5BXQA

Structure of the ntf2:rangdp complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
124
Chain Sequence
KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nuclear transport factor 2
publication title Structural basis for molecular recognition between nuclear transport factor 2 (NTF2) and the GDP-bound form of the Ras-family GTPase Ran.
pubmed rcsb
source organism Rattus norvegicus
total genus 38
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5bxqA00
5IEOA 4HM8B 1C7HA 5JPPA 2PZVA 4ORLA 3STDA 1W01A 2I9WA 3EF8A 3EN1B 3G8ZA 6STDA 3JUNA 2BMOB 1JKGB 5IG0A 3HK4A 1GS3A 3ECFA 4PEJA 1OF5A 4HM7B 3OV4A 3OWYA 1UUWB 4HM4B 3GRDA 5D82A 2CHCA 4WYKB 5AI1A 4HM3B 2GBWB 3ROBA 1OHPA 4HKVB 4XBTA 5KP4A 1DMNA 5FW5A 2BMQB 3GZBA 3NBRA 3MG2A 2W2CA 3E99A 1QMAA 1JB4A 2HMLB 3EX9A 3MG1A 3LYGA 1K41A 5STDA 3CNXA 2XRXB 2RCDA 1ISKA 2XR8B 2B24B 5JPUA 5IG5A 3KZTA 1DMMA 1HKXA 4XBXA 3GWRA 5CF2A 5AEWB 3FLJA 4WWUC 4MJDA 2GXFA 3F7SA 4HJLB 5TGNA 5CXOA 3OWUA 5IENA 3F40A 1EG9B 3B4OA 3NM2A 2JQ5A 3A76A 4LEHA 2XSOB 1OHSA 2OWPA 2A15A 4Q53A 4U13A 4STDA 1TUHA 2QIYA 4R9KA 1AR0A 5BVBA 2HMOB 1SJWA 4CDLA 5KP3A 5IG3A 1OPYA 1OCVA 5CF1A 3MKIA 3OX9A 4XDWA 5AIIA 4RZMA 3H51A 3ER7A 1CQSA 1ULJB 1VZZA 4HM5B 3VSYA 2RGQA 3T8NA 2CKFB 5DRVA 4HM2B 2Z7AA 3F9SA 2R4IA 5AIGA 4KVHA 1JB2A 1W02A 3NV0A 4HZBB 3KSPA 1W00A 2UX0A 3CNMA 3FH1A 4X2OA 4R1KA 1ASKA 3K0ZA 2QGUA 4N3VA 3I0YA 4J8TA 5BXQA 3IPTA 1O7WB 4HM6B 2GEYA 2Z77A 3BB9A 4HM1B 3FF2A 3S5CA 1OUNA 1E3RA 2IMJA 1NDOB 3G16A 3DMCA 4XDVA 3MHEA 1JN5A 3EBYA 1GY5A 1O7PB 3JUQA 3EBTA 1JKGA 1OF5B 4K1UA 1ZX2A 1NWWA 2YFJB 5IG4A 1OH0A 3F8HA 1ZO2A 3UJMA 4WYKA 5EVHA 5AIHA 2GBXB 3MSOA 4L7KA 2HMKB 1O7HB 3NXJA 3SEDA 7STDA 1JB5A 3EC9A 5D83A 5HGRA 3MYTA 3F8XA 2F98A 1A2KA 3EQQB 2K54A 3LZAA 1QJGA 2BNGA 1Q40B 2BMRB 4HVNA 5CLKA 4FCMA 2YFLB 1U5OA 4J9AA 3BLZA 1OGZA 3NHXA 3NUVA 3UNLA 3MG3A 3DM8A 5G2GA 3GZXB 3KE7A 2INXA 3SOYA 5IERA 5D81A 3JUOA 3OWSA 1Q42A 2Z76A 2F86B 4XB5A 4HZ9B 4R9LA 3VGNA 1TP6A 5KP1A 3JUPA 3G0KA 5DREA 3GZRA 1UUVB 3FGYA 4L8OA 4IIAA 3EHCA 1Z1SA 1EA2A 1BUQA 3Q90A 2B1XB 1DMQA 2RFRA 3SOAA 2HMMB 1WQLB 3CPOA 5AEUB 3F7XA 5IF6A 3EN8A 3WMDA 4L8PA 1NU3A 1O7MB 3FZWA 1IDPA 4OUQA 3DUKA 1O7NB 4LGQA 1Q40A 4X2HA 8CHOA 1GY6A 1GY7A 4XBYA 1STDA 3FSDA 3NV0B 1E3VA 1E97A 1O7GB 3RGAA 2YFIB 2GEXA 3H3HA 3GZYB 1OHOA 4K1VA 3B7CA 3B4PA 3CU3A 3DZLA 4LMIA 1ULIB 3B8LA 3T8UA 2HMJB 3EJVA 4GB5A 4OVMA 3M8CA 3OXAA 1OGXA 3KKGA 2F99A 3JUMA 3F14A 4H3UA 2XSHB 3DXOA 2STDA 4HM0B 2HMNB 3HX8A 3HZPA 5IEPA 4XM4A 4I4KA 3D9RA 3FKAA 3RGRA 5CK6A 3K7CA 4FCJA 4WP5A 3FF0A 1W6YA 1GYBA 1S5AA 5AIFA 1JN5B
chains in the Genus database with same CATH superfamily
2GU3A 1WNHA 5IEOA 2CK3H 1HYFA 3DGLA 4HM8B 1C7HA 1OACA 3KSED 3X3YA 5JPPA 2PZVA 4H61A 2Y74A 4RNZA 1V58A 1FUTA 3ZG5A 2BHMA 4ORLA 4MEIA 3WDGB 2P0MA 3Q3FA 3S29A 3STDA 1RJOA 1W01A 1YIT3 3BNBA 3G713 2I9WA 2K3DA 2L4VA 3EF8A 1YI23 1T5YA 1W6GA 1BANA 1WTHA 2F5MA 3EN1B 3G8ZA 3NBBA 3SLUA 6STDA 5IW9A 1K734 3JUNA 5LC7A 2BMOB 1CH0A 3PCSA 1JKGB 1ROAA 5IG0A 4AEQA 3VF1A 3HK4A 1GS3A 3ECFA 1BSCA 1JZOA 1OF5A 1BIRA 2YX9A 4PEJA 2ZHXB 1UGHI 4N6NB 1KD14 4NPBA 1VQ43 4MMZB 1BNJA 4HM7B 3OV4A 3OWYA 5AIFA 1UUWB 3WA3A 1Q824 4HM4B 1WMPA 4IPBA 3GRDA 4KT3B 5D82A 1BRSA 2CHCA 4WYKB 3G4S3 1BRNL 1JZDA 5AI1A 2W6JH 3X40A 1IV9A 1SPUA 1UCLA 2P05A 2CWUA 4EV5A 1LOYA 4HM3B 1LVNA 4O3VA 1BNIA 2IA7A 1VQO3 2CIUA 4EXRA 1EEJA 2GBWB 1Q9EA 1B27A 1GMRA 2ZDJA 1BRHA 1OHPA 3BIRA 3ROBA 4HKVB 1IU7A 4FMCA 4XBTA 3AMOB 4KFEA 5KP4A 3RDEA 3SVAA 1DMNA 1RKYA 5FW5A 3RNTA 1D6YA 2BMQB 3BNCA 1I2EA 3GZBA 3NBRA 1NB5I 1Q814 3MG2A 1LOWA 1CEWI 2W2CA 3E99A 3N8BA 1QMAA 1STFI 1RGEA 3NQYA 4EW5A 1IK3A 3LTCA 1BRGA 1JB4A 1EKMA 2HMLB 1US1A 3EX9A 4G1MB 3V98A 4NREA 3MG1A 3LYGA 1VQ63 1K41A 1V74A 4FMDA 1W7CA 3BU4A 5EEOA 5STDA 1AVLA 1G96A 4O8SA 3CNXA 4N6TA 3EE1A 1SIIA 2CFLA 1HZ1A 2XRXB 2RCDA 1FGQA 4I5QA 2XR8B 1ISKA 3Q2PA 1ZGXA 2B24B 2CFGA 5IG5A 5JPUA 2IUKA 2AADA 3KZTA 3DGMA 2XH9A 1SIHA 1G0TA 1DMMA 2ML5A 4RBNA 1RCLA 1UI8A 1FGMA 4CPKA 4EYCA 2UGIA 1N9EA 1HKXA 3LTBA 4XBXA 1TU5A 3I563 1UCKA 3GWRA 5CF2A 1QALA 1NO3A 2UUGC 5AEWB 1WMOA 3FLJA 4WWUC 1BNRA 4MJDA 1CYUA 2JDIH 2GXFA 3F7SA 4HJLB 5TGNA 1M9GA 2LYXA 5CXOA 3CCR3 3OWUA 5IENA 2CG1A 3F40A 2BU4A 1EG9B 4HYZA 1EQKA 3B4OA 5JBSA 3D3LA 4KFFA 1PY3A 3NM2A 1QVF2 3S28A 1A2VA 1BNEA 2IY2A 2JQ5A 3D5GA 2IUJA 1CYVA 3A76A 4LEHA 2XSOB 5I97A 2P09A 1R4YA 1Q7Y4 1FGRA 1KWIA 2CC3A 1OHSA 1M904 1UCIA 2OWPA 2A15A 3K63A 2H0GA 4Q53A 3K9MC 1DETA 4GL6A 3AGOA 4U13A 1IVWA 1EUIC 1YHQ3 4STDA 1TUHA 2QIYA 4R4KA 2KF6A 2QA43 1RN4A 6RNTA 1QAKA 4R9KA 1GOVA 1GMQA 1AR0A 1X1YA 3KN4A 4BL2A 3X42A 1AQZA 3ZG0A 1N8QA 4WHAA 1A2PA 2OTL3 4BTYA 1I0XA 2CH9A 4EC6A 2BO9B 5BVBA 1SQWA 4QWTA 2KCDA 2HMOB 2W9PA 4KZ1A 1SJWA 1GOUA 1D6UA 2K0MA 4CDLA 5KP3A 1TFOA 1B2MA 5IG3A 2OQEC 3QRDA 1OPYA 6GSPA 1OCVA 5CF1A 3MKIA 1F8NA 1GD3A 2BT3A 1MWRA 3OX9A 3PYJA 4XDWA 5AIIA 4JF8A 4RZMA 3CCS3 4N6LA 1ROVA 1RRHA 3H51A 1VQQA 1FGOA 3ER7A 3URPA 2F5WA 1CQSA 1ULJB 1VZZA 2M7OA 3N9HA 2D42A 3CCQ3 1RHLA 1ZS7A 4HM5B 3O8YA 3VSYA 2RGQA 2FXTA 3CPW2 3T8NA 1LOXA 2CKFB 5DRVA 2W0QA 2OQEA 4HM2B 2Z7AA 3F9SA 1BAOA 1RNBA 1Q7HA 1UI7A 1LNHA 1JNQA 2R4IA 5LC6A 5AIGA 4N6MA 4KVHA 4BU4A 1JB2A 1RMSA 1N5HA 1W02A 3V99A 2FNQA 3NV0A 2CFKA 1RTUA 4HZBB 3KSPA 3X3ZA 1GSPA 1W00A 1NNVA 1PYLA 2UX0A 1MWTA 1M1XB 3CNMA 2W56A 1MGRA 3FH1A 4X2OA 4WFOA 3X41A 3D5IA 5FGOA 1FUSA 2CG0A 4R1KA 2ML6A 1ASKA 1B2XA 4NHFA 3WA2X 3K0ZA 1T2HA 2QGUA 1RGLA 3FG1A 2E2TA 4N3VA 1JBRA 1SARA 3DH2A 1TJDA 2WO0A 3I0YA 4J8TA 1RN7A 3EB8A 1LRAA 5BXQA 2SBLA 1YNVX 4FMAA 2QEX3 5EQLA 1BSDA 2KXGA 1YVSA 3X3XA 1I8VA 2D1WA 3LT8A 1DVCA 3IPTA 4CCVA 3CD63 1O7WB 4HM6B 1IT7A 2GEYA 2XGNA 4EV2A 7GSPA 1M1K4 4BIRA 1VQL3 1BSEA 4J5GA 4BTXA 3BNDA 2Z77A 2WOHA 3BB9A 3QK9A 1FZUA 4HM1B 3WHOA 3FF2A 3HIGA 3S5CA 1OUNA 1RGGA 3CXC2 1B2SA 1BGSA 1BSBA 1E3RA 3CC23 1UGIA 2IMJA 1NDOB 4O2HA 3G16A 3DMCA 4XDVA 1LQGC 2GSPA 2J8XB 1UUGB 1YJN3 1LXEA 1AVKA 1T2IA 1GMPA 1JN5A 2BIRA 3MHEA 4BL3A 1BNSA 2L1SA 1VQP3 1FGTA 1KQS2 5G1LA 4GHOA 2F56A 3EBYA 1AY7A 3UB1A 1T3BA 1BUJA 1GY5A 3AGNA 5AYSC 3A5EA 1G02A 1N5PA 2F4YA 1VQ83 2WOFA 1O7PB 3FCSB 3HOHA 1I70A 1VQ73 2XF3A 4N6UA 1DE3A 2CWVA 2KRTA 1RGCA 1U8CB 1JV2B 1HU9A 1C54A 7RNTA 3JUQA 5BIRA 4MMXB 3EBTA 1JKGA 4N6V0 1RSNA 3S27A 1OF5B 3LH4A 1X1XA 4K1UA 2FGTA 3NX0A 1IT8A 3TDGA 1FA3A 1ZX2A 3SXXA 4AKZA 1NWWA 1L5GB 2YFJB 2O9UX 1YGEA 5IG4A 1UW1A 3LMLA 2MF7A 3U1WA 1OH0A 3F8HA 3UL5A 3CME3 1ZO2A 3DGYA 1VQK3 3UJMA 2ZL8A 1I3FA 2CX1A 4WYKA 5EVHA 5AIHA 1DYUA 4J5KA 2GBXB 4RNYA 2CX0A 4K61A 1RDSA 3MSOA 1B21A 5ELJA 2XFTA 5GSPA 3MWZA 4L7KA 1I3IA 2HMKB 2W03A 5RNTA 1O7HB 3CCU3 3CMA3 4FR9A 2E2UA 1I0VA 1IVXA 1W5ZA 3AMOA 3NXJA 3KCHA 2MC8A 3SEDA 4BTWA 3CCE3 3T0UA 2E2VA 2WGQA 3LT9A 3MPHA 4JRFA 7STDA 1JB5A 3EC9A 5D83A 5HGRA 4GSPA 3IMAB 3Q1CA 1FUWA 1J2BA 5ELUA 3MYTA 3F8XA 3S67A 1B2ZA 1TFKA 2F98A 1A2KA 3AHSA 3EQQB 2K54A 1Q864 1IYYA 3NM7A 3LZAA 1QJGA 2BNGA 2CFDA 3LOYA 1Q40B 2BMRB 3PGBA 4HAAA 2PNCA 4CJNA 1KSIA 4ZM8A 2AAEA 4HVNA 4MMYB 5CLKA 4KFDA 1K9M4 2W04A 1GOYA 2OTJ3 1QAFA 3CC73 1MGWA 2KF3A 2XFSA 4FCMA 2RNTA 4TX4A 2YFLB 1B20A 1U5OA 4J9AA 1VQ93 3BLZA 1TRQA 3WODG 1OGZA 1BRKA 1LOVA 1S723 1BNFA 3NHXA 3DY5A 3NUVA 3MG3A 3L0RA 4LYLB 3UNLA 3V92A 3I553 2KF5A 3OW22 1R4CA 1W4NA 1VQ53 2P38A 3DM8A 3GZXB 5G2GA 2XGLA 2C10A 3KE7A 4DKIA 2INXA 3SOYA 4RNTA 5IERA 5D81A 2H0IA 2LQVA 3JUOA 1MWSA 1PFPA 3OWSA 1Q42A 2Z76A 2F86B 3HIIA 4N6OB 5HOHA 1IQXA 1IQ8A 1Y4KA 4XB5A 1D6ZA 1TRPA 1RCKA 3JVCA 4HZ9B 4R9LA 4AKYA 3VGNA 1AV4A 3LXUX 1A90A 3LTAA 1TP6A 2RBIA 3FG3A 3DGNA 5KP1A 3NBJA 3JUPA 4LSOA 4R80A 1W6CA 3G0KA 3WOFB 3FG4A 2SARA 3PZWA 5DREA 1IVVA 3GZRA 1UUVB 3CCV3 1YJW3 1BRJA 3DGOA 4HOHA 3FGYA 4L8OA 2OOVC 4IIAA 3CCM3 3EHCA 1RN1A 1Z1SA 1YJ93 2RSXA 1VQN3 3GSPA 1EA2A 5AYRB 1A67A 1B3SA 1I2GA 4FCZA 3IJEB 1BOXA 2GU1A 1BUQA 3PXMA 1B2UA 1I2FA 3Q90A 1YIJ3 9RNTA 1RGKA 1RLSA 2B1XB 3J7Yd 2Q07A 5G1KA 1DMQA 1KC84 1N8R4 1X1WA 2RFRA 2HMMB 3SOAA 3ZFZA 1WQLB 3CPOA 5AEUB 3F7XA 3D79A 2OOVA 3EN8A 5IF6A 3WMDA 1BSAA 5A0OB 4L8PA 1BRIA 1NU3A 1O7MB 3FZWA 1BU4A 5BU4A 8RNTA 2CFWA 1IDPA 2P0XA 4O02B 3GAXA 1NB3I 1O7NB 3DUKA 4LZIA 4OUQA 1W2B2 2OCTA 4LGQA 1MNLA 1Q40A 1YVBI 3CC43 4X2HA 1IQYA 8CHOA 1IV7A 2C11A 1GY6A 1GY7A 2XEPA 3KFQC 1K8A4 4XBYA 1YGWA 1RGAA 1STDA 1RGHA 3FSDA 3PCRA 1JBSA 1JRQA 5M1AA 1LQMB 1TTOA 3NV0B 1K28A 1RRLA 1E3VA 1E97A 1O7GB 3RGAA 2YFIB 5M19A 1JJ22 2GEXA 3H3HA 3GZYB 3HI7A 1TIJA 1OHOA 3SX1A 1UCJA 2W56B 4K1VA 3N54B 3B7CA 3UL6A 2H0HA 1IVUA 1GD4A 4EBGA 2ZA4A 3B4PA 3CU3A 3U97A 2V1LA 1MOLA 3DZLA 2KF4A 1X1UA 4LMIA 3CCL3 1MWUA 3SYUA 4OK0A 2HOHA 3KIIA 1ULIB 3B8LA 3T8UA 3NQZA 4HBRA 1RNTA 2HMJB 3EJVA 4GB5A 3M8CA 3OXAA 4ILFA 4OVMA 1OGXA 4FMBA 1BNGA 3KKGA 2F99A 1QVG2 3JUMA 1JBTA 3F14A 4H3UA 1N9JA 1BVIA 3LTDA 2Y73A 5M18A 1VQM3 3BNEA 1NJI4 2O3OA 3ALAA 2CW9A 1PU4A 2XSHB 3DXOA 2STDA 4HM0B 1RGFA 3AHWA 4K90B 3G6E3 1W2ZA 3D4AA 3K5TA 2HMNB 3HX8A 1UDII 1V57A 2Z6BA 3HZPA 4XM4A 2C4BA 4I4KA 5IEPA 2WGOA 3D9RA 1FW7A 1WMNA 1DVDA 3FKAA 3WOEB 3RGRA 5CK6A 3CCJ3 4IT7A 2W9QA 3K7CA 4FCJA 4WP5A 2CWTA 3FF0A 1LNIA 1W6YA 1GYBA 3WR2A 1S5AA 2KAAA 1FYSA 2IYJA 3PS8A 2R41A 1JN5B
chains in the Genus database with same CATH topology
2GU3A 1WNHA 5IEOA 2CK3H 3DGLA 4HM8B 1C7HA 1OACA 3KSED 3X3YA 5JPPA 2PZVA 4H61A 2Y74A 4RNZA 2BHMA 4ORLA 4MEIA 3WDGB 2P0MA 3S29A 3STDA 1RJOA 1W01A 1YIT3 3BNBA 3G713 2I9WA 2L4VA 3EF8A 1YI23 1T5YA 1W6GA 1WTHA 3EN1B 3G8ZA 6STDA 3SLUA 3NBBA 5IW9A 1K734 3JUNA 5LC7A 2BMOB 3PCSA 1JKGB 1ROAA 5IG0A 4AEQA 3VF1A 3HK4A 1GS3A 3ECFA 4PEJA 1OF5A 2YX9A 4N6NB 1KD14 1VQ43 4MMZB 4HM7B 1Q824 3OV4A 3OWYA 1UUWB 3WA3A 4HM4B 1WMPA 4IPBA 3GRDA 5D82A 2CHCA 4WYKB 3G4S3 5AI1A 2W6JH 3X40A 1IV9A 1SPUA 2P05A 2CWUA 4EV5A 4HM3B 4O3VA 1LVNA 1VQO3 2IA7A 2CIUA 4EXRA 2GBWB 2ZDJA 3ROBA 1OHPA 4HKVB 1IU7A 4FMCA 4XBTA 3AMOB 4KFEA 5KP4A 3RDEA 3SVAA 1DMNA 1RKYA 5FW5A 1D6YA 2BMQB 3BNCA 3GZBA 3NBRA 1NB5I 1Q814 3MG2A 1CEWI 2W2CA 3E99A 3N8BA 1QMAA 1STFI 3NQYA 1IK3A 3LTCA 1JB4A 1EKMA 2HMLB 1US1A 3EX9A 4G1MB 3V98A 4NREA 3MG1A 3LYGA 1VQ63 1K41A 1V74A 4FMDA 1W7CA 5EEOA 5STDA 1AVLA 1G96A 4O8SA 3CNXA 4N6TA 3EE1A 1SIIA 2CFLA 2XRXB 2RCDA 1FGQA 1ISKA 2XR8B 3Q2PA 2B24B 2CFGA 5JPUA 5IG5A 2IUKA 3KZTA 3DGMA 2XH9A 1SIHA 1DMMA 2ML5A 4RBNA 4EYCA 1UI8A 1FGMA 1N9EA 1HKXA 3LTBA 4XBXA 1TU5A 3I563 3GWRA 5CF2A 1QALA 1NO3A 5AEWB 1WMOA 3FLJA 4WWUC 4MJDA 1CYUA 2JDIH 2GXFA 3F7SA 4HJLB 5TGNA 1M9GA 2LYXA 5CXOA 3CCR3 3OWUA 5IENA 2CG1A 3F40A 1EG9B 4HYZA 1EQKA 3B4OA 5JBSA 3D3LA 4KFFA 1QVF2 3NM2A 3S28A 1A2VA 2JQ5A 2IUJA 1CYVA 3A76A 4LEHA 2XSOB 5I97A 2P09A 1Q7Y4 1FGRA 1KWIA 2CC3A 1OHSA 1M904 2OWPA 2A15A 3K63A 4Q53A 3K9MC 4GL6A 4U13A 1IVWA 1YHQ3 4STDA 1TUHA 2QIYA 4R4KA 2QA43 1QAKA 4R9KA 1AR0A 3KN4A 3X42A 1N8QA 4WHAA 2OTL3 4BTYA 2CH9A 4EC6A 2BO9B 5BVBA 1SQWA 4QWTA 2KCDA 2HMOB 2W9PA 4KZ1A 1SJWA 1D6UA 2K0MA 4CDLA 5KP3A 1TFOA 5IG3A 2OQEC 3QRDA 1OPYA 1OCVA 5CF1A 3MKIA 1F8NA 1GD3A 2BT3A 3OX9A 3PYJA 4XDWA 5AIIA 4JF8A 4RZMA 3CCS3 4N6LA 1ROVA 1RRHA 3H51A 3ER7A 1FGOA 1CQSA 1ULJB 1VZZA 2M7OA 3N9HA 2D42A 3CCQ3 4HM5B 3O8YA 3VSYA 2RGQA 2FXTA 3CPW2 3T8NA 1LOXA 2CKFB 5DRVA 2W0QA 2OQEA 4HM2B 2Z7AA 3F9SA 1UI7A 1LNHA 1JNQA 2R4IA 5LC6A 5AIGA 4N6MA 4KVHA 1JB2A 1N5HA 1W02A 3V99A 2FNQA 3NV0A 2CFKA 4HZBB 3KSPA 3X3ZA 1W00A 2UX0A 1M1XB 3CNMA 2W56A 3FH1A 4WFOA 4X2OA 3X41A 5FGOA 2CG0A 4R1KA 2ML6A 1ASKA 4NHFA 3WA2X 3K0ZA 2QGUA 3FG1A 4N3VA 2E2TA 3I0YA 2WO0A 4J8TA 1RN7A 3EB8A 5BXQA 2SBLA 4FMAA 2QEX3 5EQLA 2KXGA 3X3XA 2D1WA 3LT8A 1DVCA 3IPTA 4CCVA 3CD63 1O7WB 4HM6B 1IT7A 2GEYA 2XGNA 4EV2A 1M1K4 1VQL3 4BTXA 3BNDA 2Z77A 2WOHA 3BB9A 3QK9A 4HM1B 3FF2A 3HIGA 3S5CA 1OUNA 3CXC2 1E3RA 3CC23 2IMJA 1NDOB 4O2HA 3G16A 3DMCA 4XDVA 1YJN3 1LXEA 1AVKA 3MHEA 1VQP3 1JN5A 1KQS2 1FGTA 3EBYA 3UB1A 1GY5A 5AYSC 1N5PA 1VQ83 2WOFA 1O7PB 3FCSB 1VQ73 2XF3A 4N6UA 2CWVA 2KRTA 1U8CB 1JV2B 1HU9A 3JUQA 4MMXB 3EBTA 1JKGA 4N6V0 3S27A 1OF5B 3LH4A 4K1UA 2FGTA 3NX0A 1IT8A 3TDGA 1FA3A 1ZX2A 3SXXA 4AKZA 1NWWA 1L5GB 2YFJB 2O9UX 1YGEA 5IG4A 1UW1A 3LMLA 2MF7A 3U1WA 1OH0A 3F8HA 3UL5A 3CME3 1ZO2A 1VQK3 3UJMA 2ZL8A 4WYKA 5EVHA 5AIHA 1DYUA 2GBXB 4RNYA 4K61A 3MSOA 5ELJA 2XFTA 3MWZA 4L7KA 2HMKB 2W03A 1O7HB 3CCU3 3CMA3 4FR9A 2E2UA 1IVXA 1W5ZA 3AMOA 3NXJA 3CCE3 2MC8A 3SEDA 4BTWA 3T0UA 2E2VA 2WGQA 3LT9A 3MPHA 4JRFA 7STDA 1JB5A 3EC9A 5D83A 5HGRA 3IMAB 3Q1CA 1FUWA 1J2BA 5ELUA 3MYTA 3F8XA 3S67A 1TFKA 2F98A 1A2KA 3EQQB 2K54A 1Q864 3NM7A 3LZAA 1QJGA 2BNGA 2CFDA 3LOYA 1Q40B 2BMRB 3PGBA 2PNCA 1KSIA 4ZM8A 4HVNA 4MMYB 5CLKA 4KFDA 1K9M4 2W04A 2OTJ3 1QAFA 3CC73 2XFSA 4FCMA 4TX4A 2YFLB 1U5OA 4J9AA 1VQ93 3BLZA 3WODG 1OGZA 1S723 3NHXA 3NUVA 3DY5A 3UNLA 3MG3A 3L0RA 3V92A 3I553 3OW22 1R4CA 1W4NA 1VQ53 2P38A 3DM8A 3GZXB 5G2GA 2XGLA 2C10A 3KE7A 2INXA 3SOYA 5IERA 5D81A 2LQVA 3JUOA 1PFPA 3OWSA 1Q42A 2Z76A 2F86B 3HIIA 4N6OB 1IQXA 1IQ8A 1Y4KA 4XB5A 1D6ZA 4HZ9B 3JVCA 4R9LA 4AKYA 3VGNA 1AV4A 3LXUX 1A90A 3LTAA 1TP6A 3FG3A 3DGNA 5KP1A 3NBJA 3JUPA 4LSOA 4R80A 1W6CA 3G0KA 3WOFB 3FG4A 3PZWA 5DREA 1IVVA 3GZRA 1UUVB 3CCV3 1YJW3 3DGOA 3FGYA 4L8OA 2OOVC 4IIAA 3CCM3 3EHCA 1Z1SA 1YJ93 2RSXA 1VQN3 1EA2A 5AYRB 1A67A 4FCZA 3IJEB 2GU1A 1BUQA 3PXMA 3Q90A 1YIJ3 2B1XB 3J7Yd 2Q07A 1KC84 1DMQA 1N8R4 2RFRA 3SOAA 2HMMB 1WQLB 3CPOA 5AEUB 3F7XA 2OOVA 5IF6A 3EN8A 3WMDA 5A0OB 4L8PA 1NU3A 1O7MB 3FZWA 2CFWA 1IDPA 2P0XA 4O02B 3GAXA 1NB3I 1O7NB 3DUKA 4LZIA 4OUQA 1W2B2 2OCTA 4LGQA 1MNLA 1Q40A 1YVBI 3CC43 4X2HA 1IQYA 8CHOA 1IV7A 2C11A 1GY6A 1GY7A 2XEPA 3KFQC 1K8A4 4XBYA 3PCRA 1STDA 3FSDA 1JRQA 3NV0B 1K28A 1RRLA 1E3VA 1E97A 1O7GB 3RGAA 2YFIB 1JJ22 2GEXA 3H3HA 3GZYB 3HI7A 1TIJA 1OHOA 3SX1A 2W56B 4K1VA 3N54B 3B7CA 3UL6A 1IVUA 1GD4A 4EBGA 3B4PA 3CU3A 3U97A 2V1LA 1MOLA 3DZLA 4LMIA 3CCL3 4OK0A 3KIIA 1ULIB 3B8LA 3T8UA 3NQZA 4HBRA 2HMJB 3EJVA 4GB5A 4OVMA 3M8CA 3OXAA 1OGXA 4FMBA 3KKGA 2F99A 1QVG2 3JUMA 3F14A 4H3UA 1N9JA 3LTDA 2Y73A 1VQM3 3BNEA 1NJI4 2O3OA 2CW9A 1PU4A 2XSHB 3DXOA 2STDA 4HM0B 4K90B 3G6E3 1W2ZA 3K5TA 2HMNB 3HX8A 2Z6BA 3HZPA 5IEPA 4XM4A 4I4KA 2WGOA 3D9RA 1WMNA 1DVDA 3FKAA 3WOEB 3RGRA 5CK6A 3CCJ3 4IT7A 2W9QA 3K7CA 4FCJA 4WP5A 2CWTA 3FF0A 1W6YA 1GYBA 1S5AA 3PS8A 5AIFA 3ALAA 1JN5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IEO A;  4HM8 B;  1C7H A;  5JPP A;  2PZV A;  4ORL A;  3STD A;  1W01 A;  2I9W A;  3EF8 A;  3EN1 B;  3G8Z A;  6STD A;  3JUN A;  2BMO B;  1JKG B;  5IG0 A;  3HK4 A;  1GS3 A;  3ECF A;  4PEJ A;  1OF5 A;  4HM7 B;  3OV4 A;  3OWY A;  1UUW B;  4HM4 B;  3GRD A;  5D82 A;  2CHC A;  4WYK B;  5AI1 A;  4HM3 B;  2GBW B;  3ROB A;  1OHP A;  4HKV B;  4XBT A;  5KP4 A;  1DMN A;  5FW5 A;  2BMQ B;  3GZB A;  3NBR A;  3MG2 A;  2W2C A;  3E99 A;  1QMA A;  1JB4 A;  2HML B;  3EX9 A;  3MG1 A;  3LYG A;  1K41 A;  5STD A;  3CNX A;  2XRX B;  2RCD A;  1ISK A;  2XR8 B;  2B24 B;  5JPU A;  5IG5 A;  3KZT A;  1DMM A;  1HKX A;  4XBX A;  3GWR A;  5CF2 A;  5AEW B;  3FLJ A;  4WWU C;  4MJD A;  2GXF A;  3F7S A;  4HJL B;  5TGN A;  5CXO A;  3OWU A;  5IEN A;  3F40 A;  1EG9 B;  3B4O A;  3NM2 A;  2JQ5 A;  3A76 A;  4LEH A;  2XSO B;  1OHS A;  2OWP A;  2A15 A;  4Q53 A;  4U13 A;  4STD A;  1TUH A;  2QIY A;  4R9K A;  1AR0 A;  5BVB A;  2HMO B;  1SJW A;  4CDL A;  5KP3 A;  5IG3 A;  1OPY A;  1OCV A;  5CF1 A;  3MKI A;  3OX9 A;  4XDW A;  5AII A;  4RZM A;  3H51 A;  3ER7 A;  1CQS A;  1ULJ B;  1VZZ A;  4HM5 B;  3VSY A;  2RGQ A;  3T8N A;  2CKF B;  5DRV A;  4HM2 B;  2Z7A A;  3F9S A;  2R4I A;  5AIG A;  4KVH A;  1JB2 A;  1W02 A;  3NV0 A;  4HZB B;  3KSP A;  1W00 A;  2UX0 A;  3CNM A;  3FH1 A;  4X2O A;  4R1K A;  1ASK A;  3K0Z A;  2QGU A;  4N3V A;  3I0Y A;  4J8T A;  5BXQ A;  3IPT A;  1O7W B;  4HM6 B;  2GEY A;  2Z77 A;  3BB9 A;  4HM1 B;  3FF2 A;  3S5C A;  1OUN A;  1E3R A;  2IMJ A;  1NDO B;  3G16 A;  3DMC A;  4XDV A;  3MHE A;  1JN5 A;  3EBY A;  1GY5 A;  1O7P B;  3JUQ A;  3EBT A;  1JKG A;  1OF5 B;  4K1U A;  1ZX2 A;  1NWW A;  2YFJ B;  5IG4 A;  1OH0 A;  3F8H A;  1ZO2 A;  3UJM A;  4WYK A;  5EVH A;  5AIH A;  2GBX B;  3MSO A;  4L7K A;  2HMK B;  1O7H B;  3NXJ A;  3SED A;  7STD A;  1JB5 A;  3EC9 A;  5D83 A;  5HGR A;  3MYT A;  3F8X A;  2F98 A;  1A2K A;  3EQQ B;  2K54 A;  3LZA A;  1QJG A;  2BNG A;  1Q40 B;  2BMR B;  4HVN A;  5CLK A;  4FCM A;  2YFL B;  1U5O A;  4J9A A;  3BLZ A;  1OGZ A;  3NHX A;  3NUV A;  3UNL A;  3MG3 A;  3DM8 A;  5G2G A;  3GZX B;  3KE7 A;  2INX A;  3SOY A;  5IER A;  5D81 A;  3JUO A;  3OWS A;  1Q42 A;  2Z76 A;  2F86 B;  4XB5 A;  4HZ9 B;  4R9L A;  3VGN A;  1TP6 A;  5KP1 A;  3JUP A;  3G0K A;  5DRE A;  3GZR A;  1UUV B;  3FGY A;  4L8O A;  4IIA A;  3EHC A;  1Z1S A;  1EA2 A;  1BUQ A;  3Q90 A;  2B1X B;  1DMQ A;  2RFR A;  3SOA A;  2HMM B;  1WQL B;  3CPO A;  5AEU B;  3F7X A;  5IF6 A;  3EN8 A;  3WMD A;  4L8P A;  1NU3 A;  1O7M B;  3FZW A;  1IDP A;  4OUQ A;  3DUK A;  1O7N B;  4LGQ A;  1Q40 A;  4X2H A;  8CHO A;  1GY6 A;  1GY7 A;  4XBY A;  1STD A;  3FSD A;  3NV0 B;  1E3V A;  1E97 A;  1O7G B;  3RGA A;  2YFI B;  2GEX A;  3H3H A;  3GZY B;  1OHO A;  4K1V A;  3B7C A;  3B4P A;  3CU3 A;  3DZL A;  4LMI A;  1ULI B;  3B8L A;  3T8U A;  2HMJ B;  3EJV A;  4GB5 A;  4OVM A;  3M8C A;  3OXA A;  1OGX A;  3KKG A;  2F99 A;  3JUM A;  3F14 A;  4H3U A;  2XSH B;  3DXO A;  2STD A;  4HM0 B;  2HMN B;  3HX8 A;  3HZP A;  5IEP A;  4XM4 A;  4I4K A;  3D9R A;  3FKA A;  3RGR A;  5CK6 A;  3K7C A;  4FCJ A;  4WP5 A;  3FF0 A;  1W6Y A;  1GYB A;  1S5A A;  5AIF A;  1JN5 B; 
#chains in the Genus database with same CATH topology
 2GU3 A;  1WNH A;  5IEO A;  2CK3 H;  1HYF A;  3DGL A;  4HM8 B;  1C7H A;  1OAC A;  3KSE D;  3X3Y A;  5JPP A;  2PZV A;  4H61 A;  2Y74 A;  4RNZ A;  1V58 A;  1FUT A;  3ZG5 A;  2BHM A;  4ORL A;  4MEI A;  3WDG B;  2P0M A;  3Q3F A;  3S29 A;  3STD A;  1RJO A;  1W01 A;  1YIT 3;  3BNB A;  3G71 3;  2I9W A;  2K3D A;  2L4V A;  3EF8 A;  1YI2 3;  1T5Y A;  1W6G A;  1BAN A;  1WTH A;  2F5M A;  3EN1 B;  3G8Z A;  3NBB A;  3SLU A;  6STD A;  5IW9 A;  1K73 4;  3JUN A;  5LC7 A;  2BMO B;  1CH0 A;  3PCS A;  1JKG B;  1ROA A;  5IG0 A;  4AEQ A;  3VF1 A;  3HK4 A;  1GS3 A;  3ECF A;  1BSC A;  1JZO A;  1OF5 A;  1BIR A;  2YX9 A;  4PEJ A;  2ZHX B;  1UGH I;  4N6N B;  1KD1 4;  4NPB A;  1VQ4 3;  4MMZ B;  1BNJ A;  4HM7 B;  3OV4 A;  3OWY A;  5AIF A;  1UUW B;  3WA3 A;  1Q82 4;  4HM4 B;  1WMP A;  4IPB A;  3GRD A;  4KT3 B;  5D82 A;  1BRS A;  2CHC A;  4WYK B;  3G4S 3;  1BRN L;  1JZD A;  5AI1 A;  2W6J H;  3X40 A;  1IV9 A;  1SPU A;  1UCL A;  2P05 A;  2CWU A;  4EV5 A;  1LOY A;  4HM3 B;  1LVN A;  4O3V A;  1BNI A;  2IA7 A;  1VQO 3;  2CIU A;  4EXR A;  1EEJ A;  2GBW B;  1Q9E A;  1B27 A;  1GMR A;  2ZDJ A;  1BRH A;  1OHP A;  3BIR A;  3ROB A;  4HKV B;  1IU7 A;  4FMC A;  4XBT A;  3AMO B;  4KFE A;  5KP4 A;  3RDE A;  3SVA A;  1DMN A;  1RKY A;  5FW5 A;  3RNT A;  1D6Y A;  2BMQ B;  3BNC A;  1I2E A;  3GZB A;  3NBR A;  1NB5 I;  1Q81 4;  3MG2 A;  1LOW A;  1CEW I;  2W2C A;  3E99 A;  3N8B A;  1QMA A;  1STF I;  1RGE A;  3NQY A;  4EW5 A;  1IK3 A;  3LTC A;  1BRG A;  1JB4 A;  1EKM A;  2HML B;  1US1 A;  3EX9 A;  4G1M B;  3V98 A;  4NRE A;  3MG1 A;  3LYG A;  1VQ6 3;  1K41 A;  1V74 A;  4FMD A;  1W7C A;  3BU4 A;  5EEO A;  5STD A;  1AVL A;  1G96 A;  4O8S A;  3CNX A;  4N6T A;  3EE1 A;  1SII A;  2CFL A;  1HZ1 A;  2XRX B;  2RCD A;  1FGQ A;  4I5Q A;  2XR8 B;  1ISK A;  3Q2P A;  1ZGX A;  2B24 B;  2CFG A;  5IG5 A;  5JPU A;  2IUK A;  2AAD A;  3KZT A;  3DGM A;  2XH9 A;  1SIH A;  1G0T A;  1DMM A;  2ML5 A;  4RBN A;  1RCL A;  1UI8 A;  1FGM A;  4CPK A;  4EYC A;  2UGI A;  1N9E A;  1HKX A;  3LTB A;  4XBX A;  1TU5 A;  3I56 3;  1UCK A;  3GWR A;  5CF2 A;  1QAL A;  1NO3 A;  2UUG C;  5AEW B;  1WMO A;  3FLJ A;  4WWU C;  1BNR A;  4MJD A;  1CYU A;  2JDI H;  2GXF A;  3F7S A;  4HJL B;  5TGN A;  1M9G A;  2LYX A;  5CXO A;  3CCR 3;  3OWU A;  5IEN A;  2CG1 A;  3F40 A;  2BU4 A;  1EG9 B;  4HYZ A;  1EQK A;  3B4O A;  5JBS A;  3D3L A;  4KFF A;  1PY3 A;  3NM2 A;  1QVF 2;  3S28 A;  1A2V A;  1BNE A;  2IY2 A;  2JQ5 A;  3D5G A;  2IUJ A;  1CYV A;  3A76 A;  4LEH A;  2XSO B;  5I97 A;  2P09 A;  1R4Y A;  1Q7Y 4;  1FGR A;  1KWI A;  2CC3 A;  1OHS A;  1M90 4;  1UCI A;  2OWP A;  2A15 A;  3K63 A;  2H0G A;  4Q53 A;  3K9M C;  1DET A;  4GL6 A;  3AGO A;  4U13 A;  1IVW A;  1EUI C;  1YHQ 3;  4STD A;  1TUH A;  2QIY A;  4R4K A;  2KF6 A;  2QA4 3;  1RN4 A;  6RNT A;  1QAK A;  4R9K A;  1GOV A;  1GMQ A;  1AR0 A;  1X1Y A;  3KN4 A;  4BL2 A;  3X42 A;  1AQZ A;  3ZG0 A;  1N8Q A;  4WHA A;  1A2P A;  2OTL 3;  4BTY A;  1I0X A;  2CH9 A;  4EC6 A;  2BO9 B;  5BVB A;  1SQW A;  4QWT A;  2KCD A;  2HMO B;  2W9P A;  4KZ1 A;  1SJW A;  1GOU A;  1D6U A;  2K0M A;  4CDL A;  5KP3 A;  1TFO A;  1B2M A;  5IG3 A;  2OQE C;  3QRD A;  1OPY A;  6GSP A;  1OCV A;  5CF1 A;  3MKI A;  1F8N A;  1GD3 A;  2BT3 A;  1MWR A;  3OX9 A;  3PYJ A;  4XDW A;  5AII A;  4JF8 A;  4RZM A;  3CCS 3;  4N6L A;  1ROV A;  1RRH A;  3H51 A;  1VQQ A;  1FGO A;  3ER7 A;  3URP A;  2F5W A;  1CQS A;  1ULJ B;  1VZZ A;  2M7O A;  3N9H A;  2D42 A;  3CCQ 3;  1RHL A;  1ZS7 A;  4HM5 B;  3O8Y A;  3VSY A;  2RGQ A;  2FXT A;  3CPW 2;  3T8N A;  1LOX A;  2CKF B;  5DRV A;  2W0Q A;  2OQE A;  4HM2 B;  2Z7A A;  3F9S A;  1BAO A;  1RNB A;  1Q7H A;  1UI7 A;  1LNH A;  1JNQ A;  2R4I A;  5LC6 A;  5AIG A;  4N6M A;  4KVH A;  4BU4 A;  1JB2 A;  1RMS A;  1N5H A;  1W02 A;  3V99 A;  2FNQ A;  3NV0 A;  2CFK A;  1RTU A;  4HZB B;  3KSP A;  3X3Z A;  1GSP A;  1W00 A;  1NNV A;  1PYL A;  2UX0 A;  1MWT A;  1M1X B;  3CNM A;  2W56 A;  1MGR A;  3FH1 A;  4X2O A;  4WFO A;  3X41 A;  3D5I A;  5FGO A;  1FUS A;  2CG0 A;  4R1K A;  2ML6 A;  1ASK A;  1B2X A;  4NHF A;  3WA2 X;  3K0Z A;  1T2H A;  2QGU A;  1RGL A;  3FG1 A;  2E2T A;  4N3V A;  1JBR A;  1SAR A;  3DH2 A;  1TJD A;  2WO0 A;  3I0Y A;  4J8T A;  1RN7 A;  3EB8 A;  1LRA A;  5BXQ A;  2SBL A;  1YNV X;  4FMA A;  2QEX 3;  5EQL A;  1BSD A;  2KXG A;  1YVS A;  3X3X A;  1I8V A;  2D1W A;  3LT8 A;  1DVC A;  3IPT A;  4CCV A;  3CD6 3;  1O7W B;  4HM6 B;  1IT7 A;  2GEY A;  2XGN A;  4EV2 A;  7GSP A;  1M1K 4;  4BIR A;  1VQL 3;  1BSE A;  4J5G A;  4BTX A;  3BND A;  2Z77 A;  2WOH A;  3BB9 A;  3QK9 A;  1FZU A;  4HM1 B;  3WHO A;  3FF2 A;  3HIG A;  3S5C A;  1OUN A;  1RGG A;  3CXC 2;  1B2S A;  1BGS A;  1BSB A;  1E3R A;  3CC2 3;  1UGI A;  2IMJ A;  1NDO B;  4O2H A;  3G16 A;  3DMC A;  4XDV A;  1LQG C;  2GSP A;  2J8X B;  1UUG B;  1YJN 3;  1LXE A;  1AVK A;  1T2I A;  1GMP A;  1JN5 A;  2BIR A;  3MHE A;  4BL3 A;  1BNS A;  2L1S A;  1VQP 3;  1FGT A;  1KQS 2;  5G1L A;  4GHO A;  2F56 A;  3EBY A;  1AY7 A;  3UB1 A;  1T3B A;  1BUJ A;  1GY5 A;  3AGN A;  5AYS C;  3A5E A;  1G02 A;  1N5P A;  2F4Y A;  1VQ8 3;  2WOF A;  1O7P B;  3FCS B;  3HOH A;  1I70 A;  1VQ7 3;  2XF3 A;  4N6U A;  1DE3 A;  2CWV A;  2KRT A;  1RGC A;  1U8C B;  1JV2 B;  1HU9 A;  1C54 A;  7RNT A;  3JUQ A;  5BIR A;  4MMX B;  3EBT A;  1JKG A;  4N6V 0;  1RSN A;  3S27 A;  1OF5 B;  3LH4 A;  1X1X A;  4K1U A;  2FGT A;  3NX0 A;  1IT8 A;  3TDG A;  1FA3 A;  1ZX2 A;  3SXX A;  4AKZ A;  1NWW A;  1L5G B;  2YFJ B;  2O9U X;  1YGE A;  5IG4 A;  1UW1 A;  3LML A;  2MF7 A;  3U1W A;  1OH0 A;  3F8H A;  3UL5 A;  3CME 3;  1ZO2 A;  3DGY A;  1VQK 3;  3UJM A;  2ZL8 A;  1I3F A;  2CX1 A;  4WYK A;  5EVH A;  5AIH A;  1DYU A;  4J5K A;  2GBX B;  4RNY A;  2CX0 A;  4K61 A;  1RDS A;  3MSO A;  1B21 A;  5ELJ A;  2XFT A;  5GSP A;  3MWZ A;  4L7K A;  1I3I A;  2HMK B;  2W03 A;  5RNT A;  1O7H B;  3CCU 3;  3CMA 3;  4FR9 A;  2E2U A;  1I0V A;  1IVX A;  1W5Z A;  3AMO A;  3NXJ A;  3KCH A;  2MC8 A;  3SED A;  4BTW A;  3CCE 3;  3T0U A;  2E2V A;  2WGQ A;  3LT9 A;  3MPH A;  4JRF A;  7STD A;  1JB5 A;  3EC9 A;  5D83 A;  5HGR A;  4GSP A;  3IMA B;  3Q1C A;  1FUW A;  1J2B A;  5ELU A;  3MYT A;  3F8X A;  3S67 A;  1B2Z A;  1TFK A;  2F98 A;  1A2K A;  3AHS A;  3EQQ B;  2K54 A;  1Q86 4;  1IYY A;  3NM7 A;  3LZA A;  1QJG A;  2BNG A;  2CFD A;  3LOY A;  1Q40 B;  2BMR B;  3PGB A;  4HAA A;  2PNC A;  4CJN A;  1KSI A;  4ZM8 A;  2AAE A;  4HVN A;  4MMY B;  5CLK A;  4KFD A;  1K9M 4;  2W04 A;  1GOY A;  2OTJ 3;  1QAF A;  3CC7 3;  1MGW A;  2KF3 A;  2XFS A;  4FCM A;  2RNT A;  4TX4 A;  2YFL B;  1B20 A;  1U5O A;  4J9A A;  1VQ9 3;  3BLZ A;  1TRQ A;  3WOD G;  1OGZ A;  1BRK A;  1LOV A;  1S72 3;  1BNF A;  3NHX A;  3DY5 A;  3NUV A;  3MG3 A;  3L0R A;  4LYL B;  3UNL A;  3V92 A;  3I55 3;  2KF5 A;  3OW2 2;  1R4C A;  1W4N A;  1VQ5 3;  2P38 A;  3DM8 A;  3GZX B;  5G2G A;  2XGL A;  2C10 A;  3KE7 A;  4DKI A;  2INX A;  3SOY A;  4RNT A;  5IER A;  5D81 A;  2H0I A;  2LQV A;  3JUO A;  1MWS A;  1PFP A;  3OWS A;  1Q42 A;  2Z76 A;  2F86 B;  3HII A;  4N6O B;  5HOH A;  1IQX A;  1IQ8 A;  1Y4K A;  4XB5 A;  1D6Z A;  1TRP A;  1RCK A;  3JVC A;  4HZ9 B;  4R9L A;  4AKY A;  3VGN A;  1AV4 A;  3LXU X;  1A90 A;  3LTA A;  1TP6 A;  2RBI A;  3FG3 A;  3DGN A;  5KP1 A;  3NBJ A;  3JUP A;  4LSO A;  4R80 A;  1W6C A;  3G0K A;  3WOF B;  3FG4 A;  2SAR A;  3PZW A;  5DRE A;  1IVV A;  3GZR A;  1UUV B;  3CCV 3;  1YJW 3;  1BRJ A;  3DGO A;  4HOH A;  3FGY A;  4L8O A;  2OOV C;  4IIA A;  3CCM 3;  3EHC A;  1RN1 A;  1Z1S A;  1YJ9 3;  2RSX A;  1VQN 3;  3GSP A;  1EA2 A;  5AYR B;  1A67 A;  1B3S A;  1I2G A;  4FCZ A;  3IJE B;  1BOX A;  2GU1 A;  1BUQ A;  3PXM A;  1B2U A;  1I2F A;  3Q90 A;  1YIJ 3;  9RNT A;  1RGK A;  1RLS A;  2B1X B;  3J7Y d;  2Q07 A;  5G1K A;  1DMQ A;  1KC8 4;  1N8R 4;  1X1W A;  2RFR A;  2HMM B;  3SOA A;  3ZFZ A;  1WQL B;  3CPO A;  5AEU B;  3F7X A;  3D79 A;  2OOV A;  3EN8 A;  5IF6 A;  3WMD A;  1BSA A;  5A0O B;  4L8P A;  1BRI A;  1NU3 A;  1O7M B;  3FZW A;  1BU4 A;  5BU4 A;  8RNT A;  2CFW A;  1IDP A;  2P0X A;  4O02 B;  3GAX A;  1NB3 I;  1O7N B;  3DUK A;  4LZI A;  4OUQ A;  1W2B 2;  2OCT A;  4LGQ A;  1MNL A;  1Q40 A;  1YVB I;  3CC4 3;  4X2H A;  1IQY A;  8CHO A;  1IV7 A;  2C11 A;  1GY6 A;  1GY7 A;  2XEP A;  3KFQ C;  1K8A 4;  4XBY A;  1YGW A;  1RGA A;  1STD A;  1RGH A;  3FSD A;  3PCR A;  1JBS A;  1JRQ A;  5M1A A;  1LQM B;  1TTO A;  3NV0 B;  1K28 A;  1RRL A;  1E3V A;  1E97 A;  1O7G B;  3RGA A;  2YFI B;  5M19 A;  1JJ2 2;  2GEX A;  3H3H A;  3GZY B;  3HI7 A;  1TIJ A;  1OHO A;  3SX1 A;  1UCJ A;  2W56 B;  4K1V A;  3N54 B;  3B7C A;  3UL6 A;  2H0H A;  1IVU A;  1GD4 A;  4EBG A;  2ZA4 A;  3B4P A;  3CU3 A;  3U97 A;  2V1L A;  1MOL A;  3DZL A;  2KF4 A;  1X1U A;  4LMI A;  3CCL 3;  1MWU A;  3SYU A;  4OK0 A;  2HOH A;  3KII A;  1ULI B;  3B8L A;  3T8U A;  3NQZ A;  4HBR A;  1RNT A;  2HMJ B;  3EJV A;  4GB5 A;  3M8C A;  3OXA A;  4ILF A;  4OVM A;  1OGX A;  4FMB A;  1BNG A;  3KKG A;  2F99 A;  1QVG 2;  3JUM A;  1JBT A;  3F14 A;  4H3U A;  1N9J A;  1BVI A;  3LTD A;  2Y73 A;  5M18 A;  1VQM 3;  3BNE A;  1NJI 4;  2O3O A;  3ALA A;  2CW9 A;  1PU4 A;  2XSH B;  3DXO A;  2STD A;  4HM0 B;  1RGF A;  3AHW A;  4K90 B;  3G6E 3;  1W2Z A;  3D4A A;  3K5T A;  2HMN B;  3HX8 A;  1UDI I;  1V57 A;  2Z6B A;  3HZP A;  4XM4 A;  2C4B A;  4I4K A;  5IEP A;  2WGO A;  3D9R A;  1FW7 A;  1WMN A;  1DVD A;  3FKA A;  3WOE B;  3RGR A;  5CK6 A;  3CCJ 3;  4IT7 A;  2W9Q A;  3K7C A;  4FCJ A;  4WP5 A;  2CWT A;  3FF0 A;  1LNI A;  1W6Y A;  1GYB A;  3WR2 A;  1S5A A;  2KAA A;  1FYS A;  2IYJ A;  3PS8 A;  2R41 A;  1JN5 B; 
#chains in the Genus database with same CATH homology
 2GU3 A;  1WNH A;  5IEO A;  2CK3 H;  3DGL A;  4HM8 B;  1C7H A;  1OAC A;  3KSE D;  3X3Y A;  5JPP A;  2PZV A;  4H61 A;  2Y74 A;  4RNZ A;  2BHM A;  4ORL A;  4MEI A;  3WDG B;  2P0M A;  3S29 A;  3STD A;  1RJO A;  1W01 A;  1YIT 3;  3BNB A;  3G71 3;  2I9W A;  2L4V A;  3EF8 A;  1YI2 3;  1T5Y A;  1W6G A;  1WTH A;  3EN1 B;  3G8Z A;  6STD A;  3SLU A;  3NBB A;  5IW9 A;  1K73 4;  3JUN A;  5LC7 A;  2BMO B;  3PCS A;  1JKG B;  1ROA A;  5IG0 A;  4AEQ A;  3VF1 A;  3HK4 A;  1GS3 A;  3ECF A;  4PEJ A;  1OF5 A;  2YX9 A;  4N6N B;  1KD1 4;  1VQ4 3;  4MMZ B;  4HM7 B;  1Q82 4;  3OV4 A;  3OWY A;  1UUW B;  3WA3 A;  4HM4 B;  1WMP A;  4IPB A;  3GRD A;  5D82 A;  2CHC A;  4WYK B;  3G4S 3;  5AI1 A;  2W6J H;  3X40 A;  1IV9 A;  1SPU A;  2P05 A;  2CWU A;  4EV5 A;  4HM3 B;  4O3V A;  1LVN A;  1VQO 3;  2IA7 A;  2CIU A;  4EXR A;  2GBW B;  2ZDJ A;  3ROB A;  1OHP A;  4HKV B;  1IU7 A;  4FMC A;  4XBT A;  3AMO B;  4KFE A;  5KP4 A;  3RDE A;  3SVA A;  1DMN A;  1RKY A;  5FW5 A;  1D6Y A;  2BMQ B;  3BNC A;  3GZB A;  3NBR A;  1NB5 I;  1Q81 4;  3MG2 A;  1CEW I;  2W2C A;  3E99 A;  3N8B A;  1QMA A;  1STF I;  3NQY A;  1IK3 A;  3LTC A;  1JB4 A;  1EKM A;  2HML B;  1US1 A;  3EX9 A;  4G1M B;  3V98 A;  4NRE A;  3MG1 A;  3LYG A;  1VQ6 3;  1K41 A;  1V74 A;  4FMD A;  1W7C A;  5EEO A;  5STD A;  1AVL A;  1G96 A;  4O8S A;  3CNX A;  4N6T A;  3EE1 A;  1SII A;  2CFL A;  2XRX B;  2RCD A;  1FGQ A;  1ISK A;  2XR8 B;  3Q2P A;  2B24 B;  2CFG A;  5JPU A;  5IG5 A;  2IUK A;  3KZT A;  3DGM A;  2XH9 A;  1SIH A;  1DMM A;  2ML5 A;  4RBN A;  4EYC A;  1UI8 A;  1FGM A;  1N9E A;  1HKX A;  3LTB A;  4XBX A;  1TU5 A;  3I56 3;  3GWR A;  5CF2 A;  1QAL A;  1NO3 A;  5AEW B;  1WMO A;  3FLJ A;  4WWU C;  4MJD A;  1CYU A;  2JDI H;  2GXF A;  3F7S A;  4HJL B;  5TGN A;  1M9G A;  2LYX A;  5CXO A;  3CCR 3;  3OWU A;  5IEN A;  2CG1 A;  3F40 A;  1EG9 B;  4HYZ A;  1EQK A;  3B4O A;  5JBS A;  3D3L A;  4KFF A;  1QVF 2;  3NM2 A;  3S28 A;  1A2V A;  2JQ5 A;  2IUJ A;  1CYV A;  3A76 A;  4LEH A;  2XSO B;  5I97 A;  2P09 A;  1Q7Y 4;  1FGR A;  1KWI A;  2CC3 A;  1OHS A;  1M90 4;  2OWP A;  2A15 A;  3K63 A;  4Q53 A;  3K9M C;  4GL6 A;  4U13 A;  1IVW A;  1YHQ 3;  4STD A;  1TUH A;  2QIY A;  4R4K A;  2QA4 3;  1QAK A;  4R9K A;  1AR0 A;  3KN4 A;  3X42 A;  1N8Q A;  4WHA A;  2OTL 3;  4BTY A;  2CH9 A;  4EC6 A;  2BO9 B;  5BVB A;  1SQW A;  4QWT A;  2KCD A;  2HMO B;  2W9P A;  4KZ1 A;  1SJW A;  1D6U A;  2K0M A;  4CDL A;  5KP3 A;  1TFO A;  5IG3 A;  2OQE C;  3QRD A;  1OPY A;  1OCV A;  5CF1 A;  3MKI A;  1F8N A;  1GD3 A;  2BT3 A;  3OX9 A;  3PYJ A;  4XDW A;  5AII A;  4JF8 A;  4RZM A;  3CCS 3;  4N6L A;  1ROV A;  1RRH A;  3H51 A;  3ER7 A;  1FGO A;  1CQS A;  1ULJ B;  1VZZ A;  2M7O A;  3N9H A;  2D42 A;  3CCQ 3;  4HM5 B;  3O8Y A;  3VSY A;  2RGQ A;  2FXT A;  3CPW 2;  3T8N A;  1LOX A;  2CKF B;  5DRV A;  2W0Q A;  2OQE A;  4HM2 B;  2Z7A A;  3F9S A;  1UI7 A;  1LNH A;  1JNQ A;  2R4I A;  5LC6 A;  5AIG A;  4N6M A;  4KVH A;  1JB2 A;  1N5H A;  1W02 A;  3V99 A;  2FNQ A;  3NV0 A;  2CFK A;  4HZB B;  3KSP A;  3X3Z A;  1W00 A;  2UX0 A;  1M1X B;  3CNM A;  2W56 A;  3FH1 A;  4WFO A;  4X2O A;  3X41 A;  5FGO A;  2CG0 A;  4R1K A;  2ML6 A;  1ASK A;  4NHF A;  3WA2 X;  3K0Z A;  2QGU A;  3FG1 A;  4N3V A;  2E2T A;  3I0Y A;  2WO0 A;  4J8T A;  1RN7 A;  3EB8 A;  5BXQ A;  2SBL A;  4FMA A;  2QEX 3;  5EQL A;  2KXG A;  3X3X A;  2D1W A;  3LT8 A;  1DVC A;  3IPT A;  4CCV A;  3CD6 3;  1O7W B;  4HM6 B;  1IT7 A;  2GEY A;  2XGN A;  4EV2 A;  1M1K 4;  1VQL 3;  4BTX A;  3BND A;  2Z77 A;  2WOH A;  3BB9 A;  3QK9 A;  4HM1 B;  3FF2 A;  3HIG A;  3S5C A;  1OUN A;  3CXC 2;  1E3R A;  3CC2 3;  2IMJ A;  1NDO B;  4O2H A;  3G16 A;  3DMC A;  4XDV A;  1YJN 3;  1LXE A;  1AVK A;  3MHE A;  1VQP 3;  1JN5 A;  1KQS 2;  1FGT A;  3EBY A;  3UB1 A;  1GY5 A;  5AYS C;  1N5P A;  1VQ8 3;  2WOF A;  1O7P B;  3FCS B;  1VQ7 3;  2XF3 A;  4N6U A;  2CWV A;  2KRT A;  1U8C B;  1JV2 B;  1HU9 A;  3JUQ A;  4MMX B;  3EBT A;  1JKG A;  4N6V 0;  3S27 A;  1OF5 B;  3LH4 A;  4K1U A;  2FGT A;  3NX0 A;  1IT8 A;  3TDG A;  1FA3 A;  1ZX2 A;  3SXX A;  4AKZ A;  1NWW A;  1L5G B;  2YFJ B;  2O9U X;  1YGE A;  5IG4 A;  1UW1 A;  3LML A;  2MF7 A;  3U1W A;  1OH0 A;  3F8H A;  3UL5 A;  3CME 3;  1ZO2 A;  1VQK 3;  3UJM A;  2ZL8 A;  4WYK A;  5EVH A;  5AIH A;  1DYU A;  2GBX B;  4RNY A;  4K61 A;  3MSO A;  5ELJ A;  2XFT A;  3MWZ A;  4L7K A;  2HMK B;  2W03 A;  1O7H B;  3CCU 3;  3CMA 3;  4FR9 A;  2E2U A;  1IVX A;  1W5Z A;  3AMO A;  3NXJ A;  3CCE 3;  2MC8 A;  3SED A;  4BTW A;  3T0U A;  2E2V A;  2WGQ A;  3LT9 A;  3MPH A;  4JRF A;  7STD A;  1JB5 A;  3EC9 A;  5D83 A;  5HGR A;  3IMA B;  3Q1C A;  1FUW A;  1J2B A;  5ELU A;  3MYT A;  3F8X A;  3S67 A;  1TFK A;  2F98 A;  1A2K A;  3EQQ B;  2K54 A;  1Q86 4;  3NM7 A;  3LZA A;  1QJG A;  2BNG A;  2CFD A;  3LOY A;  1Q40 B;  2BMR B;  3PGB A;  2PNC A;  1KSI A;  4ZM8 A;  4HVN A;  4MMY B;  5CLK A;  4KFD A;  1K9M 4;  2W04 A;  2OTJ 3;  1QAF A;  3CC7 3;  2XFS A;  4FCM A;  4TX4 A;  2YFL B;  1U5O A;  4J9A A;  1VQ9 3;  3BLZ A;  3WOD G;  1OGZ A;  1S72 3;  3NHX A;  3NUV A;  3DY5 A;  3UNL A;  3MG3 A;  3L0R A;  3V92 A;  3I55 3;  3OW2 2;  1R4C A;  1W4N A;  1VQ5 3;  2P38 A;  3DM8 A;  3GZX B;  5G2G A;  2XGL A;  2C10 A;  3KE7 A;  2INX A;  3SOY A;  5IER A;  5D81 A;  2LQV A;  3JUO A;  1PFP A;  3OWS A;  1Q42 A;  2Z76 A;  2F86 B;  3HII A;  4N6O B;  1IQX A;  1IQ8 A;  1Y4K A;  4XB5 A;  1D6Z A;  4HZ9 B;  3JVC A;  4R9L A;  4AKY A;  3VGN A;  1AV4 A;  3LXU X;  1A90 A;  3LTA A;  1TP6 A;  3FG3 A;  3DGN A;  5KP1 A;  3NBJ A;  3JUP A;  4LSO A;  4R80 A;  1W6C A;  3G0K A;  3WOF B;  3FG4 A;  3PZW A;  5DRE A;  1IVV A;  3GZR A;  1UUV B;  3CCV 3;  1YJW 3;  3DGO A;  3FGY A;  4L8O A;  2OOV C;  4IIA A;  3CCM 3;  3EHC A;  1Z1S A;  1YJ9 3;  2RSX A;  1VQN 3;  1EA2 A;  5AYR B;  1A67 A;  4FCZ A;  3IJE B;  2GU1 A;  1BUQ A;  3PXM A;  3Q90 A;  1YIJ 3;  2B1X B;  3J7Y d;  2Q07 A;  1KC8 4;  1DMQ A;  1N8R 4;  2RFR A;  3SOA A;  2HMM B;  1WQL B;  3CPO A;  5AEU B;  3F7X A;  2OOV A;  5IF6 A;  3EN8 A;  3WMD A;  5A0O B;  4L8P A;  1NU3 A;  1O7M B;  3FZW A;  2CFW A;  1IDP A;  2P0X A;  4O02 B;  3GAX A;  1NB3 I;  1O7N B;  3DUK A;  4LZI A;  4OUQ A;  1W2B 2;  2OCT A;  4LGQ A;  1MNL A;  1Q40 A;  1YVB I;  3CC4 3;  4X2H A;  1IQY A;  8CHO A;  1IV7 A;  2C11 A;  1GY6 A;  1GY7 A;  2XEP A;  3KFQ C;  1K8A 4;  4XBY A;  3PCR A;  1STD A;  3FSD A;  1JRQ A;  3NV0 B;  1K28 A;  1RRL A;  1E3V A;  1E97 A;  1O7G B;  3RGA A;  2YFI B;  1JJ2 2;  2GEX A;  3H3H A;  3GZY B;  3HI7 A;  1TIJ A;  1OHO A;  3SX1 A;  2W56 B;  4K1V A;  3N54 B;  3B7C A;  3UL6 A;  1IVU A;  1GD4 A;  4EBG A;  3B4P A;  3CU3 A;  3U97 A;  2V1L A;  1MOL A;  3DZL A;  4LMI A;  3CCL 3;  4OK0 A;  3KII A;  1ULI B;  3B8L A;  3T8U A;  3NQZ A;  4HBR A;  2HMJ B;  3EJV A;  4GB5 A;  4OVM A;  3M8C A;  3OXA A;  1OGX A;  4FMB A;  3KKG A;  2F99 A;  1QVG 2;  3JUM A;  3F14 A;  4H3U A;  1N9J A;  3LTD A;  2Y73 A;  1VQM 3;  3BNE A;  1NJI 4;  2O3O A;  2CW9 A;  1PU4 A;  2XSH B;  3DXO A;  2STD A;  4HM0 B;  4K90 B;  3G6E 3;  1W2Z A;  3K5T A;  2HMN B;  3HX8 A;  2Z6B A;  3HZP A;  5IEP A;  4XM4 A;  4I4K A;  2WGO A;  3D9R A;  1WMN A;  1DVD A;  3FKA A;  3WOE B;  3RGR A;  5CK6 A;  3CCJ 3;  4IT7 A;  2W9Q A;  3K7C A;  4FCJ A;  4WP5 A;  2CWT A;  3FF0 A;  1W6Y A;  1GYB A;  1S5A A;  3PS8 A;  5AIF A;  3ALA A;  1JN5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...