2CX1A 3NV0A 1STDA 3K5TA 3X40A 2Z77A 1R4YA 3S28A 1RGCA 2XEPA 4OK0A 1S723 1FUSA 3WDGB 1FGOA 1V57A 1YNVX 1RNBA 3ZFZA 1N8QA 3EN1B 3FF2A 1O7NB 4HM4B 5ELJA 3U1WA 4BU4A 1GY6A 1K28A 4GSPA 3BB9A 4Q53A 3SLUA 4O02B 3QK9A 3SEDA 2CFLA 2UGIA 4HBRA 3MHEA 2PZVA 1SIIA 3VGNA 3DUKA 3X42A 4BIRA 3Q90A 2IA7A 1BRJA 2W04A 2WOFA 3EE1A 1GMRA 1VQQA 1RN4A 5IG5A 1A67A 1YIJ3 1K8A4 2BO9B 3KKGA 1W2B2 3BLZA 3AHSA 3HX8A 3G4S3 2XGNA 3X3ZA 1TIJA 2CIUA 4HM8B 4J8TA 2W6JH 5G1KA 1QALA 5BXQA 2IMJA 2Y73A 3JUMA 2W03A 3NUVA 4HM3B 1BNIA 5LC6A 4PEJA 3CU3A 2HMMB 2GXFA 2RFRA 2HMJB 1EUIC 1VQ43 2XF3A 1K9M4 3EBYA 4LZIA 3BNBA 2CKFB 1YGEA 4N6MA 2F56A 1I2GA 1U5OA 3KFQC 1IT7A 3IMAB 3PYJA 2KAAA 5LC7A 3WHOA 1YI23 3AHWA 4RNZA 2XRXB 1BRSA 2BMQB 3FG4A 3GZBA 1BSBA 1UDII 2KF3A 3KN4A 5IERA 2RBIA 3CCE3 1MNLA 1RGKA 1RRHA 2YX9A 2K3DA 3L0RA 1GMPA 3OXAA 4K61A 3T8NA 4J9AA 1QJGA 1X1UA 1BRGA 1I70A 3DM8A 4GL6A 4MMYB 2HOHA 3NBBA 2E2TA 4EV5A 3EJVA 3DGMA 1OHPA 1IVVA 1VQM3 1O7MB 1Q7HA 3OV4A 3RNTA 3G713 1AV4A 5CF2A 1JRQA 3CCR3 1GOUA 3NBJA 5IW9A 4HM6B 1UI8A 3FZWA 4OVMA 1X1XA 5CF1A 3D5IA 1BNJA 1CQSA 1EEJA 2KF6A 3FKAA 1RGEA 1Q40B 1LNIA 2GBXB 1O7PB 2V1LA 2XFSA 2XSOB 5M1AA 5IENA 1TP6A 1VQP3 3K7CA 5CK6A 5M18A 1BSDA 1WNHA 1W6YA 3CME3 1SARA 5EEOA 1M1XB 1W01A 1C54A 3AMOA 2W56B 3MG1A 5AIHA 1IQXA 5HOHA 1UGHI 1Q40A 1B3SA 5I97A 4GHOA 3GZYB 2L1SA 4EXRA 2C11A 3WMDA 1M9GA 5KP3A 1MGWA 3F14A 3D9RA 4KFEA 1Q814 2O3OA 3MG3A 1I0XA 1IV9A 1LOWA 3N54B 1V58A 1E3RA 3DXOA 5IG3A 1IVWA 1ROAA 3U97A 1STFI 2W56A 2ZDJA 3F7XA 2CG1A 2CHCA 4L8PA 2WGOA 3RGAA 1AVKA 1D6UA 1TFOA 3LTDA 2IUJA 2Z7AA 3S29A 1ZS7A 1VQ93 3CD63 1FW7A 2BHMA 4KVHA 2BT3A 1CEWI 1UUWB 3CNXA 2QGUA 2B24B 5IG4A 2CX0A 2JDIH 4K90B 3TDGA 3CCQ3 3PCSA 1I0VA 3FG1A 1BGSA 3MSOA 5DREA 3CCJ3 3GZXB 3V92A 3RDEA 2GSPA 1WMOA 3F7SA 5FGOA 1LRAA 2P0XA 1JKGB 4MMZB 2CFGA 3ZG0A 3ALAA 3OWSA 4HM5B 1PY3A 3X41A 4AKYA 3NV0B 4EBGA 3Q1CA 4BL2A 1BRNL 3F8HA 3EF8A 1IQYA 3DGNA 2HMNB 1B20A 2XGLA 1I3IA 3QRDA 1WQLB 1SJWA 1JZDA
chains in the Genus database with same CATH topology
4J5GA 3URPA 1RHLA 3AHSA 1B2ZA 3HOHA 1UCJA 1BUJA 1GSPA 1DETA 1I8VA 1BNIA 1I2EA 1TTOA 2KF4A 3DH2A 3AGNA 3BU4A 1B2XA 1MGRA 5BIRA 1BNRA 1BSEA 1PYLA 2F56A 1I2GA 2SARA 2KAAA 2C4BA 3WHOA 3WR2A 3AHWA 1FYSA 1BRSA 1BNFA 1RGGA 1DE3A 6GSPA 2F5WA 1BSBA 2KF3A 1B2MA 1B21A 2RBIA 1IYYA 4J5KA 1RGKA 1GOVA 1GMPA 1B2UA 1RGAA 6RNTA 1JBTA 1BRIA 1UCKA 1BRGA 1I70A 1X1UA 1T2IA 3D4AA 2HOHA 1RMSA 4RNTA 1BRHA 3SYUA 1CH0A 1RGHA 1BRKA 4HOHA 2ZA4A 3RNTA 1A2PA 1GOUA 1AY7A 1RGLA 1X1XA 1JBSA 3D5IA 1BNJA 2KF6A 2AAEA 1B2SA 1RGEA 1TRQA 1LNIA 2BIRA 2RNTA 1RCLA 1BNSA 1BVIA 1FUTA 1RN1A 1Q9EA 1I3FA 1BSDA 5BU4A 8RNTA 1SARA 3AGOA 1X1WA 1BSCA 1RNTA 3DGYA 1C54A 4HAAA 1BSAA 1RDSA 9RNTA 1FZUA 5HOHA 1BNGA 1T2HA 1B3SA 7RNTA 4GHOA 5RNTA 1GOYA 1RLSA 1MGWA 7GSPA 1BU4A 1I0XA 1RCKA 1LOWA 1BANA 1RTUA 1B27A 1YVSA 3D5GA 1LOVA 5GSPA 1BNEA 1G02A 1RGFA 1UCLA 1FW7A 1LOYA 1TRPA 3Q3FA 2F5MA 2AADA 1BAOA 1BIRA 3BIRA 1I2FA 1R4YA 1HZ1A 1RGCA 1HYFA 1YGWA 2F4YA 1FUSA 1AQZA 1YNVX 1I0VA 1ZGXA 1BGSA 1RNBA 1JBRA 3GSPA 1UCIA 4BU4A 3KCHA 1RSNA 4GSPA 2GSPA 1LRAA 1PY3A 1BOXA 2KF5A 1X1YA 4BIRA 1BRNL 2BU4A 1BRJA 1GMQA 1GMRA 1B20A 1RN4A 1I3IA 3A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J5G A;  3URP A;  1RHL A;  3AHS A;  1B2Z A;  3HOH A;  1UCJ A;  1BUJ A;  1GSP A;  1DET A;  1I8V A;  1BNI A;  1I2E A;  1TTO A;  2KF4 A;  3DH2 A;  3AGN A;  3BU4 A;  1B2X A;  1MGR A;  5BIR A;  1BNR A;  1BSE A;  1PYL A;  2F56 A;  1I2G A;  2SAR A;  2KAA A;  2C4B A;  3WHO A;  3WR2 A;  3AHW A;  1FYS A;  1BRS A;  1BNF A;  1RGG A;  1DE3 A;  6GSP A;  2F5W A;  1BSB A;  2KF3 A;  1B2M A;  1B21 A;  2RBI A;  1IYY A;  4J5K A;  1RGK A;  1GOV A;  1GMP A;  1B2U A;  1RGA A;  6RNT A;  1JBT A;  1BRI A;  1UCK A;  1BRG A;  1I70 A;  1X1U A;  1T2I A;  3D4A A;  2HOH A;  1RMS A;  4RNT A;  1BRH A;  3SYU A;  1CH0 A;  1RGH A;  1BRK A;  4HOH A;  2ZA4 A;  3RNT A;  1A2P A;  1GOU A;  1AY7 A;  1RGL A;  1X1X A;  1JBS A;  3D5I A;  1BNJ A;  2KF6 A;  2AAE A;  1B2S A;  1RGE A;  1TRQ A;  1LNI A;  2BIR A;  2RNT A;  1RCL A;  1BNS A;  1BVI A;  1FUT A;  1RN1 A;  1Q9E A;  1I3F A;  1BSD A;  5BU4 A;  8RNT A;  1SAR A;  3AGO A;  1X1W A;  1BSC A;  1RNT A;  3DGY A;  1C54 A;  4HAA A;  1BSA A;  1RDS A;  9RNT A;  1FZU A;  5HOH A;  1BNG A;  1T2H A;  1B3S A;  7RNT A;  4GHO A;  5RNT A;  1GOY A;  1RLS A;  1MGW A;  7GSP A;  1BU4 A;  1I0X A;  1RCK A;  1LOW A;  1BAN A;  1RTU A;  1B27 A;  1YVS A;  3D5G A;  1LOV A;  5GSP A;  1BNE A;  1G02 A;  1RGF A;  1UCL A;  1FW7 A;  1LOY A;  1TRP A;  3Q3F A;  2F5M A;  2AAD A;  1BAO A;  1BIR A;  3BIR A;  1I2F A;  1R4Y A;  1HZ1 A;  1RGC A;  1HYF A;  1YGW A;  2F4Y A;  1FUS A;  1AQZ A;  1YNV X;  1I0V A;  1ZGX A;  1BGS A;  1RNB A;  1JBR A;  3GSP A;  1UCI A;  4BU4 A;  3KCH A;  1RSN A;  4GSP A;  2GSP A;  1LRA A;  1PY3 A;  1BOX A;  2KF5 A;  1X1Y A;  4BIR A;  1BRN L;  2BU4 A;  1BRJ A;  1GMQ A;  1GMR A;  1B20 A;  1RN4 A;  1I3I A;  3A5E A; 
#chains in the Genus database with same CATH topology
 1DVC A;  1WMN A;  1W7C A;  1GY7 A;  4J5G A;  1RHL A;  5AYS C;  3URP A;  1O7G B;  3KII A;  2FGT A;  5AIF A;  3S5C A;  4EYC A;  1QAK A;  3HOH A;  1KQS 2;  3OWY A;  1KWI A;  4XDW A;  2YFJ B;  1OHS A;  1JV2 B;  3CC4 3;  3CCU 3;  3SOA A;  4N6V 0;  2K0M A;  2F98 A;  3DH2 A;  1TTO A;  2Z76 A;  4MJD A;  2ML5 A;  2R41 A;  4HKV B;  3BU4 A;  5AIG A;  1DVD A;  3JUP A;  1MGR A;  1W5Z A;  3CPO A;  4K1V A;  1YIT 3;  1QMA A;  4N6T A;  1BSE A;  3FSD A;  1A90 A;  3KSE D;  1U8C B;  2C4B A;  4IPB A;  3NHX A;  4O3V A;  1OF5 A;  4NPB A;  1FYS A;  1CYV A;  3WR2 A;  3CC2 3;  2ZL8 A;  1DE3 A;  3FLJ A;  2F5W A;  2CFD A;  3LOY A;  1PU4 A;  5A0O B;  3GRD A;  1IYY A;  2SBL A;  4X2O A;  1NNV A;  1GOV A;  1DYU A;  1B2U A;  1NB3 I;  1RGA A;  3B4P A;  1BRI A;  1JB2 A;  3UL6 A;  1EKM A;  4IT7 A;  4U13 A;  1HU9 A;  3N8B A;  2MF7 A;  3O8Y A;  1Q86 4;  3D4A A;  1MWS A;  3IJE B;  1GD3 A;  3LYG A;  1J2B A;  3RGR A;  1RMS A;  1UUV B;  1NDO B;  3PXM A;  1CYU A;  5D83 A;  1OCV A;  4HOH A;  5JPU A;  2HML B;  1A2P A;  1W00 A;  1AVL A;  2CFW A;  5DRV A;  2BMR B;  1AY7 A;  4KT3 B;  3B8L A;  1AR0 A;  5AII A;  3LH4 A;  3DGO A;  4RNY A;  3FG3 A;  1O7W B;  1RCL A;  2ML6 A;  1BNS A;  2CG0 A;  2RNT A;  3Q2P A;  3GAX A;  2W9Q A;  4N6O B;  1Q9E A;  3SX1 A;  1L5G B;  3OX9 A;  4XB5 A;  8RNT A;  1FGT A;  2XH9 A;  4CPK A;  3AGO A;  1NWW A;  4R9K A;  4FMA A;  4HJL B;  1BSC A;  1DMN A;  3DGY A;  1OHO A;  4RBN A;  5JPP A;  1FZU A;  2P0M A;  7RNT A;  2OCT A;  3JUQ A;  5FW5 A;  2CH9 A;  1W02 A;  5AYR B;  3E99 A;  5G2G A;  2O9U X;  1RKY A;  4BTW A;  4IIA A;  1JB4 A;  1RCK A;  1GD4 A;  2Y74 A;  4HVN A;  4NHF A;  1KD1 4;  1UW1 A;  3D79 A;  4L8O A;  1FUW A;  2C10 A;  1LOV A;  3LTC A;  1KSI A;  2GEY A;  4LMI A;  3AMO B;  5GSP A;  3X3Y A;  4STD A;  1BNE A;  5JBS A;  1W2Z A;  2R4I A;  3NBR A;  3K0Z A;  4H61 A;  1VQ7 3;  1G02 A;  5AI1 A;  4GB5 A;  4XM4 A;  3WA2 X;  3S27 A;  2OOV A;  5KP1 A;  2YFL B;  1Q7Y 4;  4NRE A;  4N6U A;  1D6Z A;  1TUH A;  1W6C A;  2CC3 A;  2AAD A;  2F5M A;  2CWU A;  1S5A A;  3BIR A;  4QWT A;  1I2F A;  3A76 A;  1N5H A;  2F4Y A;  2H0H A;  4HM1 B;  1AQZ A;  1Q42 A;  6STD A;  1G96 A;  1NU3 A;  1ZGX A;  4BTY A;  3GSP A;  4XBY A;  3DGL A;  7STD A;  1V74 A;  5AEU B;  2QEX 3;  1SIH A;  1G0T A;  4R80 A;  2OTL 3;  4MEI A;  5IG0 A;  1OUN A;  2GU1 A;  1IU7 A;  3EBT A;  3SOY A;  3WOF B;  2IUK A;  2KF5 A;  1X1Y A;  3PZW A;  4N6L A;  4EC6 A;  1K41 A;  1LNH A;  3V98 A;  2P05 A;  2PNC A;  3B7C A;  2OOV C;  3KZT A;  1K73 4;  1YVB I;  3UJM A;  3KE7 A;  1GY5 A;  3BNC A;  3F40 A;  4I4K A;  2HMO B;  2IYJ A;  2E2V A;  2XSH B;  1B2Z A;  3M8C A;  5KP4 A;  5BVB A;  1DET A;  1OGZ A;  2Z6B A;  1I8V A;  1NB5 I;  2D1W A;  1TJD A;  2UX0 A;  3SXX A;  2Q07 A;  4TX4 A;  1I2E A;  3WOD G;  1YJ9 3;  4R1K A;  4WHA A;  5BIR A;  3FCS B;  2M7O A;  1SPU A;  2P38 A;  3EX9 A;  2SAR A;  4H3U A;  4L7K A;  1IK3 A;  3CCM 3;  2OTJ 3;  4AKZ A;  1LOX A;  1W4N A;  4DKI A;  3MYT A;  2H0G A;  1RGG A;  5G1L A;  6GSP A;  1B2M A;  4JF8 A;  1B21 A;  3LT8 A;  4FMD A;  3B4O A;  2W0Q A;  2XFT A;  2STD A;  3BND A;  2OQE A;  3JUN A;  4CDL A;  6RNT A;  3LTB A;  3MKI A;  1JBT A;  4AEQ A;  1VQ6 3;  4LGQ A;  4KFD A;  1T2I A;  2XR8 B;  3VSY A;  1M1K 4;  4RNT A;  1OF5 B;  3SYU A;  1US1 A;  1RGH A;  3VF1 A;  5IF6 A;  1BRK A;  4FR9 A;  2WOH A;  4FMC A;  3UL5 A;  1JN5 A;  5EVH A;  3EQQ B;  5EQL A;  1LQG C;  1RGL A;  4G1M B;  3STD A;  4FCM A;  3HK4 A;  4XBT A;  4HZB B;  1B2S A;  1E97 A;  1NJI 4;  3MG2 A;  1Z1S A;  4HM2 B;  1LVN A;  3S67 A;  3MPH A;  1RJO A;  4EV2 A;  4LSO A;  1FUT A;  1VQK 3;  1I3F A;  2INX A;  2OQE C;  3K63 A;  5IEP A;  4FCJ A;  4BL3 A;  2IY2 A;  1UI7 A;  2L4V A;  3EC9 A;  1X1W A;  3D3L A;  1IV7 A;  3J7Y d;  4HAA A;  1RDS A;  9RNT A;  4BTX A;  1BNG A;  1T2H A;  5CXO A;  3CPW 2;  4ORL A;  1ISK A;  2KCD A;  1EA2 A;  4FMB A;  4JRF A;  4XDV A;  2GEX A;  4N6N B;  4KZ1 A;  1OGX A;  7GSP A;  3H3H A;  4HM7 B;  1RTU A;  1UUG B;  3I56 3;  2F99 A;  1B27 A;  1YVS A;  1OH0 A;  5CLK A;  3D5G A;  1BUQ A;  2LYX A;  1IVU A;  2YFI B;  3CCV 3;  4KFF A;  1OAC A;  4WP5 A;  4XBX A;  3FGY A;  5D82 A;  3UB1 A;  2W2C A;  1TU5 A;  3OW2 2;  1UCL A;  3EN8 A;  1YJW 3;  1DMM A;  3G0K A;  1RN7 A;  1Y4K A;  1FGM A;  1TRP A;  3Q3F A;  1JB5 A;  3G8Z A;  3CCL 3;  4X2H A;  4LEH A;  2CFK A;  5STD A;  3NM7 A;  1BIR A;  5HGR A;  2CK3 H;  1VQO 3;  3DMC A;  1FA3 A;  1HZ1 A;  1HYF A;  1YGW A;  3FH1 A;  3WOE B;  1A2K A;  3LXU X;  1C7H A;  1EQK A;  1JBR A;  1VQ8 3;  3HI7 A;  3UNL A;  1UCI A;  1A2V A;  3KCH A;  1RSN A;  1O7H B;  1MWU A;  1F8N A;  5AEW B;  3X3X A;  4MMX B;  2P09 A;  2QA4 3;  2CWT A;  2B1X B;  1BOX A;  3EB8 A;  3NXJ A;  4HYZ A;  1D6Y A;  2CW9 A;  3CC7 3;  2BU4 A;  4RZM A;  3F9S A;  1GMQ A;  2F86 B;  2LQV A;  4ZM8 A;  5M19 A;  4HZ9 B;  8CHO A;  3T0U A;  1GYB A;  3CMA 3;  3A5E A;  4R9L A;  2ZHX B;  1IVX A;  3LZA A;  3PGB A;  5IEO A;  3HIG A;  2KRT A;  3HII A;  3N9H A;  1PFP A;  1UCJ A;  2FNQ A;  3ER7 A;  4OUQ A;  1VQ5 3;  4WYK B;  3SVA A;  3I55 3;  1BUJ A;  1GSP A;  1IDP A;  2RSX A;  2JQ5 A;  3OWU A;  3GWR A;  2KXG A;  2KF4 A;  1JJ2 2;  2UUG C;  4EW5 A;  4O8S A;  3JVC A;  1ULJ B;  2GBW B;  3AGN A;  2J8X B;  1RRL A;  1B2X A;  1LQM B;  4HM0 B;  3EHC A;  1YJN 3;  1EG9 B;  1BNR A;  4O2H A;  3LTA A;  1N9J A;  3NQZ A;  1PYL A;  3CNM A;  4WYK A;  2WO0 A;  1MWT A;  2QIY A;  2HMK B;  1NO3 A;  4CJN A;  1BNF A;  4WWU C;  1YHQ 3;  4ILF A;  1MWR A;  3G6E 3;  3V99 A;  4J5K A;  3NM2 A;  2I9W A;  2RCD A;  2BNG A;  3LT9 A;  4I5Q A;  1IQ8 A;  1UCK A;  1WMP A;  2D42 A;  3G16 A;  3H51 A;  2FXT A;  5TGN A;  3BNE A;  1M90 4;  1ZX2 A;  3DZL A;  3CCS 3;  1VQN 3;  1BRH A;  1CH0 A;  1FGR A;  3LML A;  1R4C A;  4R4K A;  1SQW A;  2ZA4 A;  1KC8 4;  4LYL B;  1QAF A;  2GU3 A;  2OWP A;  1OPY A;  3F8X A;  3PCR A;  5ELU A;  3GZR A;  3JUO A;  1HKX A;  1QVF 2;  1JBS A;  2H0I A;  3PS8 A;  2AAE A;  1TRQ A;  1ZO2 A;  2BIR A;  2E2U A;  3I0Y A;  1VQL 3;  4N3V A;  1W6G A;  3NX0 A;  1BVI A;  3NQY A;  1RN1 A;  1TFK A;  5BU4 A;  2CWV A;  3KSP A;  1VZZ A;  1JN5 B;  1ASK A;  4K1U A;  1Q82 4;  1DMQ A;  3T8U A;  1RNT A;  1E3V A;  3HZP A;  2WGQ A;  2K54 A;  4FCZ A;  1BSA A;  4WFO A;  3K9M C;  3CXC 2;  3IPT A;  5RNT A;  1N5P A;  1GOY A;  1GS3 A;  1RLS A;  2MC8 A;  3DY5 A;  3ROB A;  1BU4 A;  4CCV A;  2BMO B;  1T3B A;  1BAN A;  1FGQ A;  2RGQ A;  1QVG 2;  3ECF A;  1JNQ A;  3WA3 A;  5D81 A;  1N9E A;  1WTH A;  1LXE A;  1ROV A;  1MOL A;  3FF0 A;  1IT8 A;  1RGF A;  2A15 A;  1UGI A;  1N8R 4;  2W9P A;  3ZG5 A;  1LOY A;  1JKG A;  1T5Y A;  1JZO A;  1ULI B;  3MWZ A;  1BAO A;  2CX1 A;  3NV0 A;  1STD A;  3K5T A;  3X40 A;  2Z77 A;  1R4Y A;  3S28 A;  1RGC A;  2XEP A;  4OK0 A;  1S72 3;  1FUS A;  3WDG B;  1FGO A;  1V57 A;  1YNV X;  1RNB A;  3ZFZ A;  1N8Q A;  3EN1 B;  3FF2 A;  1O7N B;  4HM4 B;  5ELJ A;  3U1W A;  4BU4 A;  1GY6 A;  1K28 A;  4GSP A;  3BB9 A;  4Q53 A;  3SLU A;  4O02 B;  3QK9 A;  3SED A;  2CFL A;  2UGI A;  4HBR A;  3MHE A;  2PZV A;  1SII A;  3VGN A;  3DUK A;  3X42 A;  4BIR A;  3Q90 A;  2IA7 A;  1BRJ A;  2W04 A;  2WOF A;  3EE1 A;  1GMR A;  1VQQ A;  1RN4 A;  5IG5 A;  1A67 A;  1YIJ 3;  1K8A 4;  2BO9 B;  3KKG A;  1W2B 2;  3BLZ A;  3AHS A;  3HX8 A;  3G4S 3;  2XGN A;  3X3Z A;  1TIJ A;  2CIU A;  4HM8 B;  4J8T A;  2W6J H;  5G1K A;  1QAL A;  5BXQ A;  2IMJ A;  2Y73 A;  3JUM A;  2W03 A;  3NUV A;  4HM3 B;  1BNI A;  5LC6 A;  4PEJ A;  3CU3 A;  2HMM B;  2GXF A;  2RFR A;  2HMJ B;  1EUI C;  1VQ4 3;  2XF3 A;  1K9M 4;  3EBY A;  4LZI A;  3BNB A;  2CKF B;  1YGE A;  4N6M A;  2F56 A;  1I2G A;  1U5O A;  3KFQ C;  1IT7 A;  3IMA B;  3PYJ A;  2KAA A;  5LC7 A;  3WHO A;  1YI2 3;  3AHW A;  4RNZ A;  2XRX B;  1BRS A;  2BMQ B;  3FG4 A;  3GZB A;  1BSB A;  1UDI I;  2KF3 A;  3KN4 A;  5IER A;  2RBI A;  3CCE 3;  1MNL A;  1RGK A;  1RRH A;  2YX9 A;  2K3D A;  3L0R A;  1GMP A;  3OXA A;  4K61 A;  3T8N A;  4J9A A;  1QJG A;  1X1U A;  1BRG A;  1I70 A;  3DM8 A;  4GL6 A;  4MMY B;  2HOH A;  3NBB A;  2E2T A;  4EV5 A;  3EJV A;  3DGM A;  1OHP A;  1IVV A;  1VQM 3;  1O7M B;  1Q7H A;  3OV4 A;  3RNT A;  3G71 3;  1AV4 A;  5CF2 A;  1JRQ A;  3CCR 3;  1GOU A;  3NBJ A;  5IW9 A;  4HM6 B;  1UI8 A;  3FZW A;  4OVM A;  1X1X A;  5CF1 A;  3D5I A;  1BNJ A;  1CQS A;  1EEJ A;  2KF6 A;  3FKA A;  1RGE A;  1Q40 B;  1LNI A;  2GBX B;  1O7P B;  2V1L A;  2XFS A;  2XSO B;  5M1A A;  5IEN A;  1TP6 A;  1VQP 3;  3K7C A;  5CK6 A;  5M18 A;  1BSD A;  1WNH A;  1W6Y A;  3CME 3;  1SAR A;  5EEO A;  1M1X B;  1W01 A;  1C54 A;  3AMO A;  2W56 B;  3MG1 A;  5AIH A;  1IQX A;  5HOH A;  1UGH I;  1Q40 A;  1B3S A;  5I97 A;  4GHO A;  3GZY B;  2L1S A;  4EXR A;  2C11 A;  3WMD A;  1M9G A;  5KP3 A;  1MGW A;  3F14 A;  3D9R A;  4KFE A;  1Q81 4;  2O3O A;  3MG3 A;  1I0X A;  1IV9 A;  1LOW A;  3N54 B;  1V58 A;  1E3R A;  3DXO A;  5IG3 A;  1IVW A;  1ROA A;  3U97 A;  1STF I;  2W56 A;  2ZDJ A;  3F7X A;  2CG1 A;  2CHC A;  4L8P A;  2WGO A;  3RGA A;  1AVK A;  1D6U A;  1TFO A;  3LTD A;  2IUJ A;  2Z7A A;  3S29 A;  1ZS7 A;  1VQ9 3;  3CD6 3;  1FW7 A;  2BHM A;  4KVH A;  2BT3 A;  1CEW I;  1UUW B;  3CNX A;  2QGU A;  2B24 B;  5IG4 A;  2CX0 A;  2JDI H;  4K90 B;  3TDG A;  3CCQ 3;  3PCS A;  1I0V A;  3FG1 A;  1BGS A;  3MSO A;  5DRE A;  3CCJ 3;  3GZX B;  3V92 A;  3RDE A;  2GSP A;  1WMO A;  3F7S A;  5FGO A;  1LRA A;  2P0X A;  1JKG B;  4MMZ B;  2CFG A;  3ZG0 A;  3ALA A;  3OWS A;  4HM5 B;  1PY3 A;  3X41 A;  4AKY A;  3NV0 B;  4EBG A;  3Q1C A;  4BL2 A;  1BRN L;  3F8H A;  3EF8 A;  1IQY A;  3DGN A;  2HMN B;  1B20 A;  2XGL A;  1I3I A;  3QRD A;  1WQL B;  1SJW A;  1JZD A; 
#chains in the Genus database with same CATH homology
 4J5G A;  3URP A;  1RHL A;  3AHS A;  1B2Z A;  3HOH A;  1UCJ A;  1BUJ A;  1GSP A;  1DET A;  1I8V A;  1BNI A;  1I2E A;  1TTO A;  2KF4 A;  3DH2 A;  3AGN A;  3BU4 A;  1B2X A;  1MGR A;  5BIR A;  1BNR A;  1BSE A;  1PYL A;  2F56 A;  1I2G A;  2SAR A;  2KAA A;  2C4B A;  3WHO A;  3WR2 A;  3AHW A;  1FYS A;  1BRS A;  1BNF A;  1RGG A;  1DE3 A;  6GSP A;  2F5W A;  1BSB A;  2KF3 A;  1B2M A;  1B21 A;  2RBI A;  1IYY A;  4J5K A;  1RGK A;  1GOV A;  1GMP A;  1B2U A;  1RGA A;  6RNT A;  1JBT A;  1BRI A;  1UCK A;  1BRG A;  1I70 A;  1X1U A;  1T2I A;  3D4A A;  2HOH A;  1RMS A;  4RNT A;  1BRH A;  3SYU A;  1CH0 A;  1RGH A;  1BRK A;  4HOH A;  2ZA4 A;  3RNT A;  1A2P A;  1GOU A;  1AY7 A;  1RGL A;  1X1X A;  1JBS A;  3D5I A;  1BNJ A;  2KF6 A;  2AAE A;  1B2S A;  1RGE A;  1TRQ A;  1LNI A;  2BIR A;  2RNT A;  1RCL A;  1BNS A;  1BVI A;  1FUT A;  1RN1 A;  1Q9E A;  1I3F A;  1BSD A;  5BU4 A;  8RNT A;  1SAR A;  3AGO A;  1X1W A;  1BSC A;  1RNT A;  3DGY A;  1C54 A;  4HAA A;  1BSA A;  1RDS A;  9RNT A;  1FZU A;  5HOH A;  1BNG A;  1T2H A;  1B3S A;  7RNT A;  4GHO A;  5RNT A;  1GOY A;  1RLS A;  1MGW A;  7GSP A;  1BU4 A;  1I0X A;  1RCK A;  1LOW A;  1BAN A;  1RTU A;  1B27 A;  1YVS A;  3D5G A;  1LOV A;  5GSP A;  1BNE A;  1G02 A;  1RGF A;  1UCL A;  1FW7 A;  1LOY A;  1TRP A;  3Q3F A;  2F5M A;  2AAD A;  1BAO A;  1BIR A;  3BIR A;  1I2F A;  1R4Y A;  1HZ1 A;  1RGC A;  1HYF A;  1YGW A;  2F4Y A;  1FUS A;  1AQZ A;  1YNV X;  1I0V A;  1ZGX A;  1BGS A;  1RNB A;  1JBR A;  3GSP A;  1UCI A;  4BU4 A;  3KCH A;  1RSN A;  4GSP A;  2GSP A;  1LRA A;  1PY3 A;  1BOX A;  2KF5 A;  1X1Y A;  4BIR A;  1BRN L;  2BU4 A;  1BRJ A;  1GMQ A;  1GMR A;  1B20 A;  1RN4 A;  1I3I A;  3A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...