1A2PA

Barnase wildtype structure at 1.5 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribonuclease
molecule keywords BARNASE
publication title Refinement and structural analysis of barnase at 1.5 A resolution.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 36
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1a2pA00
1AY7A 1YNVX 2F5MA 1I3FA 1BVIA 1PYLA 1RLSA 2AADA 1LOWA 6RNTA 2KF5A 4RNTA 1UCKA 1FUSA 5HOHA 4HAAA 1BSCA 1DETA 1BGSA 1X1UA 1PY3A 1BNSA 5RNTA 2AAEA 1RGKA 1A2PA 1RTUA 1BSEA 1LNIA 3WHOA 1GMRA 1I2EA 1BNRA 1BNFA 1AQZA 1BRIA 1RN4A 3A5EA 1RNTA 3HOHA 1YGWA 1B21A 1RHLA 2KF6A 1TRPA 1BNJA 1BRHA 1RDSA 1BRNL 1RMSA 1I2GA 5BIRA 3DH2A 1LRAA 3AHWA 1X1YA 1B2MA 1BNIA 3URPA 1FUTA 1DE3A 3Q3FA 1I70A 8RNTA 4GSPA 1BSBA 3D4AA 1RGEA 4J5KA 7RNTA 1CH0A 4BU4A 1BSDA 2KAAA 1BRKA 1BU4A 2F4YA 3GSPA 1IYYA 1HYFA 1RGFA 1X1WA 1BRJA 1GOUA 1BSAA 3SYUA 1GMPA 2RNTA 6GSPA 5BU4A 1UCIA 2SARA 1FYSA 3D5IA 1UCJA 1BOXA 2GSPA 1T2IA 1UCLA 2F56A 4BIRA 1RGHA 1B2UA 1JBRA 1LOYA 7GSPA 1RNBA 1I0VA 3AGOA 4HOHA 1RCKA 4J5GA 9RNTA 2RBIA 1RGGA 3AGNA 1LOVA 1GMQA 2HOHA 1BUJA 1FW7A 1BNEA 3KCHA 1JBTA 2BIRA 1GSPA 1GOVA 1HZ1A 1RN1A 1C54A 3BU4A 3DGYA 3RNTA 1I0XA 1X1XA 1BIRA 1BAOA 1MGWA 5GSPA 1BRGA 1B2XA 1FZUA 2ZA4A 1B2ZA 1GOYA 1RGCA 1BNGA 1B3SA 1B20A 3D5GA 1TTOA 1RGLA 4GHOA 2F5WA 2BU4A 1MGRA 3AHSA 1T2HA 1I2FA 1TRQA 1YVSA 1B2SA 1RCLA 1B27A 1I8VA 1RGAA 1SARA 3BIRA 3WR2A 1Q9EA 1JBSA 1G02A 1R4YA 2KF4A 1I3IA 2C4BA 1BANA 1ZGXA 1RSNA 1BRSA 2KF3A
chains in the Genus database with same CATH superfamily
4J9AA 1GY5A 2IA7A 1SIIA 4LSOA 3K9MC 1VQ73 1JJ22 1W01A 1RLSA 3G713 5AIGA 1NWWA 3LH4A 1Q814 4K1VA 1UCKA 1O7GB 3CMA3 2HMOB 2KRTA 3EX9A 2QIYA 1BSCA 3Q90A 1MOLA 3LOYA 3MG2A 4N6V0 1W02A 3NM7A 3CC73 1VQ53 5IG4A 3G6E3 4H61A 1DVDA 3B4PA 3A76A 4N6UA 1RTUA 3FG3A 3FKAA 3N8BA 1BRIA 1FUWA 1UGIA 3HOHA 2WGOA 2LQVA 4K90B 1WMOA 1NDOB 1UUWB 1JB4A 1OF5A 3E99A 1UDII 1QAFA 1SIHA 5D82A 2UGIA 1RDSA 1BRHA 1Q40B 1MNLA 1IQ8A 2Z6BA 1BRNL 1JZOA 1WTHA 2WO0A 1STFI 1Q42A 3NXJA 3KSPA 1JB2A 4LGQA 3S28A 3DH2A 2Z77A 1US1A 1X1YA 2BMOB 1V58A 2P05A 3T8NA 1A90A 1QVF2 3I0YA 4ILFA 3HIIA 3UL6A 3MKIA 5AIHA 1TIJA 4JF8A 1RGEA 3B4OA 1GY7A 4K61A 4BTXA 3DXOA 3CNXA 4O8SA 1O7HB 3NV0A 1AV4A 5DREA 4MMYB 5AYRB 2D42A 3NBRA 3QRDA 2F98A 1N9EA 1QALA 2W03A 3G16A 1RGFA 1X1WA 5AIIA 1BRJA 3LZAA 3DGLA 5M19A 1K8A4 3HIGA 1QVG2 1GMPA 2W04A 3UJMA 1LQMB 1ULIB 1WMPA 1EKMA 1UCJA 1OHOA 2KXGA 3KIIA 2GSPA 3RGAA 1E97A 1RKYA 1KC84 1VQL3 1OF5B 2XH9A 1KSIA 2L1SA 5CLKA 5EQLA 5M18A 2FGTA 3AGOA 3F9SA 4HM5B 3ZFZA 4HZBB 1EA2A 3AGNA 3CD63 3EB8A 4OK0A 3JVCA 3F40A 1UUGB 3CPOA 3IPTA 2CWVA 2Y73A 4FR9A 4HZ9B 1SPUA 4KZ1A 4R9KA 2XRXB 3KCHA 1OHPA 1IQXA 1UGHI 1Z1SA 3JUQA 3VF1A 1JBTA 1C7HA 1FGMA 1OACA 1Q7HA 1Y4KA 1ZS7A 3RNTA 3ZG5A 1STDA 2Q07A 1N9JA 1BAOA 3GZYB 1W6YA 1TUHA 1MGWA 5GSPA 3NV0B 5D81A 4U13A 2XGLA 4CDLA 1KQS2 1U5OA 3Q1CA 5JPPA 1DVCA 2CIUA 3DUKA 1VQ83 1GOYA 4HM0B 5IEOA 1RGCA 1BNGA 1B3SA 2CX0A 1IVUA 2W9QA 5FGOA 3V98A 1TTOA 3EC9A 1TJDA 3LXUX 5IG5A 2IUKA 2HMLB 2F5WA 4MMXB 4EBGA 1K734 3OV4A 1OUNA 1OHSA 3NQZA 1CYVA 1JKGA 3BIRA 1RN7A 1ROAA 1UUVB 1I8VA 2CG1A 3PYJA 4EW5A 6STDA 5IENA 1CQSA 3OWYA 1UI7A 4FMAA 1TU5A 1BRSA 3HI7A 4NREA 1YNVX 4H3UA 3SEDA 2IYJA 1E3RA 4WP5A 6RNTA 1M1XB 4WFOA 5KP3A 1VQO3 4MJDA 4HAAA 5FW5A 4XBYA 1BGSA 1FGQA 3S29A 3UB1A 1VQK3 3WA2X 2GBWB 3WMDA 1ISKA 3DGMA 1MWTA 3DGNA 2LYXA 1RGKA 3GAXA 4HYZA 3N9HA 1W7CA 2YFLB 1NJI4 1A67A 1BNRA 1KD14 1RNTA 1VQ43 3CCV3 3LT8A 5AYSC 4LEHA 3EHCA 1FA3A 4AKYA 2UUGC 4XM4A 3VGNA 1DMNA 1JKGB 1B21A 1GS3A 1YGWA 3GWRA 3V92A 4HM6B 3V99A 1U8CB 3K7CA 3HK4A 4EXRA 1YJW3 1I2GA 4HM2B 5BIRA 3KN4A 3AHWA 3DZLA 1LNHA 2CFKA 2CW9A 4LZIA 4MMZB 5EEOA 3X3YA 3FSDA 1FUTA 2BMQB 2L4VA 4IIAA 1WMNA 3Q3FA 4QWTA 1IV7A 2YFJB 4WYKA 5IG0A 3NBBA 3PXMA 1K28A 3D4AA 2XR8B 3M8CA 4J5KA 1S723 1CH0A 3K63A 2KAAA 1IDPA 3FCSB 3ECFA 1FGTA 3GSPA 5IERA 1W2ZA 3LTDA 2O3OA 1HYFA 2B24B 3WDGB 1GOUA 1A2VA 3SYUA 2Z76A 1JNQA 2CFLA 2V1LA 2WGQA 1IVWA 3D5IA 3U1WA 1JRQA 3H3HA 5BU4A 2XFTA 1T2IA 2F56A 3EF8A 3PCSA 1S5AA 3DGOA 1OCVA 7GSPA 1NNVA 1JBRA 1CYUA 4ORLA 2D1WA 3LMLA 1I0VA 1AVLA 4KFEA 1DYUA 1JB5A 4J5GA 2RBIA 1RGGA 2HMMB 3G8ZA 1FGOA 1WNHA 1VZZA 4I5QA 1LOVA 5D83A 1BUQA 1QJGA 4X2OA 1IV9A 4PEJA 1JN5A 1RJOA 1W5ZA 1BNEA 2R4IA 4IT7A 4N6NB 3RGRA 3L0RA 3FGYA 4WYKB 3K0ZA 3DGYA 4O3VA 4FCMA 2W2CA 3EQQB 3GZXB 2CC3A 4HKVB 3CCJ3 1J2BA 1IT8A 1YIJ3 1OH0A 1QMAA 1FZUA 5ELJA 2ZA4A 3GZBA 3KKGA 3B8LA 1W00A 3MHEA 2OOVC 3ALAA 3WA3A 1B20A 2F99A 2GXFA 2INXA 3BNCA 3MYTA 1T5YA 4ZM8A 1KWIA 2B1XB 3EN1B 3IMAB 2YFIB 1FW7A 1MGRA 4N6TA 3Q2PA 5G1KA 5CF1A 3AHSA 1HKXA 4R9LA 4R80A 3UNLA 4AKZA 3KSED 5DRVA 3FZWA 2SBLA 3D79A 1SARA 7STDA 4L7KA 1MWSA 2CFGA 1I3IA 2C4BA 4HBRA 3X3ZA 1RSNA 3CCQ3 2KF3A 2XF3A 1AY7A 1TP6A 1JN5B 1I3FA 2XSOB 4EV5A 1GD4A 3PS8A 2KF5A 1W4NA 2GEXA 2P38A 3HX8A 2K54A 3WODG 1O7PB 1FUSA 1V57A 5HOHA 4X2HA 5G2GA 2BNGA 5IG3A 3CC43 4DKIA 2FNQA 2XGNA 1X1UA 1PY3A 5RNTA 4EC6A 1K9M4 5AEWB 5CF2A 3ER7A 3FLJA 4FCJA 3LT9A 3X3XA 3UL5A 1BSEA 1LNIA 3NX0A 1HU9A 3O8YA 4TX4A 3WHOA 1BNFA 1AQZA 3A5EA 2JDIH 2CHCA 1MWUA 2XSHB 5LC7A 4BL3A 4LMIA 3SXXA 4CCVA 4Q53A 1WQLB 1N5PA 2GU3A 1W2B2 1RHLA 2CH9A 5TGNA 4LYLB 4EYCA 3X42A 1MWRA 3MWZA 1RMSA 3J7Yd 1YJ93 3AMOA 3NBJA 3EBTA 2K3DA 2J8XB 1YIT3 1ZO2A 3EE1A 3OWUA 5JBSA 1LRAA 1Q864 1CEWI 1BNIA 3B7CA 3F8HA 3PZWA 1N8R4 3EJVA 1GY6A 1OPYA 1W6GA 1DMMA 2PZVA 4L8OA 1DE3A 1IVXA 4WWUC 1O7MB 1YVBI 1NU3A 2HMKB 4GSPA 4RNYA 2ZHXB 3DM8A 5EVHA 5AI1A 4GB5A 4BU4A 3D9RA 3CCL3 3LTCA 2IMJA 5BXQA 3GZRA 2W9PA 4L8PA 2CK3H 3H51A 4GL6A 1NB5I 4N3VA 4EV2A 1A2KA 5I97A 1T3BA 4XBXA 2CWUA 1ASKA 2W6JH 5M1AA 6GSPA 2RNTA 3OW22 4G1MB 4XDWA 1UCIA 1FYSA 2PNCA 2OQEA 4N6MA 1BOXA 3G4S3 1UCLA 4BIRA 3KZTA 1NB3I 3JUNA 1RNBA 3BNDA 4HOHA 3AMOB 1RCKA 1YI23 2W56A 2CFDA 2STDA 3K5TA 2HOHA 2CX1A 2OOVA 3NHXA 4BTYA 4BTWA 2BT3A 3CC23 2OTJ3 2P09A 3F8XA 4HM1B 4KFFA 1DMQA 2IY2A 4RNZA 1GSPA 1GOVA 2UX0A 3STDA 1RN1A 1LOXA 3BU4A 3OX9A 1F8NA 3S5CA 1M1K4 1ZX2A 3DY5A 1X1XA 1BIRA 3F7SA 3OWSA 4HM4B 4JRFA 3WOFB 3ZG0A 2E2VA 4HM7B 3NQYA 3RDEA 1LVNA 1BRGA 3BB9A 1EQKA 5CK6A 3T0UA 1RRLA 4WHAA 2W0QA 1LQGC 4AEQA 4OUQA 2K0MA 1AVKA 3I553 2BMRB 5HGRA 3D5GA 3LTAA 3QK9A 2OWPA 1PU4A 1N5HA 4GHOA 2QA43 1SJWA 1YGEA 1N8QA 5ELUA 4N6OB 1T2HA 3VSYA 1I2FA 2GEYA 1D6ZA 1RCLA 1B27A 2ML5A 3WR2A 3CCU3 3X40A 3LTBA 1Q9EA 4KVHA 4I4KA 4CJNA 1G02A 1R4YA 2W56B 2OQEC 1R4CA 1BANA 2YX9A 1NO3A 1IQYA 4IPBA 2F5MA 2RGQA 2ML6A 1BVIA 1PYLA 2AADA 3FH1A 1M904 1LOWA 1W6CA 2CFWA 2ZL8A 3KFQC 2RSXA 4RNTA 3JUPA 2A15A 3NM2A 2C10A 3FF2A 1IT7A 5JPUA 1Q824 2RFRA 1DETA 3CU3A 3G0KA 3F7XA 2BO9B 4HM3B 3CCE3 3T8UA 1BNSA 4K1UA 1TFOA 2BHMA 2AAEA 3N54B 3IJEB 1D6YA 2OTL3 1GD3A 1A2PA 1IVVA 3NUVA 1L5GB 1O7WB 1EG9B 1ULJB 3MSOA 3PCRA 4FMDA 1GMRA 1I2EA 4FMCA 1IU7A 1RN4A 3LYGA 4MEIA 2F86B 8CHOA 3CPW2 1UI8A 2R41A 1ROVA 3X41A 3FG4A 3JUMA 2MF7A 2H0IA 3BNEA 1YJN3 3PGBA 2KF6A 1TRPA 1BNJA 1TFKA 3BNBA 5IEPA 5KP4A 1LXEA 3MG3A 1VQ93 5CXOA 3FF0A 4STDA 4KFDA 2QEX3 4O02B 2C11A 3CCS3 1B2MA 3JUOA 3URPA 4J8TA 4XBTA 2CG0A 1I70A 3SX1A 3DMCA 2WOFA 1E3VA 4NPBA 8RNTA 1VQQA 2HMJB 1BSBA 2Z7AA 3BLZA 4NHFA 7RNTA 3ROBA 2H0GA 2JQ5A 1JZDA 1BSDA 2CKFB 3SOYA 1BRKA 3OXAA 2M7OA 1BU4A 3I563 2F4YA 3S27A 3CNMA 3SOAA 4BL2A 1VQ63 1VQN3 2RCDA 4XB5A 3MG1A 1IYYA 2E2TA 2O9UX 5BVBA 1BSAA 1VQP3 1EUIC 2SARA 2FXTA 1VQM3 4HVNA 2XFSA 3D3LA 3GRDA 1RGHA 1B2UA 1LOYA 1AR0A 5KP1A 3CME3 1V74A 2H0HA 3SLUA 3U97A 4HJLB 3SVAA 9RNTA 4R1KA 2HMNB 3WOEB 5STDA 1JV2B 1GMQA 1Q7Y4 5IF6A 1BUJA 1UW1A 4XDVA 5G1LA 3EBYA 1PFPA 2GBXB 2WOHA 2P0MA 4HM8B 4R4KA 1G0TA 1IK3A 2BIRA 2E2UA 5LC6A 2ZDJA 4CPKA 1HZ1A 1OGZA 1C54A 4N6LA 1I0XA 4FMBA 1G96A 3F14A 1EEJA 1D6UA 4FCZA 4O2HA 5A0OB 3FG1A 4RZMA 1K41A 1O7NB 1B2XA 2Y74A 1QAKA 2IUJA 1B2ZA 3EN8A 2OCTA 5AIFA 1SQWA 2P0XA 2CWTA 2QGUA 1M9GA 1RGLA 5IW9A 3S67A 4RBNA 3KE7A 3CXC2 2BU4A 2MC8A 1YVSA 1TRQA 3HZPA 1B2SA 3CCR3 1OGXA 1RGAA 2GU1A 2I9WA 2KCDA 3MPHA 3TDGA 1YHQ3 1JBSA 2XEPA 1FGRA 1Q40A 2KF4A 5AEUB 1RRHA 4OVMA 3CCM3 4KT3B 1ZGXA 1GYBA
chains in the Genus database with same CATH topology
1AY7A 1YNVX 2F5MA 1I3FA 1BVIA 1PYLA 1RLSA 2AADA 1LOWA 6RNTA 2KF5A 4RNTA 1UCKA 1FUSA 5HOHA 4HAAA 1BSCA 1DETA 1BGSA 1X1UA 1PY3A 1BNSA 5RNTA 2AAEA 1RGKA 1A2PA 1RTUA 1BSEA 1LNIA 3WHOA 1GMRA 1I2EA 1BNRA 1BNFA 1AQZA 1BRIA 1RN4A 3A5EA 1RNTA 3HOHA 1YGWA 1B21A 1RHLA 2KF6A 1TRPA 1BNJA 1BRHA 1RDSA 1BRNL 1RMSA 1I2GA 5BIRA 3DH2A 1LRAA 3AHWA 1X1YA 1B2MA 1BNIA 3URPA 1FUTA 1DE3A 3Q3FA 1I70A 8RNTA 4GSPA 1BSBA 3D4AA 1RGEA 4J5KA 7RNTA 1CH0A 4BU4A 1BSDA 2KAAA 1BRKA 1BU4A 2F4YA 3GSPA 1IYYA 1HYFA 1RGFA 1X1WA 1BRJA 1GOUA 1BSAA 3SYUA 1GMPA 2RNTA 6GSPA 5BU4A 1UCIA 2SARA 1FYSA 3D5IA 1UCJA 1BOXA 2GSPA 1T2IA 1UCLA 2F56A 4BIRA 1RGHA 1B2UA 1JBRA 1LOYA 7GSPA 1RNBA 1I0VA 3AGOA 4HOHA 1RCKA 4J5GA 9RNTA 2RBIA 1RGGA 3AGNA 1LOVA 1GMQA 2HOHA 1BUJA 1FW7A 1BNEA 3KCHA 1JBTA 2BIRA 1GSPA 1GOVA 1HZ1A 1RN1A 1C54A 3BU4A 3DGYA 3RNTA 1I0XA 1X1XA 1BIRA 1BAOA 1MGWA 5GSPA 1BRGA 1B2XA 1FZUA 2ZA4A 1B2ZA 1GOYA 1RGCA 1BNGA 1B3SA 1B20A 3D5GA 1TTOA 1RGLA 4GHOA 2F5WA 2BU4A 1MGRA 3AHSA 1T2HA 1I2FA 1TRQA 1YVSA 1B2SA 1RCLA 1B27A 1I8VA 1RGAA 1SARA 3BIRA 3WR2A 1Q9EA 1JBSA 1G02A 1R4YA 2KF4A 1I3IA 2C4BA 1BANA 1ZGXA 1RSNA 1BRSA 2KF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AY7 A;  1YNV X;  2F5M A;  1I3F A;  1BVI A;  1PYL A;  1RLS A;  2AAD A;  1LOW A;  6RNT A;  2KF5 A;  4RNT A;  1UCK A;  1FUS A;  5HOH A;  4HAA A;  1BSC A;  1DET A;  1BGS A;  1X1U A;  1PY3 A;  1BNS A;  5RNT A;  2AAE A;  1RGK A;  1A2P A;  1RTU A;  1BSE A;  1LNI A;  3WHO A;  1GMR A;  1I2E A;  1BNR A;  1BNF A;  1AQZ A;  1BRI A;  1RN4 A;  3A5E A;  1RNT A;  3HOH A;  1YGW A;  1B21 A;  1RHL A;  2KF6 A;  1TRP A;  1BNJ A;  1BRH A;  1RDS A;  1BRN L;  1RMS A;  1I2G A;  5BIR A;  3DH2 A;  1LRA A;  3AHW A;  1X1Y A;  1B2M A;  1BNI A;  3URP A;  1FUT A;  1DE3 A;  3Q3F A;  1I70 A;  8RNT A;  4GSP A;  1BSB A;  3D4A A;  1RGE A;  4J5K A;  7RNT A;  1CH0 A;  4BU4 A;  1BSD A;  2KAA A;  1BRK A;  1BU4 A;  2F4Y A;  3GSP A;  1IYY A;  1HYF A;  1RGF A;  1X1W A;  1BRJ A;  1GOU A;  1BSA A;  3SYU A;  1GMP A;  2RNT A;  6GSP A;  5BU4 A;  1UCI A;  2SAR A;  1FYS A;  3D5I A;  1UCJ A;  1BOX A;  2GSP A;  1T2I A;  1UCL A;  2F56 A;  4BIR A;  1RGH A;  1B2U A;  1JBR A;  1LOY A;  7GSP A;  1RNB A;  1I0V A;  3AGO A;  4HOH A;  1RCK A;  4J5G A;  9RNT A;  2RBI A;  1RGG A;  3AGN A;  1LOV A;  1GMQ A;  2HOH A;  1BUJ A;  1FW7 A;  1BNE A;  3KCH A;  1JBT A;  2BIR A;  1GSP A;  1GOV A;  1HZ1 A;  1RN1 A;  1C54 A;  3BU4 A;  3DGY A;  3RNT A;  1I0X A;  1X1X A;  1BIR A;  1BAO A;  1MGW A;  5GSP A;  1BRG A;  1B2X A;  1FZU A;  2ZA4 A;  1B2Z A;  1GOY A;  1RGC A;  1BNG A;  1B3S A;  1B20 A;  3D5G A;  1TTO A;  1RGL A;  4GHO A;  2F5W A;  2BU4 A;  1MGR A;  3AHS A;  1T2H A;  1I2F A;  1TRQ A;  1YVS A;  1B2S A;  1RCL A;  1B27 A;  1I8V A;  1RGA A;  1SAR A;  3BIR A;  3WR2 A;  1Q9E A;  1JBS A;  1G02 A;  1R4Y A;  2KF4 A;  1I3I A;  2C4B A;  1BAN A;  1ZGX A;  1RSN A;  1BRS A;  2KF3 A; 
#chains in the Genus database with same CATH topology
 4J9A A;  1GY5 A;  2IA7 A;  1SII A;  4LSO A;  3K9M C;  1VQ7 3;  1JJ2 2;  1W01 A;  1RLS A;  3G71 3;  5AIG A;  1NWW A;  3LH4 A;  1Q81 4;  4K1V A;  1UCK A;  1O7G B;  3CMA 3;  2HMO B;  2KRT A;  3EX9 A;  2QIY A;  1BSC A;  3Q90 A;  1MOL A;  3LOY A;  3MG2 A;  4N6V 0;  1W02 A;  3NM7 A;  3CC7 3;  1VQ5 3;  5IG4 A;  3G6E 3;  4H61 A;  1DVD A;  3B4P A;  3A76 A;  4N6U A;  1RTU A;  3FG3 A;  3FKA A;  3N8B A;  1BRI A;  1FUW A;  1UGI A;  3HOH A;  2WGO A;  2LQV A;  4K90 B;  1WMO A;  1NDO B;  1UUW B;  1JB4 A;  1OF5 A;  3E99 A;  1UDI I;  1QAF A;  1SIH A;  5D82 A;  2UGI A;  1RDS A;  1BRH A;  1Q40 B;  1MNL A;  1IQ8 A;  2Z6B A;  1BRN L;  1JZO A;  1WTH A;  2WO0 A;  1STF I;  1Q42 A;  3NXJ A;  3KSP A;  1JB2 A;  4LGQ A;  3S28 A;  3DH2 A;  2Z77 A;  1US1 A;  1X1Y A;  2BMO B;  1V58 A;  2P05 A;  3T8N A;  1A90 A;  1QVF 2;  3I0Y A;  4ILF A;  3HII A;  3UL6 A;  3MKI A;  5AIH A;  1TIJ A;  4JF8 A;  1RGE A;  3B4O A;  1GY7 A;  4K61 A;  4BTX A;  3DXO A;  3CNX A;  4O8S A;  1O7H B;  3NV0 A;  1AV4 A;  5DRE A;  4MMY B;  5AYR B;  2D42 A;  3NBR A;  3QRD A;  2F98 A;  1N9E A;  1QAL A;  2W03 A;  3G16 A;  1RGF A;  1X1W A;  5AII A;  1BRJ A;  3LZA A;  3DGL A;  5M19 A;  1K8A 4;  3HIG A;  1QVG 2;  1GMP A;  2W04 A;  3UJM A;  1LQM B;  1ULI B;  1WMP A;  1EKM A;  1UCJ A;  1OHO A;  2KXG A;  3KII A;  2GSP A;  3RGA A;  1E97 A;  1RKY A;  1KC8 4;  1VQL 3;  1OF5 B;  2XH9 A;  1KSI A;  2L1S A;  5CLK A;  5EQL A;  5M18 A;  2FGT A;  3AGO A;  3F9S A;  4HM5 B;  3ZFZ A;  4HZB B;  1EA2 A;  3AGN A;  3CD6 3;  3EB8 A;  4OK0 A;  3JVC A;  3F40 A;  1UUG B;  3CPO A;  3IPT A;  2CWV A;  2Y73 A;  4FR9 A;  4HZ9 B;  1SPU A;  4KZ1 A;  4R9K A;  2XRX B;  3KCH A;  1OHP A;  1IQX A;  1UGH I;  1Z1S A;  3JUQ A;  3VF1 A;  1JBT A;  1C7H A;  1FGM A;  1OAC A;  1Q7H A;  1Y4K A;  1ZS7 A;  3RNT A;  3ZG5 A;  1STD A;  2Q07 A;  1N9J A;  1BAO A;  3GZY B;  1W6Y A;  1TUH A;  1MGW A;  5GSP A;  3NV0 B;  5D81 A;  4U13 A;  2XGL A;  4CDL A;  1KQS 2;  1U5O A;  3Q1C A;  5JPP A;  1DVC A;  2CIU A;  3DUK A;  1VQ8 3;  1GOY A;  4HM0 B;  5IEO A;  1RGC A;  1BNG A;  1B3S A;  2CX0 A;  1IVU A;  2W9Q A;  5FGO A;  3V98 A;  1TTO A;  3EC9 A;  1TJD A;  3LXU X;  5IG5 A;  2IUK A;  2HML B;  2F5W A;  4MMX B;  4EBG A;  1K73 4;  3OV4 A;  1OUN A;  1OHS A;  3NQZ A;  1CYV A;  1JKG A;  3BIR A;  1RN7 A;  1ROA A;  1UUV B;  1I8V A;  2CG1 A;  3PYJ A;  4EW5 A;  6STD A;  5IEN A;  1CQS A;  3OWY A;  1UI7 A;  4FMA A;  1TU5 A;  1BRS A;  3HI7 A;  4NRE A;  1YNV X;  4H3U A;  3SED A;  2IYJ A;  1E3R A;  4WP5 A;  6RNT A;  1M1X B;  4WFO A;  5KP3 A;  1VQO 3;  4MJD A;  4HAA A;  5FW5 A;  4XBY A;  1BGS A;  1FGQ A;  3S29 A;  3UB1 A;  1VQK 3;  3WA2 X;  2GBW B;  3WMD A;  1ISK A;  3DGM A;  1MWT A;  3DGN A;  2LYX A;  1RGK A;  3GAX A;  4HYZ A;  3N9H A;  1W7C A;  2YFL B;  1NJI 4;  1A67 A;  1BNR A;  1KD1 4;  1RNT A;  1VQ4 3;  3CCV 3;  3LT8 A;  5AYS C;  4LEH A;  3EHC A;  1FA3 A;  4AKY A;  2UUG C;  4XM4 A;  3VGN A;  1DMN A;  1JKG B;  1B21 A;  1GS3 A;  1YGW A;  3GWR A;  3V92 A;  4HM6 B;  3V99 A;  1U8C B;  3K7C A;  3HK4 A;  4EXR A;  1YJW 3;  1I2G A;  4HM2 B;  5BIR A;  3KN4 A;  3AHW A;  3DZL A;  1LNH A;  2CFK A;  2CW9 A;  4LZI A;  4MMZ B;  5EEO A;  3X3Y A;  3FSD A;  1FUT A;  2BMQ B;  2L4V A;  4IIA A;  1WMN A;  3Q3F A;  4QWT A;  1IV7 A;  2YFJ B;  4WYK A;  5IG0 A;  3NBB A;  3PXM A;  1K28 A;  3D4A A;  2XR8 B;  3M8C A;  4J5K A;  1S72 3;  1CH0 A;  3K63 A;  2KAA A;  1IDP A;  3FCS B;  3ECF A;  1FGT A;  3GSP A;  5IER A;  1W2Z A;  3LTD A;  2O3O A;  1HYF A;  2B24 B;  3WDG B;  1GOU A;  1A2V A;  3SYU A;  2Z76 A;  1JNQ A;  2CFL A;  2V1L A;  2WGQ A;  1IVW A;  3D5I A;  3U1W A;  1JRQ A;  3H3H A;  5BU4 A;  2XFT A;  1T2I A;  2F56 A;  3EF8 A;  3PCS A;  1S5A A;  3DGO A;  1OCV A;  7GSP A;  1NNV A;  1JBR A;  1CYU A;  4ORL A;  2D1W A;  3LML A;  1I0V A;  1AVL A;  4KFE A;  1DYU A;  1JB5 A;  4J5G A;  2RBI A;  1RGG A;  2HMM B;  3G8Z A;  1FGO A;  1WNH A;  1VZZ A;  4I5Q A;  1LOV A;  5D83 A;  1BUQ A;  1QJG A;  4X2O A;  1IV9 A;  4PEJ A;  1JN5 A;  1RJO A;  1W5Z A;  1BNE A;  2R4I A;  4IT7 A;  4N6N B;  3RGR A;  3L0R A;  3FGY A;  4WYK B;  3K0Z A;  3DGY A;  4O3V A;  4FCM A;  2W2C A;  3EQQ B;  3GZX B;  2CC3 A;  4HKV B;  3CCJ 3;  1J2B A;  1IT8 A;  1YIJ 3;  1OH0 A;  1QMA A;  1FZU A;  5ELJ A;  2ZA4 A;  3GZB A;  3KKG A;  3B8L A;  1W00 A;  3MHE A;  2OOV C;  3ALA A;  3WA3 A;  1B20 A;  2F99 A;  2GXF A;  2INX A;  3BNC A;  3MYT A;  1T5Y A;  4ZM8 A;  1KWI A;  2B1X B;  3EN1 B;  3IMA B;  2YFI B;  1FW7 A;  1MGR A;  4N6T A;  3Q2P A;  5G1K A;  5CF1 A;  3AHS A;  1HKX A;  4R9L A;  4R80 A;  3UNL A;  4AKZ A;  3KSE D;  5DRV A;  3FZW A;  2SBL A;  3D79 A;  1SAR A;  7STD A;  4L7K A;  1MWS A;  2CFG A;  1I3I A;  2C4B A;  4HBR A;  3X3Z A;  1RSN A;  3CCQ 3;  2KF3 A;  2XF3 A;  1AY7 A;  1TP6 A;  1JN5 B;  1I3F A;  2XSO B;  4EV5 A;  1GD4 A;  3PS8 A;  2KF5 A;  1W4N A;  2GEX A;  2P38 A;  3HX8 A;  2K54 A;  3WOD G;  1O7P B;  1FUS A;  1V57 A;  5HOH A;  4X2H A;  5G2G A;  2BNG A;  5IG3 A;  3CC4 3;  4DKI A;  2FNQ A;  2XGN A;  1X1U A;  1PY3 A;  5RNT A;  4EC6 A;  1K9M 4;  5AEW B;  5CF2 A;  3ER7 A;  3FLJ A;  4FCJ A;  3LT9 A;  3X3X A;  3UL5 A;  1BSE A;  1LNI A;  3NX0 A;  1HU9 A;  3O8Y A;  4TX4 A;  3WHO A;  1BNF A;  1AQZ A;  3A5E A;  2JDI H;  2CHC A;  1MWU A;  2XSH B;  5LC7 A;  4BL3 A;  4LMI A;  3SXX A;  4CCV A;  4Q53 A;  1WQL B;  1N5P A;  2GU3 A;  1W2B 2;  1RHL A;  2CH9 A;  5TGN A;  4LYL B;  4EYC A;  3X42 A;  1MWR A;  3MWZ A;  1RMS A;  3J7Y d;  1YJ9 3;  3AMO A;  3NBJ A;  3EBT A;  2K3D A;  2J8X B;  1YIT 3;  1ZO2 A;  3EE1 A;  3OWU A;  5JBS A;  1LRA A;  1Q86 4;  1CEW I;  1BNI A;  3B7C A;  3F8H A;  3PZW A;  1N8R 4;  3EJV A;  1GY6 A;  1OPY A;  1W6G A;  1DMM A;  2PZV A;  4L8O A;  1DE3 A;  1IVX A;  4WWU C;  1O7M B;  1YVB I;  1NU3 A;  2HMK B;  4GSP A;  4RNY A;  2ZHX B;  3DM8 A;  5EVH A;  5AI1 A;  4GB5 A;  4BU4 A;  3D9R A;  3CCL 3;  3LTC A;  2IMJ A;  5BXQ A;  3GZR A;  2W9P A;  4L8P A;  2CK3 H;  3H51 A;  4GL6 A;  1NB5 I;  4N3V A;  4EV2 A;  1A2K A;  5I97 A;  1T3B A;  4XBX A;  2CWU A;  1ASK A;  2W6J H;  5M1A A;  6GSP A;  2RNT A;  3OW2 2;  4G1M B;  4XDW A;  1UCI A;  1FYS A;  2PNC A;  2OQE A;  4N6M A;  1BOX A;  3G4S 3;  1UCL A;  4BIR A;  3KZT A;  1NB3 I;  3JUN A;  1RNB A;  3BND A;  4HOH A;  3AMO B;  1RCK A;  1YI2 3;  2W56 A;  2CFD A;  2STD A;  3K5T A;  2HOH A;  2CX1 A;  2OOV A;  3NHX A;  4BTY A;  4BTW A;  2BT3 A;  3CC2 3;  2OTJ 3;  2P09 A;  3F8X A;  4HM1 B;  4KFF A;  1DMQ A;  2IY2 A;  4RNZ A;  1GSP A;  1GOV A;  2UX0 A;  3STD A;  1RN1 A;  1LOX A;  3BU4 A;  3OX9 A;  1F8N A;  3S5C A;  1M1K 4;  1ZX2 A;  3DY5 A;  1X1X A;  1BIR A;  3F7S A;  3OWS A;  4HM4 B;  4JRF A;  3WOF B;  3ZG0 A;  2E2V A;  4HM7 B;  3NQY A;  3RDE A;  1LVN A;  1BRG A;  3BB9 A;  1EQK A;  5CK6 A;  3T0U A;  1RRL A;  4WHA A;  2W0Q A;  1LQG C;  4AEQ A;  4OUQ A;  2K0M A;  1AVK A;  3I55 3;  2BMR B;  5HGR A;  3D5G A;  3LTA A;  3QK9 A;  2OWP A;  1PU4 A;  1N5H A;  4GHO A;  2QA4 3;  1SJW A;  1YGE A;  1N8Q A;  5ELU A;  4N6O B;  1T2H A;  3VSY A;  1I2F A;  2GEY A;  1D6Z A;  1RCL A;  1B27 A;  2ML5 A;  3WR2 A;  3CCU 3;  3X40 A;  3LTB A;  1Q9E A;  4KVH A;  4I4K A;  4CJN A;  1G02 A;  1R4Y A;  2W56 B;  2OQE C;  1R4C A;  1BAN A;  2YX9 A;  1NO3 A;  1IQY A;  4IPB A;  2F5M A;  2RGQ A;  2ML6 A;  1BVI A;  1PYL A;  2AAD A;  3FH1 A;  1M90 4;  1LOW A;  1W6C A;  2CFW A;  2ZL8 A;  3KFQ C;  2RSX A;  4RNT A;  3JUP A;  2A15 A;  3NM2 A;  2C10 A;  3FF2 A;  1IT7 A;  5JPU A;  1Q82 4;  2RFR A;  1DET A;  3CU3 A;  3G0K A;  3F7X A;  2BO9 B;  4HM3 B;  3CCE 3;  3T8U A;  1BNS A;  4K1U A;  1TFO A;  2BHM A;  2AAE A;  3N54 B;  3IJE B;  1D6Y A;  2OTL 3;  1GD3 A;  1A2P A;  1IVV A;  3NUV A;  1L5G B;  1O7W B;  1EG9 B;  1ULJ B;  3MSO A;  3PCR A;  4FMD A;  1GMR A;  1I2E A;  4FMC A;  1IU7 A;  1RN4 A;  3LYG A;  4MEI A;  2F86 B;  8CHO A;  3CPW 2;  1UI8 A;  2R41 A;  1ROV A;  3X41 A;  3FG4 A;  3JUM A;  2MF7 A;  2H0I A;  3BNE A;  1YJN 3;  3PGB A;  2KF6 A;  1TRP A;  1BNJ A;  1TFK A;  3BNB A;  5IEP A;  5KP4 A;  1LXE A;  3MG3 A;  1VQ9 3;  5CXO A;  3FF0 A;  4STD A;  4KFD A;  2QEX 3;  4O02 B;  2C11 A;  3CCS 3;  1B2M A;  3JUO A;  3URP A;  4J8T A;  4XBT A;  2CG0 A;  1I70 A;  3SX1 A;  3DMC A;  2WOF A;  1E3V A;  4NPB A;  8RNT A;  1VQQ A;  2HMJ B;  1BSB A;  2Z7A A;  3BLZ A;  4NHF A;  7RNT A;  3ROB A;  2H0G A;  2JQ5 A;  1JZD A;  1BSD A;  2CKF B;  3SOY A;  1BRK A;  3OXA A;  2M7O A;  1BU4 A;  3I56 3;  2F4Y A;  3S27 A;  3CNM A;  3SOA A;  4BL2 A;  1VQ6 3;  1VQN 3;  2RCD A;  4XB5 A;  3MG1 A;  1IYY A;  2E2T A;  2O9U X;  5BVB A;  1BSA A;  1VQP 3;  1EUI C;  2SAR A;  2FXT A;  1VQM 3;  4HVN A;  2XFS A;  3D3L A;  3GRD A;  1RGH A;  1B2U A;  1LOY A;  1AR0 A;  5KP1 A;  3CME 3;  1V74 A;  2H0H A;  3SLU A;  3U97 A;  4HJL B;  3SVA A;  9RNT A;  4R1K A;  2HMN B;  3WOE B;  5STD A;  1JV2 B;  1GMQ A;  1Q7Y 4;  5IF6 A;  1BUJ A;  1UW1 A;  4XDV A;  5G1L A;  3EBY A;  1PFP A;  2GBX B;  2WOH A;  2P0M A;  4HM8 B;  4R4K A;  1G0T A;  1IK3 A;  2BIR A;  2E2U A;  5LC6 A;  2ZDJ A;  4CPK A;  1HZ1 A;  1OGZ A;  1C54 A;  4N6L A;  1I0X A;  4FMB A;  1G96 A;  3F14 A;  1EEJ A;  1D6U A;  4FCZ A;  4O2H A;  5A0O B;  3FG1 A;  4RZM A;  1K41 A;  1O7N B;  1B2X A;  2Y74 A;  1QAK A;  2IUJ A;  1B2Z A;  3EN8 A;  2OCT A;  5AIF A;  1SQW A;  2P0X A;  2CWT A;  2QGU A;  1M9G A;  1RGL A;  5IW9 A;  3S67 A;  4RBN A;  3KE7 A;  3CXC 2;  2BU4 A;  2MC8 A;  1YVS A;  1TRQ A;  3HZP A;  1B2S A;  3CCR 3;  1OGX A;  1RGA A;  2GU1 A;  2I9W A;  2KCD A;  3MPH A;  3TDG A;  1YHQ 3;  1JBS A;  2XEP A;  1FGR A;  1Q40 A;  2KF4 A;  5AEU B;  1RRH A;  4OVM A;  3CCM 3;  4KT3 B;  1ZGX A;  1GYB A; 
#chains in the Genus database with same CATH homology
 1AY7 A;  1YNV X;  2F5M A;  1I3F A;  1BVI A;  1PYL A;  1RLS A;  2AAD A;  1LOW A;  6RNT A;  2KF5 A;  4RNT A;  1UCK A;  1FUS A;  5HOH A;  4HAA A;  1BSC A;  1DET A;  1BGS A;  1X1U A;  1PY3 A;  1BNS A;  5RNT A;  2AAE A;  1RGK A;  1A2P A;  1RTU A;  1BSE A;  1LNI A;  3WHO A;  1GMR A;  1I2E A;  1BNR A;  1BNF A;  1AQZ A;  1BRI A;  1RN4 A;  3A5E A;  1RNT A;  3HOH A;  1YGW A;  1B21 A;  1RHL A;  2KF6 A;  1TRP A;  1BNJ A;  1BRH A;  1RDS A;  1BRN L;  1RMS A;  1I2G A;  5BIR A;  3DH2 A;  1LRA A;  3AHW A;  1X1Y A;  1B2M A;  1BNI A;  3URP A;  1FUT A;  1DE3 A;  3Q3F A;  1I70 A;  8RNT A;  4GSP A;  1BSB A;  3D4A A;  1RGE A;  4J5K A;  7RNT A;  1CH0 A;  4BU4 A;  1BSD A;  2KAA A;  1BRK A;  1BU4 A;  2F4Y A;  3GSP A;  1IYY A;  1HYF A;  1RGF A;  1X1W A;  1BRJ A;  1GOU A;  1BSA A;  3SYU A;  1GMP A;  2RNT A;  6GSP A;  5BU4 A;  1UCI A;  2SAR A;  1FYS A;  3D5I A;  1UCJ A;  1BOX A;  2GSP A;  1T2I A;  1UCL A;  2F56 A;  4BIR A;  1RGH A;  1B2U A;  1JBR A;  1LOY A;  7GSP A;  1RNB A;  1I0V A;  3AGO A;  4HOH A;  1RCK A;  4J5G A;  9RNT A;  2RBI A;  1RGG A;  3AGN A;  1LOV A;  1GMQ A;  2HOH A;  1BUJ A;  1FW7 A;  1BNE A;  3KCH A;  1JBT A;  2BIR A;  1GSP A;  1GOV A;  1HZ1 A;  1RN1 A;  1C54 A;  3BU4 A;  3DGY A;  3RNT A;  1I0X A;  1X1X A;  1BIR A;  1BAO A;  1MGW A;  5GSP A;  1BRG A;  1B2X A;  1FZU A;  2ZA4 A;  1B2Z A;  1GOY A;  1RGC A;  1BNG A;  1B3S A;  1B20 A;  3D5G A;  1TTO A;  1RGL A;  4GHO A;  2F5W A;  2BU4 A;  1MGR A;  3AHS A;  1T2H A;  1I2F A;  1TRQ A;  1YVS A;  1B2S A;  1RCL A;  1B27 A;  1I8V A;  1RGA A;  1SAR A;  3BIR A;  3WR2 A;  1Q9E A;  1JBS A;  1G02 A;  1R4Y A;  2KF4 A;  1I3I A;  2C4B A;  1BAN A;  1ZGX A;  1RSN A;  1BRS A;  2KF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...