5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
3GL5A 2VCVA 2AJQB 2L59A 1EWXA 3TKSC 1BEDA 4IW9A 5DQSA 2CT6A 1TRWA 2M80A 2X8CA 3VPTA 1S3AA 1WP0A 2VAFA 3TRQA 6GSVA 4OO4A 3F3QA 5KN1A 4EDZA 3GFKA 2OE1A 2I81A 3KGKA 3ERFA 3FY7A 3K8NA 1XW5A 1OC3A 3IE3A 1MD4A 4RI6A 4ZB8A 3HD5A 4IKHA 3GKMA 2L5OA 2CAQA 3NIVA 2VD1A 5D9VA 3I6AA 1LU4A 6GSWA 1PKWA 5JCUA 2X8GA 5FWGA 4LA1A 3UOMA 5D8IA 4F82A 1UVZA 3ISOA 3FZ5A 3ME7A 4PQ1A 3GRXA 4WEYA 4LMWA 1V9WA 1IYHA 4KDUA 3DD3A 4GTUA 3G9BA 4BL7A 2AAWA 2RLIA 3HKRA 1ZCPA 4N0ZA 3C8EA 3BBYA 2CA8A 5GAPD 5C04A 2FGXA 1G6YA 4JE1A 1ERWA 3KH7A 5DAKB 4H86A 1UA5A 14GSA 3SBCA 2GZZA 2NBSA 1E2YA 4MZWA 5ELAA 1B8XA 3HCZA 3TKPA 2VLVA 4I8BA 4J2FA 5ECNB 3TUEA 1Y6EA 3RHBA 5JWQB 3APQA 1XBSA 4AF2A 1SL1B 2XHFA 4KUNA 5ECPB 1B9YC 1PGTA 2E7PA 4QQ7A 2MBSA 1UC7A 3G7YA 2C80A 4ZB6A 2JL4A 3ME8A 1K3LA 1M2BA 2CX3A 6GSTA 3EMXA 1ILOA 2H19A 2DIYA 4POMA 1ZOFA 4V2NA 1SK2A 4IQ1A 5ECOB 2OE0A 4RQXA 2C3NA 3ZTLA 2H6YA 2IYJA 2YJHA 4ZIJA 3F4TA 3A2XA 2N5AA 1PX6A 4LLRA 2HYXA 1M2DA 4TR0A 5IMDA 1AC1A 4MLYA 2K18A 4PGTA 3F4SA 4JBBA 4LL1B 3WGXA 3MSZA 1NM3A 4DSQA 1M2AA 3ZMKA 1O8XA 1T7PB 1HNAA 2VL9A 1TK8B 3F9UA 5GAND 4EXJA 3I43A 4MJCA 4L0WA 10GSA 1YY7A 9GSSA 2YCDA 5CRHA 5H5RA 3TJKA 2PN8A 4AJ8A 4HI7A 1Z3EA 1WJKA 3N5OA 2YZHA 3NZNA 1Z6NA 5F06A 1KNGA 2ZCTA 3QDNA 3C71A 2YP6A 5IMZA 1GP1A 5FHIA 4EUYA 3E0UA 1B4PA 4ACSA 2VLUA 3TOUA 5EPFA 3IV4A 4KX4A 2FNOA 5HQPA 1A2MA 1O6JA 1EV4A 4KCAA 4XS4A 3F6FA 4HJ2A 4ML1A 3HHVA 1V58A 2FY6A 1MDJA 1JZRA 2NTOA 3AY8A 2GT5A 5LCZA 4Q5NA 3CRTA 1EV9A 5B6MA 3F8UA 2PERA 1QQ2A 1WPIA 1GSUA 1N2AA 4GCIA 4MJEA 4Q5RA 4Z7XA 3QCPA 1OE7A 3MAKA 1TK0B 4IJIA 4POBA 2KP2A 3BCIA 3N9JA 4K7OA 2EIRA 2LRNA 3A3TA 2R4VA 4X1UA 3M0FA 5CRWA 1O7UA 2FUG2 3CRUA 3GL3A 2LQQA 1F37A 2L5LA 2PBJA 3P8WA 3ZIJA 3QD9A 4POKA 2IN3A 3L9UA 5IIZA 4AJ7A 4D73B 3NOFA 2L6CA 2YANA 2CZ2A 2H0GA 1FVKA 2KLXA 4JR4A 2CVKA 2QC7A 3UBLA 1O73A 2CAIA 5D73A 4K1FA 2PVQA 3BOAA 5ECQB 3H8QA 4JRRA 3TKRA 1SJ6A 5CRGA 1FW1A 5J41A 3WGEA 5CNWA 2YV9A 1I5GA 1A8YA 1A23A 4FH8A 3BD2A 1XW6A 4ML6A 1SD8A 4X0XA 5KN2A 4MF5A 1SU9A 3KP8A 1V98A 1WMJA 1AUCA 3ZL5A 2HRNA 1QGVA 2H1GA 3EU3A 1H75A 5G5FA 1TKDB 4QL7A 3EINA 2RUEA 1NSWA 2VCZA 1SKWB 5ENUA 1ABAA 2C0DA 1EP8A 1XW9A 2C1YA 2LJKA 3KIJA 2H0HA 2CVDA 4BWSA 3LGCA 4ZBDA 2YPMA 4MZCA 2DLXA 3KMOA 1AW9A 4MF7A 4HU7A 4YAPA 2QKEA 1XWGA 4K9ZA 1OYJA 1X9WB 1TRSA 1ZL9A 1GWCA 2E2GA 2DJ1A 2ZUPA 2YN1A 3FHKA 4E8EA 2YWOA 1GTUA 3KTBA 1MD3A 3M8NA 3LYKA 1R7HA 3Q18A 2GQLA 3LFLA 2O85A 1S3DA 2GSSA 2WRTA 2R3XA 3EU4A 2HRFA 4KA0A 1WIKA 1XOAA 4JU5A 3LORA 2YZUA 4PUFC 5G31A 3TRXA 2O8VB 2F8AA 3DYRA 1XPVA 1XFLA 4PNGA 8GSSA 4MZBA 5F8BA 3L9SA 3QMXA 3QFAC 1BQ7A 4V2MA 3APSA 1OVNA 2H72A 1JLVA 1ZYEA 3VWVA 4NHZA 1OC9A 1X9MB 3FZAA 3IC4A 1Z9HA 2VCTA 1JZOA 5AIVA 2JU5A 1O85A 4HUAA 16GSA 4GSSA 4DEJA 2H6ZA 4NAXA 2GT6A 2WULA 1HD2A 2YV7A 3C1SA 5D93A 2NPBA 2LRCA 1TU8A 5JWOB 4BA7A 5J5NA 1QMVA 5JCGA 1XWKA 5A4UA 5ABRA 3BJ5A 5DDLA 1FOVA 3ED3A 1UN2A 4FYUA 3F3RA 2QGVA 2V6KA 4XS1A 5J4UA 5IPHA 5B6NA 4ECJA 2ALBA 3UAPA 2K8SA 4OFMA 4CHSA 5D9XA 1R4WA 3LSZA 2IMIA 1SKSB 4ZL9A 3ZIVA 1A8LA 1QUWA 2TRCP 4KAEA 1J08A 4MMMA 2OBKA 3DKSA 3IA1A 5L71A 1PN9A 2EIQA 3CSJA 1RW1A 2VL2A 1FVJA 3EYTA 4AJ6A 1M7TA 3APOA 5ID2A 4YQUA 2HFDA 4GRFA 3HY2A 4TR1B 4XTSA 5E59A 2C0FA 2OBIA 3ZVJA 4N11A 5DAKA 2DC5A 2LNTA 4HU9A 3D22A 3GMFA 3DXBA 3Q74A 3QOUA 3FZ4A 4F0CA 3W6GA 4POLA 3S9FA 2O7KA 2VL3A 1EGRA 3IPZA 2BTOT 3KM6A 3F4RA 3VLNA 1PL1A 5CYYA 4GF0A 2G2QA 2OJLA 2P5RA 4WKWA 1F2EA 4P3YB 4KNDA 4PXOA 2H1DA 1F6MC 1YZXA 4WXTA 1BJXA 3DWVA 2F51A 2LEGA 5DCHA 4L5OA 4TR3A 4WR4A 4CW9A 3O6TA 3KH9A 2OADA 3ZMLA 2GSTA 3TJGA 3D21A 3KMNA 2LJAA 3LXZA 3FR6A 1ML6A 1JHBA 1A24A 4IELA 5B8BA 2GTUA 1USBA 1A2JA 2IJYA 4IS0A 1HNCA 1XOBA 2GZPA 3F6DA 5CP1A 3RHCA 4DSRA 2FWFA 4PQIA 2MMNA 2VUPA 4HS1A 2WJUA 3DEXA 2MMOA 4J57E 3IAS2 1U88A 1A0RP 2PU9C 5ECIB 1K0CA 3CSHA 1TTZA 5DALB 5C00A 1E6BA 4K7NA 4TXOA 2XBQA 3ERGA 4OFNA 2H1BA 4TXOB 1HQOA 2FA8A 1BG5A 1SK0A 3GYKA 1N8JA 2LTKA 5INYA 2GSRA 1SK1A 1GH2A 2QSIA 3IDVA 1ERVA 4FIWA 20GSA 1GTIA 1M9BA 2WZ9A 2FWHA 5EL8A 1AQWA 2KP1A 3FW2A 1M0UA 4BWQA 1M99A 2O89A 1U3AA 6GSSA 5EY6A 4EC0A 4IBPA 2KUCA 3KJYA 1ZZYA 2CX4A 4JEDA 1NW2A 2XPDA 5IOWA 2F8FA 2HNLA 1TI3A 4J56E 3TRPA 2PPTA 4ULXA 4F2IA 4MJBA 2Z9SA 3A2VA 4HQSA 1DSBA 3I69A 1RQMA 1GNEA 1LBKA 2J23A 3A5WA 3GN3A 4N0VA 4NMUA 5AISA 3CTFA 4TR1A 1G6WA 1Z6MA 2L4QA 5HR0A 3GKNA 1BAYA 2GGTA 5DJLA 2LNSA 1YF0A 1GULA 2FWEA 3RPPA 2IMFA 2RUFA 1NHOA 4F0BA 1AXDA 2C8UA 4NWYA 2HZEB 3VWUA 3IBHA 1XZOA 3W8JA 4EF0A 5GSTA 4WBJA 5LNKe 2YJ7A 1FO5A 4KCEA 3WT1A 1PD21 4I2UA 4E8HA 5AN1A 1C72A 2JACA 3RAZA 4PUAA 2R2JA 4OWYA 1AQVA 1LJRA 4BPYA 3TJFA 2DJKA 3GH9A 5J9CA 4HOJA 2E2MA 5KN0A 1O81A 4GXZA 2K8VA 1KTEA 3EVIA 3OR5A 2LQOA 4XS6A 5IQYA 2A4VA 2DJJA 2TIRA 3EWLA 5ELGA 2EC4A 1CQHA 5E4WA 5ECHB 2J9HA 6GSXA 4OCEA 5ECLB 1GUMA 2C0GA 3QAVA 3LWAA 1SJIA 5J3RA 1YQ1A 4DSSA 3D6IA 4NPBA 4HZ4A 5IO0A 1EP7A 1V2AA 4DSSB 2DJ2A 1GRXA 2MYGA 2C3QA 5HFGA 2XPEA 2AUVA 2ON5A 2ES7A 3TJBA 2LJRA 3Q6OA 4ECCA 4IJ3A 1GTAA 1TP9A 4RQRA 4KE3A 4IN0A 4CDOA 3TCOA 4K0NA 1GLQA 1QXHA 4OFTA 4ID0A 1FAAA 1XXUA 1B4QA 5IOXA 2GLRA 3C73A 4MPGA 2IMKA 2C0EA 2H01A 3GHAA 1KEBA 1OKDA 1DUGA 3KP9A 3HVSA 3HA9A 1THXA 3FKFA 4MPFA 1FHEA 4EDYA 1TDIA 1W4VA 2IL3A 1XCCA 1X0RA 4WF5A 2HT9A 3CTGA 3QFBC 3GURA 5A5KA 1VF4A 1VRSD 5ECKB 4KB3A 1MDIA 3VWWA 5DQYA 1K0AA 3EC3A 2X64A 3UVHA 2H70A 3GKXA 2M46A 3GNJA 2AV4A 2I9HA 5AIXA 1AIUA 4XHMA 3HJMA 3TJJA 1EOGA 4MF6A 3RDWA 3MNGA 2OA7A 1Y25A 3F0IA 4IP1A 1PKZA 2WGRA 3C7MA 1X5CA 5IMAA 1A0FA 2DIZA 4TVEA 1V57A 2WB9A 5IPGA 1ON4A 3PINA 1GSFA 3EMPA 5GZZB 5ECSA 2B7JA 1SENA 2FHEA 1GSDA 2JZSA 1Z7RA 1YKAA 2I3YA 1WWJA 5IMVA 2F9SA 5G1KA 1F3AA 4KDXA 3H4KA 19GSA 3VWXA 1HYUA 3UL3A 3WYWA 2A2RA 1J0FA 3HJOA 4KSOA 3U6VA 3TGZA 3CXGA 1JZDA 4XIHA 4BVYA 1B9XC 4OMVA 1W89A 5DALA 3KEBA 4ZL8A 2IMEA 1TOFA 3H79A 1YKCA 1B48A 2H6XA 3LEFA 1GSEA 1GTBA 2L57A 3FR9A 4AGSA 4G9HA 4BVXA 2VL2C 1SKRB 1U6TA 2G0FA 1K0MA 3KD0A 5JCWA 4KH7A 2BJXA 5HR3A 4KW6A 1GNWA 2V41A 2B3SA 2B1LA 5D9TA 4ILFA 3GV1A 4V2LA 2ZNMA 1H4OA 1T00A 3QAGA 3GSSA 2R6KA 5CAXA 2H75A 4HQZA 1K0BA 3VK9A 4ZB9A 11GSA 1TJDA 1U3IA 5KEJA 3DGQA 2AYTA 2LV3A 3M1GA 1K3OA 2C3TA 4JZQA 5G5EA 3GTUA 2JSYA 1SL0B 1GL8A 2VOCA 3L9VA 4GQFA 2VCWA 4V1Ap 3O76A 2YOIA 1WOUA 1PL2A 5FT3A 3VPQA 3ZREA 1AAZA 4L0UA 1OC9B 4PURA 3VFIA 3TB2A 4NV5A 3UIWA 2IPAA 5ECMB 1XVQA 5D96A 3H1NA 1VF3A 3VI5A 4TXVA 2F3MA 5HFKA 2K6VA 3TOTA 3D4MA 2HZEA 5B7CA 5F05A 1Q4JA 3LYPA 5F07A 3V1WA 3H93A 2GQKA 5DVBA 1T4YA 4L5LA 3I9V2 3WGDA 3CBUA 1DBYA 1PMTA 2H66A 5F0GA 2PWJA 1G7OA 4FYBA 2VCXA 2DBCA 4TR4A 1X5DA 4XRDA 4O92A 1R5PA 5J9BA 1T3BA 2HE3A 2VLTA 3IAM2 1JLWA 1Q98A 3LXTA 2H76A 2LUSA 2VIMA 1T8EB 1YDKA 1ZMAA 4MA9A 3D5JA 5CO3A 3FRCA 4EE0A 3ZYWA 4IP6A 3M3MA 2V32A 1WE0A 2L6DA 1DE2A 4KSMA 3LG6A 1ZYQB 5KN3A 3IK7A 1TRVA 4EO3A 3LQ7A 4MK3A 5B8AA 3E3EA 1VF2A 3GTUB 4IQAA 3R2QA 3VURA 4ECBA 2O87A 4YAVA 6GSUA 5DJMA 2K9FA 4TRXA 3GSTA 2MBTA 3KTLA 2VCQA 3JCML 3ZLPA 5D9WA 1AQXA 4ECIA 2GZYA 2LKUA 3ZFBA 5HR2A 3IHQA 4GSTA 3IK9A 2D2ZA 1FG4A 1IYIA 2WDUA 3TKSA 1GLPA 2CQ9A 2RIIA 7GSSA 5DBQA 4XRAA 3DVXA 2PVOC 3EE2A 1TI1A 4F9ZA 2JADA 4RI7A 3LJRA 2VO4A 4DVCA 3G7JA 4XCSA 4G2EA 1SYRA 5IM9A 3UARA 3HVXA 1KBNA 2EIOA 2AHEA 2LRTA 4I6XA 2H1AA 3WD6A 4NXIA 4YQVA 4JR6A 3KXOA 2NDOA 1TW9A 1TK5B 1G7EA 2ON7A 3L0HA 4LL4B 5JWRB 1ZGNA 1OE8A 4MJAA 3ZFLA 1OKTA 4TKYA 4MP4A 1A2LA 3GA4A 1ERUA 1FB6A 1X9SB 1VGLA 1EEJA 4EVMA 2V6OA 4ISDA 4K0GA 1X5EA 3P90A 2GQMA 1BYEA 1Z5YE 1ST9A 1NHYA 4OD7A 4MH2A 3GIXA 1PQNA 3RBTA 5CREA 4I97A 2LS5A 2M72A 3GX0A 4ZBBA 1YF1A 2IWTA 1EOHA 3ZVJD 5A4VA 3J7Yk 2OE3A 4I5QA 4OO5A 2B5XA 3WT2A 4TW5A 3J7Yb 1I9DA 1JZWA 2GDRA 4QL9A 4ZL7A 1MEKA 1SJZA 3UJ1A 5H5QA 1VF1A 3DRNA 3ZITA 4IHUA 3HXSA 1DE1A 5HR1A 4WF4A 3P2AA 2N5BA 2IMDA 3G7IA 2B5EA 2FCHA 3UBKA 2LSTA 4YQMA 1F9MA 1R5AA 4D73A 2L4CA 2YWNA 3TDGA 3QAWA 4O7HA 1R26A 3IRAA 3GKKA 4KDYA 4K6XA 2GS3A 4FO5A 4XS4B 4MABA 5G1LA 3HYPA 2R37A 4HZ2A 2TRXA 2YWIA 2B1KA 1GUHA 1XVWA 1G0TA 1EGOA 2GVPA 4L8EA 1OAZA 1XWBA 1GSYA 4I2TA 4MCUA 2WS2A 3ZZXA 2FLSA 2E0QA 2OKAA 5ID2B 2WFCA 3F63A 3FR3A 4O5RA 1MDKA 3P7XA 3UEMA 1K3YA 2CVBA 3RPNA 3GUSA 3IXRA 2JZTA 4WBRD 3PGTA 1K0OA 4LMVA 2HI7A 4K2DA 3HVVA 1Z7PA 2X99A 1ACVA 1XIYA 1YJ6A 1HNBA 1BX9A 3BCKA 4ZXGA 1SD9A 1XWCA 3US3A 5DCGA 5IO2A 3M9JA 1PRXA 2A2SA 2MMZA 4HEA2 1EEMA 2H73A 1RK4A 3UVTA 3ZRDA 3MWHA 4GLTA 1J9BA 2B5YA 5G2ZA 5HFIA 2REMA 2HXKA 1ERTA 4YH2A 1JFUA 2H8LA 4HDEA 1SL2B 3PR8A 2HSHA 2I4AA 1T4ZA 2AB6A 1URMA 1PX7A 12GSA 3KCMA 2XBIA 4K8MA 3TKSE 3IR4A 2I1UA 3CMIA 1SYXA 1U87A 1V40A 3IOSA 5LD0A 2B7KA 2CZ3A 2MZCA 2NVLA 2HSYA 1WRYA 3DVWA 1S3CA 1CQGA 5A4WA 3TKQA 4WR5A 2P0GA 1T1VA 2DMLA 3CSIA 3GH6A 3CYNA 4GWRA 2DJ0A 2H0IA 2RM6A 1YEXA 6GSYA 3D0ZA 2PGTA 3M9KA 1GSQA 4IGJA 1O8WA 5G30A 2IIYA 4X43A 5CRDA 2P5QA 3GX8A 4NV2A 2C4JA 2MMAA 5IMFA 4F03A 3PH9A 3W8SA 1XWAA 2B6MA 3A2WA 3E9JB 1THOA 2VM1A 4GSNA 4Q5QA 2VD0A 4FYCA 4N30A 2DSAA 2V2GA 3HZ4A 2X8HA 4KGIA 1M9AA 3EURA 2OACA 1GSSA 2HLSA 2N5FA 4TN8A 2H74A 3FEUA 2DMMA 5COHA 1OC8A 3DIEA 4TOPA 4PQHA 2DJ3A 2GSQA 4PNFA 2XC2A 3HJPA 3KZQA 2YNXA 3QPMA 1TU7A 2JSZA 3FZ9A 4PX1A 5IMCA 2IFQB 2IY2A 2KOKA 4RUVA 5EVOA 1FB0A 3HDCA 5H5SA 2FWGA 1EZKA 4ZBAA 2R5GA 3QR6A 4V1Ag 2H71A 18GSA 5AGYA 22GSA 5GSSA 1TXXA 2H30A 2JZRA 2P31A 4OCFA 2BMXA 13GSA 4K7IA 3SWLA 3L78A 2RM5A 4EKZA 4G10A 4N10A 1K0NA 5ECRB 3VI7A 4G19A 2V1MA 4NHWA 2KHPA 3UMAA 4GQCA 4MH3A 1PSQA 4O32A 3MDKA 2FA4A 1QK8A 2PUKC 3Q19A 3O3TA 2HZFA 4MDCA 2FD3A 3HZ8A 1K0DA 3ERWA 4IVFA 3D4TA 4HJMA 4WETA 3FK8A 2IFQA 3FYGA 3L4NA 2CV4A 1QFNA 1F3BA 17GSA 2WCIA 2VM2A 1YEPA 1TRUA 3U5RE 3C1RA 1PA3A 1GUKA 3DMLA 2YWMA 4Q5FA 2PMTA 4ZILA 1MTCA 4EL1A
chains in the Genus database with same CATH superfamily
4BTWA 3GL5A 2VCVA 4X4JA 4GHOA 2AJQB 2L59A 3CPOA 1EWXA 3TKSC 1BEDA 1UGHI 4IW9A 5DQSA 2R41A 1CYUA 2CT6A 1TRWA 2M80A 3AGNA 2X8CA 3VPTA 1S3AA 1WP0A 1EG9B 2VAFA 3RNTA 3TRQA 6GSVA 4OO4A 3F3QA 3K63A 5KN1A 4EDZA 3GFKA 2OE1A 2W9PA 2I81A 3KGKA 4FMDA 3EHCA 3ERFA 3FY7A 3K8NA 1RRLA 1XW5A 3Q3FA 1OC3A 3IE3A 2OQEA 1MD4A 4RI6A 2Z76A 1VQQA 4ZB8A 3HD5A 1FA3A 4IKHA 3GKMA 2L5OA 2YFIB 2CAQA 3NIVA 2VD1A 5D9VA 2ML6A 3I6AA 1U8CB 3LMLA 3ROBA 1LU4A 2OCTA 6GSWA 1DE3A 1PKWA 5JCUA 3LW9A 2X8GA 3DMCA 1LNHA 3NV0B 1SPUA 4WHAA 5FWGA 4LA1A 3UOMA 5D8IA 1GD3A 1NDOB 4F82A 1UVZA 3ISOA 3FZ5A 3ME7A 1RGHA 1QVF2 4PQ1A 3GRXA 4WEYA 4LMWA 1JKGB 1V9WA 1IYHA 3PS8A 4KDUA 3DD3A 4GTUA 3LTBA 1R4YA 3G9BA 4BL7A 2ZDJA 2AAWA 2RLIA 2Y74A 2FGTA 3HKRA 1ZCPA 2ML5A 4N0ZA 4WFOA 1Z1SA 3BBYA 2CA8A 3C8EA 4WWUC 5D81A 1VQL3 5GAPD 5C04A 2FGXA 1VZZA 3CCS3 1G6YA 1N8QA 4JE1A 1ERWA 3G16A 3KH7A 3D4AA 4H86A 1UA5A 5DAKB 14GSA 3SBCA 4EV2A 2GZZA 2NBSA 2K3DA 2IUJA 1E2YA 4MZWA 2CKFB 5ELAA 4L8OA 1B8XA 1AR0A 1UCIA 3HCZA 3TKPA 3T8NA 1VQK3 2VLVA 1GSPA 5AYRB 2QEX3 3B7CA 4K90B 4I8BA 4J2FA 1IQXA 4N6V0 5ECNB 3TUEA 1Y6EA 1BRSA 2A4HA 3RHBA 5JWQB 1RTUA 3APQA 1ROVA 1XBSA 4AF2A 3X41A 2P05A 1SL1B 2XHFA 4KUNA 1IK3A 5ECPB 1B9YC 1PGTA 2E7PA 4QQ7A 2GSPA 2MBSA 1UC7A 1O7NB 3G7YA 3EBTA 2SARA 3DGYA 2C80A 1TUHA 2JL4A 4ZB6A 4DKIA 3ME8A 3UL6A 1K3LA 1M2BA 2XSOB 2CX3A 6GSTA 3EMXA 3EF8A 1ILOA 2H19A 1PFOA 2DIYA 2XF3A 2CWUA 1ZOFA 4POMA 4V2NA 2F4YA 1SK2A 4IQ1A 5ECOB 2OE0A 4IT7A 4RQXA 2C3NA 1QAFA 1KQS2 1STDA 3ZTLA 5A0OB 2H6YA 2IYJA 2YJHA 1E3RA 4ZIJA 1EA2A 1N9EA 3F4TA 3A2XA 2N5AA 1PX6A 4LLRA 1NWWA 4HOHA 2HYXA 1M2DA 4TR0A 5IMDA 1AC1A 4MLYA 1RHLA 2K18A 4PGTA 1QMAA 3F4SA 1Q9EA 4JBBA 4LL1B 3WGXA 1FZUA 3MSZA 1NM3A 1T2IA 4DSQA 1M2AA 3F7XA 4JRFA 1LOVA 3ZMKA 1HYFA 1O8XA 4HYZA 3S5CA 1T7PB 1M3JA 4JF8A 1HNAA 2VL9A 1TK8B 3F9UA 5GAND 1JRQA 3G6E3 3Q2PA 4G0IA 4EXJA 1VQ43 2INXA 3I43A 4K1UA 4HSCX 4MJCA 1AVKA 3FKAA 4N6MA 1OUNA 1BANA 4L0WA 2Z6BA 10GSA 4OVMA 1YY7A 9GSSA 2YCDA 5CRHA 3F8XA 5H5RA 3TJKA 4CCVA 2PN8A 2JQ5A 4AJ8A 4HI7A 3AHWA 1DVDA 1Z3EA 1LVNA 1WJKA 3N5OA 3GZRA 2YZHA 1YGEA 3LTCA 3NZNA 1Z6NA 5F06A 3BNBA 1KNGA 4BIRA 2ZCTA 3QDNA 3C71A 2YP6A 1KC84 5IMZA 2BIRA 3D79A 3K0ZA 1GP1A 5FHIA 4J5KA 4EUYA 5BMUA 3E0UA 1B4PA 4ACSA 2VLUA 3TOUA 5EPFA 3IV4A 4KX4A 2FNOA 2F86B 5HQPA 2KF6A 1A2MA 8CHOA 3FF0A 3LT9A 1O6JA 1EV4A 1V74A 3R3EA 4J5GA 4KCAA 1EQKA 4XS4A 1OHSA 3F6FA 2PZVA 4HJ2A 1JNQA 4ML1A 3HHVA 1V58A 2FY6A 1CEWI 1MDJA 1JZRA 5JPPA 3CCV3 2NTOA 3AY8A 2GT5A 5LCZA 4Q5NA 3CRTA 1EV9A 5B6MA 3F8UA 2PERA 2HMKB 1QQ2A 3V92A 4RZMA 2ZL8A 1WPIA 2I9WA 2B24B 1GSUA 2P38A 4GB5A 2F99A 2K54A 9RNTA 1N2AA 4GCIA 4MJEA 4Q5RA 4Z7XA 3QCPA 2Z7AA 1OE7A 1DYUA 3MAKA 5BIRA 3NM7A 3IMAB 1TK0B 4IJIA 4POBA 1DMQA 2KP2A 3BCIA 3N9JA 4K7OA 2EIRA 2LRNA 3A3TA 2R4VA 4X1UA 3M0FA 5CRWA 1O7UA 2F5MA 2FUG2 3CRUA 3GL3A 2LQQA 1F37A 2L5LA 2PBJA 3P8WA 1W5ZA 1JN5B 1UDII 3ZIJA 3QD9A 2FNQA 3V98A 3HX8A 3LXUX 4POKA 2IN3A 4FCJA 3L9UA 5IIZA 5HGRA 1TRPA 4AJ7A 4D73B 5JPUA 1VQM3 3HVNA 3NOFA 1I0XA 2L6CA 1BVIA 2YANA 2CZ2A 1R4CA 2XGNA 3B8LA 2BMRB 3KE7A 1YHQ3 2H0GA 2OQEC 2W0QA 1FVKA 2KLXA 2OOVA 4JR4A 2CVKA 2QC7A 3UBLA 4LYLB 1O73A 2UZ8A 2CAIA 5D73A 3MKIA 1LXEA 1QAKA 4K1FA 2PVQA 3BOAA 5ECQB 1B3SA 3H8QA 4JRRA 3TKRA 4HAAA 1SJ6A 5CRGA 4HM4B 1Q42A 1O7WB 1FW1A 5J41A 3WGEA 3DGNA 5CNWA 1OGZA 2YV9A 1I5GA 1I2EA 1A8YA 1A23A 4FH8A 4HM6B 1PU4A 3BD2A 3MYTA 1X1UA 1XW6A 1OF5A 4ML6A 2P0XA 1RLSA 4LMIA 1TFOA 4EW5A 1SD8A 1GY5A 4X0XA 5KN2A 4MF5A 1SU9A 3KP8A 1V98A 1WMJA 1AUCA 3ZL5A 4Z2UA 3I553 2HRNA 1QGVA 2H1GA 3EU3A 1ASKA 3FCSB 3NBJA 1H75A 5G5FA 1TKDB 4QL7A 3EINA 2RUEA 1NSWA 1RCLA 1S3RA 2VCZA 1SKWB 5ENUA 1ABAA 2C0DA 1EP8A 1XW9A 2C1YA 1IV7A 4N3VA 3NQYA 2KF5A 2LJKA 2OOVC 3KIJA 3WHOA 2H0HA 1J2BA 2CVDA 4BWSA 5AYSC 3LGCA 2K0MA 4K1VA 4BTYA 4ZBDA 3CCL3 2YPMA 4I4KA 1BRKA 4MZCA 2DLXA 1B20A 3KMOA 1AW9A 4MF7A 4HU7A 4YAPA 2QKEA 1XWGA 2W04A 4K9ZA 1OYJA 1X9WB 1TRSA 3SEDA 1ZL9A 4G0LA 1GWCA 2E2GA 4EXRA 3JUPA 2DJ1A 2ZUPA 2YN1A 3FHKA 4E8EA 1VQ53 2YWOA 1GTUA 3KTBA 1MD3A 3M8NA 3LYKA 1R7HA 1OCVA 3Q18A 2GQLA 3LFLA 1RGGA 2O85A 2HMNB 1S3DA 1RN7A 2GSSA 2WRTA 2R3XA 3EU4A 1RN1A 2HRFA 4KA0A 4AEQA 1WIKA 3VF1A 1XOAA 4JU5A 3LORA 2JDIH 6GSPA 2YZUA 4MNNA 3LOYA 4PUFC 4N6LA 1K28A 5G31A 3TRXA 2O8VB 1RGEA 3I0YA 2F56A 1W7CA 2F8AA 3DYRA 3CME3 1XPVA 1XFLA 4PNGA 4STDA 8GSSA 4MZBA 5F8BA 5EEOA 3L9SA 3QMXA 3QFAC 1BQ7A 4V2MA 1GS3A 1UI7A 3APSA 1OVNA 2H72A 1KSIA 1JLVA 1ZYEA 3VWVA 4NHZA 1OC9A 1X9MB 1S723 3FZAA 1G02A 3IC4A 3CD63 3B4PA 3K5TA 1EUIC 3J7Yd 5HOHA 1Z9HA 1JZOA 2VCTA 3A5IA 5AIVA 2JU5A 1FGRA 1YJW3 1O85A 4HUAA 16GSA 4GSSA 4DEJA 1N5PA 1W6GA 2H6ZA 6RNTA 4NAXA 2GT6A 3HK4A 3G8ZA 2X49A 2WULA 3KSPA 3IJEB 1BNEA 1HD2A 2YV7A 3C1SA 5D93A 2NPBA 3NV0A 3MIXA 2LRCA 1TU8A 3S67A 1GMRA 5JWOB 4QWTA 4BA7A 5J5NA 4H61A 2GEYA 3Q90A 3AGOA 1QMVA 5JCGA 1XWKA 5A4UA 1UGIA 1BU4A 1WMPA 5ABRA 5IERA 3BJ5A 5DDLA 1FOVA 3ED3A 1UN2A 2HRAA 2CW9A 2CWTA 1HKXA 4FYUA 3F3RA 2QGVA 2V6KA 4XS1A 2YFLB 5J4UA 5IPHA 5B6NA 4ECJA 2ALBA 1Q40B 3EE1A 3UAPA 2K8SA 1GOVA 4OFMA 4N6UA 1S5AA 2W6JH 4CHSA 1BAOA 1BRGA 5D9XA 1R4WA 3LSZA 1PFPA 1W02A 2IMIA 1SKSB 4ZL9A 3L0RA 1Q40A 2XFSA 3ZIVA 1A8LA 3X42A 1QUWA 2TRCP 4KAEA 1J08A 2DKHA 4MMMA 3B4OA 2OBKA 3DKSA 3IA1A 5L71A 1PN9A 1T5YA 2EIQA 3CSJA 1RW1A 2VL2A 4AKYA 1FVJA 3EYTA 4AJ6A 1AY7A 1I2GA 1M7TA 3E99A 3APOA 5ID2A 1N8R4 2QA43 3N8BA 4YQUA 3Q1CA 4Z2TA 2HFDA 7STDA 3CC43 4GRFA 3HY2A 3GWRA 5AEUB 3G4S3 4TR1B 1BSAA 1B2SA 4XTSA 5E59A 1BNGA 2C0FA 2OBIA 3ZVJA 4N11A 5DAKA 2DC5A 3WOFB 2LNTA 4HU9A 1PYLA 3D22A 3OX9A 3GMFA 3DXBA 1WNHA 1NB3I 3Q74A 3FZ4A 4LEHA 3QOUA 4F0CA 3W6GA 4POLA 3ALAA 1W00A 3S9FA 2O7KA 3VSYA 1GOYA 2VL3A 1EGRA 3ZG5A 3IPZA 2CC3A 2BTOT 3KM6A 3F4RA 3VLNA 2W9QA 2BO9B 1PL1A 4GF0A 5CYYA 2G2QA 3X3ZA 2OJLA 2P5RA 1F2EA 4P3YB 4WKWA 3EX9A 4O2HA 4KNDA 2W56B 3FF2A 1YJN3 4PXOA 2H1DA 2V1LA 1F6MC 1YZXA 4WXTA 3S27A 3DWVA 1BJXA 2F51A 2LEGA 1RSNA 4L7KA 5DCHA 1I2FA 4L5OA 4TR3A 4WR4A 4CW9A 3O6TA 2C4BA 3KH9A 2OADA 3ZMLA 3NBBA 2KRTA 1BNJA 4X2OA 2GSTA 3TJGA 3D21A 4Q53A 3KMNA 4OUQA 1W2ZA 5DRVA 3NUVA 5BVBA 2LJAA 3LXZA 3MG1A 3FR6A 1ML6A 1O7MB 4FMAA 2QIYA 1JHBA 1K9M4 1LRAA 2Z77A 3MPHA 3FG1A 1I70A 1MWSA 1A24A 1Y4KA 3BNEA 1JJ22 4IELA 5B8BA 2XEPA 2GTUA 1USBA 5IG5A 3G0KA 1A2JA 5G2GA 2IJYA 2W56A 1RKYA 1IVVA 4IS0A 1B2MA 1ISKA 1HNCA 2CH9A 1XOBA 2GZPA 3F6DA 5CP1A 3RHCA 2P09A 4DSRA 2FWFA 4AKZA 4PQIA 2MMNA 2VUPA 4HS1A 2WJUA 3DEXA 2MMOA 4J57E 3IAS2 1U88A 1A0RP 2PU9C 5ECIB 1X1YA 1DVCA 1B21A 1MNLA 1K0CA 3CSHA 3MG3A 1TTZA 3M8CA 1I8VA 5DALB 1IQYA 3MYDA 5C00A 1BNFA 1E6BA 4K7NA 4TXOA 2XBQA 3ERGA 3U97A 2CFLA 1NJI4 1DMNA 3CNMA 4O3VA 4KF9A 4EBGA 4OFNA 2H1BA 4TXOB 5IF6A 1HQOA 2FA8A 4YKFA 1BG5A 1SK0A 1UUWB 3GYKA 4Z2RA 1N8JA 2LTKA 3F40A 5INYA 2GSRA 1SK1A 1GH2A 2QSIA 3IDVA 1ERVA 3NXJA 4FIWA 20GSA 1D6UA 2J8XB 1GTIA 1M9BA 2WZ9A 2FWHA 3PZWA 5EL8A 1AQWA 2KP1A 3FW2A 1M0UA 3ECFA 4BWQA 3FZWA 5KP3A 1M99A 2O89A 5I97A 1U3AA 6GSSA 1C54A 5EY6A 4EC0A 4IBPA 2KUCA 4L8PA 3KJYA 1ZZYA 2CX4A 4JEDA 1M1XB 1NW2A 1ZX2A 3NHXA 2XPDA 5IOWA 2O9UX 2F8FA 4FR9A 2R0GA 4EC6A 5BU4A 2HNLA 1VQ73 1TI3A 4J56E 1YVSA 3TRPA 2F98A 2PPTA 5D82A 1OPYA 4ULXA 4FCZA 4F2IA 4IPBA 2W03A 4MJBA 2Z9SA 3A2VA 4HQSA 1DSBA 3I69A 1RQMA 3OV4A 2CWVA 1GNEA 1LBKA 2J23A 3A5WA 3GN3A 5STDA 4KFEA 4N0VA 4NMUA 3UB1A 5AISA 5LC7A 3CTFA 1HU9A 2RNTA 4TR1A 4EYCA 1G6WA 1Z6MA 2D1WA 1OH0A 2L4QA 3GKNA 1BAYA 5HR0A 2GGTA 5DJLA 2LNSA 1US1A 1YF0A 1B2UA 1GULA 2FWEA 3RPPA 4LZIA 2IMFA 2IA7A 2RUFA 1NHOA 4F0BA 1AXDA 2C8UA 4NWYA 2HZEB 1RGAA 3VWUA 3IBHA 1XZOA 1FUWA 3W8JA 3T8UA 4EF0A 3LZAA 2F5WA 1ROAA 2X4AA 1BRIA 1SIIA 1LOYA 3CPW2 5GSTA 5KP1A 4WBJA 5LNKe 4MMZB 4MJDA 4PEJA 2YJ7A 1FO5A 4KCEA 3WT1A 1PD21 5IG0A 4I2UA 1D6ZA 1QALA 4E8HA 5AN1A 1C72A 3VGNA 2JACA 1KD14 3RAZA 1JV2B 1ZO2A 4PUAA 5BXQA 2R2JA 4OWYA 1AQVA 2WGOA 1LJRA 3TJFA 4BPYA 3D5GA 1A67A 2DJKA 3GH9A 5J9CA 4HOJA 2E2MA 2HMJB 5KN0A 5CLKA 3WA3A 3SOAA 1NB5I 1O81A 4GXZA 2K8VA 1KTEA 3EVIA 3OR5A 1YIT3 4HJLB 2LQOA 4XS6A 3STDA 5IQYA 2A4VA 2DJJA 2TIRA 2WOHA 1M1K4 3EWLA 5ELGA 3MG2A 4K61A 1RGFA 2EC4A 1CQHA 1GMPA 5M1AA 5EQLA 4XDWA 1L5GB 3JUOA 3X40A 5E4WA 1U5OA 4K5RA 5ECHB 2RCDA 2J9HA 6GSXA 4ORLA 1YIJ3 4OCEA 2BHMA 4NREA 5ECLB 3N54B 1GUMA 2C0GA 3QAVA 3LWAA 1K8A4 1SJIA 5J3RA 1YQ1A 1OGXA 3CMA3 3GZYB 4DSSA 3D6IA 4NPBA 4HZ4A 5IO0A 2AADA 3GAXA 1EP7A 1V2AA 4DSSB 1MWUA 3X3YA 2DJ2A 1GRXA 1YVBI 3URPA 2MYGA 2C3QA 5HFGA 2XPEA 2AUVA 2Q07A 3KFQC 2ES7A 3AHSA 2ON5A 1CH0A 1RNTA 1I3IA 2GXFA 3TJBA 2LJRA 3Q6OA 4ECCA 4IJ3A 1RGLA 3N9HA 1GTAA 1ULIB 1TP9A 4RQRA 1BSEA 2FXTA 1M9GA 4KE3A 1VQP3 4IN0A 5M19A 3PGBA 1W2B2 3AMOB 1Q824 4O5UA 3TCOA 4CDOA 4K0NA 4CY6A 1RDSA 1GLQA 3CC73 4H3UA 1QXHA 4OFTA 4ID0A 1FAAA 1XXUA 1B4QA 3KZTA 5IOXA 2GLRA 3C73A 4MPGA 2IMKA 2C0EA 2H01A 3GHAA 3NQZA 4XDVA 1KEBA 4G0KA 1OKDA 1DUGA 3KP9A 1WTHA 1F8NA 1EKMA 3HVSA 3HA9A 1UUVB 1THXA 3FKFA 4MMYB 1BRNL 3CCM3 4MPFA 1FHEA 4EDYA 4ICYA 1TDIA 1W4VA 2E2TA 1LOXA 2IL3A 1XCCA 1A2VA 4K5SA 1X0RA 4WF5A 4BL7B 1C7HA 2HT9A 3CTGA 2RFRA 2KAAA 3QFBC 3GURA 5A5KA 1VF4A 1VRSD 5ECKB 2IMJA 4KB3A 1MDIA 3VWWA 3H3HA 1N5HA 5DQYA 1K0AA 3EPTA 1FYSA 3EC3A 2X64A 1UCLA 2E2VA 3UVHA 3K9MC 2H70A 6STDA 4CJNA 3GKXA 3F8HA 2M46A 5GSPA 3GNJA 2AV4A 2I9HA 5AIXA 1AIUA 4XHMA 3HJMA 5AEWB 3TJJA 1OF5B 1RGCA 3LT8A 1FOHA 1W6YA 1EOGA 4MF6A 2BT3A 3RDWA 3D5IA 3EBYA 3MNGA 2OA7A 1Y25A 1BSCA 3DH2A 3F0IA 4IP1A 1PKZA 2WGRA 3C7MA 5AI1A 1X5CA 5IMAA 3A76A 3S28A 3EQQB 1A0FA 2DIZA 4TVEA 3OWYA 1V57A 2WB9A 5IPGA 1BRJA 2GBXB 1ON4A 1CYVA 1GSFA 3PINA 1B2ZA 1VQ83 3EMPA 5GZZB 1T2HA 5ECSA 1BSBA 2B7JA 1SENA 2Y73A 3U1WA 3JUNA 1GSDA 2FHEA 2JZSA 3GRDA 1Z7RA 1YKAA 2CK3H 1WWJA 2I3YA 5IMVA 2F9SA 5G1KA 1F3AA 2XGLA 2HSMA 4KDXA 3H4KA 8RNTA 19GSA 3VWXA 1HYUA 3UL3A 1G96A 3WYWA 2A2RA 1J0FA 4N6NB 3HJOA 4KSOA 3U6VA 3FG3A 3TGZA 3CXGA 1JZDA 4XIHA 4BVYA 1B9XC 4OMVA 1W01A 3PXMA 1W89A 5DALA 3KEBA 3BNDA 4ZL8A 5IEOA 2IMEA 1IU7A 1TOFA 3H79A 1YKCA 4ZM8A 1B48A 2H6XA 3LEFA 1GSEA 2SBLA 1GTBA 2L57A 3FR9A 4AGSA 1TIJA 1WQLB 4G9HA 2STDA 4BVXA 3GSPA 2VL2C 4R9LA 1SKRB 1A90A 1U6TA 2G0FA 2O3OA 1K0MA 3KD0A 1MOLA 3F7SA 5JCWA 4KH7A 2BJXA 5HR3A 4WYKB 2BU4A 3MWZA 4KW6A 1GNWA 2V41A 7GSPA 2ZA4A 2B3SA 2B1LA 5D9TA 4ILFA 2QA1A 4FQUA 3GV1A 4V2LA 2ZNMA 1H4OA 3IC8A 1T00A 1VQN3 3QAGA 3GSSA 4LGQA 1GY6A 2R6KA 5CAXA 2H75A 4HQZA 1K0BA 3VK9A 1A2KA 4ZB9A 11GSA 1TJDA 1U3IA 1ZYNA 5KEJA 4HZBB 3DGQA 1LNIA 1AV4A 1BRHA 4R4KA 2AYTA 2LV3A 3M1GA 3D9RA 5TGNA 1K3OA 2C3TA 1DETA 1KWIA 4JZQA 2R4IA 5G5EA 3DGMA 5IW9A 3GTUA 1RNBA 2JSYA 1SL0B 1GL8A 2VOCA 4J9AA 3CCE3 3L9VA 1NO3A 1TTOA 3UNLA 2C11A 4GQFA 4FMCA 2VCWA 4V1Ap 3UJMA 3O76A 3CNXA 1X1WA 2YOIA 1WOUA 1JBSA 2P0MA 1PL2A 5FT3A 3VPQA 3ZREA 1YI23 1AAZA 4L0UA 3JVCA 1OC9B 4PURA 2M7OA 3VFIA 3TB2A 2OTJ3 4NV5A 3UIWA 2L1SA 2IPAA 5ECMB 1XVQA 5CF1A 2HMOB 5D96A 2WGQA 3H1NA 1VF3A 3VI5A 4TXVA 3WR2A 2F3MA 5HFKA 2QGUA 2K6VA 1BUJA 3TOTA 3D4MA 2RBIA 3SLUA 2HZEA 2CHCA 5B7CA 5F05A 3WDGB 1Q4JA 3LYPA 4BTXA 4KFFA 3GZBA 4MMXB 5F07A 3V1WA 3H93A 2GQKA 1LOWA 5DVBA 1T4YA 4L5LA 3I9V2 1RMSA 3WGDA 1RRHA 1W4NA 3CBUA 5CXOA 1DBYA 1MGWA 1PMTA 2YFJB 1N9JA 2H66A 3KSED 4R80A 5F0GA 2PWJA 4FMBA 1G7OA 1PY3A 3UL5A 1SIHA 4FYBA 2VCXA 1SARA 2DBCA 4TR4A 1TRQA 1X5DA 4O92A 1R5PA 2RGQA 4XRDA 5J9BA 1T3BA 2WOFA 2HE3A 2RSXA 2VLTA 3IAM2 1JLWA 1Q98A 3LXTA 2H76A 5IG4A 1QJGA 2CG0A 2LUSA 3NX0A 1Q814 1IYYA 2VIMA 1GY7A 1RJOA 5RNTA 1JB5A 1T8EB 1YDKA 4HVNA 1FUTA 2CFDA 2XFTA 1ZMAA 2XR8B 4XM4A 4MA9A 3LTDA 3LYGA 4HZ9B 5KOXA 3SX1A 4GSPA 3D5JA 4N6OB 1WMOA 5CO3A 3FRCA 1A2PA 2CX1A 4EE0A 3ZYWA 4IP6A 3M3MA 5KP4A 1JBTA 2V32A 1WE0A 1IQ8A 2L6DA 1DE2A 3WODG 4KSMA 3LG6A 2XH9A 4HM0B 1ZYQB 1OHOA 5KN3A 3IK7A 1TRVA 4EO3A 3LQ7A 4MK3A 5B8AA 3E3EA 1VF2A 1W6CA 3GTUB 1BNSA 4K2XA 4IQAA 1Q7Y4 2GEXA 3R2QA 3NBRA 3VURA 4ECBA 2O87A 4YAVA 6GSUA 2K9FA 5DJMA 4TRXA 3GSTA 4BVYB 3KN4A 2MBTA 3KTLA 2VCQA 3JCML 1AQXA 1GOUA 2GU3A 5D9WA 3ZLPA 4ECIA 2GZYA 2LKUA 4O5QA 1JB2A 3BB9A 3ZFBA 5HR2A 5FGOA 3IHQA 3LH4A 1FW7A 4GSTA 1MGRA 3IK9A 2D2ZA 1FG4A 1IYIA 2WDUA 7RNTA 3TKSA 1GLPA 2CQ9A 2QA2A 3A5EA 2RIIA 3O8YA 7GSSA 4RNYA 4XBXA 5DBQA 4XRAA 4WYKA 4WP5A 3DVXA 2PVOC 3EE2A 1TI1A 2IUKA 2PNCA 4F9ZA 2JADA 1AVLA 4RI7A 3LJRA 2VO4A 4DVCA 3SVAA 3G7JA 3FMWA 4XCSA 4G2EA 1SYRA 1LQMB 2C10A 2UUGC 3DM8A 5IM9A 3UARA 4A5PA 1JBRA 3HVXA 2UX0A 1FUSA 1KBNA 3EC9A 2EIOA 2AHEA 4U13A 2LRTA 4I6XA 2H1AA 5IEPA 2OTL3 1XG8A 3WD6A 4NXIA 4YQVA 1FGQA 4HBRA 4JR6A 3KXOA 3T0UA 4BIKA 4XBTA 1O7HB 2NDOA 1TW9A 1TK5B 1BGSA 3BNCA 2ON7A 1G7EA 3L0HA 4LL4B 5JWRB 3FLJA 1ZGNA 1OE8A 4MJAA 4IIAA 3ZFLA 1OKTA 1TU5A 4TKYA 2CFWA 4MP4A 4TX4A 1IVXA 2GBWB 1A2LA 3GA4A 3CXC2 1ERUA 1FB6A 5IG3A 1X9SB 1BNIA 2LQVA 1VGLA 1EEJA 4EVMA 3CCR3 1IT7A 2V6OA 4ISDA 4K0GA 1WMNA 4KFDA 1X5EA 1I3FA 3P90A 2GQMA 1BYEA 1Z5YE 1ST9A 1NHYA 1VQ63 4OD7A 2HRKA 3DUKA 4MH2A 3OWUA 3GIXA 1PQNA 3RBTA 5CREA 4I97A 1I0VA 2LS5A 2BMOB 2M72A 3PPUA 3GX0A 4ZBBA 1YF1A 5ELJA 2IWTA 1EOHA 3ZVJD 5A4VA 3J7Yk 2OE3A 4HM1B 4I5QA 5BRTA 4OO5A 2B5XA 3WT2A 3DGLA 4TW5A 3J7Yb 3WOEB 1I9DA 1JZWA 2GDRA 1O7PB 4QL9A 2KF4A 4BU4A 4ZL7A 1MEKA 1SJZA 1UI8A 3UJ1A 5H5QA 1VF1A 3DRNA 3ZITA 4IHUA 3MHEA 2OWPA 3I563 3HXSA 1DE1A 1Q7HA 5HR1A 4WF4A 1ZGXA 3P2AA 2N5BA 2IMDA 4PTSA 3FH1A 3G7IA 1STFI 2B5EA 2FCHA 1UUGB 3RGRA 3OW22 3UBKA 3PCRA 2LSTA 5FW5A 3HI7A 1JB4A 4YQMA 1F9MA 5CK6A 2XSHB 4OK0A 1R5AA 2L4CA 4D73A 2YWNA 3TDGA 3QAWA 3S29A 1R26A 3IRAA 3GKKA 4KDYA 4O7HA 4K6XA 2GS3A 4FO5A 2A2PA 4XS4B 4MABA 3HIIA 5G1LA 5D83A 3SYUA 5AIFA 3HYPA 2R37A 4HZ2A 2TRXA 4EIPA 2YWIA 3CCQ3 1GUHA 1XVWA 2B1KA 1G0TA 1EGOA 1BIRA 1FGMA 2GVPA 4XBYA 4CDLA 4L8EA 1OAZA 1XWBA 3DY5A 1GSYA 3EN1B 1UCJA 2BMQB 4I2TA 4MCUA 2WS2A 3ZZXA 2HOHA 3EJVA 4HM5B 2FLSA 3SXXA 4GL6A 5AIHA 5DREA 2E0QA 2OKAA 5ID2B 2KF3A 2WFCA 1BSDA 3F63A 1SJWA 3FR3A 4O5RA 1MDKA 3EB8A 3P7XA 4O8SA 3UEMA 1K3YA 2CVBA 3RPNA 4HKVB 3GUSA 1IVWA 3IXRA 1IDPA 2UGIA 2KXGA 1PN0A 3D3LA 2JZTA 2A15A 4WBRD 1JKGA 3PGTA 1K0OA 2B1XB 4LMVA 1CQSA 4BVXB 3BIRA 2HI7A 5IENA 3HVVA 4K2DA 1NNVA 3X3XA 1Z7PA 2X99A 1NU3A 2BNGA 3GZXB 1MWTA 1ACVA 1XIYA 1YJ6A 1HNBA 1BX9A 3BCKA 4ZXGA 1SD9A 4NHFA 5M18A 1XWCA 4USSA 5DCGA 3US3A 5IO2A 1OHPA 3M9JA 1ZS7A 1PRXA 2A2SA 3CC23 2MMZA 4HEA2 2AAEA 1EEMA 2MC8A 4HM3B 2H73A 1RK4A 3UVTA 3ZFZA 3ZRDA 3MWHA 4GLTA 1J9BA 3ER7A 4RNZA 2B5YA 3DZLA 5G2ZA 1M904 5HFIA 3SOYA 1RGKA 2MF7A 2REMA 1X1XA 2HXKA 1BOXA 1Q864 3EN8A 2CFGA 1ERTA 4MEIA 4YH2A 1JFUA 3HOHA 4G1MB 2H8LA 4HDEA 4X2HA 1SL2B 1IV9A 4LSOA 3PR8A 2HSHA 2I4AA 1IT8A 1T4ZA 2AB6A 1URMA 1IVUA 1PX7A 12GSA 3KCMA 4O02B 2XBIA 1UCKA 1AQZA 4K8MA 1RCKA 3TKSE 3IR4A 2E2UA 2I1UA 4FCMA 3CMIA 3H51A 3IHGA 1SYXA 1BNRA 1U87A 1V40A 3IOSA 5LD0A 3RDEA 2B7KA 2CZ3A 2MZCA 1TP6A 2NVLA 2HSYA 5ELUA 3OWSA 1WRYA 3DVWA 1S3CA 1GYBA 1YJ93 1CQGA 5A4WA 4J8TA 3TKQA 4WR5A 2P0GA 1SQWA 1T1VA 2DMLA 4XB5A 3CSIA 1FGOA 3GH6A 3CYNA 4GWRA 4RBNA 2HMLB 4EV5A 2R0CA 4R1KA 2DJ0A 2H0IA 1ULJB 2WO0A 1GD4A 1K734 2RM6A 1YEXA 6GSYA 3QK9A 2L4VA 4RNTA 3D0ZA 2PGTA 1OACA 3M9KA 1GSQA 4IGJA 2CX0A 1LQGC 1O8WA 5LC6A 3WA2X 5G30A 2IIYA 4X43A 2W2CA 2GU1A 3PYJA 1D6YA 5CRDA 1M3IA 2P5QA 3GX8A 4NV2A 2C4JA 4BL2A 3KKGA 2MMAA 3CU3A 5IMFA 4F03A 2CFKA 1HZ1A 3CCU3 3PH9A 2D42A 3W8SA 1XWAA 2B6MA 3JUQA 3A2WA 3E9JB 1GMQA 1YGWA 4KVHA 3WMDA 3V99A 1THOA 2VM1A 4GSNA 4Q5QA 2VD0A 2YX9A 4FYCA 4N30A 2DSAA 2V2GA 3HZ4A 2X8HA 4KGIA 1E3VA 1M9AA 3EURA 3NM2A 2OACA 3G713 1VQ93 1GSSA 2HLSA 2N5FA 4TN8A 1YNVX 3AMOA 2H74A 2KCDA 3FEUA 2DMMA 1OC8A 5COHA 2XRXB 3DIEA 4TOPA 4PQHA 2DJ3A 3FGYA 2GSQA 3ZG0A 4HM8B 4KT3B 4PNFA 4CPKA 2XC2A 3HJPA 3KZQA 2YNXA 3QPMA 1TU7A 2JSZA 3BLZA 3FZ9A 4PX1A 3HZPA 5IMCA 3K7CA 3IPTA 2IFQB 2IY2A 2KOKA 4RUVA 1E97A 3DGOA 5EVOA 2HMMB 1FB0A 3HDCA 3QRDA 5H5SA 2FWGA 3F14A 5AIGA 1EZKA 4R9KA 4ZBAA 2R5GA 4HM7B 3QR6A 4V1Ag 2H71A 1DMMA 18GSA 2CG1A 5AGYA 22GSA 5GSSA 1TXXA 2H30A 2JZRA 2P31A 4OCFA 2BMXA 13GSA 1B27A 5CF2A 4K7IA 3SWLA 3L78A 3PCSA 2RM5A 4EKZA 4KZ1A 4G10A 1RN4A 5EVHA 2LYXA 4N10A 1O7GB 1K0NA 5ECRB 3VI7A 2R0PA 4G19A 2V1MA 3HIGA 4NHWA 5AIIA 3FG4A 2KHPA 3UMAA 4GQCA 3KIIA 4MH3A 1PSQA 4O32A 3MDKA 1ZYPA 2FA4A 3CCJ3 1K41A 1QK8A 2DKIA 2PUKC 2ZHXB 3CQFA 3Q19A 3O3TA 3MSOA 1B2XA 1UW1A 2HZFA 1QVG2 3JUMA 4BL3A 4MDCA 2FD3A 3HZ8A 1K0DA 3ERWA 4IVFA 3KCHA 3D4TA 4YKGA 3RGAA 3F9SA 4HJMA 4WETA 5KOWA 3FK8A 2IFQA 3FYGA 3L4NA 2CV4A 1QFNA 3FSDA 1F3BA 17GSA 2WCIA 1TFKA 3DXOA 1FGTA 2VM2A 1YEPA 1JN5A 1BUQA 5JBSA 3BU4A 1TRUA 3OXAA 1VQO3 3U5RE 3C1RA 1PA3A 1GUKA 3DMLA 2CIUA 2YWMA 4Q5FA 2PMTA 3LTAA 4ZILA 4HM2B 1MTCA 4CY8A 4N6TA 1MWRA 4EIQA 4EL1A
chains in the Genus database with same CATH topology
3GL5A 4X4JA 2VCVA 2AJQB 2L59A 1EWXA 3TKSC 1BEDA 4IW9A 5DQSA 2CT6A 1TRWA 2M80A 2X8CA 3VPTA 1S3AA 1WP0A 2VAFA 3TRQA 6GSVA 4OO4A 3F3QA 5KN1A 4EDZA 3GFKA 2OE1A 2I81A 3KGKA 3ERFA 3FY7A 3K8NA 1XW5A 1OC3A 3IE3A 1MD4A 4RI6A 4ZB8A 3HD5A 4IKHA 3GKMA 2L5OA 2CAQA 3NIVA 2VD1A 5D9VA 3I6AA 1LU4A 6GSWA 1PKWA 5JCUA 3LW9A 2X8GA 5FWGA 4LA1A 3UOMA 5D8IA 4F82A 1UVZA 3ISOA 3FZ5A 3ME7A 4PQ1A 3GRXA 4WEYA 4LMWA 1V9WA 1IYHA 4KDUA 3DD3A 4GTUA 3G9BA 4BL7A 2AAWA 2RLIA 3HKRA 1ZCPA 4N0ZA 3C8EA 3BBYA 2CA8A 5GAPD 5C04A 2FGXA 1G6YA 4JE1A 1ERWA 3KH7A 5DAKB 4H86A 1UA5A 14GSA 3SBCA 2GZZA 2NBSA 1E2YA 4MZWA 5ELAA 1B8XA 3HCZA 3TKPA 2VLVA 4I8BA 4J2FA 5ECNB 3TUEA 1Y6EA 2A4HA 3RHBA 5JWQB 3APQA 1XBSA 4AF2A 1SL1B 2XHFA 4KUNA 5ECPB 1B9YC 1PGTA 2E7PA 4QQ7A 2MBSA 1UC7A 3G7YA 2C80A 4ZB6A 2JL4A 3ME8A 1K3LA 1M2BA 2CX3A 6GSTA 3EMXA 1ILOA 2H19A 2DIYA 4POMA 1ZOFA 4V2NA 1SK2A 4IQ1A 5ECOB 2OE0A 4RQXA 2C3NA 3ZTLA 2H6YA 2IYJA 2YJHA 4ZIJA 3F4TA 3A2XA 2N5AA 1PX6A 4LLRA 2HYXA 1M2DA 4TR0A 5IMDA 1AC1A 4MLYA 2K18A 4PGTA 3F4SA 4JBBA 4LL1B 3WGXA 3MSZA 1NM3A 4DSQA 1M2AA 3ZMKA 1O8XA 1T7PB 1HNAA 2VL9A 1TK8B 3F9UA 5GAND 4G0IA 4EXJA 3I43A 4MJCA 4L0WA 10GSA 1YY7A 9GSSA 2YCDA 5CRHA 5H5RA 3TJKA 2PN8A 4AJ8A 4HI7A 1Z3EA 1WJKA 3N5OA 2YZHA 3NZNA 1Z6NA 5F06A 1KNGA 2ZCTA 3QDNA 3C71A 2YP6A 5IMZA 1GP1A 5FHIA 4EUYA 5BMUA 3E0UA 1B4PA 4ACSA 2VLUA 3TOUA 5EPFA 3IV4A 4KX4A 2FNOA 5HQPA 1A2MA 1O6JA 1EV4A 3R3EA 4KCAA 4XS4A 3F6FA 4HJ2A 4ML1A 3HHVA 1V58A 2FY6A 1MDJA 1JZRA 2NTOA 3AY8A 2GT5A 5LCZA 4Q5NA 3CRTA 1EV9A 5B6MA 3F8UA 2PERA 1QQ2A 1WPIA 1GSUA 1N2AA 4GCIA 4MJEA 4Q5RA 4Z7XA 3QCPA 1OE7A 3MAKA 1TK0B 4IJIA 4POBA 2KP2A 3BCIA 3N9JA 4K7OA 2EIRA 2LRNA 3A3TA 2R4VA 4X1UA 3M0FA 5CRWA 1O7UA 2FUG2 3CRUA 3GL3A 2LQQA 1F37A 2L5LA 2PBJA 3P8WA 3ZIJA 3QD9A 4POKA 2IN3A 3L9UA 5IIZA 4AJ7A 4D73B 3NOFA 2L6CA 2YANA 2CZ2A 2H0GA 1FVKA 2KLXA 4JR4A 2CVKA 2QC7A 3UBLA 1O73A 2UZ8A 2CAIA 5D73A 4K1FA 2PVQA 3BOAA 5ECQB 3H8QA 4JRRA 3TKRA 1SJ6A 5CRGA 1FW1A 5J41A 3WGEA 5CNWA 2YV9A 1I5GA 1A8YA 1A23A 4FH8A 3BD2A 1XW6A 4ML6A 1SD8A 4X0XA 5KN2A 4MF5A 1SU9A 3KP8A 1V98A 1WMJA 1AUCA 3ZL5A 4Z2UA 2HRNA 1QGVA 2H1GA 3EU3A 1H75A 5G5FA 1TKDB 4QL7A 3EINA 2RUEA 1NSWA 2VCZA 1SKWB 5ENUA 1ABAA 2C0DA 1EP8A 1XW9A 2C1YA 2LJKA 3KIJA 2H0HA 2CVDA 4BWSA 3LGCA 4ZBDA 2YPMA 4MZCA 2DLXA 3KMOA 1AW9A 4MF7A 4HU7A 4YAPA 2QKEA 1XWGA 4K9ZA 1OYJA 1X9WB 1TRSA 1ZL9A 4G0LA 1GWCA 2E2GA 2DJ1A 2ZUPA 2YN1A 3FHKA 4E8EA 2YWOA 1GTUA 3KTBA 1MD3A 3M8NA 3LYKA 1R7HA 3Q18A 2GQLA 3LFLA 2O85A 1S3DA 2GSSA 2WRTA 2R3XA 3EU4A 2HRFA 4KA0A 1WIKA 1XOAA 4JU5A 3LORA 2YZUA 4MNNA 4PUFC 5G31A 3TRXA 2O8VB 2F8AA 3DYRA 1XPVA 1XFLA 4PNGA 8GSSA 4MZBA 5F8BA 3L9SA 3QMXA 3QFAC 1BQ7A 4V2MA 3APSA 1OVNA 2H72A 1JLVA 1ZYEA 3VWVA 4NHZA 1OC9A 1X9MB 3FZAA 3IC4A 1Z9HA 2VCTA 3A5IA 1JZOA 5AIVA 2JU5A 1O85A 4HUAA 16GSA 4GSSA 4DEJA 2H6ZA 4NAXA 2GT6A 2X49A 2WULA 1HD2A 2YV7A 3C1SA 5D93A 2NPBA 3MIXA 2LRCA 1TU8A 5JWOB 4BA7A 5J5NA 1QMVA 5JCGA 1XWKA 5A4UA 5ABRA 3BJ5A 5DDLA 1FOVA 3ED3A 1UN2A 2HRAA 4FYUA 3F3RA 2QGVA 2V6KA 4XS1A 5J4UA 5IPHA 5B6NA 4ECJA 2ALBA 3UAPA 2K8SA 4OFMA 4CHSA 5D9XA 1R4WA 3LSZA 2IMIA 1SKSB 4ZL9A 3ZIVA 1A8LA 1QUWA 2TRCP 4KAEA 1J08A 2DKHA 4MMMA 2OBKA 3DKSA 3IA1A 5L71A 1PN9A 2EIQA 3CSJA 1RW1A 2VL2A 1FVJA 3EYTA 4AJ6A 1M7TA 3APOA 5ID2A 4YQUA 4Z2TA 2HFDA 4GRFA 3HY2A 4TR1B 4XTSA 5E59A 2C0FA 2OBIA 3ZVJA 4N11A 5DAKA 2DC5A 2LNTA 4HU9A 3D22A 3GMFA 3DXBA 3Q74A 3QOUA 3FZ4A 4F0CA 3W6GA 4POLA 3S9FA 2O7KA 2VL3A 1EGRA 3IPZA 2BTOT 3KM6A 3F4RA 3VLNA 1PL1A 5CYYA 4GF0A 2G2QA 2OJLA 2P5RA 4WKWA 1F2EA 4P3YB 4KNDA 4PXOA 2H1DA 1F6MC 1YZXA 4WXTA 1BJXA 3DWVA 2F51A 2LEGA 5DCHA 4L5OA 4TR3A 4WR4A 4CW9A 3O6TA 3KH9A 2OADA 3ZMLA 2GSTA 3TJGA 3D21A 3KMNA 2LJAA 3LXZA 3FR6A 1ML6A 1JHBA 1A24A 4IELA 5B8BA 2GTUA 1USBA 1A2JA 2IJYA 4IS0A 1HNCA 1XOBA 2GZPA 3F6DA 5CP1A 3RHCA 4DSRA 2FWFA 4PQIA 2MMNA 2VUPA 4HS1A 2WJUA 3DEXA 2MMOA 4J57E 3IAS2 1U88A 1A0RP 2PU9C 5ECIB 1K0CA 3CSHA 1TTZA 5DALB 3MYDA 5C00A 1E6BA 4K7NA 4TXOA 2XBQA 3ERGA 4KF9A 4OFNA 2H1BA 4TXOB 4YKFA 1HQOA 2FA8A 1BG5A 1SK0A 3GYKA 4Z2RA 1N8JA 2LTKA 5INYA 2GSRA 1SK1A 1GH2A 2QSIA 3IDVA 1ERVA 4FIWA 20GSA 1GTIA 1M9BA 2WZ9A 2FWHA 5EL8A 1AQWA 2KP1A 3FW2A 1M0UA 4BWQA 1M99A 2O89A 1U3AA 6GSSA 5EY6A 4EC0A 4IBPA 2KUCA 3KJYA 1ZZYA 2CX4A 4JEDA 1NW2A 2XPDA 5IOWA 2F8FA 2R0GA 2HNLA 1TI3A 4J56E 3TRPA 2PPTA 4ULXA 4F2IA 4MJBA 2Z9SA 3A2VA 4HQSA 1DSBA 3I69A 1RQMA 1GNEA 1LBKA 2J23A 3A5WA 3GN3A 4N0VA 4NMUA 5AISA 3CTFA 4TR1A 1G6WA 1Z6MA 2L4QA 5HR0A 3GKNA 1BAYA 2GGTA 5DJLA 2LNSA 1YF0A 1GULA 2FWEA 3RPPA 2IMFA 2RUFA 1NHOA 4F0BA 1AXDA 2C8UA 4NWYA 2HZEB 3VWUA 3IBHA 1XZOA 3W8JA 4EF0A 2X4AA 5GSTA 4WBJA 5LNKe 2YJ7A 1FO5A 4KCEA 3WT1A 1PD21 4I2UA 4E8HA 5AN1A 1C72A 2JACA 3RAZA 4PUAA 2R2JA 4OWYA 1AQVA 1LJRA 4BPYA 3TJFA 2DJKA 3GH9A 5J9CA 4HOJA 2E2MA 5KN0A 1O81A 4GXZA 2K8VA 1KTEA 3EVIA 3OR5A 2LQOA 4XS6A 5IQYA 2A4VA 2DJJA 2TIRA 3EWLA 5ELGA 2EC4A 1CQHA 5E4WA 4K5RA 5ECHB 2J9HA 6GSXA 4OCEA 5ECLB 1GUMA 2C0GA 3QAVA 3LWAA 1SJIA 5J3RA 1YQ1A 4DSSA 3D6IA 4NPBA 4HZ4A 5IO0A 1EP7A 1V2AA 4DSSB 2DJ2A 1GRXA 2MYGA 2C3QA 5HFGA 2XPEA 2AUVA 2ON5A 2ES7A 3TJBA 2LJRA 3Q6OA 4ECCA 4IJ3A 1GTAA 1TP9A 4RQRA 4KE3A 4IN0A 4O5UA 4CDOA 3TCOA 4K0NA 4CY6A 1GLQA 1QXHA 4OFTA 4ID0A 1FAAA 1XXUA 1B4QA 5IOXA 2GLRA 3C73A 4MPGA 2IMKA 2C0EA 2H01A 3GHAA 1KEBA 4G0KA 1OKDA 1DUGA 3KP9A 3HVSA 3HA9A 1THXA 3FKFA 4MPFA 1FHEA 4EDYA 4ICYA 1TDIA 1W4VA 2IL3A 1XCCA 4K5SA 1X0RA 4WF5A 4BL7B 2HT9A 3CTGA 3QFBC 3GURA 5A5KA 1VF4A 1VRSD 5ECKB 4KB3A 1MDIA 3VWWA 5DQYA 1K0AA 3EPTA 3EC3A 2X64A 3UVHA 2H70A 3GKXA 2M46A 3GNJA 2AV4A 2I9HA 5AIXA 1AIUA 4XHMA 3HJMA 3TJJA 1FOHA 1EOGA 4MF6A 3RDWA 3MNGA 2OA7A 1Y25A 3F0IA 4IP1A 1PKZA 2WGRA 3C7MA 1X5CA 5IMAA 1A0FA 2DIZA 4TVEA 1V57A 2WB9A 5IPGA 1ON4A 3PINA 1GSFA 3EMPA 5GZZB 5ECSA 2B7JA 1SENA 2FHEA 1GSDA 2JZSA 1Z7RA 1YKAA 2I3YA 1WWJA 5IMVA 2F9SA 5G1KA 1F3AA 2HSMA 4KDXA 3H4KA 19GSA 3VWXA 1HYUA 3UL3A 3WYWA 2A2RA 1J0FA 3HJOA 4KSOA 3U6VA 3TGZA 3CXGA 1JZDA 4XIHA 4BVYA 1B9XC 4OMVA 1W89A 5DALA 3KEBA 4ZL8A 2IMEA 1TOFA 3H79A 1YKCA 1B48A 2H6XA 3LEFA 1GSEA 1GTBA 2L57A 3FR9A 4AGSA 4G9HA 4BVXA 2VL2C 1SKRB 1U6TA 2G0FA 1K0MA 3KD0A 5JCWA 4KH7A 2BJXA 5HR3A 4KW6A 1GNWA 2V41A 2B3SA 2B1LA 5D9TA 4ILFA 2QA1A 4FQUA 3GV1A 4V2LA 2ZNMA 1H4OA 3IC8A 1T00A 3QAGA 3GSSA 2R6KA 5CAXA 2H75A 4HQZA 1K0BA 3VK9A 4ZB9A 11GSA 1TJDA 1U3IA 1ZYNA 5KEJA 3DGQA 2AYTA 2LV3A 3M1GA 1K3OA 2C3TA 4JZQA 5G5EA 3GTUA 2JSYA 1SL0B 1GL8A 2VOCA 3L9VA 4GQFA 2VCWA 4V1Ap 3O76A 2YOIA 1WOUA 1PL2A 5FT3A 3VPQA 3ZREA 1AAZA 4L0UA 1OC9B 4PURA 3VFIA 3TB2A 4NV5A 3UIWA 2IPAA 5ECMB 1XVQA 5D96A 3H1NA 1VF3A 3VI5A 4TXVA 2F3MA 5HFKA 2K6VA 3TOTA 3D4MA 2HZEA 5B7CA 5F05A 1Q4JA 3LYPA 5F07A 3V1WA 3H93A 2GQKA 5DVBA 1T4YA 4L5LA 3I9V2 3WGDA 3CBUA 1DBYA 1PMTA 2H66A 5F0GA 2PWJA 1G7OA 4FYBA 2VCXA 2DBCA 4TR4A 1X5DA 4XRDA 4O92A 1R5PA 5J9BA 1T3BA 2HE3A 2VLTA 3IAM2 1JLWA 1Q98A 3LXTA 2H76A 2LUSA 2VIMA 1T8EB 1YDKA 1ZMAA 4MA9A 5KOXA 3D5JA 5CO3A 3FRCA 4EE0A 3ZYWA 4IP6A 3M3MA 2V32A 1WE0A 2L6DA 1DE2A 4KSMA 3LG6A 1ZYQB 5KN3A 3IK7A 1TRVA 4EO3A 3LQ7A 4MK3A 5B8AA 3E3EA 1VF2A 3GTUB 4K2XA 4IQAA 3R2QA 3VURA 4ECBA 2O87A 4YAVA 6GSUA 5DJMA 2K9FA 4TRXA 3GSTA 4BVYB 2MBTA 3KTLA 2VCQA 3JCML 1AQXA 5D9WA 3ZLPA 4ECIA 2GZYA 2LKUA 4O5QA 3ZFBA 5HR2A 3IHQA 4GSTA 3IK9A 2D2ZA 1FG4A 1IYIA 2WDUA 3TKSA 1GLPA 2CQ9A 2QA2A 2RIIA 7GSSA 5DBQA 4XRAA 3DVXA 2PVOC 3EE2A 1TI1A 4F9ZA 2JADA 4RI7A 3LJRA 2VO4A 4DVCA 3G7JA 3FMWA 4XCSA 4G2EA 1SYRA 5IM9A 3UARA 4A5PA 3HVXA 1KBNA 2EIOA 2AHEA 2LRTA 4I6XA 2H1AA 3WD6A 4NXIA 4YQVA 4JR6A 3KXOA 2NDOA 1TW9A 1TK5B 1G7EA 2ON7A 3L0HA 4LL4B 5JWRB 1ZGNA 1OE8A 4MJAA 3ZFLA 1OKTA 4TKYA 4MP4A 1A2LA 3GA4A 1ERUA 1FB6A 1X9SB 1VGLA 1EEJA 4EVMA 2V6OA 4ISDA 4K0GA 1X5EA 3P90A 2GQMA 1BYEA 1Z5YE 1ST9A 1NHYA 4OD7A 2HRKA 4MH2A 3GIXA 1PQNA 3RBTA 5CREA 4I97A 2LS5A 2M72A 3PPUA 3GX0A 4ZBBA 1YF1A 2IWTA 1EOHA 3ZVJD 5A4VA 3J7Yk 2OE3A 5BRTA 4I5QA 4OO5A 2B5XA 3WT2A 4TW5A 3J7Yb 1I9DA 1JZWA 2GDRA 4QL9A 4ZL7A 1MEKA 1SJZA 3UJ1A 5H5QA 1VF1A 3DRNA 3ZITA 4IHUA 3HXSA 1DE1A 5HR1A 4WF4A 3P2AA 2N5BA 2IMDA 4PTSA 3G7IA 2B5EA 2FCHA 3UBKA 2LSTA 4YQMA 1F9MA 1R5AA 4D73A 2L4CA 2YWNA 3TDGA 3QAWA 4O7HA 1R26A 3IRAA 3GKKA 4KDYA 4K6XA 2GS3A 4FO5A 2A2PA 4XS4B 4MABA 5G1LA 3HYPA 2R37A 4HZ2A 2TRXA 4EIPA 2YWIA 2B1KA 1GUHA 1XVWA 1G0TA 1EGOA 2GVPA 4L8EA 1OAZA 1XWBA 1GSYA 4I2TA 4MCUA 2WS2A 3ZZXA 2FLSA 2E0QA 2OKAA 5ID2B 2WFCA 3F63A 3FR3A 4O5RA 1MDKA 3P7XA 3UEMA 1K3YA 2CVBA 3RPNA 3GUSA 3IXRA 1PN0A 2JZTA 4WBRD 3PGTA 1K0OA 4LMVA 4BVXB 2HI7A 4K2DA 3HVVA 1Z7PA 2X99A 1ACVA 1XIYA 1YJ6A 1HNBA 1BX9A 3BCKA 4ZXGA 1SD9A 1XWCA 3US3A 5DCGA 4USSA 5IO2A 3M9JA 1PRXA 2A2SA 2MMZA 4HEA2 1EEMA 2H73A 1RK4A 3UVTA 3ZRDA 3MWHA 4GLTA 1J9BA 2B5YA 5G2ZA 5HFIA 2REMA 2HXKA 1ERTA 4YH2A 1JFUA 2H8LA 4HDEA 1SL2B 3PR8A 2HSHA 2I4AA 1T4ZA 2AB6A 1URMA 1PX7A 12GSA 3KCMA 2XBIA 4K8MA 3TKSE 3IR4A 2I1UA 3CMIA 3IHGA 1SYXA 1U87A 1V40A 3IOSA 5LD0A 2B7KA 2CZ3A 2MZCA 2NVLA 2HSYA 1WRYA 3DVWA 1S3CA 1CQGA 5A4WA 3TKQA 4WR5A 2P0GA 1T1VA 2DMLA 3CSIA 3GH6A 3CYNA 4GWRA 2R0CA 2DJ0A 2H0IA 2RM6A 1YEXA 6GSYA 3D0ZA 2PGTA 3M9KA 1GSQA 4IGJA 1O8WA 5G30A 2IIYA 4X43A 5CRDA 2P5QA 3GX8A 4NV2A 2C4JA 2MMAA 5IMFA 4F03A 3PH9A 3W8SA 1XWAA 2B6MA 3A2WA 3E9JB 1THOA 2VM1A 4GSNA 4Q5QA 2VD0A 4FYCA 4N30A 2DSAA 2V2GA 3HZ4A 2X8HA 4KGIA 1M9AA 3EURA 2OACA 1GSSA 2HLSA 2N5FA 4TN8A 2H74A 3FEUA 2DMMA 5COHA 1OC8A 3DIEA 4TOPA 4PQHA 2DJ3A 2GSQA 4PNFA 2XC2A 3HJPA 3KZQA 2YNXA 3QPMA 1TU7A 2JSZA 3FZ9A 4PX1A 5IMCA 2IFQB 2IY2A 2KOKA 4RUVA 5EVOA 1FB0A 3HDCA 5H5SA 2FWGA 1EZKA 4ZBAA 2R5GA 3QR6A 4V1Ag 2H71A 18GSA 5AGYA 22GSA 5GSSA 1TXXA 2H30A 2JZRA 2P31A 4OCFA 2BMXA 13GSA 4K7IA 3SWLA 3L78A 2RM5A 4EKZA 4G10A 4N10A 1K0NA 5ECRB 3VI7A 2R0PA 4G19A 2V1MA 4NHWA 2KHPA 3UMAA 4GQCA 4MH3A 1PSQA 4O32A 3MDKA 1ZYPA 2FA4A 1QK8A 2DKIA 2PUKC 3Q19A 3O3TA 2HZFA 4MDCA 2FD3A 3HZ8A 1K0DA 3ERWA 4IVFA 4YKGA 3D4TA 5KOWA 4HJMA 4WETA 3FK8A 2IFQA 3FYGA 3L4NA 2CV4A 1QFNA 1F3BA 17GSA 2WCIA 2VM2A 1YEPA 1TRUA 3U5RE 3C1RA 1PA3A 1GUKA 3DMLA 2YWMA 4Q5FA 2PMTA 4ZILA 1MTCA 4CY8A 4EIQA 4EL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL5 A;  2VCV A;  2AJQ B;  2L59 A;  1EWX A;  3TKS C;  1BED A;  4IW9 A;  5DQS A;  2CT6 A;  1TRW A;  2M80 A;  2X8C A;  3VPT A;  1S3A A;  1WP0 A;  2VAF A;  3TRQ A;  6GSV A;  4OO4 A;  3F3Q A;  5KN1 A;  4EDZ A;  3GFK A;  2OE1 A;  2I81 A;  3KGK A;  3ERF A;  3FY7 A;  3K8N A;  1XW5 A;  1OC3 A;  3IE3 A;  1MD4 A;  4RI6 A;  4ZB8 A;  3HD5 A;  4IKH A;  3GKM A;  2L5O A;  2CAQ A;  3NIV A;  2VD1 A;  5D9V A;  3I6A A;  1LU4 A;  6GSW A;  1PKW A;  5JCU A;  2X8G A;  5FWG A;  4LA1 A;  3UOM A;  5D8I A;  4F82 A;  1UVZ A;  3ISO A;  3FZ5 A;  3ME7 A;  4PQ1 A;  3GRX A;  4WEY A;  4LMW A;  1V9W A;  1IYH A;  4KDU A;  3DD3 A;  4GTU A;  3G9B A;  4BL7 A;  2AAW A;  2RLI A;  3HKR A;  1ZCP A;  4N0Z A;  3C8E A;  3BBY A;  2CA8 A;  5GAP D;  5C04 A;  2FGX A;  1G6Y A;  4JE1 A;  1ERW A;  3KH7 A;  5DAK B;  4H86 A;  1UA5 A;  14GS A;  3SBC A;  2GZZ A;  2NBS A;  1E2Y A;  4MZW A;  5ELA A;  1B8X A;  3HCZ A;  3TKP A;  2VLV A;  4I8B A;  4J2F A;  5ECN B;  3TUE A;  1Y6E A;  3RHB A;  5JWQ B;  3APQ A;  1XBS A;  4AF2 A;  1SL1 B;  2XHF A;  4KUN A;  5ECP B;  1B9Y C;  1PGT A;  2E7P A;  4QQ7 A;  2MBS A;  1UC7 A;  3G7Y A;  2C80 A;  4ZB6 A;  2JL4 A;  3ME8 A;  1K3L A;  1M2B A;  2CX3 A;  6GST A;  3EMX A;  1ILO A;  2H19 A;  2DIY A;  4POM A;  1ZOF A;  4V2N A;  1SK2 A;  4IQ1 A;  5ECO B;  2OE0 A;  4RQX A;  2C3N A;  3ZTL A;  2H6Y A;  2IYJ A;  2YJH A;  4ZIJ A;  3F4T A;  3A2X A;  2N5A A;  1PX6 A;  4LLR A;  2HYX A;  1M2D A;  4TR0 A;  5IMD A;  1AC1 A;  4MLY A;  2K18 A;  4PGT A;  3F4S A;  4JBB A;  4LL1 B;  3WGX A;  3MSZ A;  1NM3 A;  4DSQ A;  1M2A A;  3ZMK A;  1O8X A;  1T7P B;  1HNA A;  2VL9 A;  1TK8 B;  3F9U A;  5GAN D;  4EXJ A;  3I43 A;  4MJC A;  4L0W A;  10GS A;  1YY7 A;  9GSS A;  2YCD A;  5CRH A;  5H5R A;  3TJK A;  2PN8 A;  4AJ8 A;  4HI7 A;  1Z3E A;  1WJK A;  3N5O A;  2YZH A;  3NZN A;  1Z6N A;  5F06 A;  1KNG A;  2ZCT A;  3QDN A;  3C71 A;  2YP6 A;  5IMZ A;  1GP1 A;  5FHI A;  4EUY A;  3E0U A;  1B4P A;  4ACS A;  2VLU A;  3TOU A;  5EPF A;  3IV4 A;  4KX4 A;  2FNO A;  5HQP A;  1A2M A;  1O6J A;  1EV4 A;  4KCA A;  4XS4 A;  3F6F A;  4HJ2 A;  4ML1 A;  3HHV A;  1V58 A;  2FY6 A;  1MDJ A;  1JZR A;  2NTO A;  3AY8 A;  2GT5 A;  5LCZ A;  4Q5N A;  3CRT A;  1EV9 A;  5B6M A;  3F8U A;  2PER A;  1QQ2 A;  1WPI A;  1GSU A;  1N2A A;  4GCI A;  4MJE A;  4Q5R A;  4Z7X A;  3QCP A;  1OE7 A;  3MAK A;  1TK0 B;  4IJI A;  4POB A;  2KP2 A;  3BCI A;  3N9J A;  4K7O A;  2EIR A;  2LRN A;  3A3T A;  2R4V A;  4X1U A;  3M0F A;  5CRW A;  1O7U A;  2FUG 2;  3CRU A;  3GL3 A;  2LQQ A;  1F37 A;  2L5L A;  2PBJ A;  3P8W A;  3ZIJ A;  3QD9 A;  4POK A;  2IN3 A;  3L9U A;  5IIZ A;  4AJ7 A;  4D73 B;  3NOF A;  2L6C A;  2YAN A;  2CZ2 A;  2H0G A;  1FVK A;  2KLX A;  4JR4 A;  2CVK A;  2QC7 A;  3UBL A;  1O73 A;  2CAI A;  5D73 A;  4K1F A;  2PVQ A;  3BOA A;  5ECQ B;  3H8Q A;  4JRR A;  3TKR A;  1SJ6 A;  5CRG A;  1FW1 A;  5J41 A;  3WGE A;  5CNW A;  2YV9 A;  1I5G A;  1A8Y A;  1A23 A;  4FH8 A;  3BD2 A;  1XW6 A;  4ML6 A;  1SD8 A;  4X0X A;  5KN2 A;  4MF5 A;  1SU9 A;  3KP8 A;  1V98 A;  1WMJ A;  1AUC A;  3ZL5 A;  2HRN A;  1QGV A;  2H1G A;  3EU3 A;  1H75 A;  5G5F A;  1TKD B;  4QL7 A;  3EIN A;  2RUE A;  1NSW A;  2VCZ A;  1SKW B;  5ENU A;  1ABA A;  2C0D A;  1EP8 A;  1XW9 A;  2C1Y A;  2LJK A;  3KIJ A;  2H0H A;  2CVD A;  4BWS A;  3LGC A;  4ZBD A;  2YPM A;  4MZC A;  2DLX A;  3KMO A;  1AW9 A;  4MF7 A;  4HU7 A;  4YAP A;  2QKE A;  1XWG A;  4K9Z A;  1OYJ A;  1X9W B;  1TRS A;  1ZL9 A;  1GWC A;  2E2G A;  2DJ1 A;  2ZUP A;  2YN1 A;  3FHK A;  4E8E A;  2YWO A;  1GTU A;  3KTB A;  1MD3 A;  3M8N A;  3LYK A;  1R7H A;  3Q18 A;  2GQL A;  3LFL A;  2O85 A;  1S3D A;  2GSS A;  2WRT A;  2R3X A;  3EU4 A;  2HRF A;  4KA0 A;  1WIK A;  1XOA A;  4JU5 A;  3LOR A;  2YZU A;  4PUF C;  5G31 A;  3TRX A;  2O8V B;  2F8A A;  3DYR A;  1XPV A;  1XFL A;  4PNG A;  8GSS A;  4MZB A;  5F8B A;  3L9S A;  3QMX A;  3QFA C;  1BQ7 A;  4V2M A;  3APS A;  1OVN A;  2H72 A;  1JLV A;  1ZYE A;  3VWV A;  4NHZ A;  1OC9 A;  1X9M B;  3FZA A;  3IC4 A;  1Z9H A;  2VCT A;  1JZO A;  5AIV A;  2JU5 A;  1O85 A;  4HUA A;  16GS A;  4GSS A;  4DEJ A;  2H6Z A;  4NAX A;  2GT6 A;  2WUL A;  1HD2 A;  2YV7 A;  3C1S A;  5D93 A;  2NPB A;  2LRC A;  1TU8 A;  5JWO B;  4BA7 A;  5J5N A;  1QMV A;  5JCG A;  1XWK A;  5A4U A;  5ABR A;  3BJ5 A;  5DDL A;  1FOV A;  3ED3 A;  1UN2 A;  4FYU A;  3F3R A;  2QGV A;  2V6K A;  4XS1 A;  5J4U A;  5IPH A;  5B6N A;  4ECJ A;  2ALB A;  3UAP A;  2K8S A;  4OFM A;  4CHS A;  5D9X A;  1R4W A;  3LSZ A;  2IMI A;  1SKS B;  4ZL9 A;  3ZIV A;  1A8L A;  1QUW A;  2TRC P;  4KAE A;  1J08 A;  4MMM A;  2OBK A;  3DKS A;  3IA1 A;  5L71 A;  1PN9 A;  2EIQ A;  3CSJ A;  1RW1 A;  2VL2 A;  1FVJ A;  3EYT A;  4AJ6 A;  1M7T A;  3APO A;  5ID2 A;  4YQU A;  2HFD A;  4GRF A;  3HY2 A;  4TR1 B;  4XTS A;  5E59 A;  2C0F A;  2OBI A;  3ZVJ A;  4N11 A;  5DAK A;  2DC5 A;  2LNT A;  4HU9 A;  3D22 A;  3GMF A;  3DXB A;  3Q74 A;  3QOU A;  3FZ4 A;  4F0C A;  3W6G A;  4POL A;  3S9F A;  2O7K A;  2VL3 A;  1EGR A;  3IPZ A;  2BTO T;  3KM6 A;  3F4R A;  3VLN A;  1PL1 A;  5CYY A;  4GF0 A;  2G2Q A;  2OJL A;  2P5R A;  4WKW A;  1F2E A;  4P3Y B;  4KND A;  4PXO A;  2H1D A;  1F6M C;  1YZX A;  4WXT A;  1BJX A;  3DWV A;  2F51 A;  2LEG A;  5DCH A;  4L5O A;  4TR3 A;  4WR4 A;  4CW9 A;  3O6T A;  3KH9 A;  2OAD A;  3ZML A;  2GST A;  3TJG A;  3D21 A;  3KMN A;  2LJA A;  3LXZ A;  3FR6 A;  1ML6 A;  1JHB A;  1A24 A;  4IEL A;  5B8B A;  2GTU A;  1USB A;  1A2J A;  2IJY A;  4IS0 A;  1HNC A;  1XOB A;  2GZP A;  3F6D A;  5CP1 A;  3RHC A;  4DSR A;  2FWF A;  4PQI A;  2MMN A;  2VUP A;  4HS1 A;  2WJU A;  3DEX A;  2MMO A;  4J57 E;  3IAS 2;  1U88 A;  1A0R P;  2PU9 C;  5ECI B;  1K0C A;  3CSH A;  1TTZ A;  5DAL B;  5C00 A;  1E6B A;  4K7N A;  4TXO A;  2XBQ A;  3ERG A;  4OFN A;  2H1B A;  4TXO B;  1HQO A;  2FA8 A;  1BG5 A;  1SK0 A;  3GYK A;  1N8J A;  2LTK A;  5INY A;  2GSR A;  1SK1 A;  1GH2 A;  2QSI A;  3IDV A;  1ERV A;  4FIW A;  20GS A;  1GTI A;  1M9B A;  2WZ9 A;  2FWH A;  5EL8 A;  1AQW A;  2KP1 A;  3FW2 A;  1M0U A;  4BWQ A;  1M99 A;  2O89 A;  1U3A A;  6GSS A;  5EY6 A;  4EC0 A;  4IBP A;  2KUC A;  3KJY A;  1ZZY A;  2CX4 A;  4JED A;  1NW2 A;  2XPD A;  5IOW A;  2F8F A;  2HNL A;  1TI3 A;  4J56 E;  3TRP A;  2PPT A;  4ULX A;  4F2I A;  4MJB A;  2Z9S A;  3A2V A;  4HQS A;  1DSB A;  3I69 A;  1RQM A;  1GNE A;  1LBK A;  2J23 A;  3A5W A;  3GN3 A;  4N0V A;  4NMU A;  5AIS A;  3CTF A;  4TR1 A;  1G6W A;  1Z6M A;  2L4Q A;  5HR0 A;  3GKN A;  1BAY A;  2GGT A;  5DJL A;  2LNS A;  1YF0 A;  1GUL A;  2FWE A;  3RPP A;  2IMF A;  2RUF A;  1NHO A;  4F0B A;  1AXD A;  2C8U A;  4NWY A;  2HZE B;  3VWU A;  3IBH A;  1XZO A;  3W8J A;  4EF0 A;  5GST A;  4WBJ A;  5LNK e;  2YJ7 A;  1FO5 A;  4KCE A;  3WT1 A;  1PD2 1;  4I2U A;  4E8H A;  5AN1 A;  1C72 A;  2JAC A;  3RAZ A;  4PUA A;  2R2J A;  4OWY A;  1AQV A;  1LJR A;  4BPY A;  3TJF A;  2DJK A;  3GH9 A;  5J9C A;  4HOJ A;  2E2M A;  5KN0 A;  1O81 A;  4GXZ A;  2K8V A;  1KTE A;  3EVI A;  3OR5 A;  2LQO A;  4XS6 A;  5IQY A;  2A4V A;  2DJJ A;  2TIR A;  3EWL A;  5ELG A;  2EC4 A;  1CQH A;  5E4W A;  5ECH B;  2J9H A;  6GSX A;  4OCE A;  5ECL B;  1GUM A;  2C0G A;  3QAV A;  3LWA A;  1SJI A;  5J3R A;  1YQ1 A;  4DSS A;  3D6I A;  4NPB A;  4HZ4 A;  5IO0 A;  1EP7 A;  1V2A A;  4DSS B;  2DJ2 A;  1GRX A;  2MYG A;  2C3Q A;  5HFG A;  2XPE A;  2AUV A;  2ON5 A;  2ES7 A;  3TJB A;  2LJR A;  3Q6O A;  4ECC A;  4IJ3 A;  1GTA A;  1TP9 A;  4RQR A;  4KE3 A;  4IN0 A;  4CDO A;  3TCO A;  4K0N A;  1GLQ A;  1QXH A;  4OFT A;  4ID0 A;  1FAA A;  1XXU A;  1B4Q A;  5IOX A;  2GLR A;  3C73 A;  4MPG A;  2IMK A;  2C0E A;  2H01 A;  3GHA A;  1KEB A;  1OKD A;  1DUG A;  3KP9 A;  3HVS A;  3HA9 A;  1THX A;  3FKF A;  4MPF A;  1FHE A;  4EDY A;  1TDI A;  1W4V A;  2IL3 A;  1XCC A;  1X0R A;  4WF5 A;  2HT9 A;  3CTG A;  3QFB C;  3GUR A;  5A5K A;  1VF4 A;  1VRS D;  5ECK B;  4KB3 A;  1MDI A;  3VWW A;  5DQY A;  1K0A A;  3EC3 A;  2X64 A;  3UVH A;  2H70 A;  3GKX A;  2M46 A;  3GNJ A;  2AV4 A;  2I9H A;  5AIX A;  1AIU A;  4XHM A;  3HJM A;  3TJJ A;  1EOG A;  4MF6 A;  3RDW A;  3MNG A;  2OA7 A;  1Y25 A;  3F0I A;  4IP1 A;  1PKZ A;  2WGR A;  3C7M A;  1X5C A;  5IMA A;  1A0F A;  2DIZ A;  4TVE A;  1V57 A;  2WB9 A;  5IPG A;  1ON4 A;  3PIN A;  1GSF A;  3EMP A;  5GZZ B;  5ECS A;  2B7J A;  1SEN A;  2FHE A;  1GSD A;  2JZS A;  1Z7R A;  1YKA A;  2I3Y A;  1WWJ A;  5IMV A;  2F9S A;  5G1K A;  1F3A A;  4KDX A;  3H4K A;  19GS A;  3VWX A;  1HYU A;  3UL3 A;  3WYW A;  2A2R A;  1J0F A;  3HJO A;  4KSO A;  3U6V A;  3TGZ A;  3CXG A;  1JZD A;  4XIH A;  4BVY A;  1B9X C;  4OMV A;  1W89 A;  5DAL A;  3KEB A;  4ZL8 A;  2IME A;  1TOF A;  3H79 A;  1YKC A;  1B48 A;  2H6X A;  3LEF A;  1GSE A;  1GTB A;  2L57 A;  3FR9 A;  4AGS A;  4G9H A;  4BVX A;  2VL2 C;  1SKR B;  1U6T A;  2G0F A;  1K0M A;  3KD0 A;  5JCW A;  4KH7 A;  2BJX A;  5HR3 A;  4KW6 A;  1GNW A;  2V41 A;  2B3S A;  2B1L A;  5D9T A;  4ILF A;  3GV1 A;  4V2L A;  2ZNM A;  1H4O A;  1T00 A;  3QAG A;  3GSS A;  2R6K A;  5CAX A;  2H75 A;  4HQZ A;  1K0B A;  3VK9 A;  4ZB9 A;  11GS A;  1TJD A;  1U3I A;  5KEJ A;  3DGQ A;  2AYT A;  2LV3 A;  3M1G A;  1K3O A;  2C3T A;  4JZQ A;  5G5E A;  3GTU A;  2JSY A;  1SL0 B;  1GL8 A;  2VOC A;  3L9V A;  4GQF A;  2VCW A;  4V1A p;  3O76 A;  2YOI A;  1WOU A;  1PL2 A;  5FT3 A;  3VPQ A;  3ZRE A;  1AAZ A;  4L0U A;  1OC9 B;  4PUR A;  3VFI A;  3TB2 A;  4NV5 A;  3UIW A;  2IPA A;  5ECM B;  1XVQ A;  5D96 A;  3H1N A;  1VF3 A;  3VI5 A;  4TXV A;  2F3M A;  5HFK A;  2K6V A;  3TOT A;  3D4M A;  2HZE A;  5B7C A;  5F05 A;  1Q4J A;  3LYP A;  5F07 A;  3V1W A;  3H93 A;  2GQK A;  5DVB A;  1T4Y A;  4L5L A;  3I9V 2;  3WGD A;  3CBU A;  1DBY A;  1PMT A;  2H66 A;  5F0G A;  2PWJ A;  1G7O A;  4FYB A;  2VCX A;  2DBC A;  4TR4 A;  1X5D A;  4XRD A;  4O92 A;  1R5P A;  5J9B A;  1T3B A;  2HE3 A;  2VLT A;  3IAM 2;  1JLW A;  1Q98 A;  3LXT A;  2H76 A;  2LUS A;  2VIM A;  1T8E B;  1YDK A;  1ZMA A;  4MA9 A;  3D5J A;  5CO3 A;  3FRC A;  4EE0 A;  3ZYW A;  4IP6 A;  3M3M A;  2V32 A;  1WE0 A;  2L6D A;  1DE2 A;  4KSM A;  3LG6 A;  1ZYQ B;  5KN3 A;  3IK7 A;  1TRV A;  4EO3 A;  3LQ7 A;  4MK3 A;  5B8A A;  3E3E A;  1VF2 A;  3GTU B;  4IQA A;  3R2Q A;  3VUR A;  4ECB A;  2O87 A;  4YAV A;  6GSU A;  5DJM A;  2K9F A;  4TRX A;  3GST A;  2MBT A;  3KTL A;  2VCQ A;  3JCM L;  3ZLP A;  5D9W A;  1AQX A;  4ECI A;  2GZY A;  2LKU A;  3ZFB A;  5HR2 A;  3IHQ A;  4GST A;  3IK9 A;  2D2Z A;  1FG4 A;  1IYI A;  2WDU A;  3TKS A;  1GLP A;  2CQ9 A;  2RII A;  7GSS A;  5DBQ A;  4XRA A;  3DVX A;  2PVO C;  3EE2 A;  1TI1 A;  4F9Z A;  2JAD A;  4RI7 A;  3LJR A;  2VO4 A;  4DVC A;  3G7J A;  4XCS A;  4G2E A;  1SYR A;  5IM9 A;  3UAR A;  3HVX A;  1KBN A;  2EIO A;  2AHE A;  2LRT A;  4I6X A;  2H1A A;  3WD6 A;  4NXI A;  4YQV A;  4JR6 A;  3KXO A;  2NDO A;  1TW9 A;  1TK5 B;  1G7E A;  2ON7 A;  3L0H A;  4LL4 B;  5JWR B;  1ZGN A;  1OE8 A;  4MJA A;  3ZFL A;  1OKT A;  4TKY A;  4MP4 A;  1A2L A;  3GA4 A;  1ERU A;  1FB6 A;  1X9S B;  1VGL A;  1EEJ A;  4EVM A;  2V6O A;  4ISD A;  4K0G A;  1X5E A;  3P90 A;  2GQM A;  1BYE A;  1Z5Y E;  1ST9 A;  1NHY A;  4OD7 A;  4MH2 A;  3GIX A;  1PQN A;  3RBT A;  5CRE A;  4I97 A;  2LS5 A;  2M72 A;  3GX0 A;  4ZBB A;  1YF1 A;  2IWT A;  1EOH A;  3ZVJ D;  5A4V A;  3J7Y k;  2OE3 A;  4I5Q A;  4OO5 A;  2B5X A;  3WT2 A;  4TW5 A;  3J7Y b;  1I9D A;  1JZW A;  2GDR A;  4QL9 A;  4ZL7 A;  1MEK A;  1SJZ A;  3UJ1 A;  5H5Q A;  1VF1 A;  3DRN A;  3ZIT A;  4IHU A;  3HXS A;  1DE1 A;  5HR1 A;  4WF4 A;  3P2A A;  2N5B A;  2IMD A;  3G7I A;  2B5E A;  2FCH A;  3UBK A;  2LST A;  4YQM A;  1F9M A;  1R5A A;  4D73 A;  2L4C A;  2YWN A;  3TDG A;  3QAW A;  4O7H A;  1R26 A;  3IRA A;  3GKK A;  4KDY A;  4K6X A;  2GS3 A;  4FO5 A;  4XS4 B;  4MAB A;  5G1L A;  3HYP A;  2R37 A;  4HZ2 A;  2TRX A;  2YWI A;  2B1K A;  1GUH A;  1XVW A;  1G0T A;  1EGO A;  2GVP A;  4L8E A;  1OAZ A;  1XWB A;  1GSY A;  4I2T A;  4MCU A;  2WS2 A;  3ZZX A;  2FLS A;  2E0Q A;  2OKA A;  5ID2 B;  2WFC A;  3F63 A;  3FR3 A;  4O5R A;  1MDK A;  3P7X A;  3UEM A;  1K3Y A;  2CVB A;  3RPN A;  3GUS A;  3IXR A;  2JZT A;  4WBR D;  3PGT A;  1K0O A;  4LMV A;  2HI7 A;  4K2D A;  3HVV A;  1Z7P A;  2X99 A;  1ACV A;  1XIY A;  1YJ6 A;  1HNB A;  1BX9 A;  3BCK A;  4ZXG A;  1SD9 A;  1XWC A;  3US3 A;  5DCG A;  5IO2 A;  3M9J A;  1PRX A;  2A2S A;  2MMZ A;  4HEA 2;  1EEM A;  2H73 A;  1RK4 A;  3UVT A;  3ZRD A;  3MWH A;  4GLT A;  1J9B A;  2B5Y A;  5G2Z A;  5HFI A;  2REM A;  2HXK A;  1ERT A;  4YH2 A;  1JFU A;  2H8L A;  4HDE A;  1SL2 B;  3PR8 A;  2HSH A;  2I4A A;  1T4Z A;  2AB6 A;  1URM A;  1PX7 A;  12GS A;  3KCM A;  2XBI A;  4K8M A;  3TKS E;  3IR4 A;  2I1U A;  3CMI A;  1SYX A;  1U87 A;  1V40 A;  3IOS A;  5LD0 A;  2B7K A;  2CZ3 A;  2MZC A;  2NVL A;  2HSY A;  1WRY A;  3DVW A;  1S3C A;  1CQG A;  5A4W A;  3TKQ A;  4WR5 A;  2P0G A;  1T1V A;  2DML A;  3CSI A;  3GH6 A;  3CYN A;  4GWR A;  2DJ0 A;  2H0I A;  2RM6 A;  1YEX A;  6GSY A;  3D0Z A;  2PGT A;  3M9K A;  1GSQ A;  4IGJ A;  1O8W A;  5G30 A;  2IIY A;  4X43 A;  5CRD A;  2P5Q A;  3GX8 A;  4NV2 A;  2C4J A;  2MMA A;  5IMF A;  4F03 A;  3PH9 A;  3W8S A;  1XWA A;  2B6M A;  3A2W A;  3E9J B;  1THO A;  2VM1 A;  4GSN A;  4Q5Q A;  2VD0 A;  4FYC A;  4N30 A;  2DSA A;  2V2G A;  3HZ4 A;  2X8H A;  4KGI A;  1M9A A;  3EUR A;  2OAC A;  1GSS A;  2HLS A;  2N5F A;  4TN8 A;  2H74 A;  3FEU A;  2DMM A;  5COH A;  1OC8 A;  3DIE A;  4TOP A;  4PQH A;  2DJ3 A;  2GSQ A;  4PNF A;  2XC2 A;  3HJP A;  3KZQ A;  2YNX A;  3QPM A;  1TU7 A;  2JSZ A;  3FZ9 A;  4PX1 A;  5IMC A;  2IFQ B;  2IY2 A;  2KOK A;  4RUV A;  5EVO A;  1FB0 A;  3HDC A;  5H5S A;  2FWG A;  1EZK A;  4ZBA A;  2R5G A;  3QR6 A;  4V1A g;  2H71 A;  18GS A;  5AGY A;  22GS A;  5GSS A;  1TXX A;  2H30 A;  2JZR A;  2P31 A;  4OCF A;  2BMX A;  13GS A;  4K7I A;  3SWL A;  3L78 A;  2RM5 A;  4EKZ A;  4G10 A;  4N10 A;  1K0N A;  5ECR B;  3VI7 A;  4G19 A;  2V1M A;  4NHW A;  2KHP A;  3UMA A;  4GQC A;  4MH3 A;  1PSQ A;  4O32 A;  3MDK A;  2FA4 A;  1QK8 A;  2PUK C;  3Q19 A;  3O3T A;  2HZF A;  4MDC A;  2FD3 A;  3HZ8 A;  1K0D A;  3ERW A;  4IVF A;  3D4T A;  4HJM A;  4WET A;  3FK8 A;  2IFQ A;  3FYG A;  3L4N A;  2CV4 A;  1QFN A;  1F3B A;  17GS A;  2WCI A;  2VM2 A;  1YEP A;  1TRU A;  3U5R E;  3C1R A;  1PA3 A;  1GUK A;  3DML A;  2YWM A;  4Q5F A;  2PMT A;  4ZIL A;  1MTC A;  4EL1 A; 
#chains in the Genus database with same CATH topology
 4BTW A;  3GL5 A;  2VCV A;  4X4J A;  4GHO A;  2AJQ B;  2L59 A;  3CPO A;  1EWX A;  3TKS C;  1BED A;  1UGH I;  4IW9 A;  5DQS A;  2R41 A;  1CYU A;  2CT6 A;  1TRW A;  2M80 A;  3AGN A;  2X8C A;  3VPT A;  1S3A A;  1WP0 A;  1EG9 B;  2VAF A;  3RNT A;  3TRQ A;  6GSV A;  4OO4 A;  3F3Q A;  3K63 A;  5KN1 A;  4EDZ A;  3GFK A;  2OE1 A;  2W9P A;  2I81 A;  3KGK A;  4FMD A;  3EHC A;  3ERF A;  3FY7 A;  3K8N A;  1RRL A;  1XW5 A;  3Q3F A;  1OC3 A;  3IE3 A;  2OQE A;  1MD4 A;  4RI6 A;  2Z76 A;  1VQQ A;  4ZB8 A;  3HD5 A;  1FA3 A;  4IKH A;  3GKM A;  2L5O A;  2YFI B;  2CAQ A;  3NIV A;  2VD1 A;  5D9V A;  2ML6 A;  3I6A A;  1U8C B;  3LML A;  3ROB A;  1LU4 A;  2OCT A;  6GSW A;  1DE3 A;  1PKW A;  5JCU A;  3LW9 A;  2X8G A;  3DMC A;  1LNH A;  3NV0 B;  1SPU A;  4WHA A;  5FWG A;  4LA1 A;  3UOM A;  5D8I A;  1GD3 A;  1NDO B;  4F82 A;  1UVZ A;  3ISO A;  3FZ5 A;  3ME7 A;  1RGH A;  1QVF 2;  4PQ1 A;  3GRX A;  4WEY A;  4LMW A;  1JKG B;  1V9W A;  1IYH A;  3PS8 A;  4KDU A;  3DD3 A;  4GTU A;  3LTB A;  1R4Y A;  3G9B A;  4BL7 A;  2ZDJ A;  2AAW A;  2RLI A;  2Y74 A;  2FGT A;  3HKR A;  1ZCP A;  2ML5 A;  4N0Z A;  4WFO A;  1Z1S A;  3BBY A;  2CA8 A;  3C8E A;  4WWU C;  5D81 A;  1VQL 3;  5GAP D;  5C04 A;  2FGX A;  1VZZ A;  3CCS 3;  1G6Y A;  1N8Q A;  4JE1 A;  1ERW A;  3G16 A;  3KH7 A;  3D4A A;  4H86 A;  1UA5 A;  5DAK B;  14GS A;  3SBC A;  4EV2 A;  2GZZ A;  2NBS A;  2K3D A;  2IUJ A;  1E2Y A;  4MZW A;  2CKF B;  5ELA A;  4L8O A;  1B8X A;  1AR0 A;  1UCI A;  3HCZ A;  3TKP A;  3T8N A;  1VQK 3;  2VLV A;  1GSP A;  5AYR B;  2QEX 3;  3B7C A;  4K90 B;  4I8B A;  4J2F A;  1IQX A;  4N6V 0;  5ECN B;  3TUE A;  1Y6E A;  1BRS A;  2A4H A;  3RHB A;  5JWQ B;  1RTU A;  3APQ A;  1ROV A;  1XBS A;  4AF2 A;  3X41 A;  2P05 A;  1SL1 B;  2XHF A;  4KUN A;  1IK3 A;  5ECP B;  1B9Y C;  1PGT A;  2E7P A;  4QQ7 A;  2GSP A;  2MBS A;  1UC7 A;  1O7N B;  3G7Y A;  3EBT A;  2SAR A;  3DGY A;  2C80 A;  1TUH A;  2JL4 A;  4ZB6 A;  4DKI A;  3ME8 A;  3UL6 A;  1K3L A;  1M2B A;  2XSO B;  2CX3 A;  6GST A;  3EMX A;  3EF8 A;  1ILO A;  2H19 A;  1PFO A;  2DIY A;  2XF3 A;  2CWU A;  1ZOF A;  4POM A;  4V2N A;  2F4Y A;  1SK2 A;  4IQ1 A;  5ECO B;  2OE0 A;  4IT7 A;  4RQX A;  2C3N A;  1QAF A;  1KQS 2;  1STD A;  3ZTL A;  5A0O B;  2H6Y A;  2IYJ A;  2YJH A;  1E3R A;  4ZIJ A;  1EA2 A;  1N9E A;  3F4T A;  3A2X A;  2N5A A;  1PX6 A;  4LLR A;  1NWW A;  4HOH A;  2HYX A;  1M2D A;  4TR0 A;  5IMD A;  1AC1 A;  4MLY A;  1RHL A;  2K18 A;  4PGT A;  1QMA A;  3F4S A;  1Q9E A;  4JBB A;  4LL1 B;  3WGX A;  1FZU A;  3MSZ A;  1NM3 A;  1T2I A;  4DSQ A;  1M2A A;  3F7X A;  4JRF A;  1LOV A;  3ZMK A;  1HYF A;  1O8X A;  4HYZ A;  3S5C A;  1T7P B;  1M3J A;  4JF8 A;  1HNA A;  2VL9 A;  1TK8 B;  3F9U A;  5GAN D;  1JRQ A;  3G6E 3;  3Q2P A;  4G0I A;  4EXJ A;  1VQ4 3;  2INX A;  3I43 A;  4K1U A;  4HSC X;  4MJC A;  1AVK A;  3FKA A;  4N6M A;  1OUN A;  1BAN A;  4L0W A;  2Z6B A;  10GS A;  4OVM A;  1YY7 A;  9GSS A;  2YCD A;  5CRH A;  3F8X A;  5H5R A;  3TJK A;  4CCV A;  2PN8 A;  2JQ5 A;  4AJ8 A;  4HI7 A;  3AHW A;  1DVD A;  1Z3E A;  1LVN A;  1WJK A;  3N5O A;  3GZR A;  2YZH A;  1YGE A;  3LTC A;  3NZN A;  1Z6N A;  5F06 A;  3BNB A;  1KNG A;  4BIR A;  2ZCT A;  3QDN A;  3C71 A;  2YP6 A;  1KC8 4;  5IMZ A;  2BIR A;  3D79 A;  3K0Z A;  1GP1 A;  5FHI A;  4J5K A;  4EUY A;  5BMU A;  3E0U A;  1B4P A;  4ACS A;  2VLU A;  3TOU A;  5EPF A;  3IV4 A;  4KX4 A;  2FNO A;  2F86 B;  5HQP A;  2KF6 A;  1A2M A;  8CHO A;  3FF0 A;  3LT9 A;  1O6J A;  1EV4 A;  1V74 A;  3R3E A;  4J5G A;  4KCA A;  1EQK A;  4XS4 A;  1OHS A;  3F6F A;  2PZV A;  4HJ2 A;  1JNQ A;  4ML1 A;  3HHV A;  1V58 A;  2FY6 A;  1CEW I;  1MDJ A;  1JZR A;  5JPP A;  3CCV 3;  2NTO A;  3AY8 A;  2GT5 A;  5LCZ A;  4Q5N A;  3CRT A;  1EV9 A;  5B6M A;  3F8U A;  2PER A;  2HMK B;  1QQ2 A;  3V92 A;  4RZM A;  2ZL8 A;  1WPI A;  2I9W A;  2B24 B;  1GSU A;  2P38 A;  4GB5 A;  2F99 A;  2K54 A;  9RNT A;  1N2A A;  4GCI A;  4MJE A;  4Q5R A;  4Z7X A;  3QCP A;  2Z7A A;  1OE7 A;  1DYU A;  3MAK A;  5BIR A;  3NM7 A;  3IMA B;  1TK0 B;  4IJI A;  4POB A;  1DMQ A;  2KP2 A;  3BCI A;  3N9J A;  4K7O A;  2EIR A;  2LRN A;  3A3T A;  2R4V A;  4X1U A;  3M0F A;  5CRW A;  1O7U A;  2F5M A;  2FUG 2;  3CRU A;  3GL3 A;  2LQQ A;  1F37 A;  2L5L A;  2PBJ A;  3P8W A;  1W5Z A;  1JN5 B;  1UDI I;  3ZIJ A;  3QD9 A;  2FNQ A;  3V98 A;  3HX8 A;  3LXU X;  4POK A;  2IN3 A;  4FCJ A;  3L9U A;  5IIZ A;  5HGR A;  1TRP A;  4AJ7 A;  4D73 B;  5JPU A;  1VQM 3;  3HVN A;  3NOF A;  1I0X A;  2L6C A;  1BVI A;  2YAN A;  2CZ2 A;  1R4C A;  2XGN A;  3B8L A;  2BMR B;  3KE7 A;  1YHQ 3;  2H0G A;  2OQE C;  2W0Q A;  1FVK A;  2KLX A;  2OOV A;  4JR4 A;  2CVK A;  2QC7 A;  3UBL A;  4LYL B;  1O73 A;  2UZ8 A;  2CAI A;  5D73 A;  3MKI A;  1LXE A;  1QAK A;  4K1F A;  2PVQ A;  3BOA A;  5ECQ B;  1B3S A;  3H8Q A;  4JRR A;  3TKR A;  4HAA A;  1SJ6 A;  5CRG A;  4HM4 B;  1Q42 A;  1O7W B;  1FW1 A;  5J41 A;  3WGE A;  3DGN A;  5CNW A;  1OGZ A;  2YV9 A;  1I5G A;  1I2E A;  1A8Y A;  1A23 A;  4FH8 A;  4HM6 B;  1PU4 A;  3BD2 A;  3MYT A;  1X1U A;  1XW6 A;  1OF5 A;  4ML6 A;  2P0X A;  1RLS A;  4LMI A;  1TFO A;  4EW5 A;  1SD8 A;  1GY5 A;  4X0X A;  5KN2 A;  4MF5 A;  1SU9 A;  3KP8 A;  1V98 A;  1WMJ A;  1AUC A;  3ZL5 A;  4Z2U A;  3I55 3;  2HRN A;  1QGV A;  2H1G A;  3EU3 A;  1ASK A;  3FCS B;  3NBJ A;  1H75 A;  5G5F A;  1TKD B;  4QL7 A;  3EIN A;  2RUE A;  1NSW A;  1RCL A;  1S3R A;  2VCZ A;  1SKW B;  5ENU A;  1ABA A;  2C0D A;  1EP8 A;  1XW9 A;  2C1Y A;  1IV7 A;  4N3V A;  3NQY A;  2KF5 A;  2LJK A;  2OOV C;  3KIJ A;  3WHO A;  2H0H A;  1J2B A;  2CVD A;  4BWS A;  5AYS C;  3LGC A;  2K0M A;  4K1V A;  4BTY A;  4ZBD A;  3CCL 3;  2YPM A;  4I4K A;  1BRK A;  4MZC A;  2DLX A;  1B20 A;  3KMO A;  1AW9 A;  4MF7 A;  4HU7 A;  4YAP A;  2QKE A;  1XWG A;  2W04 A;  4K9Z A;  1OYJ A;  1X9W B;  1TRS A;  3SED A;  1ZL9 A;  4G0L A;  1GWC A;  2E2G A;  4EXR A;  3JUP A;  2DJ1 A;  2ZUP A;  2YN1 A;  3FHK A;  4E8E A;  1VQ5 3;  2YWO A;  1GTU A;  3KTB A;  1MD3 A;  3M8N A;  3LYK A;  1R7H A;  1OCV A;  3Q18 A;  2GQL A;  3LFL A;  1RGG A;  2O85 A;  2HMN B;  1S3D A;  1RN7 A;  2GSS A;  2WRT A;  2R3X A;  3EU4 A;  1RN1 A;  2HRF A;  4KA0 A;  4AEQ A;  1WIK A;  3VF1 A;  1XOA A;  4JU5 A;  3LOR A;  2JDI H;  6GSP A;  2YZU A;  4MNN A;  3LOY A;  4PUF C;  4N6L A;  1K28 A;  5G31 A;  3TRX A;  2O8V B;  1RGE A;  3I0Y A;  2F56 A;  1W7C A;  2F8A A;  3DYR A;  3CME 3;  1XPV A;  1XFL A;  4PNG A;  4STD A;  8GSS A;  4MZB A;  5F8B A;  5EEO A;  3L9S A;  3QMX A;  3QFA C;  1BQ7 A;  4V2M A;  1GS3 A;  1UI7 A;  3APS A;  1OVN A;  2H72 A;  1KSI A;  1JLV A;  1ZYE A;  3VWV A;  4NHZ A;  1OC9 A;  1X9M B;  1S72 3;  3FZA A;  1G02 A;  3IC4 A;  3CD6 3;  3B4P A;  3K5T A;  1EUI C;  3J7Y d;  5HOH A;  1Z9H A;  1JZO A;  2VCT A;  3A5I A;  5AIV A;  2JU5 A;  1FGR A;  1YJW 3;  1O85 A;  4HUA A;  16GS A;  4GSS A;  4DEJ A;  1N5P A;  1W6G A;  2H6Z A;  6RNT A;  4NAX A;  2GT6 A;  3HK4 A;  3G8Z A;  2X49 A;  2WUL A;  3KSP A;  3IJE B;  1BNE A;  1HD2 A;  2YV7 A;  3C1S A;  5D93 A;  2NPB A;  3NV0 A;  3MIX A;  2LRC A;  1TU8 A;  3S67 A;  1GMR A;  5JWO B;  4QWT A;  4BA7 A;  5J5N A;  4H61 A;  2GEY A;  3Q90 A;  3AGO A;  1QMV A;  5JCG A;  1XWK A;  5A4U A;  1UGI A;  1BU4 A;  1WMP A;  5ABR A;  5IER A;  3BJ5 A;  5DDL A;  1FOV A;  3ED3 A;  1UN2 A;  2HRA A;  2CW9 A;  2CWT A;  1HKX A;  4FYU A;  3F3R A;  2QGV A;  2V6K A;  4XS1 A;  2YFL B;  5J4U A;  5IPH A;  5B6N A;  4ECJ A;  2ALB A;  1Q40 B;  3EE1 A;  3UAP A;  2K8S A;  1GOV A;  4OFM A;  4N6U A;  1S5A A;  2W6J H;  4CHS A;  1BAO A;  1BRG A;  5D9X A;  1R4W A;  3LSZ A;  1PFP A;  1W02 A;  2IMI A;  1SKS B;  4ZL9 A;  3L0R A;  1Q40 A;  2XFS A;  3ZIV A;  1A8L A;  3X42 A;  1QUW A;  2TRC P;  4KAE A;  1J08 A;  2DKH A;  4MMM A;  3B4O A;  2OBK A;  3DKS A;  3IA1 A;  5L71 A;  1PN9 A;  1T5Y A;  2EIQ A;  3CSJ A;  1RW1 A;  2VL2 A;  4AKY A;  1FVJ A;  3EYT A;  4AJ6 A;  1AY7 A;  1I2G A;  1M7T A;  3E99 A;  3APO A;  5ID2 A;  1N8R 4;  2QA4 3;  3N8B A;  4YQU A;  3Q1C A;  4Z2T A;  2HFD A;  7STD A;  3CC4 3;  4GRF A;  3HY2 A;  3GWR A;  5AEU B;  3G4S 3;  4TR1 B;  1BSA A;  1B2S A;  4XTS A;  5E59 A;  1BNG A;  2C0F A;  2OBI A;  3ZVJ A;  4N11 A;  5DAK A;  2DC5 A;  3WOF B;  2LNT A;  4HU9 A;  1PYL A;  3D22 A;  3OX9 A;  3GMF A;  3DXB A;  1WNH A;  1NB3 I;  3Q74 A;  3FZ4 A;  4LEH A;  3QOU A;  4F0C A;  3W6G A;  4POL A;  3ALA A;  1W00 A;  3S9F A;  2O7K A;  3VSY A;  1GOY A;  2VL3 A;  1EGR A;  3ZG5 A;  3IPZ A;  2CC3 A;  2BTO T;  3KM6 A;  3F4R A;  3VLN A;  2W9Q A;  2BO9 B;  1PL1 A;  4GF0 A;  5CYY A;  2G2Q A;  3X3Z A;  2OJL A;  2P5R A;  1F2E A;  4P3Y B;  4WKW A;  3EX9 A;  4O2H A;  4KND A;  2W56 B;  3FF2 A;  1YJN 3;  4PXO A;  2H1D A;  2V1L A;  1F6M C;  1YZX A;  4WXT A;  3S27 A;  3DWV A;  1BJX A;  2F51 A;  2LEG A;  1RSN A;  4L7K A;  5DCH A;  1I2F A;  4L5O A;  4TR3 A;  4WR4 A;  4CW9 A;  3O6T A;  2C4B A;  3KH9 A;  2OAD A;  3ZML A;  3NBB A;  2KRT A;  1BNJ A;  4X2O A;  2GST A;  3TJG A;  3D21 A;  4Q53 A;  3KMN A;  4OUQ A;  1W2Z A;  5DRV A;  3NUV A;  5BVB A;  2LJA A;  3LXZ A;  3MG1 A;  3FR6 A;  1ML6 A;  1O7M B;  4FMA A;  2QIY A;  1JHB A;  1K9M 4;  1LRA A;  2Z77 A;  3MPH A;  3FG1 A;  1I70 A;  1MWS A;  1A24 A;  1Y4K A;  3BNE A;  1JJ2 2;  4IEL A;  5B8B A;  2XEP A;  2GTU A;  1USB A;  5IG5 A;  3G0K A;  1A2J A;  5G2G A;  2IJY A;  2W56 A;  1RKY A;  1IVV A;  4IS0 A;  1B2M A;  1ISK A;  1HNC A;  2CH9 A;  1XOB A;  2GZP A;  3F6D A;  5CP1 A;  3RHC A;  2P09 A;  4DSR A;  2FWF A;  4AKZ A;  4PQI A;  2MMN A;  2VUP A;  4HS1 A;  2WJU A;  3DEX A;  2MMO A;  4J57 E;  3IAS 2;  1U88 A;  1A0R P;  2PU9 C;  5ECI B;  1X1Y A;  1DVC A;  1B21 A;  1MNL A;  1K0C A;  3CSH A;  3MG3 A;  1TTZ A;  3M8C A;  1I8V A;  5DAL B;  1IQY A;  3MYD A;  5C00 A;  1BNF A;  1E6B A;  4K7N A;  4TXO A;  2XBQ A;  3ERG A;  3U97 A;  2CFL A;  1NJI 4;  1DMN A;  3CNM A;  4O3V A;  4KF9 A;  4EBG A;  4OFN A;  2H1B A;  4TXO B;  5IF6 A;  1HQO A;  2FA8 A;  4YKF A;  1BG5 A;  1SK0 A;  1UUW B;  3GYK A;  4Z2R A;  1N8J A;  2LTK A;  3F40 A;  5INY A;  2GSR A;  1SK1 A;  1GH2 A;  2QSI A;  3IDV A;  1ERV A;  3NXJ A;  4FIW A;  20GS A;  1D6U A;  2J8X B;  1GTI A;  1M9B A;  2WZ9 A;  2FWH A;  3PZW A;  5EL8 A;  1AQW A;  2KP1 A;  3FW2 A;  1M0U A;  3ECF A;  4BWQ A;  3FZW A;  5KP3 A;  1M99 A;  2O89 A;  5I97 A;  1U3A A;  6GSS A;  1C54 A;  5EY6 A;  4EC0 A;  4IBP A;  2KUC A;  4L8P A;  3KJY A;  1ZZY A;  2CX4 A;  4JED A;  1M1X B;  1NW2 A;  1ZX2 A;  3NHX A;  2XPD A;  5IOW A;  2O9U X;  2F8F A;  4FR9 A;  2R0G A;  4EC6 A;  5BU4 A;  2HNL A;  1VQ7 3;  1TI3 A;  4J56 E;  1YVS A;  3TRP A;  2F98 A;  2PPT A;  5D82 A;  1OPY A;  4ULX A;  4FCZ A;  4F2I A;  4IPB A;  2W03 A;  4MJB A;  2Z9S A;  3A2V A;  4HQS A;  1DSB A;  3I69 A;  1RQM A;  3OV4 A;  2CWV A;  1GNE A;  1LBK A;  2J23 A;  3A5W A;  3GN3 A;  5STD A;  4KFE A;  4N0V A;  4NMU A;  3UB1 A;  5AIS A;  5LC7 A;  3CTF A;  1HU9 A;  2RNT A;  4TR1 A;  4EYC A;  1G6W A;  1Z6M A;  2D1W A;  1OH0 A;  2L4Q A;  3GKN A;  1BAY A;  5HR0 A;  2GGT A;  5DJL A;  2LNS A;  1US1 A;  1YF0 A;  1B2U A;  1GUL A;  2FWE A;  3RPP A;  4LZI A;  2IMF A;  2IA7 A;  2RUF A;  1NHO A;  4F0B A;  1AXD A;  2C8U A;  4NWY A;  2HZE B;  1RGA A;  3VWU A;  3IBH A;  1XZO A;  1FUW A;  3W8J A;  3T8U A;  4EF0 A;  3LZA A;  2F5W A;  1ROA A;  2X4A A;  1BRI A;  1SII A;  1LOY A;  3CPW 2;  5GST A;  5KP1 A;  4WBJ A;  5LNK e;  4MMZ B;  4MJD A;  4PEJ A;  2YJ7 A;  1FO5 A;  4KCE A;  3WT1 A;  1PD2 1;  5IG0 A;  4I2U A;  1D6Z A;  1QAL A;  4E8H A;  5AN1 A;  1C72 A;  3VGN A;  2JAC A;  1KD1 4;  3RAZ A;  1JV2 B;  1ZO2 A;  4PUA A;  5BXQ A;  2R2J A;  4OWY A;  1AQV A;  2WGO A;  1LJR A;  3TJF A;  4BPY A;  3D5G A;  1A67 A;  2DJK A;  3GH9 A;  5J9C A;  4HOJ A;  2E2M A;  2HMJ B;  5KN0 A;  5CLK A;  3WA3 A;  3SOA A;  1NB5 I;  1O81 A;  4GXZ A;  2K8V A;  1KTE A;  3EVI A;  3OR5 A;  1YIT 3;  4HJL B;  2LQO A;  4XS6 A;  3STD A;  5IQY A;  2A4V A;  2DJJ A;  2TIR A;  2WOH A;  1M1K 4;  3EWL A;  5ELG A;  3MG2 A;  4K61 A;  1RGF A;  2EC4 A;  1CQH A;  1GMP A;  5M1A A;  5EQL A;  4XDW A;  1L5G B;  3JUO A;  3X40 A;  5E4W A;  1U5O A;  4K5R A;  5ECH B;  2RCD A;  2J9H A;  6GSX A;  4ORL A;  1YIJ 3;  4OCE A;  2BHM A;  4NRE A;  5ECL B;  3N54 B;  1GUM A;  2C0G A;  3QAV A;  3LWA A;  1K8A 4;  1SJI A;  5J3R A;  1YQ1 A;  1OGX A;  3CMA 3;  3GZY B;  4DSS A;  3D6I A;  4NPB A;  4HZ4 A;  5IO0 A;  2AAD A;  3GAX A;  1EP7 A;  1V2A A;  4DSS B;  1MWU A;  3X3Y A;  2DJ2 A;  1GRX A;  1YVB I;  3URP A;  2MYG A;  2C3Q A;  5HFG A;  2XPE A;  2AUV A;  2Q07 A;  3KFQ C;  2ES7 A;  3AHS A;  2ON5 A;  1CH0 A;  1RNT A;  1I3I A;  2GXF A;  3TJB A;  2LJR A;  3Q6O A;  4ECC A;  4IJ3 A;  1RGL A;  3N9H A;  1GTA A;  1ULI B;  1TP9 A;  4RQR A;  1BSE A;  2FXT A;  1M9G A;  4KE3 A;  1VQP 3;  4IN0 A;  5M19 A;  3PGB A;  1W2B 2;  3AMO B;  1Q82 4;  4O5U A;  3TCO A;  4CDO A;  4K0N A;  4CY6 A;  1RDS A;  1GLQ A;  3CC7 3;  4H3U A;  1QXH A;  4OFT A;  4ID0 A;  1FAA A;  1XXU A;  1B4Q A;  3KZT A;  5IOX A;  2GLR A;  3C73 A;  4MPG A;  2IMK A;  2C0E A;  2H01 A;  3GHA A;  3NQZ A;  4XDV A;  1KEB A;  4G0K A;  1OKD A;  1DUG A;  3KP9 A;  1WTH A;  1F8N A;  1EKM A;  3HVS A;  3HA9 A;  1UUV B;  1THX A;  3FKF A;  4MMY B;  1BRN L;  3CCM 3;  4MPF A;  1FHE A;  4EDY A;  4ICY A;  1TDI A;  1W4V A;  2E2T A;  1LOX A;  2IL3 A;  1XCC A;  1A2V A;  4K5S A;  1X0R A;  4WF5 A;  4BL7 B;  1C7H A;  2HT9 A;  3CTG A;  2RFR A;  2KAA A;  3QFB C;  3GUR A;  5A5K A;  1VF4 A;  1VRS D;  5ECK B;  2IMJ A;  4KB3 A;  1MDI A;  3VWW A;  3H3H A;  1N5H A;  5DQY A;  1K0A A;  3EPT A;  1FYS A;  3EC3 A;  2X64 A;  1UCL A;  2E2V A;  3UVH A;  3K9M C;  2H70 A;  6STD A;  4CJN A;  3GKX A;  3F8H A;  2M46 A;  5GSP A;  3GNJ A;  2AV4 A;  2I9H A;  5AIX A;  1AIU A;  4XHM A;  3HJM A;  5AEW B;  3TJJ A;  1OF5 B;  1RGC A;  3LT8 A;  1FOH A;  1W6Y A;  1EOG A;  4MF6 A;  2BT3 A;  3RDW A;  3D5I A;  3EBY A;  3MNG A;  2OA7 A;  1Y25 A;  1BSC A;  3DH2 A;  3F0I A;  4IP1 A;  1PKZ A;  2WGR A;  3C7M A;  5AI1 A;  1X5C A;  5IMA A;  3A76 A;  3S28 A;  3EQQ B;  1A0F A;  2DIZ A;  4TVE A;  3OWY A;  1V57 A;  2WB9 A;  5IPG A;  1BRJ A;  2GBX B;  1ON4 A;  1CYV A;  1GSF A;  3PIN A;  1B2Z A;  1VQ8 3;  3EMP A;  5GZZ B;  1T2H A;  5ECS A;  1BSB A;  2B7J A;  1SEN A;  2Y73 A;  3U1W A;  3JUN A;  1GSD A;  2FHE A;  2JZS A;  3GRD A;  1Z7R A;  1YKA A;  2CK3 H;  1WWJ A;  2I3Y A;  5IMV A;  2F9S A;  5G1K A;  1F3A A;  2XGL A;  2HSM A;  4KDX A;  3H4K A;  8RNT A;  19GS A;  3VWX A;  1HYU A;  3UL3 A;  1G96 A;  3WYW A;  2A2R A;  1J0F A;  4N6N B;  3HJO A;  4KSO A;  3U6V A;  3FG3 A;  3TGZ A;  3CXG A;  1JZD A;  4XIH A;  4BVY A;  1B9X C;  4OMV A;  1W01 A;  3PXM A;  1W89 A;  5DAL A;  3KEB A;  3BND A;  4ZL8 A;  5IEO A;  2IME A;  1IU7 A;  1TOF A;  3H79 A;  1YKC A;  4ZM8 A;  1B48 A;  2H6X A;  3LEF A;  1GSE A;  2SBL A;  1GTB A;  2L57 A;  3FR9 A;  4AGS A;  1TIJ A;  1WQL B;  4G9H A;  2STD A;  4BVX A;  3GSP A;  2VL2 C;  4R9L A;  1SKR B;  1A90 A;  1U6T A;  2G0F A;  2O3O A;  1K0M A;  3KD0 A;  1MOL A;  3F7S A;  5JCW A;  4KH7 A;  2BJX A;  5HR3 A;  4WYK B;  2BU4 A;  3MWZ A;  4KW6 A;  1GNW A;  2V41 A;  7GSP A;  2ZA4 A;  2B3S A;  2B1L A;  5D9T A;  4ILF A;  2QA1 A;  4FQU A;  3GV1 A;  4V2L A;  2ZNM A;  1H4O A;  3IC8 A;  1T00 A;  1VQN 3;  3QAG A;  3GSS A;  4LGQ A;  1GY6 A;  2R6K A;  5CAX A;  2H75 A;  4HQZ A;  1K0B A;  3VK9 A;  1A2K A;  4ZB9 A;  11GS A;  1TJD A;  1U3I A;  1ZYN A;  5KEJ A;  4HZB B;  3DGQ A;  1LNI A;  1AV4 A;  1BRH A;  4R4K A;  2AYT A;  2LV3 A;  3M1G A;  3D9R A;  5TGN A;  1K3O A;  2C3T A;  1DET A;  1KWI A;  4JZQ A;  2R4I A;  5G5E A;  3DGM A;  5IW9 A;  3GTU A;  1RNB A;  2JSY A;  1SL0 B;  1GL8 A;  2VOC A;  4J9A A;  3CCE 3;  3L9V A;  1NO3 A;  1TTO A;  3UNL A;  2C11 A;  4GQF A;  4FMC A;  2VCW A;  4V1A p;  3UJM A;  3O76 A;  3CNX A;  1X1W A;  2YOI A;  1WOU A;  1JBS A;  2P0M A;  1PL2 A;  5FT3 A;  3VPQ A;  3ZRE A;  1YI2 3;  1AAZ A;  4L0U A;  3JVC A;  1OC9 B;  4PUR A;  2M7O A;  3VFI A;  3TB2 A;  2OTJ 3;  4NV5 A;  3UIW A;  2L1S A;  2IPA A;  5ECM B;  1XVQ A;  5CF1 A;  2HMO B;  5D96 A;  2WGQ A;  3H1N A;  1VF3 A;  3VI5 A;  4TXV A;  3WR2 A;  2F3M A;  5HFK A;  2QGU A;  2K6V A;  1BUJ A;  3TOT A;  3D4M A;  2RBI A;  3SLU A;  2HZE A;  2CHC A;  5B7C A;  5F05 A;  3WDG B;  1Q4J A;  3LYP A;  4BTX A;  4KFF A;  3GZB A;  4MMX B;  5F07 A;  3V1W A;  3H93 A;  2GQK A;  1LOW A;  5DVB A;  1T4Y A;  4L5L A;  3I9V 2;  1RMS A;  3WGD A;  1RRH A;  1W4N A;  3CBU A;  5CXO A;  1DBY A;  1MGW A;  1PMT A;  2YFJ B;  1N9J A;  2H66 A;  3KSE D;  4R80 A;  5F0G A;  2PWJ A;  4FMB A;  1G7O A;  1PY3 A;  3UL5 A;  1SIH A;  4FYB A;  2VCX A;  1SAR A;  2DBC A;  4TR4 A;  1TRQ A;  1X5D A;  4O92 A;  1R5P A;  2RGQ A;  4XRD A;  5J9B A;  1T3B A;  2WOF A;  2HE3 A;  2RSX A;  2VLT A;  3IAM 2;  1JLW A;  1Q98 A;  3LXT A;  2H76 A;  5IG4 A;  1QJG A;  2CG0 A;  2LUS A;  3NX0 A;  1Q81 4;  1IYY A;  2VIM A;  1GY7 A;  1RJO A;  5RNT A;  1JB5 A;  1T8E B;  1YDK A;  4HVN A;  1FUT A;  2CFD A;  2XFT A;  1ZMA A;  2XR8 B;  4XM4 A;  4MA9 A;  3LTD A;  3LYG A;  4HZ9 B;  5KOX A;  3SX1 A;  4GSP A;  3D5J A;  4N6O B;  1WMO A;  5CO3 A;  3FRC A;  1A2P A;  2CX1 A;  4EE0 A;  3ZYW A;  4IP6 A;  3M3M A;  5KP4 A;  1JBT A;  2V32 A;  1WE0 A;  1IQ8 A;  2L6D A;  1DE2 A;  3WOD G;  4KSM A;  3LG6 A;  2XH9 A;  4HM0 B;  1ZYQ B;  1OHO A;  5KN3 A;  3IK7 A;  1TRV A;  4EO3 A;  3LQ7 A;  4MK3 A;  5B8A A;  3E3E A;  1VF2 A;  1W6C A;  3GTU B;  1BNS A;  4K2X A;  4IQA A;  1Q7Y 4;  2GEX A;  3R2Q A;  3NBR A;  3VUR A;  4ECB A;  2O87 A;  4YAV A;  6GSU A;  2K9F A;  5DJM A;  4TRX A;  3GST A;  4BVY B;  3KN4 A;  2MBT A;  3KTL A;  2VCQ A;  3JCM L;  1AQX A;  1GOU A;  2GU3 A;  5D9W A;  3ZLP A;  4ECI A;  2GZY A;  2LKU A;  4O5Q A;  1JB2 A;  3BB9 A;  3ZFB A;  5HR2 A;  5FGO A;  3IHQ A;  3LH4 A;  1FW7 A;  4GST A;  1MGR A;  3IK9 A;  2D2Z A;  1FG4 A;  1IYI A;  2WDU A;  7RNT A;  3TKS A;  1GLP A;  2CQ9 A;  2QA2 A;  3A5E A;  2RII A;  3O8Y A;  7GSS A;  4RNY A;  4XBX A;  5DBQ A;  4XRA A;  4WYK A;  4WP5 A;  3DVX A;  2PVO C;  3EE2 A;  1TI1 A;  2IUK A;  2PNC A;  4F9Z A;  2JAD A;  1AVL A;  4RI7 A;  3LJR A;  2VO4 A;  4DVC A;  3SVA A;  3G7J A;  3FMW A;  4XCS A;  4G2E A;  1SYR A;  1LQM B;  2C10 A;  2UUG C;  3DM8 A;  5IM9 A;  3UAR A;  4A5P A;  1JBR A;  3HVX A;  2UX0 A;  1FUS A;  1KBN A;  3EC9 A;  2EIO A;  2AHE A;  4U13 A;  2LRT A;  4I6X A;  2H1A A;  5IEP A;  2OTL 3;  1XG8 A;  3WD6 A;  4NXI A;  4YQV A;  1FGQ A;  4HBR A;  4JR6 A;  3KXO A;  3T0U A;  4BIK A;  4XBT A;  1O7H B;  2NDO A;  1TW9 A;  1TK5 B;  1BGS A;  3BNC A;  2ON7 A;  1G7E A;  3L0H A;  4LL4 B;  5JWR B;  3FLJ A;  1ZGN A;  1OE8 A;  4MJA A;  4IIA A;  3ZFL A;  1OKT A;  1TU5 A;  4TKY A;  2CFW A;  4MP4 A;  4TX4 A;  1IVX A;  2GBW B;  1A2L A;  3GA4 A;  3CXC 2;  1ERU A;  1FB6 A;  5IG3 A;  1X9S B;  1BNI A;  2LQV A;  1VGL A;  1EEJ A;  4EVM A;  3CCR 3;  1IT7 A;  2V6O A;  4ISD A;  4K0G A;  1WMN A;  4KFD A;  1X5E A;  1I3F A;  3P90 A;  2GQM A;  1BYE A;  1Z5Y E;  1ST9 A;  1NHY A;  1VQ6 3;  4OD7 A;  2HRK A;  3DUK A;  4MH2 A;  3OWU A;  3GIX A;  1PQN A;  3RBT A;  5CRE A;  4I97 A;  1I0V A;  2LS5 A;  2BMO B;  2M72 A;  3PPU A;  3GX0 A;  4ZBB A;  1YF1 A;  5ELJ A;  2IWT A;  1EOH A;  3ZVJ D;  5A4V A;  3J7Y k;  2OE3 A;  4HM1 B;  4I5Q A;  5BRT A;  4OO5 A;  2B5X A;  3WT2 A;  3DGL A;  4TW5 A;  3J7Y b;  3WOE B;  1I9D A;  1JZW A;  2GDR A;  1O7P B;  4QL9 A;  2KF4 A;  4BU4 A;  4ZL7 A;  1MEK A;  1SJZ A;  1UI8 A;  3UJ1 A;  5H5Q A;  1VF1 A;  3DRN A;  3ZIT A;  4IHU A;  3MHE A;  2OWP A;  3I56 3;  3HXS A;  1DE1 A;  1Q7H A;  5HR1 A;  4WF4 A;  1ZGX A;  3P2A A;  2N5B A;  2IMD A;  4PTS A;  3FH1 A;  3G7I A;  1STF I;  2B5E A;  2FCH A;  1UUG B;  3RGR A;  3OW2 2;  3UBK A;  3PCR A;  2LST A;  5FW5 A;  3HI7 A;  1JB4 A;  4YQM A;  1F9M A;  5CK6 A;  2XSH B;  4OK0 A;  1R5A A;  2L4C A;  4D73 A;  2YWN A;  3TDG A;  3QAW A;  3S29 A;  1R26 A;  3IRA A;  3GKK A;  4KDY A;  4O7H A;  4K6X A;  2GS3 A;  4FO5 A;  2A2P A;  4XS4 B;  4MAB A;  3HII A;  5G1L A;  5D83 A;  3SYU A;  5AIF A;  3HYP A;  2R37 A;  4HZ2 A;  2TRX A;  4EIP A;  2YWI A;  3CCQ 3;  1GUH A;  1XVW A;  2B1K A;  1G0T A;  1EGO A;  1BIR A;  1FGM A;  2GVP A;  4XBY A;  4CDL A;  4L8E A;  1OAZ A;  1XWB A;  3DY5 A;  1GSY A;  3EN1 B;  1UCJ A;  2BMQ B;  4I2T A;  4MCU A;  2WS2 A;  3ZZX A;  2HOH A;  3EJV A;  4HM5 B;  2FLS A;  3SXX A;  4GL6 A;  5AIH A;  5DRE A;  2E0Q A;  2OKA A;  5ID2 B;  2KF3 A;  2WFC A;  1BSD A;  3F63 A;  1SJW A;  3FR3 A;  4O5R A;  1MDK A;  3EB8 A;  3P7X A;  4O8S A;  3UEM A;  1K3Y A;  2CVB A;  3RPN A;  4HKV B;  3GUS A;  1IVW A;  3IXR A;  1IDP A;  2UGI A;  2KXG A;  1PN0 A;  3D3L A;  2JZT A;  2A15 A;  4WBR D;  1JKG A;  3PGT A;  1K0O A;  2B1X B;  4LMV A;  1CQS A;  4BVX B;  3BIR A;  2HI7 A;  5IEN A;  3HVV A;  4K2D A;  1NNV A;  3X3X A;  1Z7P A;  2X99 A;  1NU3 A;  2BNG A;  3GZX B;  1MWT A;  1ACV A;  1XIY A;  1YJ6 A;  1HNB A;  1BX9 A;  3BCK A;  4ZXG A;  1SD9 A;  4NHF A;  5M18 A;  1XWC A;  4USS A;  5DCG A;  3US3 A;  5IO2 A;  1OHP A;  3M9J A;  1ZS7 A;  1PRX A;  2A2S A;  3CC2 3;  2MMZ A;  4HEA 2;  2AAE A;  1EEM A;  2MC8 A;  4HM3 B;  2H73 A;  1RK4 A;  3UVT A;  3ZFZ A;  3ZRD A;  3MWH A;  4GLT A;  1J9B A;  3ER7 A;  4RNZ A;  2B5Y A;  3DZL A;  5G2Z A;  1M90 4;  5HFI A;  3SOY A;  1RGK A;  2MF7 A;  2REM A;  1X1X A;  2HXK A;  1BOX A;  1Q86 4;  3EN8 A;  2CFG A;  1ERT A;  4MEI A;  4YH2 A;  1JFU A;  3HOH A;  4G1M B;  2H8L A;  4HDE A;  4X2H A;  1SL2 B;  1IV9 A;  4LSO A;  3PR8 A;  2HSH A;  2I4A A;  1IT8 A;  1T4Z A;  2AB6 A;  1URM A;  1IVU A;  1PX7 A;  12GS A;  3KCM A;  4O02 B;  2XBI A;  1UCK A;  1AQZ A;  4K8M A;  1RCK A;  3TKS E;  3IR4 A;  2E2U A;  2I1U A;  4FCM A;  3CMI A;  3H51 A;  3IHG A;  1SYX A;  1BNR A;  1U87 A;  1V40 A;  3IOS A;  5LD0 A;  3RDE A;  2B7K A;  2CZ3 A;  2MZC A;  1TP6 A;  2NVL A;  2HSY A;  5ELU A;  3OWS A;  1WRY A;  3DVW A;  1S3C A;  1GYB A;  1YJ9 3;  1CQG A;  5A4W A;  4J8T A;  3TKQ A;  4WR5 A;  2P0G A;  1SQW A;  1T1V A;  2DML A;  4XB5 A;  3CSI A;  1FGO A;  3GH6 A;  3CYN A;  4GWR A;  4RBN A;  2HML B;  4EV5 A;  2R0C A;  4R1K A;  2DJ0 A;  2H0I A;  1ULJ B;  2WO0 A;  1GD4 A;  1K73 4;  2RM6 A;  1YEX A;  6GSY A;  3QK9 A;  2L4V A;  4RNT A;  3D0Z A;  2PGT A;  1OAC A;  3M9K A;  1GSQ A;  4IGJ A;  2CX0 A;  1LQG C;  1O8W A;  5LC6 A;  3WA2 X;  5G30 A;  2IIY A;  4X43 A;  2W2C A;  2GU1 A;  3PYJ A;  1D6Y A;  5CRD A;  1M3I A;  2P5Q A;  3GX8 A;  4NV2 A;  2C4J A;  4BL2 A;  3KKG A;  2MMA A;  3CU3 A;  5IMF A;  4F03 A;  2CFK A;  1HZ1 A;  3CCU 3;  3PH9 A;  2D42 A;  3W8S A;  1XWA A;  2B6M A;  3JUQ A;  3A2W A;  3E9J B;  1GMQ A;  1YGW A;  4KVH A;  3WMD A;  3V99 A;  1THO A;  2VM1 A;  4GSN A;  4Q5Q A;  2VD0 A;  2YX9 A;  4FYC A;  4N30 A;  2DSA A;  2V2G A;  3HZ4 A;  2X8H A;  4KGI A;  1E3V A;  1M9A A;  3EUR A;  3NM2 A;  2OAC A;  3G71 3;  1VQ9 3;  1GSS A;  2HLS A;  2N5F A;  4TN8 A;  1YNV X;  3AMO A;  2H74 A;  2KCD A;  3FEU A;  2DMM A;  1OC8 A;  5COH A;  2XRX B;  3DIE A;  4TOP A;  4PQH A;  2DJ3 A;  3FGY A;  2GSQ A;  3ZG0 A;  4HM8 B;  4KT3 B;  4PNF A;  4CPK A;  2XC2 A;  3HJP A;  3KZQ A;  2YNX A;  3QPM A;  1TU7 A;  2JSZ A;  3BLZ A;  3FZ9 A;  4PX1 A;  3HZP A;  5IMC A;  3K7C A;  3IPT A;  2IFQ B;  2IY2 A;  2KOK A;  4RUV A;  1E97 A;  3DGO A;  5EVO A;  2HMM B;  1FB0 A;  3HDC A;  3QRD A;  5H5S A;  2FWG A;  3F14 A;  5AIG A;  1EZK A;  4R9K A;  4ZBA A;  2R5G A;  4HM7 B;  3QR6 A;  4V1A g;  2H71 A;  1DMM A;  18GS A;  2CG1 A;  5AGY A;  22GS A;  5GSS A;  1TXX A;  2H30 A;  2JZR A;  2P31 A;  4OCF A;  2BMX A;  13GS A;  1B27 A;  5CF2 A;  4K7I A;  3SWL A;  3L78 A;  3PCS A;  2RM5 A;  4EKZ A;  4KZ1 A;  4G10 A;  1RN4 A;  5EVH A;  2LYX A;  4N10 A;  1O7G B;  1K0N A;  5ECR B;  3VI7 A;  2R0P A;  4G19 A;  2V1M A;  3HIG A;  4NHW A;  5AII A;  3FG4 A;  2KHP A;  3UMA A;  4GQC A;  3KII A;  4MH3 A;  1PSQ A;  4O32 A;  3MDK A;  1ZYP A;  2FA4 A;  3CCJ 3;  1K41 A;  1QK8 A;  2DKI A;  2PUK C;  2ZHX B;  3CQF A;  3Q19 A;  3O3T A;  3MSO A;  1B2X A;  1UW1 A;  2HZF A;  1QVG 2;  3JUM A;  4BL3 A;  4MDC A;  2FD3 A;  3HZ8 A;  1K0D A;  3ERW A;  4IVF A;  3KCH A;  3D4T A;  4YKG A;  3RGA A;  3F9S A;  4HJM A;  4WET A;  5KOW A;  3FK8 A;  2IFQ A;  3FYG A;  3L4N A;  2CV4 A;  1QFN A;  3FSD A;  1F3B A;  17GS A;  2WCI A;  1TFK A;  3DXO A;  1FGT A;  2VM2 A;  1YEP A;  1JN5 A;  1BUQ A;  5JBS A;  3BU4 A;  1TRU A;  3OXA A;  1VQO 3;  3U5R E;  3C1R A;  1PA3 A;  1GUK A;  3DML A;  2CIU A;  2YWM A;  4Q5F A;  2PMT A;  3LTA A;  4ZIL A;  4HM2 B;  1MTC A;  4CY8 A;  4N6T A;  1MWR A;  4EIQ A;  4EL1 A; 
#chains in the Genus database with same CATH homology
 3GL5 A;  4X4J A;  2VCV A;  2AJQ B;  2L59 A;  1EWX A;  3TKS C;  1BED A;  4IW9 A;  5DQS A;  2CT6 A;  1TRW A;  2M80 A;  2X8C A;  3VPT A;  1S3A A;  1WP0 A;  2VAF A;  3TRQ A;  6GSV A;  4OO4 A;  3F3Q A;  5KN1 A;  4EDZ A;  3GFK A;  2OE1 A;  2I81 A;  3KGK A;  3ERF A;  3FY7 A;  3K8N A;  1XW5 A;  1OC3 A;  3IE3 A;  1MD4 A;  4RI6 A;  4ZB8 A;  3HD5 A;  4IKH A;  3GKM A;  2L5O A;  2CAQ A;  3NIV A;  2VD1 A;  5D9V A;  3I6A A;  1LU4 A;  6GSW A;  1PKW A;  5JCU A;  3LW9 A;  2X8G A;  5FWG A;  4LA1 A;  3UOM A;  5D8I A;  4F82 A;  1UVZ A;  3ISO A;  3FZ5 A;  3ME7 A;  4PQ1 A;  3GRX A;  4WEY A;  4LMW A;  1V9W A;  1IYH A;  4KDU A;  3DD3 A;  4GTU A;  3G9B A;  4BL7 A;  2AAW A;  2RLI A;  3HKR A;  1ZCP A;  4N0Z A;  3C8E A;  3BBY A;  2CA8 A;  5GAP D;  5C04 A;  2FGX A;  1G6Y A;  4JE1 A;  1ERW A;  3KH7 A;  5DAK B;  4H86 A;  1UA5 A;  14GS A;  3SBC A;  2GZZ A;  2NBS A;  1E2Y A;  4MZW A;  5ELA A;  1B8X A;  3HCZ A;  3TKP A;  2VLV A;  4I8B A;  4J2F A;  5ECN B;  3TUE A;  1Y6E A;  2A4H A;  3RHB A;  5JWQ B;  3APQ A;  1XBS A;  4AF2 A;  1SL1 B;  2XHF A;  4KUN A;  5ECP B;  1B9Y C;  1PGT A;  2E7P A;  4QQ7 A;  2MBS A;  1UC7 A;  3G7Y A;  2C80 A;  4ZB6 A;  2JL4 A;  3ME8 A;  1K3L A;  1M2B A;  2CX3 A;  6GST A;  3EMX A;  1ILO A;  2H19 A;  2DIY A;  4POM A;  1ZOF A;  4V2N A;  1SK2 A;  4IQ1 A;  5ECO B;  2OE0 A;  4RQX A;  2C3N A;  3ZTL A;  2H6Y A;  2IYJ A;  2YJH A;  4ZIJ A;  3F4T A;  3A2X A;  2N5A A;  1PX6 A;  4LLR A;  2HYX A;  1M2D A;  4TR0 A;  5IMD A;  1AC1 A;  4MLY A;  2K18 A;  4PGT A;  3F4S A;  4JBB A;  4LL1 B;  3WGX A;  3MSZ A;  1NM3 A;  4DSQ A;  1M2A A;  3ZMK A;  1O8X A;  1T7P B;  1HNA A;  2VL9 A;  1TK8 B;  3F9U A;  5GAN D;  4G0I A;  4EXJ A;  3I43 A;  4MJC A;  4L0W A;  10GS A;  1YY7 A;  9GSS A;  2YCD A;  5CRH A;  5H5R A;  3TJK A;  2PN8 A;  4AJ8 A;  4HI7 A;  1Z3E A;  1WJK A;  3N5O A;  2YZH A;  3NZN A;  1Z6N A;  5F06 A;  1KNG A;  2ZCT A;  3QDN A;  3C71 A;  2YP6 A;  5IMZ A;  1GP1 A;  5FHI A;  4EUY A;  5BMU A;  3E0U A;  1B4P A;  4ACS A;  2VLU A;  3TOU A;  5EPF A;  3IV4 A;  4KX4 A;  2FNO A;  5HQP A;  1A2M A;  1O6J A;  1EV4 A;  3R3E A;  4KCA A;  4XS4 A;  3F6F A;  4HJ2 A;  4ML1 A;  3HHV A;  1V58 A;  2FY6 A;  1MDJ A;  1JZR A;  2NTO A;  3AY8 A;  2GT5 A;  5LCZ A;  4Q5N A;  3CRT A;  1EV9 A;  5B6M A;  3F8U A;  2PER A;  1QQ2 A;  1WPI A;  1GSU A;  1N2A A;  4GCI A;  4MJE A;  4Q5R A;  4Z7X A;  3QCP A;  1OE7 A;  3MAK A;  1TK0 B;  4IJI A;  4POB A;  2KP2 A;  3BCI A;  3N9J A;  4K7O A;  2EIR A;  2LRN A;  3A3T A;  2R4V A;  4X1U A;  3M0F A;  5CRW A;  1O7U A;  2FUG 2;  3CRU A;  3GL3 A;  2LQQ A;  1F37 A;  2L5L A;  2PBJ A;  3P8W A;  3ZIJ A;  3QD9 A;  4POK A;  2IN3 A;  3L9U A;  5IIZ A;  4AJ7 A;  4D73 B;  3NOF A;  2L6C A;  2YAN A;  2CZ2 A;  2H0G A;  1FVK A;  2KLX A;  4JR4 A;  2CVK A;  2QC7 A;  3UBL A;  1O73 A;  2UZ8 A;  2CAI A;  5D73 A;  4K1F A;  2PVQ A;  3BOA A;  5ECQ B;  3H8Q A;  4JRR A;  3TKR A;  1SJ6 A;  5CRG A;  1FW1 A;  5J41 A;  3WGE A;  5CNW A;  2YV9 A;  1I5G A;  1A8Y A;  1A23 A;  4FH8 A;  3BD2 A;  1XW6 A;  4ML6 A;  1SD8 A;  4X0X A;  5KN2 A;  4MF5 A;  1SU9 A;  3KP8 A;  1V98 A;  1WMJ A;  1AUC A;  3ZL5 A;  4Z2U A;  2HRN A;  1QGV A;  2H1G A;  3EU3 A;  1H75 A;  5G5F A;  1TKD B;  4QL7 A;  3EIN A;  2RUE A;  1NSW A;  2VCZ A;  1SKW B;  5ENU A;  1ABA A;  2C0D A;  1EP8 A;  1XW9 A;  2C1Y A;  2LJK A;  3KIJ A;  2H0H A;  2CVD A;  4BWS A;  3LGC A;  4ZBD A;  2YPM A;  4MZC A;  2DLX A;  3KMO A;  1AW9 A;  4MF7 A;  4HU7 A;  4YAP A;  2QKE A;  1XWG A;  4K9Z A;  1OYJ A;  1X9W B;  1TRS A;  1ZL9 A;  4G0L A;  1GWC A;  2E2G A;  2DJ1 A;  2ZUP A;  2YN1 A;  3FHK A;  4E8E A;  2YWO A;  1GTU A;  3KTB A;  1MD3 A;  3M8N A;  3LYK A;  1R7H A;  3Q18 A;  2GQL A;  3LFL A;  2O85 A;  1S3D A;  2GSS A;  2WRT A;  2R3X A;  3EU4 A;  2HRF A;  4KA0 A;  1WIK A;  1XOA A;  4JU5 A;  3LOR A;  2YZU A;  4MNN A;  4PUF C;  5G31 A;  3TRX A;  2O8V B;  2F8A A;  3DYR A;  1XPV A;  1XFL A;  4PNG A;  8GSS A;  4MZB A;  5F8B A;  3L9S A;  3QMX A;  3QFA C;  1BQ7 A;  4V2M A;  3APS A;  1OVN A;  2H72 A;  1JLV A;  1ZYE A;  3VWV A;  4NHZ A;  1OC9 A;  1X9M B;  3FZA A;  3IC4 A;  1Z9H A;  2VCT A;  3A5I A;  1JZO A;  5AIV A;  2JU5 A;  1O85 A;  4HUA A;  16GS A;  4GSS A;  4DEJ A;  2H6Z A;  4NAX A;  2GT6 A;  2X49 A;  2WUL A;  1HD2 A;  2YV7 A;  3C1S A;  5D93 A;  2NPB A;  3MIX A;  2LRC A;  1TU8 A;  5JWO B;  4BA7 A;  5J5N A;  1QMV A;  5JCG A;  1XWK A;  5A4U A;  5ABR A;  3BJ5 A;  5DDL A;  1FOV A;  3ED3 A;  1UN2 A;  2HRA A;  4FYU A;  3F3R A;  2QGV A;  2V6K A;  4XS1 A;  5J4U A;  5IPH A;  5B6N A;  4ECJ A;  2ALB A;  3UAP A;  2K8S A;  4OFM A;  4CHS A;  5D9X A;  1R4W A;  3LSZ A;  2IMI A;  1SKS B;  4ZL9 A;  3ZIV A;  1A8L A;  1QUW A;  2TRC P;  4KAE A;  1J08 A;  2DKH A;  4MMM A;  2OBK A;  3DKS A;  3IA1 A;  5L71 A;  1PN9 A;  2EIQ A;  3CSJ A;  1RW1 A;  2VL2 A;  1FVJ A;  3EYT A;  4AJ6 A;  1M7T A;  3APO A;  5ID2 A;  4YQU A;  4Z2T A;  2HFD A;  4GRF A;  3HY2 A;  4TR1 B;  4XTS A;  5E59 A;  2C0F A;  2OBI A;  3ZVJ A;  4N11 A;  5DAK A;  2DC5 A;  2LNT A;  4HU9 A;  3D22 A;  3GMF A;  3DXB A;  3Q74 A;  3QOU A;  3FZ4 A;  4F0C A;  3W6G A;  4POL A;  3S9F A;  2O7K A;  2VL3 A;  1EGR A;  3IPZ A;  2BTO T;  3KM6 A;  3F4R A;  3VLN A;  1PL1 A;  5CYY A;  4GF0 A;  2G2Q A;  2OJL A;  2P5R A;  4WKW A;  1F2E A;  4P3Y B;  4KND A;  4PXO A;  2H1D A;  1F6M C;  1YZX A;  4WXT A;  1BJX A;  3DWV A;  2F51 A;  2LEG A;  5DCH A;  4L5O A;  4TR3 A;  4WR4 A;  4CW9 A;  3O6T A;  3KH9 A;  2OAD A;  3ZML A;  2GST A;  3TJG A;  3D21 A;  3KMN A;  2LJA A;  3LXZ A;  3FR6 A;  1ML6 A;  1JHB A;  1A24 A;  4IEL A;  5B8B A;  2GTU A;  1USB A;  1A2J A;  2IJY A;  4IS0 A;  1HNC A;  1XOB A;  2GZP A;  3F6D A;  5CP1 A;  3RHC A;  4DSR A;  2FWF A;  4PQI A;  2MMN A;  2VUP A;  4HS1 A;  2WJU A;  3DEX A;  2MMO A;  4J57 E;  3IAS 2;  1U88 A;  1A0R P;  2PU9 C;  5ECI B;  1K0C A;  3CSH A;  1TTZ A;  5DAL B;  3MYD A;  5C00 A;  1E6B A;  4K7N A;  4TXO A;  2XBQ A;  3ERG A;  4KF9 A;  4OFN A;  2H1B A;  4TXO B;  4YKF A;  1HQO A;  2FA8 A;  1BG5 A;  1SK0 A;  3GYK A;  4Z2R A;  1N8J A;  2LTK A;  5INY A;  2GSR A;  1SK1 A;  1GH2 A;  2QSI A;  3IDV A;  1ERV A;  4FIW A;  20GS A;  1GTI A;  1M9B A;  2WZ9 A;  2FWH A;  5EL8 A;  1AQW A;  2KP1 A;  3FW2 A;  1M0U A;  4BWQ A;  1M99 A;  2O89 A;  1U3A A;  6GSS A;  5EY6 A;  4EC0 A;  4IBP A;  2KUC A;  3KJY A;  1ZZY A;  2CX4 A;  4JED A;  1NW2 A;  2XPD A;  5IOW A;  2F8F A;  2R0G A;  2HNL A;  1TI3 A;  4J56 E;  3TRP A;  2PPT A;  4ULX A;  4F2I A;  4MJB A;  2Z9S A;  3A2V A;  4HQS A;  1DSB A;  3I69 A;  1RQM A;  1GNE A;  1LBK A;  2J23 A;  3A5W A;  3GN3 A;  4N0V A;  4NMU A;  5AIS A;  3CTF A;  4TR1 A;  1G6W A;  1Z6M A;  2L4Q A;  5HR0 A;  3GKN A;  1BAY A;  2GGT A;  5DJL A;  2LNS A;  1YF0 A;  1GUL A;  2FWE A;  3RPP A;  2IMF A;  2RUF A;  1NHO A;  4F0B A;  1AXD A;  2C8U A;  4NWY A;  2HZE B;  3VWU A;  3IBH A;  1XZO A;  3W8J A;  4EF0 A;  2X4A A;  5GST A;  4WBJ A;  5LNK e;  2YJ7 A;  1FO5 A;  4KCE A;  3WT1 A;  1PD2 1;  4I2U A;  4E8H A;  5AN1 A;  1C72 A;  2JAC A;  3RAZ A;  4PUA A;  2R2J A;  4OWY A;  1AQV A;  1LJR A;  4BPY A;  3TJF A;  2DJK A;  3GH9 A;  5J9C A;  4HOJ A;  2E2M A;  5KN0 A;  1O81 A;  4GXZ A;  2K8V A;  1KTE A;  3EVI A;  3OR5 A;  2LQO A;  4XS6 A;  5IQY A;  2A4V A;  2DJJ A;  2TIR A;  3EWL A;  5ELG A;  2EC4 A;  1CQH A;  5E4W A;  4K5R A;  5ECH B;  2J9H A;  6GSX A;  4OCE A;  5ECL B;  1GUM A;  2C0G A;  3QAV A;  3LWA A;  1SJI A;  5J3R A;  1YQ1 A;  4DSS A;  3D6I A;  4NPB A;  4HZ4 A;  5IO0 A;  1EP7 A;  1V2A A;  4DSS B;  2DJ2 A;  1GRX A;  2MYG A;  2C3Q A;  5HFG A;  2XPE A;  2AUV A;  2ON5 A;  2ES7 A;  3TJB A;  2LJR A;  3Q6O A;  4ECC A;  4IJ3 A;  1GTA A;  1TP9 A;  4RQR A;  4KE3 A;  4IN0 A;  4O5U A;  4CDO A;  3TCO A;  4K0N A;  4CY6 A;  1GLQ A;  1QXH A;  4OFT A;  4ID0 A;  1FAA A;  1XXU A;  1B4Q A;  5IOX A;  2GLR A;  3C73 A;  4MPG A;  2IMK A;  2C0E A;  2H01 A;  3GHA A;  1KEB A;  4G0K A;  1OKD A;  1DUG A;  3KP9 A;  3HVS A;  3HA9 A;  1THX A;  3FKF A;  4MPF A;  1FHE A;  4EDY A;  4ICY A;  1TDI A;  1W4V A;  2IL3 A;  1XCC A;  4K5S A;  1X0R A;  4WF5 A;  4BL7 B;  2HT9 A;  3CTG A;  3QFB C;  3GUR A;  5A5K A;  1VF4 A;  1VRS D;  5ECK B;  4KB3 A;  1MDI A;  3VWW A;  5DQY A;  1K0A A;  3EPT A;  3EC3 A;  2X64 A;  3UVH A;  2H70 A;  3GKX A;  2M46 A;  3GNJ A;  2AV4 A;  2I9H A;  5AIX A;  1AIU A;  4XHM A;  3HJM A;  3TJJ A;  1FOH A;  1EOG A;  4MF6 A;  3RDW A;  3MNG A;  2OA7 A;  1Y25 A;  3F0I A;  4IP1 A;  1PKZ A;  2WGR A;  3C7M A;  1X5C A;  5IMA A;  1A0F A;  2DIZ A;  4TVE A;  1V57 A;  2WB9 A;  5IPG A;  1ON4 A;  3PIN A;  1GSF A;  3EMP A;  5GZZ B;  5ECS A;  2B7J A;  1SEN A;  2FHE A;  1GSD A;  2JZS A;  1Z7R A;  1YKA A;  2I3Y A;  1WWJ A;  5IMV A;  2F9S A;  5G1K A;  1F3A A;  2HSM A;  4KDX A;  3H4K A;  19GS A;  3VWX A;  1HYU A;  3UL3 A;  3WYW A;  2A2R A;  1J0F A;  3HJO A;  4KSO A;  3U6V A;  3TGZ A;  3CXG A;  1JZD A;  4XIH A;  4BVY A;  1B9X C;  4OMV A;  1W89 A;  5DAL A;  3KEB A;  4ZL8 A;  2IME A;  1TOF A;  3H79 A;  1YKC A;  1B48 A;  2H6X A;  3LEF A;  1GSE A;  1GTB A;  2L57 A;  3FR9 A;  4AGS A;  4G9H A;  4BVX A;  2VL2 C;  1SKR B;  1U6T A;  2G0F A;  1K0M A;  3KD0 A;  5JCW A;  4KH7 A;  2BJX A;  5HR3 A;  4KW6 A;  1GNW A;  2V41 A;  2B3S A;  2B1L A;  5D9T A;  4ILF A;  2QA1 A;  4FQU A;  3GV1 A;  4V2L A;  2ZNM A;  1H4O A;  3IC8 A;  1T00 A;  3QAG A;  3GSS A;  2R6K A;  5CAX A;  2H75 A;  4HQZ A;  1K0B A;  3VK9 A;  4ZB9 A;  11GS A;  1TJD A;  1U3I A;  1ZYN A;  5KEJ A;  3DGQ A;  2AYT A;  2LV3 A;  3M1G A;  1K3O A;  2C3T A;  4JZQ A;  5G5E A;  3GTU A;  2JSY A;  1SL0 B;  1GL8 A;  2VOC A;  3L9V A;  4GQF A;  2VCW A;  4V1A p;  3O76 A;  2YOI A;  1WOU A;  1PL2 A;  5FT3 A;  3VPQ A;  3ZRE A;  1AAZ A;  4L0U A;  1OC9 B;  4PUR A;  3VFI A;  3TB2 A;  4NV5 A;  3UIW A;  2IPA A;  5ECM B;  1XVQ A;  5D96 A;  3H1N A;  1VF3 A;  3VI5 A;  4TXV A;  2F3M A;  5HFK A;  2K6V A;  3TOT A;  3D4M A;  2HZE A;  5B7C A;  5F05 A;  1Q4J A;  3LYP A;  5F07 A;  3V1W A;  3H93 A;  2GQK A;  5DVB A;  1T4Y A;  4L5L A;  3I9V 2;  3WGD A;  3CBU A;  1DBY A;  1PMT A;  2H66 A;  5F0G A;  2PWJ A;  1G7O A;  4FYB A;  2VCX A;  2DBC A;  4TR4 A;  1X5D A;  4XRD A;  4O92 A;  1R5P A;  5J9B A;  1T3B A;  2HE3 A;  2VLT A;  3IAM 2;  1JLW A;  1Q98 A;  3LXT A;  2H76 A;  2LUS A;  2VIM A;  1T8E B;  1YDK A;  1ZMA A;  4MA9 A;  5KOX A;  3D5J A;  5CO3 A;  3FRC A;  4EE0 A;  3ZYW A;  4IP6 A;  3M3M A;  2V32 A;  1WE0 A;  2L6D A;  1DE2 A;  4KSM A;  3LG6 A;  1ZYQ B;  5KN3 A;  3IK7 A;  1TRV A;  4EO3 A;  3LQ7 A;  4MK3 A;  5B8A A;  3E3E A;  1VF2 A;  3GTU B;  4K2X A;  4IQA A;  3R2Q A;  3VUR A;  4ECB A;  2O87 A;  4YAV A;  6GSU A;  5DJM A;  2K9F A;  4TRX A;  3GST A;  4BVY B;  2MBT A;  3KTL A;  2VCQ A;  3JCM L;  1AQX A;  5D9W A;  3ZLP A;  4ECI A;  2GZY A;  2LKU A;  4O5Q A;  3ZFB A;  5HR2 A;  3IHQ A;  4GST A;  3IK9 A;  2D2Z A;  1FG4 A;  1IYI A;  2WDU A;  3TKS A;  1GLP A;  2CQ9 A;  2QA2 A;  2RII A;  7GSS A;  5DBQ A;  4XRA A;  3DVX A;  2PVO C;  3EE2 A;  1TI1 A;  4F9Z A;  2JAD A;  4RI7 A;  3LJR A;  2VO4 A;  4DVC A;  3G7J A;  3FMW A;  4XCS A;  4G2E A;  1SYR A;  5IM9 A;  3UAR A;  4A5P A;  3HVX A;  1KBN A;  2EIO A;  2AHE A;  2LRT A;  4I6X A;  2H1A A;  3WD6 A;  4NXI A;  4YQV A;  4JR6 A;  3KXO A;  2NDO A;  1TW9 A;  1TK5 B;  1G7E A;  2ON7 A;  3L0H A;  4LL4 B;  5JWR B;  1ZGN A;  1OE8 A;  4MJA A;  3ZFL A;  1OKT A;  4TKY A;  4MP4 A;  1A2L A;  3GA4 A;  1ERU A;  1FB6 A;  1X9S B;  1VGL A;  1EEJ A;  4EVM A;  2V6O A;  4ISD A;  4K0G A;  1X5E A;  3P90 A;  2GQM A;  1BYE A;  1Z5Y E;  1ST9 A;  1NHY A;  4OD7 A;  2HRK A;  4MH2 A;  3GIX A;  1PQN A;  3RBT A;  5CRE A;  4I97 A;  2LS5 A;  2M72 A;  3PPU A;  3GX0 A;  4ZBB A;  1YF1 A;  2IWT A;  1EOH A;  3ZVJ D;  5A4V A;  3J7Y k;  2OE3 A;  5BRT A;  4I5Q A;  4OO5 A;  2B5X A;  3WT2 A;  4TW5 A;  3J7Y b;  1I9D A;  1JZW A;  2GDR A;  4QL9 A;  4ZL7 A;  1MEK A;  1SJZ A;  3UJ1 A;  5H5Q A;  1VF1 A;  3DRN A;  3ZIT A;  4IHU A;  3HXS A;  1DE1 A;  5HR1 A;  4WF4 A;  3P2A A;  2N5B A;  2IMD A;  4PTS A;  3G7I A;  2B5E A;  2FCH A;  3UBK A;  2LST A;  4YQM A;  1F9M A;  1R5A A;  4D73 A;  2L4C A;  2YWN A;  3TDG A;  3QAW A;  4O7H A;  1R26 A;  3IRA A;  3GKK A;  4KDY A;  4K6X A;  2GS3 A;  4FO5 A;  2A2P A;  4XS4 B;  4MAB A;  5G1L A;  3HYP A;  2R37 A;  4HZ2 A;  2TRX A;  4EIP A;  2YWI A;  2B1K A;  1GUH A;  1XVW A;  1G0T A;  1EGO A;  2GVP A;  4L8E A;  1OAZ A;  1XWB A;  1GSY A;  4I2T A;  4MCU A;  2WS2 A;  3ZZX A;  2FLS A;  2E0Q A;  2OKA A;  5ID2 B;  2WFC A;  3F63 A;  3FR3 A;  4O5R A;  1MDK A;  3P7X A;  3UEM A;  1K3Y A;  2CVB A;  3RPN A;  3GUS A;  3IXR A;  1PN0 A;  2JZT A;  4WBR D;  3PGT A;  1K0O A;  4LMV A;  4BVX B;  2HI7 A;  4K2D A;  3HVV A;  1Z7P A;  2X99 A;  1ACV A;  1XIY A;  1YJ6 A;  1HNB A;  1BX9 A;  3BCK A;  4ZXG A;  1SD9 A;  1XWC A;  3US3 A;  5DCG A;  4USS A;  5IO2 A;  3M9J A;  1PRX A;  2A2S A;  2MMZ A;  4HEA 2;  1EEM A;  2H73 A;  1RK4 A;  3UVT A;  3ZRD A;  3MWH A;  4GLT A;  1J9B A;  2B5Y A;  5G2Z A;  5HFI A;  2REM A;  2HXK A;  1ERT A;  4YH2 A;  1JFU A;  2H8L A;  4HDE A;  1SL2 B;  3PR8 A;  2HSH A;  2I4A A;  1T4Z A;  2AB6 A;  1URM A;  1PX7 A;  12GS A;  3KCM A;  2XBI A;  4K8M A;  3TKS E;  3IR4 A;  2I1U A;  3CMI A;  3IHG A;  1SYX A;  1U87 A;  1V40 A;  3IOS A;  5LD0 A;  2B7K A;  2CZ3 A;  2MZC A;  2NVL A;  2HSY A;  1WRY A;  3DVW A;  1S3C A;  1CQG A;  5A4W A;  3TKQ A;  4WR5 A;  2P0G A;  1T1V A;  2DML A;  3CSI A;  3GH6 A;  3CYN A;  4GWR A;  2R0C A;  2DJ0 A;  2H0I A;  2RM6 A;  1YEX A;  6GSY A;  3D0Z A;  2PGT A;  3M9K A;  1GSQ A;  4IGJ A;  1O8W A;  5G30 A;  2IIY A;  4X43 A;  5CRD A;  2P5Q A;  3GX8 A;  4NV2 A;  2C4J A;  2MMA A;  5IMF A;  4F03 A;  3PH9 A;  3W8S A;  1XWA A;  2B6M A;  3A2W A;  3E9J B;  1THO A;  2VM1 A;  4GSN A;  4Q5Q A;  2VD0 A;  4FYC A;  4N30 A;  2DSA A;  2V2G A;  3HZ4 A;  2X8H A;  4KGI A;  1M9A A;  3EUR A;  2OAC A;  1GSS A;  2HLS A;  2N5F A;  4TN8 A;  2H74 A;  3FEU A;  2DMM A;  5COH A;  1OC8 A;  3DIE A;  4TOP A;  4PQH A;  2DJ3 A;  2GSQ A;  4PNF A;  2XC2 A;  3HJP A;  3KZQ A;  2YNX A;  3QPM A;  1TU7 A;  2JSZ A;  3FZ9 A;  4PX1 A;  5IMC A;  2IFQ B;  2IY2 A;  2KOK A;  4RUV A;  5EVO A;  1FB0 A;  3HDC A;  5H5S A;  2FWG A;  1EZK A;  4ZBA A;  2R5G A;  3QR6 A;  4V1A g;  2H71 A;  18GS A;  5AGY A;  22GS A;  5GSS A;  1TXX A;  2H30 A;  2JZR A;  2P31 A;  4OCF A;  2BMX A;  13GS A;  4K7I A;  3SWL A;  3L78 A;  2RM5 A;  4EKZ A;  4G10 A;  4N10 A;  1K0N A;  5ECR B;  3VI7 A;  2R0P A;  4G19 A;  2V1M A;  4NHW A;  2KHP A;  3UMA A;  4GQC A;  4MH3 A;  1PSQ A;  4O32 A;  3MDK A;  1ZYP A;  2FA4 A;  1QK8 A;  2DKI A;  2PUK C;  3Q19 A;  3O3T A;  2HZF A;  4MDC A;  2FD3 A;  3HZ8 A;  1K0D A;  3ERW A;  4IVF A;  4YKG A;  3D4T A;  5KOW A;  4HJM A;  4WET A;  3FK8 A;  2IFQ A;  3FYG A;  3L4N A;  2CV4 A;  1QFN A;  1F3B A;  17GS A;  2WCI A;  2VM2 A;  1YEP A;  1TRU A;  3U5R E;  3C1R A;  1PA3 A;  1GUK A;  3DML A;  2YWM A;  4Q5F A;  2PMT A;  4ZIL A;  1MTC A;  4CY8 A;  4EIQ A;  4EL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...