5BXQA

Structure of the ntf2:rangdp complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
124
structure length
124
Chain Sequence
KPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear transport factor 2
publication title Structural basis for molecular recognition between nuclear transport factor 2 (NTF2) and the GDP-bound form of the Ras-family GTPase Ran.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 38
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5bxqA00
3LZAA 1GY7A 1GY5A 1OPYA 3CU3A 3DXOA 3G8ZA 1DMNA 3FF2A 2BNGA 2B1XB 4XBTA 4HJLB 4K1UA 2Z7AA 3EQQB 3VSYA 3HK4A 4HVNA 3EN1B 2YFJB 4HZ9B 1JB5A 1OF5A 5AIHA 1O7MB 3EHCA 3FH1A 3F8HA 4HM7B 4GB5A 4L7KA 5BXQA 1O7NB 1K41A 2HMJB 2XSHB 4RZMA 2HMMB 5IENA 1O7PB 3FKAA 3OX9A 5D81A 4R9KA 2I9WA 2QGUA 4XBXA 2UX0A 2YFLB 4PEJA 1DMQA 4HM5B 3DM8A 1W01A 1E3RA 1UUWB 1ASKA 1O7GB 3F7SA 3UNLA 3K0ZA 5IEOA 3LYGA 5CLKA 4R1KA 3VGNA 4LGQA 5IG3A 4HM6B 2XRXB 2STDA 5CXOA 4MJDA 1NWWA 3WMDA 4FCMA 3RGRA 3HX8A 3H51A 4HM8B 1GS3A 3JUQA 5CK6A 5D82A 1ISKA 3MG3A 3M8CA 4XDWA 1NU3A 3OWUA 1Q42A 3ECFA 2IMJA 4Q53A 5CF2A 1Q40B 3KZTA 5AIIA 3K7CA 3E99A 8CHOA 1OHOA 3B7CA 2A15A 4U13A 2R4IA 4ORLA 3JUOA 1AR0A 3OWSA 5KP3A 2K54A 4OUQA 1TUHA 3NV0B 2BMOB 4IIAA 5AIFA 2W2CA 3GZYB 3HZPA 4XDVA 3SEDA 2RGQA 4WYKB 2OWPA 5IERA 2BMRB 3OWYA 3F9SA 4L8OA 2GBXB 2INXA 4LEHA 1W00A 3I0YA 1JKGB 3SOAA 1OHSA 1Q40A 2RCDA 1E3VA 3MHEA 1EG9B 3D9RA 1OCVA 4N3VA 3NUVA 4HM0B 5JPPA 3NHXA 1E97A 5AI1A 3MSOA 4FCJA 1SJWA 3F40A 3DZLA 5BVBA 1UUVB 3NM2A 2CKFB 2GEXA 3NBRA 3MG2A 4WYKA 5JPUA 3CNXA 4XM4A 3T8UA 2JQ5A 3CPOA 1JKGA 3EN8A 3CNMA 2HMOB 1S5AA 2XR8B 3F14A 3MKIA 4XB5A 1OGXA 3FSDA 5EVHA 4HM2B 1O7WB 5STDA 5AEUB 3OXAA 1ZO2A 3GZBA 4HKVB 1CQSA 3KKGA 1DMMA 1JN5B 4XBYA 1HKXA 3S5CA 1ULIB 4HM1B 1A2KA 3G16A 1GY6A 1TP6A 1JB4A 2F98A 4STDA 1ULJB 3EC9A 2YFIB 3F8XA 2BMQB 3KSPA 1W6YA 3FGYA 5AEWB 5KP4A 2Z77A 3KE7A 3IPTA 5IG5A 3DMCA 2GXFA 2QIYA 6STDA 5KP1A 1JN5A 5DRVA 3A76A 2Z76A 1QMAA 3FLJA 5DREA 2HMNB 3JUNA 3RGAA 3MYTA 5G2GA 5IEPA 1STDA 1OHPA 4KVHA 3GWRA 1JB2A 2HMKB 1U5OA 5CF1A 3FF0A 1GYBA 3EX9A 3B4PA 3SOYA 3B8LA 3GZRA 4X2OA 1VZZA 5HGRA 4LMIA 5IF6A 1WQLB 3FZWA 5TGNA 3GZXB 3EBYA 3OV4A 5IG0A 3NV0A 1O7HB 3UJMA 3Q90A 1QJGA 1W02A 5IG4A 5D83A 2XSOB 4H3UA 1OH0A 1C7HA 4HM3B 4I4KA 3ER7A 3BLZA 1NDOB 3MG1A 4K1VA 2RFRA 1Z1SA 1OGZA 3STDA 3NXJA 4WP5A 2F99A 1IDPA 3BB9A 3DUKA 4J9AA 1BUQA 2CHCA 1ZX2A 3G0KA 3H3HA 4HM4B 3B4OA 4X2HA 3F7XA 2HMLB 5FW5A 4HZBB 3EJVA 3GRDA 4OVMA 2PZVA 4CDLA 2F86B 4L8PA 3JUMA 1OUNA 1EA2A 3EF8A 2GBWB 3JUPA 2GEYA 2B24B 5AIGA 3T8NA 4R9LA 7STDA 1OF5B 3EBTA 3ROBA 4WWUC 4J8TA
chains in the Genus database with same CATH superfamily
3CCM3 1RN7A 2W6JH 2BO9B 1K28A 1GY7A 3LZAA 1GY5A 1TIJA 3ZFZA 2CFLA 1YVSA 1MGRA 3T0UA 1VQL3 1RSNA 2FXTA 2CIUA 4MMXB 2F56A 1BNFA 2P0MA 1TFOA 1I0VA 2CWUA 4N6TA 1OPYA 2QEX3 1VQ93 1SIHA 1B2UA 3CU3A 2H0IA 3DXOA 1YNVX 3G8ZA 5BU4A 4N6UA 1DMNA 3FF2A 3FG1A 2BNGA 2B1XB 4XBTA 4HJLB 3WR2A 3AHSA 3LOYA 4K1UA 1JV2B 3LMLA 1L5GB 2Z7AA 2P05A 3U1WA 3EQQB 1RRHA 2YX9A 3X3ZA 4N6MA 3HK4A 3VSYA 1BOXA 5EQLA 1AVLA 4HVNA 1YVBI 2Z6BA 3NX0A 1BSBA 3EN1B 3MWZA 2YFJB 4HOHA 4HZ9B 4LYLB 4CCVA 1JB5A 3CCV3 1LQMB 1BUJA 1OF5A 1VQN3 4FR9A 4RNYA 1X1WA 2E2UA 3OW22 5AIHA 1O7MB 4GL6A 3EHCA 3FH1A 4BTWA 1K9M4 2XGLA 3X40A 3F8HA 4HM7B 4G1MB 4GB5A 4IPBA 4L7KA 5BXQA 1O7NB 3A5EA 1VQK3 1K41A 2HMJB 2W0QA 2WOFA 1BRGA 2XSHB 4RZMA 3O8YA 4BTYA 1FA3A 1BAOA 2HMMB 5IENA 1X1UA 2QA43 5LC7A 1M1XB 1O7PB 1T3BA 2E2VA 3AHWA 3ZG5A 2J8XB 1U8CB 1J2BA 3Q1CA 3FKAA 1V74A 3OX9A 5D81A 1DVCA 4R9KA 4R4KA 2I9WA 2QGUA 3CMA3 4XBXA 4J5GA 2UX0A 2ZL8A 6GSPA 1RKYA 2YFLB 4PEJA 1AQZA 1FGOA 4ILFA 1DMQA 4HM5B 1UGIA 3DM8A 5ELJA 4CPKA 1W01A 1TRQA 2CFWA 1E3RA 1UUWB 3D5GA 1VQM3 1IV9A 3CD63 1B2XA 2CFDA 1AVKA 1ASKA 4WHAA 1O7GB 1TU5A 1EUIC 1NO3A 3F7SA 1OACA 3HIGA 3UNLA 1N8R4 1MWUA 3K0ZA 4KZ1A 3GSPA 5IEOA 1X1YA 2CFGA 3SX1A 1YGWA 2C4BA 1LNIA 1NB3I 2ZHXB 3LYGA 5CLKA 2V1LA 3JVCA 1BNRA 2UUGC 1BRSA 4R1KA 3VGNA 4LGQA 5IG3A 1RGKA 4HM6B 1K734 1QAFA 2XRXB 2STDA 2UGIA 5CXOA 4MJDA 1UI7A 4BTXA 1NWWA 2KF6A 3WMDA 5G1LA 4FCMA 4N6V0 1N5HA 3RGRA 4BIRA 1YHQ3 1IV7A 4N6OB 1GSPA 1EQKA 2O3OA 3CPW2 3HX8A 1PU4A 2XEPA 4FMDA 1FW7A 1UCJA 1MWRA 3H51A 1GMQA 1GS3A 3JUQA 3Q3FA 1R4CA 2BU4A 4HM8B 5CK6A 5D82A 1WMPA 4KFEA 1ISKA 2OTJ3 1RGEA 2XH9A 3MG3A 3UL6A 1DVDA 2GSPA 1I70A 3LT8A 3M8CA 1G96A 3BNCA 3V98A 1I3FA 4FMAA 4XDWA 3V92A 1NU3A 1KWIA 2CH9A 6RNTA 3OWUA 1QVF2 1Q42A 2KF5A 3ECFA 2XFTA 1STFI 1FGRA 1IVXA 1WNHA 2E2TA 2IMJA 3X41A 1M904 4Q53A 5CF2A 1SIIA 3SLUA 1A2VA 2RNTA 3S28A 1Q40B 3FCSB 3KZTA 5AIIA 3K7CA 3LXUX 3E99A 1GMRA 3UL5A 8CHOA 1OHOA 1WMNA 1BIRA 3B7CA 2A15A 4U13A 1FGQA 3DGNA 2R4IA 5HOHA 1BRHA 4ORLA 1JNQA 1ROAA 3JUOA 1AR0A 1BNGA 1BU4A 1MOLA 2WOHA 1BNJA 3HOHA 1PFPA 3L0RA 3OWSA 1PY3A 2K54A 1UI8A 5KP3A 1QAKA 2SBLA 1LOXA 5JBSA 3KN4A 1FUSA 3CC43 1W6CA 1RMSA 1RGHA 4OUQA 1TUHA 1YJ93 1GOUA 3NV0B 3G6E3 1RHLA 2BMOB 2D1WA 4IIAA 1WMOA 4NREA 4EXRA 5I97A 5AIFA 2W2CA 3GZYB 3HZPA 4XDVA 3SEDA 2RGQA 4WYKB 1RCKA 5AYRB 3X42A 2OWPA 3FG3A 2CFKA 2ZA4A 1F8NA 2CX1A 1RGAA 2BMRB 2P38A 5G1KA 3OWYA 5IERA 2P09A 2C10A 3F9SA 2KRTA 2IUJA 1NJI4 4L8OA 5AYSC 2GBXB 2CWVA 4QWTA 1M1K4 1KQS2 2RBIA 1V58A 1YGEA 1FGMA 2INXA 1W00A 3I0YA 4LEHA 1DYUA 1JKGB 4JF8A 3SOAA 1OHSA 3NBBA 2KAAA 2WGQA 1W5ZA 1VQ43 1N9EA 5IW9A 1Q40A 1QALA 1E3VA 2RCDA 3MHEA 3CC73 3DGYA 1EG9B 3D9RA 1BGSA 1OCVA 2KCDA 3HI7A 5FGOA 1W7CA 1UCLA 1JZDA 4N3VA 2FNQA 3NUVA 4HM0B 5JPPA 1GD4A 1LVNA 1G02A 1RTUA 1E97A 3NHXA 3CCE3 1LRAA 2SARA 5AI1A 2LQVA 3MSOA 3RNTA 2RSXA 1I3IA 3X3XA 3K5TA 2IY2A 1BSDA 3PXMA 1UUGB 4FCJA 1SJWA 2IYJA 3TDGA 1W2ZA 3F40A 3DGLA 1RJOA 2OQEA 4RNTA 1HYFA 2AADA 1BVIA 3DZLA 3SVAA 3ZG0A 4AKYA 5BVBA 2OOVC 1UUVB 1B3SA 3NM2A 1B27A 1BSCA 2H0GA 4JRFA 2ML6A 1IQXA 1NB5I 1Q7Y4 2CKFB 4WFOA 1IVWA 2GEXA 1LOYA 1K8A4 3GAXA 3NBRA 3MG2A 4O02B 4WYKA 5JPUA 3SYUA 1R4YA 3CNXA 4XM4A 3T8UA 1B2MA 4CJNA 3PCRA 1T2IA 1I2FA 1VQQA 1HU9A 1WTHA 3K9MC 1JBSA 2JQ5A 3CPOA 1TRPA 2ZDJA 9RNTA 1JKGA 2C11A 3EN8A 1RLSA 2H0HA 2R41A 3CNMA 2OOVA 4LZIA 2HMOB 1B21A 3AMOB 1LOWA 4BL3A 1BSEA 1S5AA 2WO0A 2XR8B 3QK9A 4EYCA 1SARA 1IU7A 2XF3A 1BSAA 2PNCA 4MEIA 3CCU3 3PCSA 3F14A 1Y4KA 2Y74A 5EEOA 1C54A 3MKIA 1BNIA 4N6NB 1OGXA 4XB5A 3FSDA 2CWTA 5EVHA 1MWTA 3G4S3 3KFQC 1O7WB 2IA7A 4HM2B 5STDA 5AEUB 2BT3A 3CME3 3BU4A 1D6UA 1UDII 1ZO2A 3EB8A 1I2EA 3DY5A 3GZBA 3OXAA 4HKVB 3S29A 1YJW3 1CQSA 3LTDA 1JRQA 2W9QA 1RNTA 1BANA 3VF1A 3KKGA 1N9JA 1DMMA 1JN5B 4XBYA 1Q814 1HKXA 3S5CA 1ULIB 3PS8A 4HM1B 1A2KA 8RNTA 2LYXA 3CCS3 7RNTA 3CCQ3 3G16A 1GY6A 1TP6A 1EKMA 4GSPA 4FCZA 4KFFA 1JB4A 5M1AA 5GSPA 3NQYA 1LOVA 4FMCA 2F98A 3V99A 4EV2A 4STDA 1W4NA 1RGFA 3IJEB 4J5KA 3N54B 1RGCA 1ULJB 1IQ8A 3EC9A 2YFIB 3BNDA 3WHOA 1AY7A 3F8XA 3CCL3 1N8QA 3LTCA 1TTOA 2BMQB 3KSPA 4MMYB 4RNZA 3MPHA 3WOFB 1DETA 1JJ22 1W6YA 3FGYA 1GD3A 3LT9A 5AEWB 1VQ53 1KSIA 3NM7A 3NBJA 1W2B2 5KP4A 3DGMA 4IT7A 1B2SA 1GOYA 2Z77A 2XFSA 3KE7A 7GSPA 5A0OB 1X1XA 3AMOA 3CCJ3 3IPTA 5IG5A 3DMCA 1VQ83 4K90B 1QVG2 1Q9EA 4K61A 5M19A 1VQ73 1T2HA 1V57A 1YIT3 3K63A 1JZOA 1GOVA 2O9UX 4EBGA 3BNEA 1B20A 1PYLA 2GXFA 4EC6A 1A2PA 1CEWI 4KT3B 2W03A 1LQGC 3DGOA 2K3DA 2QIYA 3Q2PA 4BL2A 6STDA 1G0TA 1BRIA 5KP1A 1JN5A 1EEJA 4HYZA 5DRVA 3I553 3A76A 2Z76A 2CG0A 1QMAA 3CXC2 3FLJA 5DREA 3WA3A 3PZWA 3IMAB 2HMNB 3JUNA 3RGAA 4OK0A 3S27A 3PYJA 3MYTA 5G2GA 3AGOA 5IEPA 1STDA 3FG4A 3LH4A 1OHPA 4KVHA 1CYUA 1SQWA 3GWRA 1JB2A 2HMKB 1U5OA 2OQEC 2Y73A 5CF1A 1GMPA 3FF0A 1GYBA 3EX9A 3B4PA 1NNVA 3SOYA 1T5YA 2CK3H 3B8LA 3GZRA 2WGOA 3N9HA 1IT8A 4X2OA 1RN1A 2K0MA 1VZZA 2GU3A 1BRJA 2F4YA 1BNSA 3N8BA 1ROVA 5HGRA 4LMIA 5IF6A 1KC84 1WQLB 3FZWA 1BRKA 3UB1A 4RBNA 5TGNA 1RDSA 4CDLA 1US1A 3LTAA 2BIRA 3ALAA 3EE1A 1UW1A 1I2GA 3EBYA 3GZXB 2IUKA 3OV4A 3AGNA 2CG1A 5IG0A 1ZGXA 3HIIA 3NV0A 4TX4A 1O7HB 1KD14 1FUTA 3UJMA 3Q90A 1AV4A 2F5MA 1QJGA 4KFDA 2BHMA 1W02A 5IG4A 3PGBA 5D83A 2XSOB 3I563 3QRDA 4H3UA 1N5PA 1A67A 2W56B 1RCLA 3LTBA 1OH0A 3NQZA 1C7HA 1CH0A 2KF4A 4HM3B 3X3YA 4R80A 2CW9A 1Q7HA 3J7Yd 2GU1A 4I4KA 3ER7A 1VQP3 1Q864 1YJN3 1W6GA 1IK3A 2F5WA 3WOEB 3RDEA 2FGTA 1A90A 1M9GA 1HZ1A 4ZM8A 4N6LA 2OTL3 3BLZA 1NDOB 5RNTA 3WDGB 4HBRA 3MG1A 4K1VA 1ZS7A 1LXEA 1Z1SA 2KF3A 2RFRA 1UCKA 3URPA 4EV5A 1OGZA 3D5IA 3STDA 3WA2X 4AKZA 3NXJA 4H61A 4WP5A 2MF7A 1UGHI 2F99A 1IDPA 3BIRA 4NHFA 4O3VA 3BB9A 2W04A 3KCHA 4GHOA 4O8SA 3DUKA 4J9AA 1BUQA 2CHCA 3G713 2ML5A 1IQYA 1ZX2A 1B2ZA 3S67A 3G0KA 1UCIA 3DH2A 1BNEA 2W9PA 1LNHA 4FMBA 2AAEA 4DKIA 1MWSA 3H3HA 4HM4B 4O2HA 3WODG 1D6ZA 4NPBA 1VQO3 3B4OA 4X2HA 1RGGA 2M7OA 3D4AA 1DE3A 2JDIH 3F7XA 5BIRA 2HMLB 1FGTA 1CYVA 3KIIA 5FW5A 1MGWA 4HZBB 1D6YA 3EJVA 2L1SA 3GRDA 2Q07A 1RRLA 2W56A 1I0XA 4OVMA 1YIJ3 1TFKA 1I8VA 1MNLA 1SPUA 2F86B 2PZVA 3JUMA 4L8PA 2CC3A 1OUNA 4MMZB 1RGLA 5ELUA 1Q824 3D3LA 2D42A 1EA2A 3BNBA 4EW5A 3EF8A 5M18A 1IYYA 4BU4A 2GBWB 3SXXA 1VQ63 1FUWA 1IT7A 1RNBA 2KXGA 1S723 3JUPA 1FZUA 1RN4A 2GEYA 2XGNA 4HAAA 2B24B 1TJDA 1YI23 5AIGA 1JBRA 3CC23 1IVUA 2HOHA 3T8NA 3KSED 1JBTA 3U97A 2L4VA 4R9LA 7STDA 1OF5B 2OCTA 3EBTA 3CCR3 3D79A 3ROBA 2CX0A 2P0XA 4WWUC 1IVVA 4AEQA 4J8TA 4I5QA 2MC8A 5LC6A 1FYSA 4LSOA 1BRNL
chains in the Genus database with same CATH topology
3CCM3 1RN7A 2W6JH 2BO9B 1K28A 1GY7A 3LZAA 1GY5A 1TIJA 2CFLA 3T0UA 1VQL3 2FXTA 2CIUA 4MMXB 2P0MA 1TFOA 2CWUA 4N6TA 1OPYA 2QEX3 1VQ93 1SIHA 3CU3A 3DXOA 3G8ZA 4N6UA 1DMNA 3FF2A 3FG1A 2BNGA 2B1XB 4XBTA 4HJLB 3LOYA 4K1UA 1JV2B 3LMLA 1L5GB 2Z7AA 2P05A 3U1WA 3EQQB 1RRHA 2YX9A 3X3ZA 4N6MA 3HK4A 3VSYA 5EQLA 1AVLA 4HVNA 1YVBI 2Z6BA 3NX0A 3EN1B 3MWZA 2YFJB 4HZ9B 4CCVA 1JB5A 3CCV3 1OF5A 1VQN3 4FR9A 4RNYA 2E2UA 3OW22 5AIHA 1O7MB 4GL6A 3EHCA 3FH1A 4BTWA 1K9M4 2XGLA 3X40A 3F8HA 4HM7B 4G1MB 4GB5A 4IPBA 4L7KA 5BXQA 1O7NB 1VQK3 1K41A 2HMJB 2W0QA 2WOFA 2XSHB 4RZMA 3O8YA 4BTYA 1FA3A 2HMMB 5IENA 2QA43 5LC7A 1M1XB 1O7PB 2E2VA 1J2BA 1U8CB 3Q1CA 3FKAA 1V74A 3OX9A 5D81A 1DVCA 4R9KA 4R4KA 2I9WA 2QGUA 3CMA3 4XBXA 2UX0A 2ZL8A 1RKYA 2YFLB 4PEJA 1FGOA 1DMQA 4HM5B 3DM8A 5ELJA 1W01A 2CFWA 1E3RA 1UUWB 1VQM3 3CD63 1IV9A 2CFDA 1AVKA 1ASKA 4WHAA 1O7GB 1NO3A 3F7SA 1OACA 3HIGA 3UNLA 1N8R4 3K0ZA 4KZ1A 5IEOA 2CFGA 3SX1A 1NB3I 3LYGA 5CLKA 2V1LA 3JVCA 4R1KA 3VGNA 4LGQA 5IG3A 4HM6B 1K734 1QAFA 2XRXB 2STDA 5CXOA 4MJDA 1UI7A 4BTXA 1NWWA 3WMDA 4FCMA 4N6V0 1N5HA 3RGRA 1YHQ3 1IV7A 4N6OB 1EQKA 2O3OA 3CPW2 3HX8A 1PU4A 2XEPA 4FMDA 3H51A 4HM8B 1GS3A 3JUQA 5CK6A 1R4CA 5D82A 1WMPA 4KFEA 1ISKA 2OTJ3 2XH9A 3MG3A 3UL6A 1DVDA 3LT8A 3M8CA 1G96A 3BNCA 3V98A 4FMAA 4XDWA 3V92A 1NU3A 1KWIA 2CH9A 1QVF2 3OWUA 1Q42A 3ECFA 2XFTA 1STFI 1FGRA 1IVXA 1WNHA 2E2TA 2IMJA 3X41A 1M904 4Q53A 5CF2A 1SIIA 3SLUA 1A2VA 3S28A 1Q40B 3FCSB 3KZTA 5AIIA 3K7CA 3LXUX 3E99A 3UL5A 8CHOA 1OHOA 1WMNA 3B7CA 2A15A 4U13A 1FGQA 3DGNA 2R4IA 4ORLA 1JNQA 1ROAA 3JUOA 1AR0A 1MOLA 2WOHA 3OWSA 5KP3A 1PFPA 3L0RA 2K54A 1UI8A 5JBSA 1QAKA 2SBLA 1LOXA 3CC43 3KN4A 1W6CA 4OUQA 1TUHA 1YJ93 3NV0B 3G6E3 2BMOB 2D1WA 4IIAA 1WMOA 4NREA 4EXRA 5I97A 5AIFA 2W2CA 3GZYB 3HZPA 4XDVA 3SEDA 2RGQA 4WYKB 5AYRB 3X42A 2OWPA 3FG3A 2CFKA 1F8NA 5IERA 2BMRB 2P38A 3OWYA 2P09A 2C10A 3F9SA 2KRTA 2IUJA 1NJI4 4L8OA 5AYSC 2GBXB 2CWVA 4QWTA 1M1K4 1KQS2 1YGEA 1FGMA 2INXA 1W00A 3I0YA 4LEHA 1DYUA 1JKGB 4JF8A 3SOAA 1OHSA 3NBBA 2WGQA 1W5ZA 1VQ43 1N9EA 5IW9A 2RCDA 1Q40A 1QALA 1E3VA 3MHEA 3CC73 1EG9B 3D9RA 1OCVA 2KCDA 3HI7A 5FGOA 1W7CA 4N3VA 2FNQA 3NUVA 4HM0B 5JPPA 1GD4A 1LVNA 3NHXA 1E97A 3CCE3 5AI1A 3X3XA 2LQVA 3MSOA 2RSXA 3K5TA 3PXMA 4FCJA 1SJWA 3TDGA 1W2ZA 3F40A 3DGLA 1RJOA 2OQEA 3SVAA 3DZLA 4AKYA 5BVBA 2OOVC 1UUVB 3NM2A 4JRFA 2ML6A 1IQXA 1NB5I 1Q7Y4 2CKFB 4WFOA 1IVWA 2GEXA 1K8A4 3GAXA 3NBRA 3MG2A 4O02B 4WYKA 5JPUA 3CNXA 4XM4A 3T8UA 3PCRA 3K9MC 1HU9A 1WTHA 2JQ5A 3CPOA 2ZDJA 1JKGA 2C11A 3EN8A 3CNMA 2OOVA 4LZIA 2HMOB 3AMOB 1S5AA 2WO0A 2XR8B 3QK9A 4EYCA 2XF3A 1IU7A 2PNCA 4MEIA 3CCU3 3PCSA 3F14A 1Y4KA 2Y74A 5EEOA 3MKIA 4N6NB 4XB5A 1OGXA 3FSDA 2CWTA 5EVHA 3G4S3 3KFQC 1O7WB 2IA7A 4HM2B 5STDA 5AEUB 2BT3A 3CME3 3EB8A 1D6UA 1ZO2A 3DY5A 3GZBA 3OXAA 4HKVB 3S29A 1TU5A 1YJW3 1CQSA 3LTDA 1JRQA 2W9QA 3VF1A 3KKGA 1N9JA 1DMMA 1JN5B 4XBYA 1Q814 1HKXA 3S5CA 1ULIB 3PS8A 4HM1B 1A2KA 2LYXA 3CCS3 3CCQ3 3G16A 1GY6A 1TP6A 1EKMA 4FCZA 4KFFA 1JB4A 3NQYA 4FMCA 2F98A 3V99A 4EV2A 4STDA 1W4NA 3IJEB 3N54B 1ULJB 1IQ8A 3EC9A 2YFIB 3BNDA 3F8XA 3CCL3 1N8QA 3LTCA 2BMQB 3KSPA 4MMYB 4RNZA 3WOFB 3MPHA 1JJ22 1W6YA 3FGYA 1GD3A 1VQ53 5AEWB 1KSIA 3NM7A 3NBJA 1W2B2 5KP4A 3DGMA 4IT7A 2Z77A 2XFSA 3KE7A 3CCJ3 5A0OB 3AMOA 3IPTA 5IG5A 3DMCA 1VQ83 4K90B 1QVG2 4K61A 1VQ73 1YIT3 3K63A 2O9UX 4EBGA 3BNEA 4EC6A 2GXFA 1CEWI 2W03A 3DGOA 2QIYA 3Q2PA 6STDA 5KP1A 1JN5A 4HYZA 5DRVA 3I553 3A76A 2Z76A 2CG0A 1QMAA 3CXC2 3FLJA 5DREA 3WA3A 3PZWA 3IMAB 2HMNB 3JUNA 3RGAA 4OK0A 3S27A 3PYJA 3MYTA 5G2GA 5IEPA 1STDA 3FG4A 3LH4A 1OHPA 4KVHA 1CYUA 1SQWA 3GWRA 1JB2A 2HMKB 1U5OA 2OQEC 2Y73A 5CF1A 3FF0A 1GYBA 3EX9A 3B4PA 3SOYA 1T5YA 2CK3H 3B8LA 3GZRA 2WGOA 3N9HA 1IT8A 4X2OA 2K0MA 1VZZA 2GU3A 3N8BA 1ROVA 5HGRA 4LMIA 5IF6A 1KC84 1WQLB 3FZWA 3UB1A 4RBNA 5TGNA 4CDLA 1US1A 3LTAA 3ALAA 3EE1A 3GZXB 1UW1A 3EBYA 2IUKA 3OV4A 2CG1A 5IG0A 3HIIA 3NV0A 4TX4A 1O7HB 1KD14 3UJMA 3Q90A 1AV4A 4KFDA 1QJGA 2BHMA 1W02A 5IG4A 3PGBA 5D83A 2XSOB 3I563 3QRDA 4H3UA 1N5PA 1A67A 2W56B 3LTBA 3NQZA 1OH0A 1C7HA 3X3YA 4HM3B 4R80A 2CW9A 3J7Yd 2GU1A 4I4KA 3ER7A 1VQP3 1Q864 1YJN3 1W6GA 1IK3A 3WOEB 3RDEA 2FGTA 1A90A 1M9GA 4ZM8A 4N6LA 2OTL3 3BLZA 1NDOB 3WDGB 4HBRA 3MG1A 4K1VA 2RFRA 1LXEA 1Z1SA 4EV5A 1OGZA 3STDA 3WA2X 4AKZA 3NXJA 4H61A 4WP5A 2MF7A 4NHFA 2F99A 1IDPA 4O3VA 3BB9A 2W04A 4O8SA 3DUKA 4J9AA 1BUQA 2CHCA 3G713 2ML5A 1IQYA 1ZX2A 3S67A 3G0KA 2W9PA 1LNHA 4FMBA 3H3HA 4HM4B 4O2HA 3WODG 1D6ZA 1VQO3 3B4OA 4X2HA 2M7OA 2JDIH 3F7XA 2HMLB 1FGTA 1CYVA 3KIIA 5FW5A 4HZBB 1D6YA 3EJVA 3GRDA 2Q07A 1RRLA 2W56A 4OVMA 1YIJ3 1TFKA 1MNLA 1SPUA 2F86B 2PZVA 3JUMA 4L8PA 2CC3A 1OUNA 4MMZB 5ELUA 1Q824 3D3LA 2D42A 1EA2A 3BNBA 3EF8A 2GBWB 3SXXA 1VQ63 1FUWA 1IT7A 2KXGA 1S723 3JUPA 2XGNA 2GEYA 2B24B 1YI23 5AIGA 3CC23 1IVUA 3T8NA 3KSED 3U97A 2L4VA 4R9LA 7STDA 1OF5B 2OCTA 3EBTA 3CCR3 3ROBA 2P0XA 4WWUC 1IVVA 4AEQA 4J8TA 2MC8A 5LC6A 3LT9A 4LSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZA A;  1GY7 A;  1GY5 A;  1OPY A;  3CU3 A;  3DXO A;  3G8Z A;  1DMN A;  3FF2 A;  2BNG A;  2B1X B;  4XBT A;  4HJL B;  4K1U A;  2Z7A A;  3EQQ B;  3VSY A;  3HK4 A;  4HVN A;  3EN1 B;  2YFJ B;  4HZ9 B;  1JB5 A;  1OF5 A;  5AIH A;  1O7M B;  3EHC A;  3FH1 A;  3F8H A;  4HM7 B;  4GB5 A;  4L7K A;  5BXQ A;  1O7N B;  1K41 A;  2HMJ B;  2XSH B;  4RZM A;  2HMM B;  5IEN A;  1O7P B;  3FKA A;  3OX9 A;  5D81 A;  4R9K A;  2I9W A;  2QGU A;  4XBX A;  2UX0 A;  2YFL B;  4PEJ A;  1DMQ A;  4HM5 B;  3DM8 A;  1W01 A;  1E3R A;  1UUW B;  1ASK A;  1O7G B;  3F7S A;  3UNL A;  3K0Z A;  5IEO A;  3LYG A;  5CLK A;  4R1K A;  3VGN A;  4LGQ A;  5IG3 A;  4HM6 B;  2XRX B;  2STD A;  5CXO A;  4MJD A;  1NWW A;  3WMD A;  4FCM A;  3RGR A;  3HX8 A;  3H51 A;  4HM8 B;  1GS3 A;  3JUQ A;  5CK6 A;  5D82 A;  1ISK A;  3MG3 A;  3M8C A;  4XDW A;  1NU3 A;  3OWU A;  1Q42 A;  3ECF A;  2IMJ A;  4Q53 A;  5CF2 A;  1Q40 B;  3KZT A;  5AII A;  3K7C A;  3E99 A;  8CHO A;  1OHO A;  3B7C A;  2A15 A;  4U13 A;  2R4I A;  4ORL A;  3JUO A;  1AR0 A;  3OWS A;  5KP3 A;  2K54 A;  4OUQ A;  1TUH A;  3NV0 B;  2BMO B;  4IIA A;  5AIF A;  2W2C A;  3GZY B;  3HZP A;  4XDV A;  3SED A;  2RGQ A;  4WYK B;  2OWP A;  5IER A;  2BMR B;  3OWY A;  3F9S A;  4L8O A;  2GBX B;  2INX A;  4LEH A;  1W00 A;  3I0Y A;  1JKG B;  3SOA A;  1OHS A;  1Q40 A;  2RCD A;  1E3V A;  3MHE A;  1EG9 B;  3D9R A;  1OCV A;  4N3V A;  3NUV A;  4HM0 B;  5JPP A;  3NHX A;  1E97 A;  5AI1 A;  3MSO A;  4FCJ A;  1SJW A;  3F40 A;  3DZL A;  5BVB A;  1UUV B;  3NM2 A;  2CKF B;  2GEX A;  3NBR A;  3MG2 A;  4WYK A;  5JPU A;  3CNX A;  4XM4 A;  3T8U A;  2JQ5 A;  3CPO A;  1JKG A;  3EN8 A;  3CNM A;  2HMO B;  1S5A A;  2XR8 B;  3F14 A;  3MKI A;  4XB5 A;  1OGX A;  3FSD A;  5EVH A;  4HM2 B;  1O7W B;  5STD A;  5AEU B;  3OXA A;  1ZO2 A;  3GZB A;  4HKV B;  1CQS A;  3KKG A;  1DMM A;  1JN5 B;  4XBY A;  1HKX A;  3S5C A;  1ULI B;  4HM1 B;  1A2K A;  3G16 A;  1GY6 A;  1TP6 A;  1JB4 A;  2F98 A;  4STD A;  1ULJ B;  3EC9 A;  2YFI B;  3F8X A;  2BMQ B;  3KSP A;  1W6Y A;  3FGY A;  5AEW B;  5KP4 A;  2Z77 A;  3KE7 A;  3IPT A;  5IG5 A;  3DMC A;  2GXF A;  2QIY A;  6STD A;  5KP1 A;  1JN5 A;  5DRV A;  3A76 A;  2Z76 A;  1QMA A;  3FLJ A;  5DRE A;  2HMN B;  3JUN A;  3RGA A;  3MYT A;  5G2G A;  5IEP A;  1STD A;  1OHP A;  4KVH A;  3GWR A;  1JB2 A;  2HMK B;  1U5O A;  5CF1 A;  3FF0 A;  1GYB A;  3EX9 A;  3B4P A;  3SOY A;  3B8L A;  3GZR A;  4X2O A;  1VZZ A;  5HGR A;  4LMI A;  5IF6 A;  1WQL B;  3FZW A;  5TGN A;  3GZX B;  3EBY A;  3OV4 A;  5IG0 A;  3NV0 A;  1O7H B;  3UJM A;  3Q90 A;  1QJG A;  1W02 A;  5IG4 A;  5D83 A;  2XSO B;  4H3U A;  1OH0 A;  1C7H A;  4HM3 B;  4I4K A;  3ER7 A;  3BLZ A;  1NDO B;  3MG1 A;  4K1V A;  2RFR A;  1Z1S A;  1OGZ A;  3STD A;  3NXJ A;  4WP5 A;  2F99 A;  1IDP A;  3BB9 A;  3DUK A;  4J9A A;  1BUQ A;  2CHC A;  1ZX2 A;  3G0K A;  3H3H A;  4HM4 B;  3B4O A;  4X2H A;  3F7X A;  2HML B;  5FW5 A;  4HZB B;  3EJV A;  3GRD A;  4OVM A;  2PZV A;  4CDL A;  2F86 B;  4L8P A;  3JUM A;  1OUN A;  1EA2 A;  3EF8 A;  2GBW B;  3JUP A;  2GEY A;  2B24 B;  5AIG A;  3T8N A;  4R9L A;  7STD A;  1OF5 B;  3EBT A;  3ROB A;  4WWU C;  4J8T A; 
#chains in the Genus database with same CATH topology
 3CCM 3;  1RN7 A;  2W6J H;  2BO9 B;  1K28 A;  1GY7 A;  3LZA A;  1GY5 A;  1TIJ A;  3ZFZ A;  2CFL A;  1YVS A;  1MGR A;  3T0U A;  1VQL 3;  1RSN A;  2FXT A;  2CIU A;  4MMX B;  2F56 A;  1BNF A;  2P0M A;  1TFO A;  1I0V A;  2CWU A;  4N6T A;  1OPY A;  2QEX 3;  1VQ9 3;  1SIH A;  1B2U A;  3CU3 A;  2H0I A;  3DXO A;  1YNV X;  3G8Z A;  5BU4 A;  4N6U A;  1DMN A;  3FF2 A;  3FG1 A;  2BNG A;  2B1X B;  4XBT A;  4HJL B;  3WR2 A;  3AHS A;  3LOY A;  4K1U A;  1JV2 B;  3LML A;  1L5G B;  2Z7A A;  2P05 A;  3U1W A;  3EQQ B;  1RRH A;  2YX9 A;  3X3Z A;  4N6M A;  3HK4 A;  3VSY A;  1BOX A;  5EQL A;  1AVL A;  4HVN A;  1YVB I;  2Z6B A;  3NX0 A;  1BSB A;  3EN1 B;  3MWZ A;  2YFJ B;  4HOH A;  4HZ9 B;  4LYL B;  4CCV A;  1JB5 A;  3CCV 3;  1LQM B;  1BUJ A;  1OF5 A;  1VQN 3;  4FR9 A;  4RNY A;  1X1W A;  2E2U A;  3OW2 2;  5AIH A;  1O7M B;  4GL6 A;  3EHC A;  3FH1 A;  4BTW A;  1K9M 4;  2XGL A;  3X40 A;  3F8H A;  4HM7 B;  4G1M B;  4GB5 A;  4IPB A;  4L7K A;  5BXQ A;  1O7N B;  3A5E A;  1VQK 3;  1K41 A;  2HMJ B;  2W0Q A;  2WOF A;  1BRG A;  2XSH B;  4RZM A;  3O8Y A;  4BTY A;  1FA3 A;  1BAO A;  2HMM B;  5IEN A;  1X1U A;  2QA4 3;  5LC7 A;  1M1X B;  1O7P B;  1T3B A;  2E2V A;  3AHW A;  3ZG5 A;  2J8X B;  1U8C B;  1J2B A;  3Q1C A;  3FKA A;  1V74 A;  3OX9 A;  5D81 A;  1DVC A;  4R9K A;  4R4K A;  2I9W A;  2QGU A;  3CMA 3;  4XBX A;  4J5G A;  2UX0 A;  2ZL8 A;  6GSP A;  1RKY A;  2YFL B;  4PEJ A;  1AQZ A;  1FGO A;  4ILF A;  1DMQ A;  4HM5 B;  1UGI A;  3DM8 A;  5ELJ A;  4CPK A;  1W01 A;  1TRQ A;  2CFW A;  1E3R A;  1UUW B;  3D5G A;  1VQM 3;  1IV9 A;  3CD6 3;  1B2X A;  2CFD A;  1AVK A;  1ASK A;  4WHA A;  1O7G B;  1TU5 A;  1EUI C;  1NO3 A;  3F7S A;  1OAC A;  3HIG A;  3UNL A;  1N8R 4;  1MWU A;  3K0Z A;  4KZ1 A;  3GSP A;  5IEO A;  1X1Y A;  2CFG A;  3SX1 A;  1YGW A;  2C4B A;  1LNI A;  1NB3 I;  2ZHX B;  3LYG A;  5CLK A;  2V1L A;  3JVC A;  1BNR A;  2UUG C;  1BRS A;  4R1K A;  3VGN A;  4LGQ A;  5IG3 A;  1RGK A;  4HM6 B;  1K73 4;  1QAF A;  2XRX B;  2STD A;  2UGI A;  5CXO A;  4MJD A;  1UI7 A;  4BTX A;  1NWW A;  2KF6 A;  3WMD A;  5G1L A;  4FCM A;  4N6V 0;  1N5H A;  3RGR A;  4BIR A;  1YHQ 3;  1IV7 A;  4N6O B;  1GSP A;  1EQK A;  2O3O A;  3CPW 2;  3HX8 A;  1PU4 A;  2XEP A;  4FMD A;  1FW7 A;  1UCJ A;  1MWR A;  3H51 A;  1GMQ A;  1GS3 A;  3JUQ A;  3Q3F A;  1R4C A;  2BU4 A;  4HM8 B;  5CK6 A;  5D82 A;  1WMP A;  4KFE A;  1ISK A;  2OTJ 3;  1RGE A;  2XH9 A;  3MG3 A;  3UL6 A;  1DVD A;  2GSP A;  1I70 A;  3LT8 A;  3M8C A;  1G96 A;  3BNC A;  3V98 A;  1I3F A;  4FMA A;  4XDW A;  3V92 A;  1NU3 A;  1KWI A;  2CH9 A;  6RNT A;  3OWU A;  1QVF 2;  1Q42 A;  2KF5 A;  3ECF A;  2XFT A;  1STF I;  1FGR A;  1IVX A;  1WNH A;  2E2T A;  2IMJ A;  3X41 A;  1M90 4;  4Q53 A;  5CF2 A;  1SII A;  3SLU A;  1A2V A;  2RNT A;  3S28 A;  1Q40 B;  3FCS B;  3KZT A;  5AII A;  3K7C A;  3LXU X;  3E99 A;  1GMR A;  3UL5 A;  8CHO A;  1OHO A;  1WMN A;  1BIR A;  3B7C A;  2A15 A;  4U13 A;  1FGQ A;  3DGN A;  2R4I A;  5HOH A;  1BRH A;  4ORL A;  1JNQ A;  1ROA A;  3JUO A;  1AR0 A;  1BNG A;  1BU4 A;  1MOL A;  2WOH A;  1BNJ A;  3HOH A;  1PFP A;  3L0R A;  3OWS A;  1PY3 A;  2K54 A;  1UI8 A;  5KP3 A;  1QAK A;  2SBL A;  1LOX A;  5JBS A;  3KN4 A;  1FUS A;  3CC4 3;  1W6C A;  1RMS A;  1RGH A;  4OUQ A;  1TUH A;  1YJ9 3;  1GOU A;  3NV0 B;  3G6E 3;  1RHL A;  2BMO B;  2D1W A;  4IIA A;  1WMO A;  4NRE A;  4EXR A;  5I97 A;  5AIF A;  2W2C A;  3GZY B;  3HZP A;  4XDV A;  3SED A;  2RGQ A;  4WYK B;  1RCK A;  5AYR B;  3X42 A;  2OWP A;  3FG3 A;  2CFK A;  2ZA4 A;  1F8N A;  2CX1 A;  1RGA A;  2BMR B;  2P38 A;  5G1K A;  3OWY A;  5IER A;  2P09 A;  2C10 A;  3F9S A;  2KRT A;  2IUJ A;  1NJI 4;  4L8O A;  5AYS C;  2GBX B;  2CWV A;  4QWT A;  1M1K 4;  1KQS 2;  2RBI A;  1V58 A;  1YGE A;  1FGM A;  2INX A;  1W00 A;  3I0Y A;  4LEH A;  1DYU A;  1JKG B;  4JF8 A;  3SOA A;  1OHS A;  3NBB A;  2KAA A;  2WGQ A;  1W5Z A;  1VQ4 3;  1N9E A;  5IW9 A;  1Q40 A;  1QAL A;  1E3V A;  2RCD A;  3MHE A;  3CC7 3;  3DGY A;  1EG9 B;  3D9R A;  1BGS A;  1OCV A;  2KCD A;  3HI7 A;  5FGO A;  1W7C A;  1UCL A;  1JZD A;  4N3V A;  2FNQ A;  3NUV A;  4HM0 B;  5JPP A;  1GD4 A;  1LVN A;  1G02 A;  1RTU A;  1E97 A;  3NHX A;  3CCE 3;  1LRA A;  2SAR A;  5AI1 A;  2LQV A;  3MSO A;  3RNT A;  2RSX A;  1I3I A;  3X3X A;  3K5T A;  2IY2 A;  1BSD A;  3PXM A;  1UUG B;  4FCJ A;  1SJW A;  2IYJ A;  3TDG A;  1W2Z A;  3F40 A;  3DGL A;  1RJO A;  2OQE A;  4RNT A;  1HYF A;  2AAD A;  1BVI A;  3DZL A;  3SVA A;  3ZG0 A;  4AKY A;  5BVB A;  2OOV C;  1UUV B;  1B3S A;  3NM2 A;  1B27 A;  1BSC A;  2H0G A;  4JRF A;  2ML6 A;  1IQX A;  1NB5 I;  1Q7Y 4;  2CKF B;  4WFO A;  1IVW A;  2GEX A;  1LOY A;  1K8A 4;  3GAX A;  3NBR A;  3MG2 A;  4O02 B;  4WYK A;  5JPU A;  3SYU A;  1R4Y A;  3CNX A;  4XM4 A;  3T8U A;  1B2M A;  4CJN A;  3PCR A;  1T2I A;  1I2F A;  1VQQ A;  1HU9 A;  1WTH A;  3K9M C;  1JBS A;  2JQ5 A;  3CPO A;  1TRP A;  2ZDJ A;  9RNT A;  1JKG A;  2C11 A;  3EN8 A;  1RLS A;  2H0H A;  2R41 A;  3CNM A;  2OOV A;  4LZI A;  2HMO B;  1B21 A;  3AMO B;  1LOW A;  4BL3 A;  1BSE A;  1S5A A;  2WO0 A;  2XR8 B;  3QK9 A;  4EYC A;  1SAR A;  1IU7 A;  2XF3 A;  1BSA A;  2PNC A;  4MEI A;  3CCU 3;  3PCS A;  3F14 A;  1Y4K A;  2Y74 A;  5EEO A;  1C54 A;  3MKI A;  1BNI A;  4N6N B;  1OGX A;  4XB5 A;  3FSD A;  2CWT A;  5EVH A;  1MWT A;  3G4S 3;  3KFQ C;  1O7W B;  2IA7 A;  4HM2 B;  5STD A;  5AEU B;  2BT3 A;  3CME 3;  3BU4 A;  1D6U A;  1UDI I;  1ZO2 A;  3EB8 A;  1I2E A;  3DY5 A;  3GZB A;  3OXA A;  4HKV B;  3S29 A;  1YJW 3;  1CQS A;  3LTD A;  1JRQ A;  2W9Q A;  1RNT A;  1BAN A;  3VF1 A;  3KKG A;  1N9J A;  1DMM A;  1JN5 B;  4XBY A;  1Q81 4;  1HKX A;  3S5C A;  1ULI B;  3PS8 A;  4HM1 B;  1A2K A;  8RNT A;  2LYX A;  3CCS 3;  7RNT A;  3CCQ 3;  3G16 A;  1GY6 A;  1TP6 A;  1EKM A;  4GSP A;  4FCZ A;  4KFF A;  1JB4 A;  5M1A A;  5GSP A;  3NQY A;  1LOV A;  4FMC A;  2F98 A;  3V99 A;  4EV2 A;  4STD A;  1W4N A;  1RGF A;  3IJE B;  4J5K A;  3N54 B;  1RGC A;  1ULJ B;  1IQ8 A;  3EC9 A;  2YFI B;  3BND A;  3WHO A;  1AY7 A;  3F8X A;  3CCL 3;  1N8Q A;  3LTC A;  1TTO A;  2BMQ B;  3KSP A;  4MMY B;  4RNZ A;  3MPH A;  3WOF B;  1DET A;  1JJ2 2;  1W6Y A;  3FGY A;  1GD3 A;  3LT9 A;  5AEW B;  1VQ5 3;  1KSI A;  3NM7 A;  3NBJ A;  1W2B 2;  5KP4 A;  3DGM A;  4IT7 A;  1B2S A;  1GOY A;  2Z77 A;  2XFS A;  3KE7 A;  7GSP A;  5A0O B;  1X1X A;  3AMO A;  3CCJ 3;  3IPT A;  5IG5 A;  3DMC A;  1VQ8 3;  4K90 B;  1QVG 2;  1Q9E A;  4K61 A;  5M19 A;  1VQ7 3;  1T2H A;  1V57 A;  1YIT 3;  3K63 A;  1JZO A;  1GOV A;  2O9U X;  4EBG A;  3BNE A;  1B20 A;  1PYL A;  2GXF A;  4EC6 A;  1A2P A;  1CEW I;  4KT3 B;  2W03 A;  1LQG C;  3DGO A;  2K3D A;  2QIY A;  3Q2P A;  4BL2 A;  6STD A;  1G0T A;  1BRI A;  5KP1 A;  1JN5 A;  1EEJ A;  4HYZ A;  5DRV A;  3I55 3;  3A76 A;  2Z76 A;  2CG0 A;  1QMA A;  3CXC 2;  3FLJ A;  5DRE A;  3WA3 A;  3PZW A;  3IMA B;  2HMN B;  3JUN A;  3RGA A;  4OK0 A;  3S27 A;  3PYJ A;  3MYT A;  5G2G A;  3AGO A;  5IEP A;  1STD A;  3FG4 A;  3LH4 A;  1OHP A;  4KVH A;  1CYU A;  1SQW A;  3GWR A;  1JB2 A;  2HMK B;  1U5O A;  2OQE C;  2Y73 A;  5CF1 A;  1GMP A;  3FF0 A;  1GYB A;  3EX9 A;  3B4P A;  1NNV A;  3SOY A;  1T5Y A;  2CK3 H;  3B8L A;  3GZR A;  2WGO A;  3N9H A;  1IT8 A;  4X2O A;  1RN1 A;  2K0M A;  1VZZ A;  2GU3 A;  1BRJ A;  2F4Y A;  1BNS A;  3N8B A;  1ROV A;  5HGR A;  4LMI A;  5IF6 A;  1KC8 4;  1WQL B;  3FZW A;  1BRK A;  3UB1 A;  4RBN A;  5TGN A;  1RDS A;  4CDL A;  1US1 A;  3LTA A;  2BIR A;  3ALA A;  3EE1 A;  1UW1 A;  1I2G A;  3EBY A;  3GZX B;  2IUK A;  3OV4 A;  3AGN A;  2CG1 A;  5IG0 A;  1ZGX A;  3HII A;  3NV0 A;  4TX4 A;  1O7H B;  1KD1 4;  1FUT A;  3UJM A;  3Q90 A;  1AV4 A;  2F5M A;  1QJG A;  4KFD A;  2BHM A;  1W02 A;  5IG4 A;  3PGB A;  5D83 A;  2XSO B;  3I56 3;  3QRD A;  4H3U A;  1N5P A;  1A67 A;  2W56 B;  1RCL A;  3LTB A;  1OH0 A;  3NQZ A;  1C7H A;  1CH0 A;  2KF4 A;  4HM3 B;  3X3Y A;  4R80 A;  2CW9 A;  1Q7H A;  3J7Y d;  2GU1 A;  4I4K A;  3ER7 A;  1VQP 3;  1Q86 4;  1YJN 3;  1W6G A;  1IK3 A;  2F5W A;  3WOE B;  3RDE A;  2FGT A;  1A90 A;  1M9G A;  1HZ1 A;  4ZM8 A;  4N6L A;  2OTL 3;  3BLZ A;  1NDO B;  5RNT A;  3WDG B;  4HBR A;  3MG1 A;  4K1V A;  1ZS7 A;  1LXE A;  1Z1S A;  2KF3 A;  2RFR A;  1UCK A;  3URP A;  4EV5 A;  1OGZ A;  3D5I A;  3STD A;  3WA2 X;  4AKZ A;  3NXJ A;  4H61 A;  4WP5 A;  2MF7 A;  1UGH I;  2F99 A;  1IDP A;  3BIR A;  4NHF A;  4O3V A;  3BB9 A;  2W04 A;  3KCH A;  4GHO A;  4O8S A;  3DUK A;  4J9A A;  1BUQ A;  2CHC A;  3G71 3;  2ML5 A;  1IQY A;  1ZX2 A;  1B2Z A;  3S67 A;  3G0K A;  1UCI A;  3DH2 A;  1BNE A;  2W9P A;  1LNH A;  4FMB A;  2AAE A;  4DKI A;  1MWS A;  3H3H A;  4HM4 B;  4O2H A;  3WOD G;  1D6Z A;  4NPB A;  1VQO 3;  3B4O A;  4X2H A;  1RGG A;  2M7O A;  3D4A A;  1DE3 A;  2JDI H;  3F7X A;  5BIR A;  2HML B;  1FGT A;  1CYV A;  3KII A;  5FW5 A;  1MGW A;  4HZB B;  1D6Y A;  3EJV A;  2L1S A;  3GRD A;  2Q07 A;  1RRL A;  2W56 A;  1I0X A;  4OVM A;  1YIJ 3;  1TFK A;  1I8V A;  1MNL A;  1SPU A;  2F86 B;  2PZV A;  3JUM A;  4L8P A;  2CC3 A;  1OUN A;  4MMZ B;  1RGL A;  5ELU A;  1Q82 4;  3D3L A;  2D42 A;  1EA2 A;  3BNB A;  4EW5 A;  3EF8 A;  5M18 A;  1IYY A;  4BU4 A;  2GBW B;  3SXX A;  1VQ6 3;  1FUW A;  1IT7 A;  1RNB A;  2KXG A;  1S72 3;  3JUP A;  1FZU A;  1RN4 A;  2GEY A;  2XGN A;  4HAA A;  2B24 B;  1TJD A;  1YI2 3;  5AIG A;  1JBR A;  3CC2 3;  1IVU A;  2HOH A;  3T8N A;  3KSE D;  1JBT A;  3U97 A;  2L4V A;  4R9L A;  7STD A;  1OF5 B;  2OCT A;  3EBT A;  3CCR 3;  3D79 A;  3ROB A;  2CX0 A;  2P0X A;  4WWU C;  1IVV A;  4AEQ A;  4J8T A;  4I5Q A;  2MC8 A;  5LC6 A;  1FYS A;  4LSO A;  1BRN L; 
#chains in the Genus database with same CATH homology
 3CCM 3;  1RN7 A;  2W6J H;  2BO9 B;  1K28 A;  1GY7 A;  3LZA A;  1GY5 A;  1TIJ A;  2CFL A;  3T0U A;  1VQL 3;  2FXT A;  2CIU A;  4MMX B;  2P0M A;  1TFO A;  2CWU A;  4N6T A;  1OPY A;  2QEX 3;  1VQ9 3;  1SIH A;  3CU3 A;  3DXO A;  3G8Z A;  4N6U A;  1DMN A;  3FF2 A;  3FG1 A;  2BNG A;  2B1X B;  4XBT A;  4HJL B;  3LOY A;  4K1U A;  1JV2 B;  3LML A;  1L5G B;  2Z7A A;  2P05 A;  3U1W A;  3EQQ B;  1RRH A;  2YX9 A;  3X3Z A;  4N6M A;  3HK4 A;  3VSY A;  5EQL A;  1AVL A;  4HVN A;  1YVB I;  2Z6B A;  3NX0 A;  3EN1 B;  3MWZ A;  2YFJ B;  4HZ9 B;  4CCV A;  1JB5 A;  3CCV 3;  1OF5 A;  1VQN 3;  4FR9 A;  4RNY A;  2E2U A;  3OW2 2;  5AIH A;  1O7M B;  4GL6 A;  3EHC A;  3FH1 A;  4BTW A;  1K9M 4;  2XGL A;  3X40 A;  3F8H A;  4HM7 B;  4G1M B;  4GB5 A;  4IPB A;  4L7K A;  5BXQ A;  1O7N B;  1VQK 3;  1K41 A;  2HMJ B;  2W0Q A;  2WOF A;  2XSH B;  4RZM A;  3O8Y A;  4BTY A;  1FA3 A;  2HMM B;  5IEN A;  2QA4 3;  5LC7 A;  1M1X B;  1O7P B;  2E2V A;  1J2B A;  1U8C B;  3Q1C A;  3FKA A;  1V74 A;  3OX9 A;  5D81 A;  1DVC A;  4R9K A;  4R4K A;  2I9W A;  2QGU A;  3CMA 3;  4XBX A;  2UX0 A;  2ZL8 A;  1RKY A;  2YFL B;  4PEJ A;  1FGO A;  1DMQ A;  4HM5 B;  3DM8 A;  5ELJ A;  1W01 A;  2CFW A;  1E3R A;  1UUW B;  1VQM 3;  3CD6 3;  1IV9 A;  2CFD A;  1AVK A;  1ASK A;  4WHA A;  1O7G B;  1NO3 A;  3F7S A;  1OAC A;  3HIG A;  3UNL A;  1N8R 4;  3K0Z A;  4KZ1 A;  5IEO A;  2CFG A;  3SX1 A;  1NB3 I;  3LYG A;  5CLK A;  2V1L A;  3JVC A;  4R1K A;  3VGN A;  4LGQ A;  5IG3 A;  4HM6 B;  1K73 4;  1QAF A;  2XRX B;  2STD A;  5CXO A;  4MJD A;  1UI7 A;  4BTX A;  1NWW A;  3WMD A;  4FCM A;  4N6V 0;  1N5H A;  3RGR A;  1YHQ 3;  1IV7 A;  4N6O B;  1EQK A;  2O3O A;  3CPW 2;  3HX8 A;  1PU4 A;  2XEP A;  4FMD A;  3H51 A;  4HM8 B;  1GS3 A;  3JUQ A;  5CK6 A;  1R4C A;  5D82 A;  1WMP A;  4KFE A;  1ISK A;  2OTJ 3;  2XH9 A;  3MG3 A;  3UL6 A;  1DVD A;  3LT8 A;  3M8C A;  1G96 A;  3BNC A;  3V98 A;  4FMA A;  4XDW A;  3V92 A;  1NU3 A;  1KWI A;  2CH9 A;  1QVF 2;  3OWU A;  1Q42 A;  3ECF A;  2XFT A;  1STF I;  1FGR A;  1IVX A;  1WNH A;  2E2T A;  2IMJ A;  3X41 A;  1M90 4;  4Q53 A;  5CF2 A;  1SII A;  3SLU A;  1A2V A;  3S28 A;  1Q40 B;  3FCS B;  3KZT A;  5AII A;  3K7C A;  3LXU X;  3E99 A;  3UL5 A;  8CHO A;  1OHO A;  1WMN A;  3B7C A;  2A15 A;  4U13 A;  1FGQ A;  3DGN A;  2R4I A;  4ORL A;  1JNQ A;  1ROA A;  3JUO A;  1AR0 A;  1MOL A;  2WOH A;  3OWS A;  5KP3 A;  1PFP A;  3L0R A;  2K54 A;  1UI8 A;  5JBS A;  1QAK A;  2SBL A;  1LOX A;  3CC4 3;  3KN4 A;  1W6C A;  4OUQ A;  1TUH A;  1YJ9 3;  3NV0 B;  3G6E 3;  2BMO B;  2D1W A;  4IIA A;  1WMO A;  4NRE A;  4EXR A;  5I97 A;  5AIF A;  2W2C A;  3GZY B;  3HZP A;  4XDV A;  3SED A;  2RGQ A;  4WYK B;  5AYR B;  3X42 A;  2OWP A;  3FG3 A;  2CFK A;  1F8N A;  5IER A;  2BMR B;  2P38 A;  3OWY A;  2P09 A;  2C10 A;  3F9S A;  2KRT A;  2IUJ A;  1NJI 4;  4L8O A;  5AYS C;  2GBX B;  2CWV A;  4QWT A;  1M1K 4;  1KQS 2;  1YGE A;  1FGM A;  2INX A;  1W00 A;  3I0Y A;  4LEH A;  1DYU A;  1JKG B;  4JF8 A;  3SOA A;  1OHS A;  3NBB A;  2WGQ A;  1W5Z A;  1VQ4 3;  1N9E A;  5IW9 A;  2RCD A;  1Q40 A;  1QAL A;  1E3V A;  3MHE A;  3CC7 3;  1EG9 B;  3D9R A;  1OCV A;  2KCD A;  3HI7 A;  5FGO A;  1W7C A;  4N3V A;  2FNQ A;  3NUV A;  4HM0 B;  5JPP A;  1GD4 A;  1LVN A;  3NHX A;  1E97 A;  3CCE 3;  5AI1 A;  3X3X A;  2LQV A;  3MSO A;  2RSX A;  3K5T A;  3PXM A;  4FCJ A;  1SJW A;  3TDG A;  1W2Z A;  3F40 A;  3DGL A;  1RJO A;  2OQE A;  3SVA A;  3DZL A;  4AKY A;  5BVB A;  2OOV C;  1UUV B;  3NM2 A;  4JRF A;  2ML6 A;  1IQX A;  1NB5 I;  1Q7Y 4;  2CKF B;  4WFO A;  1IVW A;  2GEX A;  1K8A 4;  3GAX A;  3NBR A;  3MG2 A;  4O02 B;  4WYK A;  5JPU A;  3CNX A;  4XM4 A;  3T8U A;  3PCR A;  3K9M C;  1HU9 A;  1WTH A;  2JQ5 A;  3CPO A;  2ZDJ A;  1JKG A;  2C11 A;  3EN8 A;  3CNM A;  2OOV A;  4LZI A;  2HMO B;  3AMO B;  1S5A A;  2WO0 A;  2XR8 B;  3QK9 A;  4EYC A;  2XF3 A;  1IU7 A;  2PNC A;  4MEI A;  3CCU 3;  3PCS A;  3F14 A;  1Y4K A;  2Y74 A;  5EEO A;  3MKI A;  4N6N B;  4XB5 A;  1OGX A;  3FSD A;  2CWT A;  5EVH A;  3G4S 3;  3KFQ C;  1O7W B;  2IA7 A;  4HM2 B;  5STD A;  5AEU B;  2BT3 A;  3CME 3;  3EB8 A;  1D6U A;  1ZO2 A;  3DY5 A;  3GZB A;  3OXA A;  4HKV B;  3S29 A;  1TU5 A;  1YJW 3;  1CQS A;  3LTD A;  1JRQ A;  2W9Q A;  3VF1 A;  3KKG A;  1N9J A;  1DMM A;  1JN5 B;  4XBY A;  1Q81 4;  1HKX A;  3S5C A;  1ULI B;  3PS8 A;  4HM1 B;  1A2K A;  2LYX A;  3CCS 3;  3CCQ 3;  3G16 A;  1GY6 A;  1TP6 A;  1EKM A;  4FCZ A;  4KFF A;  1JB4 A;  3NQY A;  4FMC A;  2F98 A;  3V99 A;  4EV2 A;  4STD A;  1W4N A;  3IJE B;  3N54 B;  1ULJ B;  1IQ8 A;  3EC9 A;  2YFI B;  3BND A;  3F8X A;  3CCL 3;  1N8Q A;  3LTC A;  2BMQ B;  3KSP A;  4MMY B;  4RNZ A;  3WOF B;  3MPH A;  1JJ2 2;  1W6Y A;  3FGY A;  1GD3 A;  1VQ5 3;  5AEW B;  1KSI A;  3NM7 A;  3NBJ A;  1W2B 2;  5KP4 A;  3DGM A;  4IT7 A;  2Z77 A;  2XFS A;  3KE7 A;  3CCJ 3;  5A0O B;  3AMO A;  3IPT A;  5IG5 A;  3DMC A;  1VQ8 3;  4K90 B;  1QVG 2;  4K61 A;  1VQ7 3;  1YIT 3;  3K63 A;  2O9U X;  4EBG A;  3BNE A;  4EC6 A;  2GXF A;  1CEW I;  2W03 A;  3DGO A;  2QIY A;  3Q2P A;  6STD A;  5KP1 A;  1JN5 A;  4HYZ A;  5DRV A;  3I55 3;  3A76 A;  2Z76 A;  2CG0 A;  1QMA A;  3CXC 2;  3FLJ A;  5DRE A;  3WA3 A;  3PZW A;  3IMA B;  2HMN B;  3JUN A;  3RGA A;  4OK0 A;  3S27 A;  3PYJ A;  3MYT A;  5G2G A;  5IEP A;  1STD A;  3FG4 A;  3LH4 A;  1OHP A;  4KVH A;  1CYU A;  1SQW A;  3GWR A;  1JB2 A;  2HMK B;  1U5O A;  2OQE C;  2Y73 A;  5CF1 A;  3FF0 A;  1GYB A;  3EX9 A;  3B4P A;  3SOY A;  1T5Y A;  2CK3 H;  3B8L A;  3GZR A;  2WGO A;  3N9H A;  1IT8 A;  4X2O A;  2K0M A;  1VZZ A;  2GU3 A;  3N8B A;  1ROV A;  5HGR A;  4LMI A;  5IF6 A;  1KC8 4;  1WQL B;  3FZW A;  3UB1 A;  4RBN A;  5TGN A;  4CDL A;  1US1 A;  3LTA A;  3ALA A;  3EE1 A;  3GZX B;  1UW1 A;  3EBY A;  2IUK A;  3OV4 A;  2CG1 A;  5IG0 A;  3HII A;  3NV0 A;  4TX4 A;  1O7H B;  1KD1 4;  3UJM A;  3Q90 A;  1AV4 A;  4KFD A;  1QJG A;  2BHM A;  1W02 A;  5IG4 A;  3PGB A;  5D83 A;  2XSO B;  3I56 3;  3QRD A;  4H3U A;  1N5P A;  1A67 A;  2W56 B;  3LTB A;  3NQZ A;  1OH0 A;  1C7H A;  3X3Y A;  4HM3 B;  4R80 A;  2CW9 A;  3J7Y d;  2GU1 A;  4I4K A;  3ER7 A;  1VQP 3;  1Q86 4;  1YJN 3;  1W6G A;  1IK3 A;  3WOE B;  3RDE A;  2FGT A;  1A90 A;  1M9G A;  4ZM8 A;  4N6L A;  2OTL 3;  3BLZ A;  1NDO B;  3WDG B;  4HBR A;  3MG1 A;  4K1V A;  2RFR A;  1LXE A;  1Z1S A;  4EV5 A;  1OGZ A;  3STD A;  3WA2 X;  4AKZ A;  3NXJ A;  4H61 A;  4WP5 A;  2MF7 A;  4NHF A;  2F99 A;  1IDP A;  4O3V A;  3BB9 A;  2W04 A;  4O8S A;  3DUK A;  4J9A A;  1BUQ A;  2CHC A;  3G71 3;  2ML5 A;  1IQY A;  1ZX2 A;  3S67 A;  3G0K A;  2W9P A;  1LNH A;  4FMB A;  3H3H A;  4HM4 B;  4O2H A;  3WOD G;  1D6Z A;  1VQO 3;  3B4O A;  4X2H A;  2M7O A;  2JDI H;  3F7X A;  2HML B;  1FGT A;  1CYV A;  3KII A;  5FW5 A;  4HZB B;  1D6Y A;  3EJV A;  3GRD A;  2Q07 A;  1RRL A;  2W56 A;  4OVM A;  1YIJ 3;  1TFK A;  1MNL A;  1SPU A;  2F86 B;  2PZV A;  3JUM A;  4L8P A;  2CC3 A;  1OUN A;  4MMZ B;  5ELU A;  1Q82 4;  3D3L A;  2D42 A;  1EA2 A;  3BNB A;  3EF8 A;  2GBW B;  3SXX A;  1VQ6 3;  1FUW A;  1IT7 A;  2KXG A;  1S72 3;  3JUP A;  2XGN A;  2GEY A;  2B24 B;  1YI2 3;  5AIG A;  3CC2 3;  1IVU A;  3T8N A;  3KSE D;  3U97 A;  2L4V A;  4R9L A;  7STD A;  1OF5 B;  2OCT A;  3EBT A;  3CCR 3;  3ROB A;  2P0X A;  4WWU C;  1IVV A;  4AEQ A;  4J8T A;  2MC8 A;  5LC6 A;  3LT9 A;  4LSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...