5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
b'LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
molecule tags Isomerase
source organism Escherichia coli
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
3ZYWA 3LYKA 4FYUA 1G7EA 2G2QA 5ECOB 3D22A 2I4AA 4G19A 3UARA 1A23A 1F6MC 2R37A 3GRXA 1ABAA 5FHIA 2I9HA 2LNTA 1ZCPA 1AUCA 1RQMA 1XWAA 1WP0A 1SU9A 5D9VA 1T4YA 2OACA 2FLSA 5CRDA 1GSEA 1YZXA 2C3QA 1YKAA 2VCVA 1A8YA 1B9YC 5ECRB 1XBSA 1X5DA 4JEDA 3E9JB 2VM1A 4KDYA 1VF2A 5J4UA 4KSOA 1AXDA 2IWTA 3EWLA 1CQGA 2ON7A 2QSIA 1PX7A 5ECQB 4L5OA 3APSA 2R5GA 5G30A 3VURA 1T00A 2GZPA 1TP9A 2TRXA 3GH9A 1GSYA 1AW9A 2KUCA 1OE7A 3FZ5A 1TU7A 1SL1B 1GNWA 1USBA 5CRWA 2DC5A 2EIOA 2AAWA 1K0MA 1B48A 3LWAA 4ISDA 4WEYA 13GSA 4KNDA 4BPYA 4WR5A 3AY8A 1GP1A 1GLQA 4OFTA 4X0XA 4BL7A 2VL2C 4IW9A 1A0RP 5D96A 1BG5A 3TRXA 4TXOA 4JRRA 1F37A 4XIHA 3I43A 1ZYQB 2QC7A 2GZZA 3IHQA 4XS4A 4XRAA 2CVKA 4MLYA 3GX0A 8GSSA 3RPNA 1K3OA 2B3SA 1O85A 5ECKB 2IN3A 3KP9A 1WE0A 1J9BA 2LRCA 2ES7A 5CRHA 4MZBA 4PQ1A 1ERVA 3IE3A 4TXOB 3GV1A 3F3QA 3ZFBA 1SJIA 2C8UA 1SD9A 5L71A 3F4SA 5H5RA 5CAXA 2JU5A 3RPPA 5C00A 3KZQA 2L6DA 1K0CA 3GKKA 2IMFA 1EOHA 4NHWA 3MDKA 1XIYA 3LORA 3F6DA 3EC3A 1B8XA 3BCIA 5DVBA 2YOIA 2IMDA 1QQ2A 4NPBA 4F0BA 2LQQA 4HU9A 4MH2A 1PL1A 2FHEA 4E8HA 3KM6A 3KJYA 1MTCA 4YH2A 2OE3A 3RBTA 3C1SA 4IP1A 1DBYA 2K8SA 1MDKA 3HJPA 1U3AA 4EUYA 3TKQA 2PVOC 4TN8A 1X0RA 1NSWA 1XWCA 2NVLA 3F63A 3TUEA 1ERUA 5B6MA 5AIVA 1AQXA 5KN1A 2H6ZA 2X8HA 2CV4A 1EV4A 4NV5A 4J57E 4TRXA 4ZIJA 2MMNA 2R3XA 4OCEA 2JZTA 3L4NA 4G9HA 4GQCA 4MF5A 3G7YA 1O8WA 2YNXA 1TI3A 2ZCTA 1HNBA 5D9XA 1M9AA 2JADA 2GGTA 4DVCA 5A4VA 1IYIA 2VLVA 5ID2A 4OWYA 3FRCA 3QAVA 2HSHA 3D4TA 4ID0A 5F05A 3UVHA 1V2AA 1Q98A 2H1DA 3DRNA 4RQRA 4WR4A 6GSTA 4MCUA 1PD21 2OBKA 3F9UA 1PRXA 1WJKA 3F4TA 2H0IA 3A2WA 3DGQA 3F0IA 2C4JA 4ZL8A 9GSSA 1G0TA 1PQNA 22GSA 4O7HA 2CVDA 5A5KA 19GSA 3TJGA 4LMWA 3WGXA 1GTBA 3P8WA 1GSDA 4OO5A 5D9TA 1XWBA 1YF1A 4FYBA 2H6YA 2IFQB 2RIIA 1SD8A 1KNGA 3HJMA 1HNAA 3RAZA 4EF0A 1UN2A 5LCZA 4BVYA 4EDYA 3EE2A 5B6NA 4ML6A 1KTEA 4XHMA 5ECNB 4HUAA 4PNGA 4PXOA 1DUGA 4K2DA 1E6BA 1JZRA 3CXGA 4K0GA 1AIUA 3V1WA 4IJIA 4JR6A 2GDRA 4XTSA 3KCMA 1OC9A 2HFDA 3HKRA 2V41A 4TOPA 4IVFA 2DMLA 1VF4A 2A4VA 1XWGA 5CP1A 4IJ3A 2VCXA 3IC4A 1WMJA 4GWRA 2PVQA 1AQWA 4DEJA 1OVNA 5ELGA 2L4QA 1GTIA 4TXVA 3HVSA 1RW1A 4HI7A 4O92A 1XCCA 1THOA 1VF3A 3GNJA 3H79A 3PH9A 4GF0A 5J9BA 1B4QA 1TU8A 3ZRDA 1SK2A 3FY7A 11GSA 1F2EA 1OC8A 4DSSB 2KLXA 5FT3A 2YJ7A 3WT1A 3W6GA 3FZ9A 4AJ8A 1GUHA 1YEXA 5HR3A 4BA7A 2WFCA 3APOA 4HEA2 3TKRA 2JSYA 4MH3A 3ZIJA 2HI7A 1X5EA 1K3YA 3MSZA 4ZL9A 2H0GA 3IAS2 4HJ2A 1XWKA 1GUMA 3VK9A 1OAZA 5DDLA 2VLUA 3EURA 1Z6MA 3GTUA 2HE3A 2X8CA 1N2AA 2KP2A 2LJAA 3BJ5A 4E8EA 4HQZA 3UEMA 4RI6A 2YPMA 2E2MA 4MA9A 3GH6A 3GKMA 3M3MA 4MZCA 5GAPD 5ENUA 2HZEA 1FAAA 2B5YA 1JLWA 1OYJA 1X5CA 3P90A 2H66A 4HU7A 1MDJA 2B7KA 4NMUA 1BJXA 3F4RA 3QDNA 1XVWA 1WOUA 4KA0A 3TRPA 3IR4A 5E59A 3OR5A 2V2GA 2VCZA 3E0UA 1Z3EA 2FWEA 3LSZA 3UJ1A 1U87A 5DQYA 5HR1A 4KW6A 3ZMLA 5HFIA 2ZNMA 4POMA 14GSA 5IMCA 1F3AA 1WWJA 2XPDA 1ZZYA 1GL8A 2HYXA 5IM9A 2O8VB 1A24A 1U88A 3IBHA 1XZOA 5G1LA 3US3A 4TW5A 2LRTA 3HA9A 3TKSC 2VCWA 2DJJA 1GSQA 3RHBA 1Z6NA 1QFNA 1B9XC 2CAIA 2LKUA 2OBIA 4I5QA 16GSA 1OE8A 5D8IA 2MBTA 2FGXA 5F06A 4MPGA 2K18A 10GSA 2GLRA 4MJBA 1T8EB 3S9FA 2B1KA 2VL9A 2FA8A 4GSTA 2E0QA 3W8SA 2V32A 2EIRA 4L8EA 2E2GA 2K9FA 4I97A 3EU3A 1SKWB 4ZBAA 3ISOA 4LL4B 5J5NA 1ZGNA 4OO4A 5IMFA 1LU4A 2DIZA 1EWXA 3EU4A 2X64A 1FVKA 3DVWA 4JR4A 3EINA 1WIKA 4FO5A 3PINA 2DSAA 1FW1A 5D93A 4OCFA 1TKDB 1R4WA 4TR3A 5IOWA 4WF4A 3LFLA 4KCAA 4N0ZA 1A8LA 3L9SA 1GNEA 2C0GA 2VOCA 3C8EA 1M99A 3PR8A 3J7Yb 4PQHA 4V2MA 2N5BA 4EC0A 1SL2B 5INYA 1Z7RA 3CTFA 3L9UA 2GS3A 1SK0A 4I2TA 1HQOA 3C73A 4GSSA 4L0UA 2HRFA 3IPZA 2X99A 1CQHA 4IN0A 1W4VA 4CW9A 2H1BA 2OA7A 3DVXA 1MDIA 2ALBA 1LBKA 5COHA 4O5RA 4CDOA 2GSRA 3RDWA 2EIQA 2V6OA 2AHEA 4KSMA 2F3MA 1SKRB 2BMXA 2H0HA 1GLPA 2N5AA 3WT2A 2VUPA 3TKSA 4MPFA 3TRQA 3LJRA 2I1UA 3UL3A 3KMOA 5EPFA 3WYWA 1G6YA 1HNCA 2H76A 1I9DA 4AF2A 4MF7A 4EXJA 4IBPA 3A3TA 1ZMAA 3VPQA 3D5JA 2YP6A 5DCGA 4KAEA 2VL2A 3GURA 2IY2A 1U6TA 3FR3A 2F8FA 3EMXA 2FY6A 1V57A 2EC4A 1PKWA 3ZVJA 1Z5YE 3HHVA 3GUSA 3IA1A 1MD3A 3IV4A 2H73A 5D9WA 3TJBA 1X9WB 3UVTA 4JBBA 2RLIA 5A4UA 1TDIA 2F9SA 2HSYA 6GSVA 2LV3A 4YQUA 1C72A 3FR9A 4KH7A 2VCQA 4QL9A 3QPMA 3WD6A 3CSJA 3GSSA 1W89A 1XOBA 1F9MA 2DBCA 3KD0A 4L0WA 4XRDA 1NHYA 2PGTA 1NHOA 3M9KA 1K0AA 2LJRA 1PA3A 5GSTA 4NWYA 3KMNA 2IMIA 1ACVA 2LJKA 3DYRA 2JZRA 2LSTA 4GTUA 1J0FA 1SKSB 1AAZA 1EP8A 5JWRB 6GSYA 2FWHA 2AUVA 5D73A 2MYGA 2AB6A 3BBYA 2OE0A 3D21A 5DAKB 1E2YA 1O73A 5G5EA 1YKCA 4ZXGA 1PX6A 3ZLPA 3I69A 1G6WA 4MZWA 3HY2A 2H71A 3J7Yk 2QGVA 2YWIA 3IK7A 5IMZA 5CREA 2TIRA 4YQVA 4POLA 5EY6A 3HYPA 4ZILA 2OKAA 3GIXA 2GZYA 3LGCA 5JCWA 1FOVA 3ERWA 2NBSA 2F8AA 2FCHA 2M46A 2DJ2A 1OKDA 4KCEA 3QAGA 4POBA 2R2JA 3TKPA 3EYTA 1BQ7A 4K1FA 4LMVA 2C80A 1JHBA 2LQOA 3EVIA 3UBLA 3D4MA 5DJLA 3QAWA 1YQ1A 2IFQA 1GWCA 1AC1A 2GQMA 4NHZA 3BD2A 2C0FA 1V40A 2K8VA 2PN8A 1RK4A 2YJHA 1GSSA 1Q4JA 3KIJA 2FD3A 2YZHA 2R6KA 2PMTA 4KDUA 2I81A 3FZAA 1K0OA 2L4CA 4HOJA 1U3IA 4K9ZA 2JZSA 4MMMA 4WETA 3FR6A 3L78A 4KX4A 2NDOA 5IPHA 2MBSA 3LXZA 3ZL5A 4RQXA 2KOKA 4MDCA 3DWVA 4D73B 2GT6A 2OADA 4V1Ap 1G7OA 1V58A 3H93A 4MJAA 5KN0A 1SYRA 4KUNA 3O6TA 4MJEA 3UMAA 2F51A 2PBJA 1K3LA 5EL8A 1SL0B 2AV4A 4RUVA 4ZB9A 4GCIA 1R26A 4MF6A 4TKYA 3C71A 1DSBA 4NV2A 2HLSA 5DJMA 2RM6A 4Q5NA 3GL5A 1TW9A 1PGTA 5KN2A 3MAKA 5IMVA 2DJ3A 1KEBA 2YWNA 1R7HA 1TK5B 3DXBA 2NPBA 3N9JA 5B8AA 2CQ9A 4G2EA 4V2NA 2A2SA 2HZFA 3GHAA 5J9CA 2WB9A 2CAQA 2H19A 4EVMA 2O89A 4IELA 5G31A 5H5QA 4EE0A 1YY7A 2LTKA 2AYTA 3TB2A 2GVPA 4OFMA 4TR1B 3TCOA 2IJYA 2C3NA 1EOGA 1JLVA 5G5FA 2XPEA 5J41A 4IQ1A 4AGSA 1NM3A 2JL4A 3CMIA 5HR0A 3DEXA 1V9WA 3CSIA 3LEFA 1WPIA 3VLNA 2IMKA 4PURA 1I5GA 5C04A 1WRYA 1UA5A 1OC9B 2J9HA 5GSSA 2WGRA 4JE1A 4FH8A 5DQSA 2P5QA 4WXTA 3FEUA 1ML6A 2PU9C 3H8QA 2E7PA 1DE2A 2CT6A 2LRNA 5LNKe 1R5PA 1ZL9A 2R4VA 4X43A 4YQMA 4P3YB 2PUKC 2YCDA 4ZBDA 3KH7A 2GSSA 3D6IA 1S3DA 4GXZA 4AJ6A 6GSSA 2PWJA 2B1LA 1TOFA 1O8XA 3FK8A 4RI7A 4XS1A 2WRTA 2VL3A 3VI7A 3NOFA 4OFNA 4I6XA 5HFKA 4PX1A 3VWXA 2IL3A 2OJLA 3FYGA 5CYYA 5JCGA 2KP1A 1TI1A 3UIWA 1TRVA 4Z7XA 3ZVJD 2WCIA 1XXUA 1VRSD 4LL1B 1JZOA 2DJKA 1ZOFA 4HZ2A 2VM2A 4HZ4A 3L9VA 2FNOA 4G10A 2VD1A 1FB6A 2L59A 2FWFA 2P0GA 4FYCA 2L57A 4CHSA 2CX3A 3KTLA 1XVQA 1GH2A 2H72A 3NZNA 3M0FA 1GSUA 4TR0A 4EKZA 4L5LA 5KEJA 2JACA 3ZITA 1A2JA 1X9SB 4ACSA 4BWSA 2V1MA 2M72A 5B7CA 1FO5A 3GKNA 2YANA 3GFKA 3VI5A 3UBKA 4LA1A 3VWUA 3GMFA 2AJQB 4TR4A 1J08A 3W8JA 2TRCP 2VIMA 5IMDA 1YEPA 1BYEA 5HR2A 4Q5RA 3FW2A 2CA8A 2HNLA 2DLXA 3ERFA 2H74A 5AN1A 5G2ZA 4ML1A 2O87A 4Q5FA 3K8NA 3HZ8A 5CRGA 4HS1A 4QL7A 2WDUA 3QR6A 5IO2A 3PGTA 3VWWA 3ZIVA 5AIXA 3TKSE 5H5SA 1M2AA 1IYHA 3TOUA 5IMAA 3KXOA 2REMA 1H4OA 1URMA 3LXTA 3FHKA 3SWLA 20GSA 2L5OA 4IKHA 3QOUA 5EVOA 4V2LA 3ZTLA 1OC3A 5ECIB 3LQ7A 2WULA 4ZBBA 5ECMB 3Q74A 2B5EA 1HYUA 3LYPA 2OE1A 2B7JA 3ZREA 1GSFA 2JSZA 2XHFA 5IIZA 2YZUA 2H75A 4J56E 3CRTA 4I8BA 3KGKA 1EP7A 2BTOT 1R5AA 3MWHA 4HDEA 3TJFA 3A5WA 4GLTA 4IP6A 1THXA 1MD4A 2D2ZA 4BVXA 2J23A 3TDGA 2MMAA 1TXXA 4MK3A 1BEDA 1TJDA 2YV7A 3I9V2 7GSSA 4HQSA 2O85A 5AISA 1K0NA 1DE1A 1HD2A 1UVZA 3CSHA 4XS6A 3IAM2 1GULA 1XW9A 3DIEA 5GZZB 2FA4A 5DAKA 3HXSA 4DSQA 1O6JA 3ME8A 4OD7A 4XCSA 1YDKA 2LS5A 1N8JA 3F6FA 3ERGA 3GN3A 2GQKA 4PNFA 1O81A 1SENA 1UC7A 2CX4A 4NAXA 3C1RA 1XFLA 1FVJA 2MZCA 3HD5A 3A2XA 3ME7A 1GRXA 4BWQA 2VD0A 3KH9A 3HZ4A 1PMTA 3HCZA 1LJRA 3KTBA 2H01A 5HFGA 3GSTA 4F0CA 1XPVA 1S3AA 1EV9A 1TRUA 3IK9A 3UAPA 1PSQA 1TK0B 5DCHA 1GUKA 2XBIA 3G7JA 3QD9A 2P31A 1FG4A 3RHCA 4ZB8A 3E3EA 5GAND 2H1AA 5AGYA 1GTUA 6GSWA 1JFUA 5IO0A 2GTUA 2IPAA 5ELAA 3HVXA 3CTGA 18GSA 1OKTA 2A2RA 2VAFA 2IIYA 5A4WA 3M8NA 3QMXA 1EEJA 2B6MA 2GSQA 5ECSA 1M2DA 4EL1A 1ILOA 1PN9A 4FIWA 2VCTA 1A2MA 3M1GA 4D73A 3ED3A 1M0UA 2H8LA 17GSA 2C3TA 3IOSA 3BOAA 4YAPA 4F03A 1VF1A 3I6AA 3L0HA 5DALB 4ZB6A 1ON4A 1Y25A 2FWGA 4ECBA 3FKFA 1JZWA 1QK8A 1TTZA 3G7IA 4XS4B 1ST9A 2MMOA 5JWQB 3FZ4A 2HZEB 4I2UA 3TJKA 1AQVA 2PERA 1FHEA 2WS2A 2WJUA 2H1GA 3BCKA 3Q6OA 2V6KA 4OMVA 5LD0A 4KGIA 1ZYEA 1NW2A 3GA4A 3JCML 2VLTA 4Q5QA 3UOMA 2K6VA 1QXHA 5KN3A 4WF5A 1A0FA 4N10A 3KP8A 4IGJA 4KB3A 3H1NA 4ECCA 3KEBA 3IXRA 2BJXA 5F07A 1QUWA 1XOAA 3C7MA 3GL3A 3HVVA 2YN1A 1SJ6A 2HRNA 2H6XA 2O7KA 1PL2A 3CRUA 2X8GA 4WKWA 2B5XA 3ZMKA 4MJCA 2RM5A 4IS0A 3VFIA 2C0EA 5ID2B 3HJOA 1SK1A 1GTAA 2YWOA 3QFBC 2P5RA 1EZKA 2LNSA 5JWOB 1M9BA 2MMZA 1M2BA 5DBQA 1A2LA 3H4KA 5E4WA 5IPGA 4K7NA 4QQ7A 3N5OA 2DIYA 1TRWA 1V98A 2XC2A 4EO3A 1O7UA 2DJ1A 2FUG2 2L5LA 1K0BA 2YV9A 3P2AA 1EGRA 1EEMA 3CBUA 4ULXA 4KDXA 4PUAA 2WZ9A 4GRFA 6GSUA 2H70A 1JZDA 3CYNA 3HDCA 4N30A 3ZFLA 5G1KA 1ERTA 2LUSA 4ZL7A 2GQLA 3F3RA 4DSRA 2CVBA 4MABA 2DJ0A 1Z9HA 4F2IA 2XBQA 2IMEA 5CO3A 5HQPA 2G0FA 1T1VA 4X1UA 1T4ZA 5DALA 2GT5A 3O3TA 4HJMA 2KHPA 4WBRD 3WGDA 6GSXA 2LEGA 3U6VA 4H86A 5J3RA 4PGTA 4YAVA 5F0GA 2VO4A 4JZQA 3GYKA 1F3BA 4K8MA 1FB0A 2IYJA 1H75A 1XW6A 4ECJA 2C1YA 4GQFA 4NXIA 3GTUB 1KBNA 4N0VA 4TVEA 2QKEA 2GSTA 3SBCA 5ECPB 5JCUA 2CZ3A 4AJ7A 4IQAA 3QFAC 5CNWA 4K6XA 4J2FA 3IRAA 1QGVA 2Z9SA 5FWGA 2M80A 2NTOA 1TRSA 4V1Ag 2H30A 1ERWA 1Y6EA 4MP4A 5ABRA 2YWMA 1PKZA 3G9BA 2ON5A 1SJZA 3MNGA 3O76A 5ECLB 2CZ2A 5B8BA 3IDVA 3Q18A 3DD3A 4PQIA 4DSSA 3LG6A 2HT9A 3DKSA 4N11A 3VPTA 1T7PB 4POKA 5ECHB 4GSNA 2DMMA 2L6CA 3WGEA 3A2VA 1YF0A 4LLRA 1X9MB 1BAYA 1T3BA 1VGLA 3DMLA 3M9JA 1M7TA 3GKXA 3QCPA 1K0DA 5F8BA 4KE3A 3APQA 3R2QA 3VWVA 3Q19A 1B4PA 2ZUPA 4WBJA 4PUFC 1TK8B 12GSA 5IOXA 1QMVA 3TGZA 3P7XA 2N5FA 4O32A 3D0ZA 2RUFA 4EDZA 5IQYA 1EGOA 2C0DA 4F9ZA 4ECIA 4ILFA 4JU5A 3TJJA 2RUEA 3F8UA 1S3CA 4F82A 2I3YA 1Z7PA 3GX8A 4IHUA 1SYXA 1MEKA 1YJ6A 3U5RE 4K7IA 3TOTA 2HXKA 4K7OA 4K0NA 3ZZXA 3NIVA 2PPTA 1BX9A 3EMPA 4TR1A 1XW5A
chains in the Genus database with same CATH superfamily
3ZYWA 3LYKA 1SJWA 1W02A 1FUTA 4FYUA 1G7EA 2G2QA 5ECOB 3D22A 2I4AA 4G19A 3UARA 1A23A 4BIRA 1I0XA 1F6MC 2R37A 3WODG 3GRXA 1ABAA 5FHIA 2I9HA 4HM0B 2LNTA 1ZCPA 3FSDA 3NM7A 3ROBA 1AUCA 3RGAA 3NUVA 3UL6A 3GZXB 1IYYA 1RQMA 1XWAA 1WP0A 1A67A 1SU9A 3RDEA 5D9VA 3WOFB 3N54B 1T4YA 2OACA 2FLSA 1I2EA 4N6LA 5CRDA 1W4NA 1GSEA 1YZXA 2ZHXB 4FCMA 2C3QA 1YKAA 1IVXA 1RHLA 2VCVA 1A8YA 1B9YC 5STDA 5ECRB 1XBSA 1NU3A 2W9PA 1X5DA 4JEDA 3E9JB 2VM1A 3LTDA 3JVCA 1VQ43 4KDYA 1VF2A 4EIPA 5J4UA 1SIIA 5EQLA 5AI1A 1RGFA 4KSOA 1AXDA 2HMJB 2IWTA 3EWLA 1FGTA 1CQGA 1HYFA 2ON7A 2QSIA 1PX7A 5ECQB 2CG1A 1Z1SA 4L5OA 2CWTA 3S29A 5IEOA 3APSA 2R5GA 4HM4B 5ELJA 5G30A 3VURA 1T00A 2GZPA 3MHEA 1TP9A 1QAFA 2TRXA 3GH9A 1GSYA 1AW9A 4USSA 7GSPA 5I97A 2KUCA 1OE7A 3FZ5A 4FMAA 1TU7A 1C7HA 1GNWA 4HM6B 1SL1B 2KF6A 3D3LA 1USBA 5CRWA 2DC5A 2EIOA 2AAWA 1K0MA 1B48A 3LWAA 4KT3B 4ISDA 1I3IA 4WEYA 1R4YA 4IIAA 13GSA 1UCLA 2C11A 3PXMA 1YI23 4KNDA 4WYKA 2CKFB 4BPYA 1VQQA 1QVF2 3FG3A 4WR5A 4Q53A 4TX4A 3AY8A 1GP1A 1GLQA 4OFTA 4X0XA 4BL7A 2JDIH 2VL2C 4IW9A 1GYBA 1A0RP 1BRGA 5D96A 1BG5A 3TRXA 4KFFA 1RN1A 1NWWA 4TXOA 4JRRA 1F37A 4XIHA 4HZBB 3I43A 1ZYQB 2QC7A 1J2BA 2Z6BA 1BU4A 2GZZA 3IHQA 4XS4A 4XRAA 2CVKA 4MLYA 2UX0A 1S5AA 3GX0A 3RPNA 8GSSA 1K3OA 1GY7A 2B3SA 3Q2PA 1RNBA 1O85A 2IN3A 5ECKB 1VQK3 3KP9A 1GOYA 1K734 4ICYA 5AIHA 2HOHA 4O8SA 1WE0A 1W6GA 1JKGA 4EIQA 1WMOA 1J9BA 2LRCA 2ES7A 5CRHA 4MZBA 4PQ1A 1ERVA 3IE3A 2BMRB 2GU3A 4TXOB 4R1KA 3GV1A 2IMJA 1B21A 3F3QA 2XFTA 3ZFBA 3BIRA 1IK3A 1CYVA 1N9EA 1SJIA 2C8UA 1I2GA 1SD9A 5L71A 3F4SA 3NV0B 5H5RA 5CAXA 3BNBA 2JU5A 4PTSA 2QEX3 3RPPA 5C00A 3F8XA 3KZQA 5D82A 2L6DA 1K0CA 3GKKA 1RGKA 1EOHA 4MMZB 2IMFA 1BNGA 4NHWA 3MDKA 1XIYA 3LORA 3F6DA 3EC3A 3I0YA 3SVAA 1B8XA 1W6YA 3MG3A 3OW22 3BCIA 5DVBA 1CQSA 1PU4A 2BU4A 2IMDA 1BSAA 1QQ2A 2YOIA 1S723 4NPBA 4F0BA 2BT3A 3NX0A 2W9QA 1S3RA 4N6TA 2LQQA 4HU9A 4MH2A 2V1LA 1M1XB 1PL1A 2FHEA 1US1A 3DUKA 4E8HA 4WWUC 2IUJA 3KM6A 3KJYA 1MTCA 4YH2A 1OPYA 1VQO3 2OE3A 3RBTA 4MJDA 4EV2A 3C1SA 2CFGA 4IP1A 1DBYA 2K8SA 1MDKA 3HJPA 1U3AA 4EUYA 2OQEC 3Q3FA 3TKQA 3LT9A 1LXEA 3LOYA 2PVOC 4L8PA 1TIJA 1SARA 3FH1A 4TN8A 4BTXA 1X0RA 1BIRA 9RNTA 1NSWA 3D79A 1HZ1A 1XWCA 2NVLA 1ERUA 3F63A 3TUEA 5B6MA 2F4YA 5AIVA 1AQXA 5KN1A 1M9GA 2H6ZA 1JB5A 4KFEA 2X8HA 1IQYA 1BNJA 2CV4A 4MMXB 2XSHB 4Z2UA 1EV4A 3PCSA 4NV5A 4J57E 5IG0A 2HMKB 3GAXA 4TRXA 4ZIJA 2MMNA 3R3EA 2R3XA 3DZLA 1KWIA 4OCEA 2JZTA 3L4NA 2IA7A 4H3UA 4RZMA 4G9HA 5BMUA 4GQCA 4MF5A 3G7YA 1FA3A 1O8WA 2YNXA 1TI3A 2ZCTA 1HNBA 5D9XA 1M9AA 1AVKA 2JADA 3GZBA 2GGTA 3CMA3 4DVCA 1M904 5A4VA 1IYIA 2VLVA 5ID2A 1YNVX 4ZM8A 4OWYA 3FRCA 3QAVA 1OF5B 2HSHA 3D4TA 4ID0A 5F05A 3UVHA 1V2AA 1Q98A 2H1DA 3BLZA 3DRNA 4RQRA 4WR4A 6GSTA 4MCUA 2MC8A 1PD21 2W56B 2OBKA 2RSXA 4MNNA 1EA2A 3F9UA 1PRXA 1WJKA 3F4TA 2YX9A 2H0IA 3GSPA 3A2WA 1BRJA 3DGQA 4L8OA 3F0IA 2C4JA 4ZL8A 1KQS2 9GSSA 3CPW2 1FYSA 3S28A 1G0TA 4FQUA 1PQNA 22GSA 4O7HA 2CVDA 5A5KA 3Q90A 3FZWA 19GSA 3TJGA 1TRPA 4IT7A 2CG0A 4LMWA 3WGXA 3NQYA 3L0RA 3CXC2 1GTBA 1VQL3 3P8WA 3X3ZA 1OGXA 1GSDA 4OO5A 1XWBA 5D9TA 1YF1A 4FYBA 5BVBA 1PYLA 2H6YA 2IFQB 2RIIA 1FUWA 1CH0A 1SD8A 2CW9A 1KNGA 3HJMA 1HNAA 3RAZA 4EF0A 1O7MB 1UN2A 5LCZA 4BVYA 4EDYA 3EE2A 1YVSA 5B6NA 2UUGC 4ML6A 1KTEA 4XHMA 4BIKA 1B20A 3HI7A 5ECNB 4HUAA 5FGOA 1BRNL 4PNGA 4PXOA 5AEWB 1DUGA 4K2DA 4AKYA 1E6BA 1JZRA 3CXGA 1DMMA 4K0GA 1KC84 1AIUA 3V1WA 1X1XA 4IJIA 4JR6A 2GDRA 4XTSA 3KCMA 1OUNA 1OC9A 2HFDA 3WOEB 2V41A 1BRSA 3HKRA 4TOPA 5EVHA 1ZX2A 4IVFA 2DMLA 4O02B 5HGRA 1VF4A 2A4VA 1M3JA 3PZWA 2WOFA 1XWGA 4IJ3A 5CP1A 2I9WA 3H51A 3EQQB 2VCXA 3CCE3 1WTHA 1Q9EA 3IC4A 5KOXA 2JQ5A 1WMJA 1D6UA 2K0MA 3GRDA 5JPPA 4GWRA 2PVQA 1AQWA 3QK9A 4DEJA 1OVNA 4MEIA 5ELGA 2L4QA 1GTIA 4TXVA 3HVSA 1RW1A 4HI7A 4O92A 1XCCA 1EKMA 1THOA 1VF3A 3GNJA 1UGIA 3H79A 3PH9A 4GF0A 5J9BA 2A4HA 2XFSA 1K28A 1B4QA 1TU8A 3ZRDA 1SK2A 3FY7A 11GSA 1F2EA 1OC8A 3KN4A 4DSSB 2KF5A 1BGSA 1X1WA 3PS8A 2KLXA 5FT3A 2YJ7A 3WT1A 3W6GA 3FZ9A 2WGOA 4AJ8A 1GUHA 1YEXA 4G0KA 2RBIA 5HR3A 4BA7A 6RNTA 2WFCA 3APOA 1MWSA 4HEA2 3TKRA 1MNLA 2JSYA 4MH3A 3ZIJA 2HI7A 2GBXB 1X5EA 1K3YA 3T0UA 3MSZA 4ZL9A 2A15A 2H0GA 3IAS2 4HJ2A 1XWKA 1GUMA 3VK9A 1OAZA 2ML6A 2VLUA 5DDLA 3X42A 5AEUB 1NB3I 3EURA 1Z6MA 1JB4A 3GTUA 1G96A 2HE3A 3D5GA 2X8CA 1N2AA 5KOWA 2KP2A 2LJAA 4KF9A 4GB5A 3BJ5A 4E8EA 4HQZA 1DYUA 1O7HB 3UEMA 3FKAA 4RI6A 2YPMA 2E2MA 4MA9A 1JRQA 3GH6A 3GKMA 1L5GB 2FNQA 1OHPA 3M3MA 1UI8A 4MZCA 5GAPD 3JUMA 5ENUA 2HZEA 1TTOA 1GY6A 3ALAA 4R4KA 1FAAA 1JLWA 2B5YA 1X5CA 1OYJA 1TUHA 2UGIA 3P90A 2H66A 4BVXB 2J8XB 3D5IA 4HU7A 1MDJA 2B7KA 1BNIA 1AV4A 4NMUA 1BJXA 4PEJA 3F4RA 3QDNA 1XVWA 4JF8A 1WOUA 4KA0A 3TRPA 3IR4A 5E59A 3OR5A 2V2GA 3NXJA 5IF6A 2VCZA 4FR9A 2UZ8A 3MG1A 3LYGA 3E0UA 1Z3EA 3MSOA 1Q864 1T2HA 2FWEA 2GSPA 3LSZA 3UJ1A 1DE3A 1VQ93 2AADA 1U87A 5DQYA 5HR1A 4KW6A 3S67A 3ZMLA 5HFIA 3EPTA 2ZNMA 4POMA 14GSA 3EBYA 5IMCA 1F3AA 1WWJA 1UCJA 2XPDA 1ZZYA 1GL8A 2HYXA 2Q07A 5IM9A 2O8VB 1NO3A 4BL7B 1A24A 3EX9A 1U88A 3IBHA 1XZOA 5G1LA 1TFOA 4TW5A 3US3A 1GMPA 2LRTA 3HA9A 3TKSC 3EBTA 2VCWA 2DJJA 1GSQA 3RHBA 1Z6NA 1QFNA 2HRAA 4Z2TA 1B9XC 1VZZA 2L1SA 2WOHA 2CAIA 3KCHA 2LKUA 2OBIA 1GD4A 4I5QA 16GSA 1OE8A 1PY3A 3OWUA 3SOYA 5D8IA 3K0ZA 1WQLB 2MBTA 3FG4A 2FGXA 5F06A 3DGYA 4MPGA 1TRQA 3VF1A 2K18A 10GSA 2GLRA 4MJBA 2SBLA 1T8EB 1DVDA 3S9FA 3GWRA 2B1KA 4N6V0 2VL9A 1A90A 2FA8A 4GSTA 2E0QA 3W8SA 3KIIA 2V32A 1RTUA 3RNTA 3BNCA 2EIRA 4L8EA 4OUQA 2E2GA 2K9FA 3M8CA 3EU3A 1RGEA 4I97A 3ISOA 4LL4B 4ZBAA 1SKWB 1Q814 3HZPA 5J5NA 1ZGNA 4OO4A 3T8UA 5IMFA 1LU4A 2DIZA 1EWXA 3EU4A 1VQ73 2O3OA 2X64A 1FVKA 3DVWA 4JR4A 3WHOA 3EINA 1WIKA 2ZA4A 4FO5A 4ORLA 3PINA 2QIYA 2DSAA 1FW1A 3PGBA 4OCFA 5D93A 1TKDB 2YFIB 1R4WA 4TR3A 3PCRA 5IOWA 4WF4A 4G0LA 3CCR3 1B3SA 4JRFA 2HMMB 3LFLA 4KCAA 3CCQ3 2C10A 3A76A 3HIGA 1A8LA 3L9SA 4N0ZA 1I2FA 1WMNA 1O7PB 1GNEA 2C0GA 2VOCA 3C8EA 1QALA 2QA43 2W6JH 1M99A 5IG4A 3PR8A 3J7Yb 1GS3A 5D83A 1BSBA 4PQHA 3EN8A 1TFKA 4V2MA 4G0IA 2N5BA 3MG2A 4EC0A 1SL2B 5INYA 3OWSA 1Z7RA 3CTFA 1FGRA 3L9UA 2GS3A 4GHOA 1SK0A 4I2TA 1HQOA 3C73A 4GSSA 1YJ93 5LC6A 4L0UA 2OOVC 2HRFA 2OTL3 3IPZA 2X99A 1CQHA 4WHAA 4IN0A 1ZYPA 1W4VA 4CW9A 2H1BA 2OA7A 3DVXA 1MDIA 2ALBA 1LBKA 5COHA 4O5RA 4EYCA 1BRKA 4CDOA 2GSRA 3VGNA 3CNMA 1OH0A 1BRHA 3RDWA 2EIQA 1BSEA 2V6OA 1JJ22 2AHEA 4KSMA 2F3MA 3FG1A 3ZG0A 1SKRB 1VQ53 2BMXA 2H0HA 1GLPA 2N5AA 1KD14 3WT2A 2VUPA 4K1UA 3CU3A 3TKSA 4MPFA 3TRQA 3LJRA 3WA2X 2I1UA 3UL3A 3KMOA 2RNTA 5EPFA 3WYWA 4O3VA 2CX0A 1G6YA 4HKVB 3EF8A 1HNCA 2H76A 3J7Yd 1I9DA 4AF2A 4MF7A 3BU4A 4EXJA 5D81A 1FUSA 4IBPA 5IG3A 3IPTA 3A3TA 1BVIA 1SPUA 3CCU3 1ZMAA 3VPQA 3D5JA 2YP6A 5DCGA 4KAEA 2VL2A 3GURA 2IY2A 4FMBA 1FGMA 1U6TA 3FR3A 1LNHA 1BAOA 2F8FA 3EMXA 2FY6A 1V57A 2EC4A 1PKWA 3ZVJA 1MGWA 3N8BA 1Z5YE 3HHVA 3GUSA 3IA1A 3FF2A 1MD3A 3IV4A 4O5UA 4EW5A 2H73A 5D9WA 3TJBA 3MPHA 2F5MA 1YIT3 1SQWA 1X9WB 3CPOA 3UVTA 4JBBA 2CH9A 2BIRA 2RLIA 5A4UA 1TDIA 2F9SA 2HSYA 6GSVA 2LV3A 4YQUA 1C72A 3FR9A 4KH7A 2VCQA 1IVVA 4QL9A 3QPMA 3WD6A 2D42A 3CSJA 3GSSA 1I3FA 2CC3A 1BNFA 1F9MA 1W89A 1XOBA 3CC43 1ZYNA 2DBCA 3KD0A 1NHYA 4L0WA 2PGTA 4XRDA 1NHOA 3M9KA 1K0AA 2LJRA 1PA3A 5GSTA 1STDA 1Q7Y4 2HSMA 2CFDA 4NWYA 3PPUA 5M19A 6STDA 3KMNA 2IMIA 1ACVA 2LJKA 3DYRA 2JZRA 1U8CB 2LSTA 1M1K4 4GTUA 1Q40A 1J0FA 1SKSB 1RJOA 5GSPA 1ROAA 4CY6A 8CHOA 1AAZA 1EP8A 5JWRB 6GSYA 2LYXA 1BSDA 3MWZA 2FWHA 2AUVA 2CFLA 5D73A 2MYGA 2AB6A 3BBYA 2OE0A 4R80A 3D21A 1JNQA 5DAKB 1E2YA 1O73A 5G5EA 1E3RA 1UCKA 1YKCA 4ZXGA 1EQKA 1PX6A 3ZLPA 3I69A 1G6WA 5CK6A 4MZWA 3BB9A 3HY2A 2H71A 1LOYA 2DKIA 3J7Yk 2QGVA 2YWIA 3IK7A 2A2PA 5IMZA 5CREA 2TIRA 4YQVA 4POLA 5EY6A 3HYPA 4ZILA 2OKAA 3GIXA 2GZYA 4GL6A 4FCZA 3LGCA 2KCDA 5JCWA 1FOVA 3ERWA 1STFI 2NBSA 2F8AA 1RDSA 3IMAB 3IHGA 2FCHA 3LW9A 1RN4A 3PYJA 2P0MA 1D6ZA 2M46A 3DM8A 2DJ2A 1OKDA 4N6OB 5LC7A 1IDPA 4KVHA 4KCEA 3QAGA 4POBA 2R2JA 1LQMB 1EUIC 3TKPA 3EYTA 4WP5A 3CCL3 3V92A 4J5KA 1QVG2 1BQ7A 1ZGXA 4K1FA 4LMVA 2C80A 1JHBA 1JB2A 2LQOA 3EVIA 3UBLA 3D4MA 5DJLA 1KSIA 4O2HA 3SEDA 1MWRA 2O9UX 3QAWA 1YQ1A 2IFQA 1GWCA 3X41A 2XF3A 1AC1A 2GQMA 4NHZA 3BD2A 2C0FA 1V40A 1NDOB 4RNTA 5DREA 2K8VA 2PN8A 1RK4A 1LOWA 2YJHA 1GSSA 1Q4JA 3KIJA 2FD3A 2YZHA 2R6KA 2PMTA 4KDUA 2I81A 3FZAA 1K0OA 1RCLA 2L4CA 5M18A 4FCJA 4XDWA 4HOJA 1U3IA 4K9ZA 2KAAA 2JZSA 4MMMA 4WETA 3FR6A 3L78A 4KX4A 2NDOA 5IPHA 1OACA 2MBSA 2R0CA 3LXZA 3ZL5A 4RQXA 2KOKA 2CFKA 5KP1A 4MDCA 2K3DA 1G02A 1B2UA 3K5TA 3S27A 2GT6A 3DWVA 4D73B 2OADA 1TU5A 2L4VA 1V58A 4V1Ap 1G7OA 1E97A 3H93A 4MJAA 5KN0A 1SYRA 3ER7A 4CJNA 2R41A 4KUNA 3O6TA 4MJEA 3UMAA 2F51A 2PBJA 3K63A 1K3LA 1YIJ3 5EL8A 1C54A 1SL0B 3CNXA 3STDA 2AV4A 4RUVA 4ZB9A 1N8R4 4GCIA 1R26A 3K9MC 4MF6A 4TKYA 3C71A 1DSBA 4NV2A 2HLSA 3F7XA 5DJMA 2RM6A 4Q5NA 4MMYB 1TW9A 3GL5A 1PGTA 5KN2A 2GEXA 1PFOA 3MAKA 2F56A 5IERA 3AGOA 5IMVA 2DJ3A 1YJW3 1KEBA 2W04A 2YWNA 1R7HA 1TK5B 3DXBA 2NPBA 3N9JA 5B8AA 2CQ9A 4G2EA 4V2NA 2A2SA 2PZVA 3B4OA 1PN0A 3I563 2HZFA 3GHAA 5J9CA 2WB9A 3KFQC 2CAQA 3SXXA 2H19A 4EVMA 5AIGA 2O89A 4IELA 5AYRB 5G31A 1A2KA 5H5QA 4EE0A 1YY7A 2HMNB 2LTKA 1W01A 2XEPA 1EG9B 1UI7A 3NV0A 2AYTA 2WGQA 3TB2A 2GVPA 3HK4A 4OFMA 1QMAA 4TR1B 3TCOA 2IJYA 3EHCA 3FGYA 2C3NA 1EOGA 1JLVA 5G5FA 4EC6A 4FMCA 2XPEA 5J41A 4EV5A 2ZL8A 4IQ1A 4AGSA 5RNTA 1NM3A 8RNTA 1X1UA 2Y73A 3FCSB 4XB5A 1B2XA 5AIIA 2JL4A 3CMIA 5HR0A 1IVUA 2YFJB 1B27A 1I70A 3DEXA 3N9HA 1V9WA 3CSIA 3LEFA 3CCV3 1WPIA 3VLNA 2IMKA 4PURA 1ULIB 2F5WA 1I5GA 1B2SA 1MWTA 3RGRA 1WRYA 5C04A 1UA5A 1OC9B 2ZDJA 2J9HA 5GSSA 2WGRA 4JE1A 4FH8A 5DQSA 2P5QA 4WXTA 4L7KA 3FEUA 1O7WB 1ML6A 4CPKA 2PU9C 4HM3B 3H8QA 3G6E3 2E7PA 1W5ZA 1DE2A 2CT6A 2LRNA 5LNKe 1R5PA 1ZL9A 3URPA 1N5PA 2R4VA 4X43A 4YQMA 4RBNA 4P3YB 2PUKC 1RNTA 2YCDA 3UJMA 4ZBDA 2HMLB 1JBTA 3KH7A 2GSSA 2QA2A 3D6IA 1S3DA 4GXZA 4AJ6A 6GSSA 2PWJA 2B1LA 5JPUA 3A5EA 4EBGA 1TOFA 4LZIA 1O8XA 3FK8A 1ZO2A 3CD63 4IPBA 4RI7A 4XS1A 2WRTA 2VL3A 4K2XA 5BXQA 3VI7A 1HKXA 3I553 3NOFA 4XM4A 3WMDA 4OFNA 2OOVA 2CK3H 1BANA 4I6XA 5HFKA 3HX8A 4PX1A 3VWXA 2IL3A 2OJLA 3FYGA 3NBRA 2LQVA 4LEHA 1W2ZA 5CYYA 5JCGA 1RN7A 2KP1A 1TI1A 1BNEA 3UIWA 1W00A 3S5CA 3MKIA 1TRVA 1GY5A 3X40A 4Z7XA 3ZVJD 2WCIA 1XXUA 1VRSD 4LL1B 1JZOA 5EEOA 2DJKA 2MF7A 1ZOFA 4HZ2A 2VM2A 4HZ4A 3WA3A 3L9VA 2FNOA 4G10A 2VD1A 1FB6A 2L59A 2FWFA 3EN1B 2OTJ3 5CF1A 2P0GA 1DMQA 4FYCA 2L57A 4CHSA 2CX3A 3KTLA 1XVQA 2RFRA 1GH2A 2H72A 3NZNA 1FW7A 2P09A 3M0FA 1ASKA 1GSUA 3JUQA 3V99A 4AKZA 1NJI4 4TR0A 4EKZA 5BIRA 4L5LA 2GEYA 5KEJA 5ELUA 2JACA 1FGQA 3LT8A 3LXUX 3ZITA 1I8VA 1A2JA 1X9SB 4ACSA 3EC9A 1FOHA 2V1MA 2M72A 4BWSA 5B7CA 3CME3 4R9LA 1FO5A 3GKNA 2YANA 3GFKA 1JV2B 3VI5A 3UBKA 2Z76A 4LA1A 2X49A 3VWUA 3GMFA 2AJQB 4TR4A 1J08A 3W8JA 2TRCP 2VIMA 5IMDA 3KSED 3V98A 1E3VA 1YEPA 2KF3A 3O8YA 2QA1A 1RGGA 2P38A 2E2VA 4N6UA 1BYEA 5HR2A 4Q5RA 3FW2A 2CA8A 2HNLA 2DLXA 3ERFA 2H74A 5AN1A 5G2ZA 4ML1A 2O87A 1SIHA 4Q5FA 1IT8A 1GOVA 4A5PA 3K8NA 5IENA 1RSNA 3HZ8A 3EE1A 2HRKA 5CRGA 2STDA 1RRLA 3AHSA 4HS1A 2CIUA 4QL7A 2WDUA 3QR6A 4WFOA 5IO2A 3PGTA 4HYZA 3VWWA 2KRTA 3ZIVA 5AIXA 2Z7AA 1UCIA 3TKSE 5H5SA 1M2AA 1IYHA 2QGUA 3TOUA 3BNEA 4KFDA 1T2IA 1VQP3 5IMAA 3CC23 3KXOA 1LOXA 2REMA 1H4OA 1URMA 2XSOB 3LXTA 3E99A 5BU4A 3FHKA 3SWLA 20GSA 2L5OA 4IKHA 1LOVA 4NREA 3QOUA 5EVOA 1B2ZA 4V2LA 1JN5B 3ZTLA 1IU7A 1OC3A 1IV7A 1RGLA 5ECIB 3FF0A 2XH9A 1RKYA 1K9M4 3LQ7A 2WULA 4ZBBA 5ECMB 7STDA 3Q74A 2B5EA 3SLUA 1HYUA 1MGRA 3LYPA 4STDA 2OE1A 2B7JA 1WMPA 2INXA 3ZREA 1GSFA 5M1AA 2JSZA 2XHFA 5IIZA 2YZUA 2H75A 3CC73 4J56E 3DY5A 3CRTA 4I8BA 4CY8A 3KGKA 3SOAA 3DGOA 3ECFA 1EP7A 1R5AA 2BTOT 3MWHA 3IJEB 4HDEA 1YGWA 1OHOA 3TJFA 3A5WA 4GLTA 4IP6A 3F40A 1THXA 3DMCA 1MD4A 3LZAA 2M7OA 3MYTA 1NB5I 2D2ZA 4BVXA 1XG8A 2J23A 3TDGA 1IT7A 3A5IA 2MMAA 4BL2A 1TXXA 4MK3A 1BEDA 1TJDA 2YV7A 3I9V2 7GSSA 4HQSA 6GSPA 2O85A 5AISA 1K0NA 1UW1A 2Y74A 1OF5A 1DE1A 1HD2A 2BMQB 5CXOA 5KP3A 2W03A 1UVZA 3CSHA 4XS6A 3IAM2 1IQXA 4OK0A 1GULA 1XW9A 1W6CA 3DIEA 2BO9B 5GZZB 2FA4A 5DAKA 3HXSA 4DSQA 1O6JA 2BNGA 3ME8A 4OD7A 4HBRA 4XCSA 1BNRA 1YDKA 2LS5A 3F7SA 1N8JA 2YFLB 3G4S3 5HOHA 3F6FA 1O7GB 1W2B2 3ERGA 3GN3A 2GQKA 4PNFA 1UUGB 1O81A 1SENA 1UC7A 2Z77A 2CX4A 4NAXA 3C1RA 1XFLA 1FVJA 1RLSA 1ZS7A 2MZCA 3HD5A 3A2XA 1OHSA 3ME7A 1BOXA 1K8A4 1GRXA 3U1WA 4BWQA 2VD0A 3KH9A 3HZ4A 1PMTA 1LJRA 3HCZA 1BRIA 3KTBA 4HM7B 2H01A 5HFGA 3GSTA 4F0CA 1XPVA 3G16A 1S3AA 1EV9A 1TRUA 4LGQA 3IK9A 3UAPA 1PSQA 2C4BA 1TK0B 5DCHA 1GUKA 2XBIA 1AQZA 3VSYA 3G7JA 4HM5B 3QD9A 4HZ9B 4KZ1A 2P31A 1FG4A 3RHCA 4LYLB 4ZB8A 4NHFA 2OWPA 3E3EA 1AVLA 4HOHA 5GAND 2H1AA 5AGYA 3JUOA 4XDVA 1GTUA 2CFWA 6GSWA 3GZYB 1N5HA 1JFUA 2GTUA 5IO0A 2IPAA 5ELAA 3HVXA 1A2VA 3CTGA 4X4JA 18GSA 1OKTA 5JBSA 2A2RA 2VAFA 1OGZA 2F99A 4HSCX 2IIYA 5A4WA 3M8NA 3QRDA 3QMXA 2CWUA 1EEJA 3DGMA 2B6MA 3AMOA 2X4AA 2GSQA 3IC8A 3D4AA 5ECSA 1M2DA 4XBXA 4N3VA 1Y4KA 4EL1A 1ILOA 1PN9A 4FIWA 4FMDA 2VCTA 1A2MA 1JBRA 3M1GA 4D73A 3ED3A 1M0UA 2H8LA 17GSA 1DVCA 3DGLA 2FXTA 3NM2A 2C3TA 3BOAA 3IOSA 2W0QA 1CEWI 4YAPA 4F03A 3NBBA 1VF1A 3I6AA 3LH4A 1UUWB 3L0HA 2DKHA 3G713 5DALB 3OX9A 4ZB6A 1ROVA 1ON4A 1Y25A 5IG5A 2FWGA 4RNYA 3FKFA 4ECBA 1JZWA 1QK8A 1TTZA 2XR8B 3ZFZA 3G7IA 4LMIA 3SX1A 3F14A 4XS4B 1ST9A 2MMOA 5JWQB 3K7CA 3H3HA 1RCKA 3UL5A 3FZ4A 3GZRA 2HZEB 2WO0A 4I2UA 3KZTA 3TJKA 1AQVA 2PERA 5DRVA 1FHEA 2WS2A 1GMQA 4BTYA 2WJUA 2H1GA 3BCKA 3Q6OA 2FGTA 2V6KA 4OMVA 5LD0A 3EB8A 4KGIA 1ZYEA 1GSPA 4RNZA 4GSPA 1RRHA 2CX1A 1NW2A 3GA4A 1Q7HA 3JCML 2VLTA 1IQ8A 1GOUA 1Q824 4Q5QA 3UOMA 2K6VA 4CDLA 2CHCA 1QXHA 5KN3A 4LSOA 4WF5A 1A0FA 4N10A 3KP8A 4IGJA 4KB3A 3H1NA 4ECCA 2BMOB 3KEBA 3IXRA 1ISKA 4X2OA 1BUQA 2BJXA 5F07A 2GXFA 3F9SA 1QUWA 3OV4A 4HVNA 1XOAA 3C7MA 3GL3A 3HVVA 2YN1A 2XGNA 5G2GA 1SJ6A 1W7CA 2H6XA 2HRNA 2O7KA 2HMOB 3CCS3 5KP4A 1PL2A 3CRUA 3LTBA 2X8GA 4WKWA 1JN5A 1K41A 2B5XA 3ZMKA 1F8NA 4J5GA 4MJCA 1RGHA 2GU1A 2RM5A 4IS0A 3VFIA 3HOHA 3NBJA 4K90B 3Q1CA 2C0EA 5ID2B 2B24B 3HJOA 1SK1A 5AIFA 4BL3A 3B8LA 1GTAA 3SYUA 2IUKA 2YWOA 1RGCA 1HU9A 3QFBC 2P5RA 5IW9A 2XRXB 1EZKA 3EJVA 1N8QA 1O7NB 2LNSA 1Q42A 1N9JA 5JWOB 2W2CA 1M9BA 2MMZA 1M2BA 1GMRA 1VQ83 5DBQA 1A2LA 3H4KA 3KE7A 3MYDA 5E4WA 5IPGA 4J9AA 4K7NA 4QQ7A 1FZUA 3N5OA 2SARA 1VQN3 3DXOA 4EXRA 2DIYA 5FW5A 2RCDA 2BHMA 1I0VA 1TRWA 2XGLA 1V98A 2XC2A 4EO3A 1O7UA 4QWTA 2DJ1A 3MIXA 2FUG2 1X1YA 2L5LA 1LQGC 1K0BA 2W56A 4I4KA 2YV9A 3P2AA 4N6NB 1EGRA 4HM1B 1EEMA 3CBUA 4ULXA 3WDGB 4KDXA 3FLJA 4PUAA 2WZ9A 1UGHI 4GRFA 1LNIA 2E2UA 5CF2A 3G0KA 4R9KA 6GSUA 2H70A 1JKGB 4Z2RA 1JZDA 3CYNA 1VQM3 3HDCA 3CCJ3 3CQFA 4N30A 3ZFLA 5G1KA 1ERTA 2LUSA 4ZL7A 1MOLA 2E2TA 3UNLA 2PNCA 2GQLA 3F3RA 4DSRA 2R0GA 2CVBA 4MABA 2DJ0A 1Z9HA 4O5QA 4YKFA 4F2IA 4HJLB 2XBQA 2IMEA 5BRTA 5CO3A 1T5YA 5HQPA 1QAKA 1T1VA 2G0FA 1Q40B 5IEPA 1MWUA 4X1UA 1T4ZA 1LRAA 3BNDA 4K61A 3FMWA 3U97A 5DALA 2GT5A 3O3TA 1YGEA 4K5SA 1LVNA 5CLKA 4HJMA 2R4IA 2KHPA 4WBRD 3WGDA 6GSXA 3HIIA 4H61A 4HM8B 1U5OA 4CCVA 2LEGA 3U6VA 4H86A 5J3RA 4PGTA 3T8NA 4YAVA 5F0GA 5A0OB 2VO4A 4JZQA 2KXGA 3GYKA 1F3BA 1AY7A 4K8MA 4K1VA 2RGQA 1FB0A 2IYJA 3LTAA 1M3IA 1H75A 1XW6A 4ECJA 3AGNA 3AHWA 3AMOB 2C1YA 3B4PA 1JBSA 4GQFA 4NXIA 3X3YA 1NNVA 3GTUB 1KBNA 1GD3A 4N0VA 4TVEA 4HAAA 4YKGA 2QKEA 4J8TA 5TGNA 1V74A 3HVNA 2GSTA 3SBCA 5ECPB 2R0PA 5JCUA 2B1XB 4OVMA 2CZ3A 4AJ7A 4IQAA 3QFAC 2GBWB 2CWVA 5CNWA 1QJGA 2AAEA 4X2HA 4AEQA 4K6XA 4J2FA 2D1WA 4U13A 3IRAA 1DMNA 1QGVA 2Z9SA 1BSCA 5FWGA 4HM2B 2M80A 2NTOA 1DETA 1TRSA 4V1Ag 2H30A 1UUVB 1ERWA 1Y6EA 4MP4A 3OXAA 1UDII 3G8ZA 1BUJA 5ABRA 2YWMA 1RMSA 2P05A 7RNTA 1PKZA 3G9BA 2ON5A 1SJZA 1RGAA 1IVWA 3MNGA 3O76A 5ECLB 2CZ2A 5B8BA 1ULJB 3IDVA 3B7CA 2OQEA 3Q18A 4XBTA 4BTWA 3DD3A 4PQIA 4DSSA 3LMLA 3LG6A 2HT9A 3DKSA 4N11A 3NHXA 4N6MA 3WR2A 3VPTA 1T7PB 3UB1A 4POKA 2K54A 1AR0A 5ECHB 4GSNA 2DMMA 2L6CA 3WGEA 3A2VA 3DGNA 2F86B 1YF0A 3NQZA 1YVBI 4LLRA 1X9MB 1BAYA 3JUNA 1T3BA 4DKIA 1VGLA 4BVYB 2OCTA 3DMLA 3M9JA 1M7TA 1IV9A 3GKXA 3QCPA 1D6YA 3JUPA 1K0DA 5F8BA 4KE3A 3APQA 3R2QA 3VWVA 3Q19A 4XBYA 3DH2A 1B4PA 3D9RA 2ZUPA 4WBJA 4PUFC 1TK8B 12GSA 5IOXA 1QMVA 3KSPA 3P7XA 3TGZA 1BNSA 2N5FA 3D0ZA 1PFPA 4O32A 1WNHA 2RUFA 4EDZA 5IQYA 1EGOA 2C0DA 4F9ZA 4ECIA 1OCVA 4ILFA 4WYKB 4JU5A 3F8HA 3TJJA 1YHQ3 2RUEA 3F8UA 1CYUA 1B2MA 2F98A 1S3CA 4F82A 3ZG5A 4BU4A 3X3XA 2I3YA 3LTCA 1Z7PA 3KKGA 2ML5A 3GX8A 4IHUA 5AYSC 3OWYA 1SYXA 1MEKA 1VQ63 1TP6A 1YJ6A 1YJN3 3U5RE 4K7IA 3TOTA 3CCM3 1R4CA 2HXKA 4K7OA 4K0NA 3ZZXA 3NIVA 2P0XA 2PPTA 4G1MB 1BX9A 1A2PA 2KF4A 3EMPA 4TR1A 1XW5A 4K5RA 1FGOA
chains in the Genus database with same CATH topology
3ZYWA 3LYKA 4FYUA 1G7EA 2G2QA 5ECOB 3D22A 2I4AA 4G19A 3UARA 1A23A 1F6MC 2R37A 3GRXA 1ABAA 5FHIA 2I9HA 2LNTA 1ZCPA 1AUCA 1RQMA 1XWAA 1WP0A 1SU9A 5D9VA 1T4YA 2OACA 2FLSA 5CRDA 1GSEA 1YZXA 2C3QA 1YKAA 2VCVA 1A8YA 1B9YC 5ECRB 1XBSA 1X5DA 4JEDA 3E9JB 2VM1A 4KDYA 4EIPA 1VF2A 5J4UA 4KSOA 1AXDA 2IWTA 3EWLA 1CQGA 2ON7A 2QSIA 1PX7A 5ECQB 4L5OA 3APSA 2R5GA 5G30A 3VURA 1T00A 2GZPA 1TP9A 2TRXA 3GH9A 1GSYA 1AW9A 4USSA 2KUCA 1OE7A 3FZ5A 1TU7A 1SL1B 1GNWA 1USBA 5CRWA 2DC5A 2EIOA 2AAWA 1K0MA 1B48A 3LWAA 4ISDA 4WEYA 13GSA 4KNDA 4BPYA 4WR5A 3AY8A 1GP1A 1GLQA 4OFTA 4X0XA 4BL7A 2VL2C 4IW9A 1A0RP 5D96A 1BG5A 3TRXA 4TXOA 4JRRA 1F37A 4XIHA 3I43A 1ZYQB 2QC7A 2GZZA 3IHQA 4XS4A 4XRAA 2CVKA 4MLYA 3GX0A 8GSSA 3RPNA 1K3OA 2B3SA 1O85A 5ECKB 2IN3A 3KP9A 4ICYA 1WE0A 4EIQA 1J9BA 2LRCA 2ES7A 5CRHA 4MZBA 4PQ1A 1ERVA 3IE3A 4TXOB 3GV1A 3F3QA 3ZFBA 1SJIA 2C8UA 1SD9A 5L71A 3F4SA 5H5RA 5CAXA 2JU5A 4PTSA 3RPPA 5C00A 3KZQA 2L6DA 1K0CA 3GKKA 2IMFA 1EOHA 4NHWA 3MDKA 1XIYA 3LORA 3F6DA 3EC3A 1B8XA 3BCIA 5DVBA 2YOIA 2IMDA 1QQ2A 4NPBA 4F0BA 2LQQA 4HU9A 4MH2A 1PL1A 2FHEA 4E8HA 3KM6A 3KJYA 1MTCA 4YH2A 2OE3A 3RBTA 3C1SA 4IP1A 1DBYA 2K8SA 1MDKA 3HJPA 1U3AA 4EUYA 3TKQA 2PVOC 4TN8A 1X0RA 1NSWA 1XWCA 2NVLA 3F63A 3TUEA 1ERUA 5B6MA 5AIVA 1AQXA 5KN1A 2H6ZA 2X8HA 2CV4A 4Z2UA 1EV4A 4NV5A 4J57E 4TRXA 4ZIJA 2MMNA 3R3EA 2R3XA 4OCEA 2JZTA 3L4NA 4G9HA 5BMUA 4GQCA 4MF5A 3G7YA 1O8WA 2YNXA 1TI3A 2ZCTA 1HNBA 5D9XA 1M9AA 2JADA 2GGTA 4DVCA 5A4VA 1IYIA 2VLVA 5ID2A 4OWYA 3FRCA 3QAVA 2HSHA 3D4TA 4ID0A 5F05A 3UVHA 1V2AA 1Q98A 2H1DA 3DRNA 4RQRA 4WR4A 6GSTA 4MCUA 1PD21 2OBKA 4MNNA 3F9UA 1PRXA 1WJKA 3F4TA 2H0IA 3A2WA 3DGQA 3F0IA 2C4JA 4ZL8A 9GSSA 1G0TA 4FQUA 1PQNA 22GSA 4O7HA 2CVDA 5A5KA 19GSA 3TJGA 4LMWA 3WGXA 1GTBA 3P8WA 1GSDA 4OO5A 5D9TA 1XWBA 1YF1A 4FYBA 2H6YA 2IFQB 2RIIA 1SD8A 1KNGA 3HJMA 1HNAA 3RAZA 4EF0A 1UN2A 5LCZA 4BVYA 4EDYA 3EE2A 5B6NA 4ML6A 1KTEA 4XHMA 5ECNB 4HUAA 4PNGA 4PXOA 1DUGA 4K2DA 1E6BA 1JZRA 3CXGA 4K0GA 1AIUA 3V1WA 4IJIA 4JR6A 2GDRA 4XTSA 3KCMA 1OC9A 2HFDA 3HKRA 2V41A 4TOPA 4IVFA 2DMLA 1VF4A 2A4VA 1XWGA 5CP1A 4IJ3A 2VCXA 3IC4A 5KOXA 1WMJA 4GWRA 2PVQA 1AQWA 4DEJA 1OVNA 5ELGA 2L4QA 1GTIA 4TXVA 3HVSA 1RW1A 4HI7A 4O92A 1XCCA 1THOA 1VF3A 3GNJA 3H79A 3PH9A 4GF0A 5J9BA 2A4HA 1B4QA 1TU8A 3ZRDA 1SK2A 3FY7A 11GSA 1F2EA 1OC8A 4DSSB 2KLXA 5FT3A 2YJ7A 3WT1A 3W6GA 3FZ9A 4AJ8A 1GUHA 1YEXA 4G0KA 5HR3A 4BA7A 2WFCA 3APOA 4HEA2 3TKRA 2JSYA 4MH3A 3ZIJA 2HI7A 1X5EA 1K3YA 3MSZA 4ZL9A 2H0GA 3IAS2 4HJ2A 1XWKA 1GUMA 3VK9A 1OAZA 5DDLA 2VLUA 3EURA 1Z6MA 3GTUA 2HE3A 2X8CA 1N2AA 5KOWA 2KP2A 2LJAA 4KF9A 3BJ5A 4E8EA 4HQZA 3UEMA 4RI6A 2YPMA 2E2MA 4MA9A 3GH6A 3GKMA 3M3MA 4MZCA 5GAPD 5ENUA 2HZEA 1FAAA 2B5YA 1JLWA 1OYJA 1X5CA 3P90A 2H66A 4BVXB 4HU7A 1MDJA 2B7KA 4NMUA 1BJXA 3F4RA 3QDNA 1XVWA 1WOUA 4KA0A 3TRPA 3IR4A 5E59A 3OR5A 2V2GA 2VCZA 2UZ8A 3E0UA 1Z3EA 2FWEA 3LSZA 3UJ1A 1U87A 5DQYA 5HR1A 4KW6A 3ZMLA 5HFIA 3EPTA 2ZNMA 4POMA 14GSA 5IMCA 1F3AA 1WWJA 2XPDA 1ZZYA 1GL8A 2HYXA 5IM9A 2O8VB 4BL7B 1A24A 1U88A 3IBHA 1XZOA 5G1LA 3US3A 4TW5A 2LRTA 3HA9A 3TKSC 2VCWA 2DJJA 1GSQA 3RHBA 1Z6NA 1QFNA 2HRAA 4Z2TA 1B9XC 2CAIA 2LKUA 2OBIA 4I5QA 16GSA 1OE8A 5D8IA 2MBTA 2FGXA 5F06A 4MPGA 2K18A 10GSA 2GLRA 4MJBA 1T8EB 3S9FA 2B1KA 2VL9A 2FA8A 4GSTA 2E0QA 3W8SA 2V32A 2EIRA 4L8EA 2E2GA 2K9FA 4I97A 3EU3A 1SKWB 4ZBAA 3ISOA 4LL4B 5J5NA 1ZGNA 4OO4A 5IMFA 1LU4A 2DIZA 1EWXA 3EU4A 2X64A 1FVKA 3DVWA 4JR4A 3EINA 1WIKA 4FO5A 3PINA 2DSAA 1FW1A 5D93A 4OCFA 1TKDB 1R4WA 4TR3A 5IOWA 4WF4A 4G0LA 3LFLA 4KCAA 4N0ZA 1A8LA 3L9SA 1GNEA 2C0GA 2VOCA 3C8EA 1M99A 3PR8A 3J7Yb 4PQHA 4V2MA 4G0IA 2N5BA 4EC0A 1SL2B 5INYA 1Z7RA 3CTFA 3L9UA 2GS3A 1SK0A 4I2TA 1HQOA 3C73A 4GSSA 4L0UA 2HRFA 3IPZA 2X99A 1CQHA 4IN0A 1ZYPA 1W4VA 4CW9A 2H1BA 2OA7A 3DVXA 1MDIA 2ALBA 1LBKA 5COHA 4O5RA 4CDOA 2GSRA 3RDWA 2EIQA 2V6OA 2AHEA 4KSMA 2F3MA 1SKRB 2BMXA 2H0HA 1GLPA 2N5AA 3WT2A 2VUPA 3TKSA 4MPFA 3TRQA 3LJRA 2I1UA 3UL3A 3KMOA 5EPFA 3WYWA 1G6YA 1HNCA 2H76A 1I9DA 4AF2A 4MF7A 4EXJA 4IBPA 3A3TA 1ZMAA 3VPQA 3D5JA 2YP6A 5DCGA 4KAEA 2VL2A 3GURA 2IY2A 1U6TA 3FR3A 2F8FA 3EMXA 2FY6A 1V57A 2EC4A 1PKWA 3ZVJA 1Z5YE 3HHVA 3GUSA 3IA1A 1MD3A 3IV4A 4O5UA 2H73A 5D9WA 3TJBA 1X9WB 3UVTA 4JBBA 2RLIA 5A4UA 1TDIA 2F9SA 2HSYA 6GSVA 2LV3A 4YQUA 1C72A 3FR9A 4KH7A 2VCQA 4QL9A 3QPMA 3WD6A 3CSJA 3GSSA 1W89A 1XOBA 1F9MA 2DBCA 3KD0A 1ZYNA 4L0WA 4XRDA 1NHYA 2PGTA 1NHOA 3M9KA 1K0AA 2LJRA 1PA3A 5GSTA 2HSMA 4NWYA 3PPUA 3KMNA 2IMIA 1ACVA 2LJKA 3DYRA 2JZRA 2LSTA 4GTUA 1J0FA 1SKSB 4CY6A 1AAZA 1EP8A 5JWRB 6GSYA 2FWHA 2AUVA 5D73A 2MYGA 2AB6A 3BBYA 2OE0A 3D21A 5DAKB 1E2YA 1O73A 5G5EA 1YKCA 4ZXGA 1PX6A 3ZLPA 3I69A 1G6WA 4MZWA 3HY2A 2H71A 2DKIA 3J7Yk 2QGVA 2YWIA 3IK7A 5IMZA 2A2PA 5CREA 2TIRA 4YQVA 4POLA 5EY6A 3HYPA 4ZILA 2OKAA 3GIXA 2GZYA 3LGCA 5JCWA 1FOVA 3ERWA 2NBSA 2F8AA 3IHGA 2FCHA 3LW9A 2M46A 2DJ2A 1OKDA 4KCEA 3QAGA 4POBA 2R2JA 3TKPA 3EYTA 1BQ7A 4K1FA 4LMVA 2C80A 1JHBA 2LQOA 3EVIA 3UBLA 3D4MA 5DJLA 3QAWA 1YQ1A 2IFQA 1GWCA 1AC1A 2GQMA 4NHZA 3BD2A 2C0FA 1V40A 2K8VA 2PN8A 1RK4A 2YJHA 1GSSA 1Q4JA 3KIJA 2FD3A 2YZHA 2R6KA 2PMTA 4KDUA 2I81A 3FZAA 1K0OA 2L4CA 4HOJA 1U3IA 4K9ZA 2JZSA 4MMMA 4WETA 3FR6A 3L78A 4KX4A 2NDOA 5IPHA 2MBSA 2R0CA 3LXZA 3ZL5A 4RQXA 2KOKA 4MDCA 3DWVA 4D73B 2GT6A 2OADA 4V1Ap 1G7OA 1V58A 3H93A 4MJAA 5KN0A 1SYRA 4KUNA 3O6TA 4MJEA 3UMAA 2F51A 2PBJA 1K3LA 5EL8A 1SL0B 2AV4A 4RUVA 4ZB9A 4GCIA 1R26A 4MF6A 4TKYA 3C71A 1DSBA 4NV2A 2HLSA 5DJMA 2RM6A 4Q5NA 3GL5A 1TW9A 1PGTA 5KN2A 3MAKA 5IMVA 2DJ3A 1KEBA 2YWNA 1R7HA 1TK5B 3DXBA 2NPBA 3N9JA 5B8AA 2CQ9A 4G2EA 4V2NA 2A2SA 1PN0A 2HZFA 3GHAA 5J9CA 2WB9A 2CAQA 2H19A 4EVMA 2O89A 4IELA 5G31A 5H5QA 4EE0A 1YY7A 2LTKA 2AYTA 3TB2A 2GVPA 4OFMA 4TR1B 3TCOA 2IJYA 2C3NA 1EOGA 1JLVA 5G5FA 2XPEA 5J41A 4IQ1A 4AGSA 1NM3A 2JL4A 3CMIA 5HR0A 3DEXA 1V9WA 3CSIA 3LEFA 1WPIA 3VLNA 2IMKA 4PURA 1I5GA 5C04A 1WRYA 1UA5A 1OC9B 2J9HA 5GSSA 2WGRA 4JE1A 4FH8A 5DQSA 2P5QA 4WXTA 3FEUA 1ML6A 2PU9C 3H8QA 2E7PA 1DE2A 2CT6A 2LRNA 5LNKe 1R5PA 1ZL9A 2R4VA 4X43A 4YQMA 4P3YB 2PUKC 2YCDA 4ZBDA 3KH7A 2GSSA 2QA2A 3D6IA 1S3DA 4GXZA 4AJ6A 6GSSA 2PWJA 2B1LA 1TOFA 1O8XA 3FK8A 4RI7A 4XS1A 2WRTA 2VL3A 4K2XA 3VI7A 3NOFA 4OFNA 4I6XA 5HFKA 4PX1A 3VWXA 2IL3A 2OJLA 3FYGA 5CYYA 5JCGA 2KP1A 1TI1A 3UIWA 1TRVA 4Z7XA 3ZVJD 2WCIA 1XXUA 1VRSD 4LL1B 1JZOA 2DJKA 1ZOFA 4HZ2A 2VM2A 4HZ4A 3L9VA 2FNOA 4G10A 2VD1A 1FB6A 2L59A 2FWFA 2P0GA 4FYCA 2L57A 4CHSA 2CX3A 3KTLA 1XVQA 1GH2A 2H72A 3NZNA 3M0FA 1GSUA 4TR0A 4EKZA 4L5LA 5KEJA 2JACA 3ZITA 1A2JA 1X9SB 4ACSA 1FOHA 4BWSA 2V1MA 2M72A 5B7CA 1FO5A 3GKNA 2YANA 3GFKA 3VI5A 3UBKA 4LA1A 2X49A 3VWUA 3GMFA 2AJQB 4TR4A 1J08A 3W8JA 2TRCP 2VIMA 5IMDA 1YEPA 2QA1A 1BYEA 5HR2A 4Q5RA 3FW2A 2CA8A 2HNLA 2DLXA 3ERFA 2H74A 5AN1A 5G2ZA 4ML1A 2O87A 4Q5FA 4A5PA 3K8NA 3HZ8A 5CRGA 2HRKA 4HS1A 4QL7A 2WDUA 3QR6A 5IO2A 3PGTA 3VWWA 3ZIVA 5AIXA 3TKSE 5H5SA 1M2AA 1IYHA 3TOUA 5IMAA 3KXOA 2REMA 1H4OA 1URMA 3LXTA 3FHKA 3SWLA 20GSA 2L5OA 4IKHA 3QOUA 5EVOA 4V2LA 3ZTLA 1OC3A 5ECIB 3LQ7A 2WULA 4ZBBA 5ECMB 3Q74A 2B5EA 1HYUA 3LYPA 2OE1A 2B7JA 3ZREA 1GSFA 2JSZA 2XHFA 5IIZA 2YZUA 2H75A 4J56E 3CRTA 4I8BA 4CY8A 3KGKA 1EP7A 2BTOT 1R5AA 3MWHA 4HDEA 3TJFA 3A5WA 4GLTA 4IP6A 1THXA 1MD4A 2D2ZA 4BVXA 2J23A 3TDGA 3A5IA 2MMAA 1TXXA 4MK3A 1BEDA 1TJDA 2YV7A 3I9V2 7GSSA 4HQSA 2O85A 5AISA 1K0NA 1DE1A 1HD2A 1UVZA 3CSHA 4XS6A 3IAM2 1GULA 1XW9A 3DIEA 5GZZB 2FA4A 5DAKA 3HXSA 4DSQA 1O6JA 3ME8A 4OD7A 4XCSA 1YDKA 2LS5A 1N8JA 3F6FA 3ERGA 3GN3A 2GQKA 4PNFA 1O81A 1SENA 1UC7A 2CX4A 4NAXA 3C1RA 1XFLA 1FVJA 2MZCA 3HD5A 3A2XA 3ME7A 1GRXA 4BWQA 2VD0A 3KH9A 3HZ4A 1PMTA 3HCZA 1LJRA 3KTBA 2H01A 5HFGA 3GSTA 4F0CA 1XPVA 1S3AA 1EV9A 1TRUA 3IK9A 3UAPA 1PSQA 1TK0B 5DCHA 1GUKA 2XBIA 3G7JA 3QD9A 2P31A 1FG4A 3RHCA 4ZB8A 3E3EA 5GAND 2H1AA 5AGYA 1GTUA 6GSWA 1JFUA 5IO0A 2GTUA 2IPAA 5ELAA 3HVXA 3CTGA 4X4JA 18GSA 1OKTA 2A2RA 2VAFA 2IIYA 5A4WA 3M8NA 3QMXA 1EEJA 2B6MA 2X4AA 2GSQA 3IC8A 5ECSA 1M2DA 4EL1A 1ILOA 1PN9A 4FIWA 2VCTA 1A2MA 3M1GA 4D73A 3ED3A 1M0UA 2H8LA 17GSA 2C3TA 3IOSA 3BOAA 4YAPA 4F03A 1VF1A 3I6AA 3L0HA 2DKHA 5DALB 4ZB6A 1ON4A 1Y25A 2FWGA 4ECBA 3FKFA 1JZWA 1QK8A 1TTZA 3G7IA 4XS4B 1ST9A 2MMOA 5JWQB 3FZ4A 2HZEB 4I2UA 3TJKA 1AQVA 2PERA 1FHEA 2WS2A 2WJUA 2H1GA 3BCKA 3Q6OA 2V6KA 4OMVA 5LD0A 4KGIA 1ZYEA 1NW2A 3GA4A 3JCML 2VLTA 4Q5QA 3UOMA 2K6VA 1QXHA 5KN3A 4WF5A 1A0FA 4N10A 3KP8A 4IGJA 4KB3A 3H1NA 4ECCA 3KEBA 3IXRA 2BJXA 5F07A 1QUWA 1XOAA 3C7MA 3GL3A 3HVVA 2YN1A 1SJ6A 2HRNA 2H6XA 2O7KA 1PL2A 3CRUA 2X8GA 4WKWA 2B5XA 3ZMKA 4MJCA 2RM5A 4IS0A 3VFIA 2C0EA 5ID2B 3HJOA 1SK1A 1GTAA 2YWOA 3QFBC 2P5RA 1EZKA 2LNSA 5JWOB 1M9BA 2MMZA 1M2BA 5DBQA 1A2LA 3H4KA 3MYDA 5E4WA 5IPGA 4K7NA 4QQ7A 3N5OA 2DIYA 1TRWA 1V98A 2XC2A 4EO3A 1O7UA 2DJ1A 3MIXA 2FUG2 2L5LA 1K0BA 2YV9A 3P2AA 1EGRA 1EEMA 3CBUA 4ULXA 4KDXA 4PUAA 2WZ9A 4GRFA 6GSUA 2H70A 4Z2RA 1JZDA 3CYNA 3HDCA 4N30A 3ZFLA 5G1KA 1ERTA 2LUSA 4ZL7A 2GQLA 3F3RA 4DSRA 2R0GA 2CVBA 4MABA 2DJ0A 1Z9HA 4O5QA 4YKFA 4F2IA 2XBQA 2IMEA 5BRTA 5CO3A 5HQPA 2G0FA 1T1VA 4X1UA 1T4ZA 3FMWA 5DALA 2GT5A 3O3TA 4K5SA 4HJMA 2KHPA 4WBRD 3WGDA 6GSXA 2LEGA 3U6VA 4H86A 5J3RA 4PGTA 4YAVA 5F0GA 2VO4A 4JZQA 3GYKA 1F3BA 4K8MA 1FB0A 2IYJA 1H75A 1XW6A 4ECJA 2C1YA 4GQFA 4NXIA 3GTUB 1KBNA 4N0VA 4TVEA 4YKGA 2QKEA 2GSTA 3SBCA 5ECPB 2R0PA 5JCUA 2CZ3A 4AJ7A 4IQAA 3QFAC 5CNWA 4K6XA 4J2FA 3IRAA 1QGVA 2Z9SA 5FWGA 2M80A 2NTOA 1TRSA 4V1Ag 2H30A 1ERWA 1Y6EA 4MP4A 5ABRA 2YWMA 1PKZA 3G9BA 2ON5A 1SJZA 3MNGA 3O76A 5ECLB 2CZ2A 5B8BA 3IDVA 3Q18A 3DD3A 4PQIA 4DSSA 3LG6A 2HT9A 3DKSA 4N11A 3VPTA 1T7PB 4POKA 5ECHB 4GSNA 2DMMA 2L6CA 3WGEA 3A2VA 1YF0A 4LLRA 1X9MB 1BAYA 1T3BA 1VGLA 4BVYB 3DMLA 3M9JA 1M7TA 3GKXA 3QCPA 1K0DA 5F8BA 4KE3A 3APQA 3R2QA 3VWVA 3Q19A 1B4PA 2ZUPA 4WBJA 4PUFC 1TK8B 12GSA 5IOXA 1QMVA 3TGZA 3P7XA 2N5FA 4O32A 3D0ZA 2RUFA 4EDZA 5IQYA 1EGOA 2C0DA 4F9ZA 4ECIA 4ILFA 4JU5A 3TJJA 2RUEA 3F8UA 1S3CA 4F82A 2I3YA 1Z7PA 3GX8A 4IHUA 1SYXA 1MEKA 1YJ6A 3U5RE 4K7IA 3TOTA 2HXKA 4K7OA 4K0NA 3ZZXA 3NIVA 2PPTA 1BX9A 3EMPA 4TR1A 1XW5A 4K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYW A;  3LYK A;  4FYU A;  1G7E A;  2G2Q A;  5ECO B;  3D22 A;  2I4A A;  4G19 A;  3UAR A;  1A23 A;  1F6M C;  2R37 A;  3GRX A;  1ABA A;  5FHI A;  2I9H A;  2LNT A;  1ZCP A;  1AUC A;  1RQM A;  1XWA A;  1WP0 A;  1SU9 A;  5D9V A;  1T4Y A;  2OAC A;  2FLS A;  5CRD A;  1GSE A;  1YZX A;  2C3Q A;  1YKA A;  2VCV A;  1A8Y A;  1B9Y C;  5ECR B;  1XBS A;  1X5D A;  4JED A;  3E9J B;  2VM1 A;  4KDY A;  1VF2 A;  5J4U A;  4KSO A;  1AXD A;  2IWT A;  3EWL A;  1CQG A;  2ON7 A;  2QSI A;  1PX7 A;  5ECQ B;  4L5O A;  3APS A;  2R5G A;  5G30 A;  3VUR A;  1T00 A;  2GZP A;  1TP9 A;  2TRX A;  3GH9 A;  1GSY A;  1AW9 A;  2KUC A;  1OE7 A;  3FZ5 A;  1TU7 A;  1SL1 B;  1GNW A;  1USB A;  5CRW A;  2DC5 A;  2EIO A;  2AAW A;  1K0M A;  1B48 A;  3LWA A;  4ISD A;  4WEY A;  13GS A;  4KND A;  4BPY A;  4WR5 A;  3AY8 A;  1GP1 A;  1GLQ A;  4OFT A;  4X0X A;  4BL7 A;  2VL2 C;  4IW9 A;  1A0R P;  5D96 A;  1BG5 A;  3TRX A;  4TXO A;  4JRR A;  1F37 A;  4XIH A;  3I43 A;  1ZYQ B;  2QC7 A;  2GZZ A;  3IHQ A;  4XS4 A;  4XRA A;  2CVK A;  4MLY A;  3GX0 A;  8GSS A;  3RPN A;  1K3O A;  2B3S A;  1O85 A;  5ECK B;  2IN3 A;  3KP9 A;  1WE0 A;  1J9B A;  2LRC A;  2ES7 A;  5CRH A;  4MZB A;  4PQ1 A;  1ERV A;  3IE3 A;  4TXO B;  3GV1 A;  3F3Q A;  3ZFB A;  1SJI A;  2C8U A;  1SD9 A;  5L71 A;  3F4S A;  5H5R A;  5CAX A;  2JU5 A;  3RPP A;  5C00 A;  3KZQ A;  2L6D A;  1K0C A;  3GKK A;  2IMF A;  1EOH A;  4NHW A;  3MDK A;  1XIY A;  3LOR A;  3F6D A;  3EC3 A;  1B8X A;  3BCI A;  5DVB A;  2YOI A;  2IMD A;  1QQ2 A;  4NPB A;  4F0B A;  2LQQ A;  4HU9 A;  4MH2 A;  1PL1 A;  2FHE A;  4E8H A;  3KM6 A;  3KJY A;  1MTC A;  4YH2 A;  2OE3 A;  3RBT A;  3C1S A;  4IP1 A;  1DBY A;  2K8S A;  1MDK A;  3HJP A;  1U3A A;  4EUY A;  3TKQ A;  2PVO C;  4TN8 A;  1X0R A;  1NSW A;  1XWC A;  2NVL A;  3F63 A;  3TUE A;  1ERU A;  5B6M A;  5AIV A;  1AQX A;  5KN1 A;  2H6Z A;  2X8H A;  2CV4 A;  1EV4 A;  4NV5 A;  4J57 E;  4TRX A;  4ZIJ A;  2MMN A;  2R3X A;  4OCE A;  2JZT A;  3L4N A;  4G9H A;  4GQC A;  4MF5 A;  3G7Y A;  1O8W A;  2YNX A;  1TI3 A;  2ZCT A;  1HNB A;  5D9X A;  1M9A A;  2JAD A;  2GGT A;  4DVC A;  5A4V A;  1IYI A;  2VLV A;  5ID2 A;  4OWY A;  3FRC A;  3QAV A;  2HSH A;  3D4T A;  4ID0 A;  5F05 A;  3UVH A;  1V2A A;  1Q98 A;  2H1D A;  3DRN A;  4RQR A;  4WR4 A;  6GST A;  4MCU A;  1PD2 1;  2OBK A;  3F9U A;  1PRX A;  1WJK A;  3F4T A;  2H0I A;  3A2W A;  3DGQ A;  3F0I A;  2C4J A;  4ZL8 A;  9GSS A;  1G0T A;  1PQN A;  22GS A;  4O7H A;  2CVD A;  5A5K A;  19GS A;  3TJG A;  4LMW A;  3WGX A;  1GTB A;  3P8W A;  1GSD A;  4OO5 A;  5D9T A;  1XWB A;  1YF1 A;  4FYB A;  2H6Y A;  2IFQ B;  2RII A;  1SD8 A;  1KNG A;  3HJM A;  1HNA A;  3RAZ A;  4EF0 A;  1UN2 A;  5LCZ A;  4BVY A;  4EDY A;  3EE2 A;  5B6N A;  4ML6 A;  1KTE A;  4XHM A;  5ECN B;  4HUA A;  4PNG A;  4PXO A;  1DUG A;  4K2D A;  1E6B A;  1JZR A;  3CXG A;  4K0G A;  1AIU A;  3V1W A;  4IJI A;  4JR6 A;  2GDR A;  4XTS A;  3KCM A;  1OC9 A;  2HFD A;  3HKR A;  2V41 A;  4TOP A;  4IVF A;  2DML A;  1VF4 A;  2A4V A;  1XWG A;  5CP1 A;  4IJ3 A;  2VCX A;  3IC4 A;  1WMJ A;  4GWR A;  2PVQ A;  1AQW A;  4DEJ A;  1OVN A;  5ELG A;  2L4Q A;  1GTI A;  4TXV A;  3HVS A;  1RW1 A;  4HI7 A;  4O92 A;  1XCC A;  1THO A;  1VF3 A;  3GNJ A;  3H79 A;  3PH9 A;  4GF0 A;  5J9B A;  1B4Q A;  1TU8 A;  3ZRD A;  1SK2 A;  3FY7 A;  11GS A;  1F2E A;  1OC8 A;  4DSS B;  2KLX A;  5FT3 A;  2YJ7 A;  3WT1 A;  3W6G A;  3FZ9 A;  4AJ8 A;  1GUH A;  1YEX A;  5HR3 A;  4BA7 A;  2WFC A;  3APO A;  4HEA 2;  3TKR A;  2JSY A;  4MH3 A;  3ZIJ A;  2HI7 A;  1X5E A;  1K3Y A;  3MSZ A;  4ZL9 A;  2H0G A;  3IAS 2;  4HJ2 A;  1XWK A;  1GUM A;  3VK9 A;  1OAZ A;  5DDL A;  2VLU A;  3EUR A;  1Z6M A;  3GTU A;  2HE3 A;  2X8C A;  1N2A A;  2KP2 A;  2LJA A;  3BJ5 A;  4E8E A;  4HQZ A;  3UEM A;  4RI6 A;  2YPM A;  2E2M A;  4MA9 A;  3GH6 A;  3GKM A;  3M3M A;  4MZC A;  5GAP D;  5ENU A;  2HZE A;  1FAA A;  2B5Y A;  1JLW A;  1OYJ A;  1X5C A;  3P90 A;  2H66 A;  4HU7 A;  1MDJ A;  2B7K A;  4NMU A;  1BJX A;  3F4R A;  3QDN A;  1XVW A;  1WOU A;  4KA0 A;  3TRP A;  3IR4 A;  5E59 A;  3OR5 A;  2V2G A;  2VCZ A;  3E0U A;  1Z3E A;  2FWE A;  3LSZ A;  3UJ1 A;  1U87 A;  5DQY A;  5HR1 A;  4KW6 A;  3ZML A;  5HFI A;  2ZNM A;  4POM A;  14GS A;  5IMC A;  1F3A A;  1WWJ A;  2XPD A;  1ZZY A;  1GL8 A;  2HYX A;  5IM9 A;  2O8V B;  1A24 A;  1U88 A;  3IBH A;  1XZO A;  5G1L A;  3US3 A;  4TW5 A;  2LRT A;  3HA9 A;  3TKS C;  2VCW A;  2DJJ A;  1GSQ A;  3RHB A;  1Z6N A;  1QFN A;  1B9X C;  2CAI A;  2LKU A;  2OBI A;  4I5Q A;  16GS A;  1OE8 A;  5D8I A;  2MBT A;  2FGX A;  5F06 A;  4MPG A;  2K18 A;  10GS A;  2GLR A;  4MJB A;  1T8E B;  3S9F A;  2B1K A;  2VL9 A;  2FA8 A;  4GST A;  2E0Q A;  3W8S A;  2V32 A;  2EIR A;  4L8E A;  2E2G A;  2K9F A;  4I97 A;  3EU3 A;  1SKW B;  4ZBA A;  3ISO A;  4LL4 B;  5J5N A;  1ZGN A;  4OO4 A;  5IMF A;  1LU4 A;  2DIZ A;  1EWX A;  3EU4 A;  2X64 A;  1FVK A;  3DVW A;  4JR4 A;  3EIN A;  1WIK A;  4FO5 A;  3PIN A;  2DSA A;  1FW1 A;  5D93 A;  4OCF A;  1TKD B;  1R4W A;  4TR3 A;  5IOW A;  4WF4 A;  3LFL A;  4KCA A;  4N0Z A;  1A8L A;  3L9S A;  1GNE A;  2C0G A;  2VOC A;  3C8E A;  1M99 A;  3PR8 A;  3J7Y b;  4PQH A;  4V2M A;  2N5B A;  4EC0 A;  1SL2 B;  5INY A;  1Z7R A;  3CTF A;  3L9U A;  2GS3 A;  1SK0 A;  4I2T A;  1HQO A;  3C73 A;  4GSS A;  4L0U A;  2HRF A;  3IPZ A;  2X99 A;  1CQH A;  4IN0 A;  1W4V A;  4CW9 A;  2H1B A;  2OA7 A;  3DVX A;  1MDI A;  2ALB A;  1LBK A;  5COH A;  4O5R A;  4CDO A;  2GSR A;  3RDW A;  2EIQ A;  2V6O A;  2AHE A;  4KSM A;  2F3M A;  1SKR B;  2BMX A;  2H0H A;  1GLP A;  2N5A A;  3WT2 A;  2VUP A;  3TKS A;  4MPF A;  3TRQ A;  3LJR A;  2I1U A;  3UL3 A;  3KMO A;  5EPF A;  3WYW A;  1G6Y A;  1HNC A;  2H76 A;  1I9D A;  4AF2 A;  4MF7 A;  4EXJ A;  4IBP A;  3A3T A;  1ZMA A;  3VPQ A;  3D5J A;  2YP6 A;  5DCG A;  4KAE A;  2VL2 A;  3GUR A;  2IY2 A;  1U6T A;  3FR3 A;  2F8F A;  3EMX A;  2FY6 A;  1V57 A;  2EC4 A;  1PKW A;  3ZVJ A;  1Z5Y E;  3HHV A;  3GUS A;  3IA1 A;  1MD3 A;  3IV4 A;  2H73 A;  5D9W A;  3TJB A;  1X9W B;  3UVT A;  4JBB A;  2RLI A;  5A4U A;  1TDI A;  2F9S A;  2HSY A;  6GSV A;  2LV3 A;  4YQU A;  1C72 A;  3FR9 A;  4KH7 A;  2VCQ A;  4QL9 A;  3QPM A;  3WD6 A;  3CSJ A;  3GSS A;  1W89 A;  1XOB A;  1F9M A;  2DBC A;  3KD0 A;  4L0W A;  4XRD A;  1NHY A;  2PGT A;  1NHO A;  3M9K A;  1K0A A;  2LJR A;  1PA3 A;  5GST A;  4NWY A;  3KMN A;  2IMI A;  1ACV A;  2LJK A;  3DYR A;  2JZR A;  2LST A;  4GTU A;  1J0F A;  1SKS B;  1AAZ A;  1EP8 A;  5JWR B;  6GSY A;  2FWH A;  2AUV A;  5D73 A;  2MYG A;  2AB6 A;  3BBY A;  2OE0 A;  3D21 A;  5DAK B;  1E2Y A;  1O73 A;  5G5E A;  1YKC A;  4ZXG A;  1PX6 A;  3ZLP A;  3I69 A;  1G6W A;  4MZW A;  3HY2 A;  2H71 A;  3J7Y k;  2QGV A;  2YWI A;  3IK7 A;  5IMZ A;  5CRE A;  2TIR A;  4YQV A;  4POL A;  5EY6 A;  3HYP A;  4ZIL A;  2OKA A;  3GIX A;  2GZY A;  3LGC A;  5JCW A;  1FOV A;  3ERW A;  2NBS A;  2F8A A;  2FCH A;  2M46 A;  2DJ2 A;  1OKD A;  4KCE A;  3QAG A;  4POB A;  2R2J A;  3TKP A;  3EYT A;  1BQ7 A;  4K1F A;  4LMV A;  2C80 A;  1JHB A;  2LQO A;  3EVI A;  3UBL A;  3D4M A;  5DJL A;  3QAW A;  1YQ1 A;  2IFQ A;  1GWC A;  1AC1 A;  2GQM A;  4NHZ A;  3BD2 A;  2C0F A;  1V40 A;  2K8V A;  2PN8 A;  1RK4 A;  2YJH A;  1GSS A;  1Q4J A;  3KIJ A;  2FD3 A;  2YZH A;  2R6K A;  2PMT A;  4KDU A;  2I81 A;  3FZA A;  1K0O A;  2L4C A;  4HOJ A;  1U3I A;  4K9Z A;  2JZS A;  4MMM A;  4WET A;  3FR6 A;  3L78 A;  4KX4 A;  2NDO A;  5IPH A;  2MBS A;  3LXZ A;  3ZL5 A;  4RQX A;  2KOK A;  4MDC A;  3DWV A;  4D73 B;  2GT6 A;  2OAD A;  4V1A p;  1G7O A;  1V58 A;  3H93 A;  4MJA A;  5KN0 A;  1SYR A;  4KUN A;  3O6T A;  4MJE A;  3UMA A;  2F51 A;  2PBJ A;  1K3L A;  5EL8 A;  1SL0 B;  2AV4 A;  4RUV A;  4ZB9 A;  4GCI A;  1R26 A;  4MF6 A;  4TKY A;  3C71 A;  1DSB A;  4NV2 A;  2HLS A;  5DJM A;  2RM6 A;  4Q5N A;  3GL5 A;  1TW9 A;  1PGT A;  5KN2 A;  3MAK A;  5IMV A;  2DJ3 A;  1KEB A;  2YWN A;  1R7H A;  1TK5 B;  3DXB A;  2NPB A;  3N9J A;  5B8A A;  2CQ9 A;  4G2E A;  4V2N A;  2A2S A;  2HZF A;  3GHA A;  5J9C A;  2WB9 A;  2CAQ A;  2H19 A;  4EVM A;  2O89 A;  4IEL A;  5G31 A;  5H5Q A;  4EE0 A;  1YY7 A;  2LTK A;  2AYT A;  3TB2 A;  2GVP A;  4OFM A;  4TR1 B;  3TCO A;  2IJY A;  2C3N A;  1EOG A;  1JLV A;  5G5F A;  2XPE A;  5J41 A;  4IQ1 A;  4AGS A;  1NM3 A;  2JL4 A;  3CMI A;  5HR0 A;  3DEX A;  1V9W A;  3CSI A;  3LEF A;  1WPI A;  3VLN A;  2IMK A;  4PUR A;  1I5G A;  5C04 A;  1WRY A;  1UA5 A;  1OC9 B;  2J9H A;  5GSS A;  2WGR A;  4JE1 A;  4FH8 A;  5DQS A;  2P5Q A;  4WXT A;  3FEU A;  1ML6 A;  2PU9 C;  3H8Q A;  2E7P A;  1DE2 A;  2CT6 A;  2LRN A;  5LNK e;  1R5P A;  1ZL9 A;  2R4V A;  4X43 A;  4YQM A;  4P3Y B;  2PUK C;  2YCD A;  4ZBD A;  3KH7 A;  2GSS A;  3D6I A;  1S3D A;  4GXZ A;  4AJ6 A;  6GSS A;  2PWJ A;  2B1L A;  1TOF A;  1O8X A;  3FK8 A;  4RI7 A;  4XS1 A;  2WRT A;  2VL3 A;  3VI7 A;  3NOF A;  4OFN A;  4I6X A;  5HFK A;  4PX1 A;  3VWX A;  2IL3 A;  2OJL A;  3FYG A;  5CYY A;  5JCG A;  2KP1 A;  1TI1 A;  3UIW A;  1TRV A;  4Z7X A;  3ZVJ D;  2WCI A;  1XXU A;  1VRS D;  4LL1 B;  1JZO A;  2DJK A;  1ZOF A;  4HZ2 A;  2VM2 A;  4HZ4 A;  3L9V A;  2FNO A;  4G10 A;  2VD1 A;  1FB6 A;  2L59 A;  2FWF A;  2P0G A;  4FYC A;  2L57 A;  4CHS A;  2CX3 A;  3KTL A;  1XVQ A;  1GH2 A;  2H72 A;  3NZN A;  3M0F A;  1GSU A;  4TR0 A;  4EKZ A;  4L5L A;  5KEJ A;  2JAC A;  3ZIT A;  1A2J A;  1X9S B;  4ACS A;  4BWS A;  2V1M A;  2M72 A;  5B7C A;  1FO5 A;  3GKN A;  2YAN A;  3GFK A;  3VI5 A;  3UBK A;  4LA1 A;  3VWU A;  3GMF A;  2AJQ B;  4TR4 A;  1J08 A;  3W8J A;  2TRC P;  2VIM A;  5IMD A;  1YEP A;  1BYE A;  5HR2 A;  4Q5R A;  3FW2 A;  2CA8 A;  2HNL A;  2DLX A;  3ERF A;  2H74 A;  5AN1 A;  5G2Z A;  4ML1 A;  2O87 A;  4Q5F A;  3K8N A;  3HZ8 A;  5CRG A;  4HS1 A;  4QL7 A;  2WDU A;  3QR6 A;  5IO2 A;  3PGT A;  3VWW A;  3ZIV A;  5AIX A;  3TKS E;  5H5S A;  1M2A A;  1IYH A;  3TOU A;  5IMA A;  3KXO A;  2REM A;  1H4O A;  1URM A;  3LXT A;  3FHK A;  3SWL A;  20GS A;  2L5O A;  4IKH A;  3QOU A;  5EVO A;  4V2L A;  3ZTL A;  1OC3 A;  5ECI B;  3LQ7 A;  2WUL A;  4ZBB A;  5ECM B;  3Q74 A;  2B5E A;  1HYU A;  3LYP A;  2OE1 A;  2B7J A;  3ZRE A;  1GSF A;  2JSZ A;  2XHF A;  5IIZ A;  2YZU A;  2H75 A;  4J56 E;  3CRT A;  4I8B A;  3KGK A;  1EP7 A;  2BTO T;  1R5A A;  3MWH A;  4HDE A;  3TJF A;  3A5W A;  4GLT A;  4IP6 A;  1THX A;  1MD4 A;  2D2Z A;  4BVX A;  2J23 A;  3TDG A;  2MMA A;  1TXX A;  4MK3 A;  1BED A;  1TJD A;  2YV7 A;  3I9V 2;  7GSS A;  4HQS A;  2O85 A;  5AIS A;  1K0N A;  1DE1 A;  1HD2 A;  1UVZ A;  3CSH A;  4XS6 A;  3IAM 2;  1GUL A;  1XW9 A;  3DIE A;  5GZZ B;  2FA4 A;  5DAK A;  3HXS A;  4DSQ A;  1O6J A;  3ME8 A;  4OD7 A;  4XCS A;  1YDK A;  2LS5 A;  1N8J A;  3F6F A;  3ERG A;  3GN3 A;  2GQK A;  4PNF A;  1O81 A;  1SEN A;  1UC7 A;  2CX4 A;  4NAX A;  3C1R A;  1XFL A;  1FVJ A;  2MZC A;  3HD5 A;  3A2X A;  3ME7 A;  1GRX A;  4BWQ A;  2VD0 A;  3KH9 A;  3HZ4 A;  1PMT A;  3HCZ A;  1LJR A;  3KTB A;  2H01 A;  5HFG A;  3GST A;  4F0C A;  1XPV A;  1S3A A;  1EV9 A;  1TRU A;  3IK9 A;  3UAP A;  1PSQ A;  1TK0 B;  5DCH A;  1GUK A;  2XBI A;  3G7J A;  3QD9 A;  2P31 A;  1FG4 A;  3RHC A;  4ZB8 A;  3E3E A;  5GAN D;  2H1A A;  5AGY A;  1GTU A;  6GSW A;  1JFU A;  5IO0 A;  2GTU A;  2IPA A;  5ELA A;  3HVX A;  3CTG A;  18GS A;  1OKT A;  2A2R A;  2VAF A;  2IIY A;  5A4W A;  3M8N A;  3QMX A;  1EEJ A;  2B6M A;  2GSQ A;  5ECS A;  1M2D A;  4EL1 A;  1ILO A;  1PN9 A;  4FIW A;  2VCT A;  1A2M A;  3M1G A;  4D73 A;  3ED3 A;  1M0U A;  2H8L A;  17GS A;  2C3T A;  3IOS A;  3BOA A;  4YAP A;  4F03 A;  1VF1 A;  3I6A A;  3L0H A;  5DAL B;  4ZB6 A;  1ON4 A;  1Y25 A;  2FWG A;  4ECB A;  3FKF A;  1JZW A;  1QK8 A;  1TTZ A;  3G7I A;  4XS4 B;  1ST9 A;  2MMO A;  5JWQ B;  3FZ4 A;  2HZE B;  4I2U A;  3TJK A;  1AQV A;  2PER A;  1FHE A;  2WS2 A;  2WJU A;  2H1G A;  3BCK A;  3Q6O A;  2V6K A;  4OMV A;  5LD0 A;  4KGI A;  1ZYE A;  1NW2 A;  3GA4 A;  3JCM L;  2VLT A;  4Q5Q A;  3UOM A;  2K6V A;  1QXH A;  5KN3 A;  4WF5 A;  1A0F A;  4N10 A;  3KP8 A;  4IGJ A;  4KB3 A;  3H1N A;  4ECC A;  3KEB A;  3IXR A;  2BJX A;  5F07 A;  1QUW A;  1XOA A;  3C7M A;  3GL3 A;  3HVV A;  2YN1 A;  1SJ6 A;  2HRN A;  2H6X A;  2O7K A;  1PL2 A;  3CRU A;  2X8G A;  4WKW A;  2B5X A;  3ZMK A;  4MJC A;  2RM5 A;  4IS0 A;  3VFI A;  2C0E A;  5ID2 B;  3HJO A;  1SK1 A;  1GTA A;  2YWO A;  3QFB C;  2P5R A;  1EZK A;  2LNS A;  5JWO B;  1M9B A;  2MMZ A;  1M2B A;  5DBQ A;  1A2L A;  3H4K A;  5E4W A;  5IPG A;  4K7N A;  4QQ7 A;  3N5O A;  2DIY A;  1TRW A;  1V98 A;  2XC2 A;  4EO3 A;  1O7U A;  2DJ1 A;  2FUG 2;  2L5L A;  1K0B A;  2YV9 A;  3P2A A;  1EGR A;  1EEM A;  3CBU A;  4ULX A;  4KDX A;  4PUA A;  2WZ9 A;  4GRF A;  6GSU A;  2H70 A;  1JZD A;  3CYN A;  3HDC A;  4N30 A;  3ZFL A;  5G1K A;  1ERT A;  2LUS A;  4ZL7 A;  2GQL A;  3F3R A;  4DSR A;  2CVB A;  4MAB A;  2DJ0 A;  1Z9H A;  4F2I A;  2XBQ A;  2IME A;  5CO3 A;  5HQP A;  2G0F A;  1T1V A;  4X1U A;  1T4Z A;  5DAL A;  2GT5 A;  3O3T A;  4HJM A;  2KHP A;  4WBR D;  3WGD A;  6GSX A;  2LEG A;  3U6V A;  4H86 A;  5J3R A;  4PGT A;  4YAV A;  5F0G A;  2VO4 A;  4JZQ A;  3GYK A;  1F3B A;  4K8M A;  1FB0 A;  2IYJ A;  1H75 A;  1XW6 A;  4ECJ A;  2C1Y A;  4GQF A;  4NXI A;  3GTU B;  1KBN A;  4N0V A;  4TVE A;  2QKE A;  2GST A;  3SBC A;  5ECP B;  5JCU A;  2CZ3 A;  4AJ7 A;  4IQA A;  3QFA C;  5CNW A;  4K6X A;  4J2F A;  3IRA A;  1QGV A;  2Z9S A;  5FWG A;  2M80 A;  2NTO A;  1TRS A;  4V1A g;  2H30 A;  1ERW A;  1Y6E A;  4MP4 A;  5ABR A;  2YWM A;  1PKZ A;  3G9B A;  2ON5 A;  1SJZ A;  3MNG A;  3O76 A;  5ECL B;  2CZ2 A;  5B8B A;  3IDV A;  3Q18 A;  3DD3 A;  4PQI A;  4DSS A;  3LG6 A;  2HT9 A;  3DKS A;  4N11 A;  3VPT A;  1T7P B;  4POK A;  5ECH B;  4GSN A;  2DMM A;  2L6C A;  3WGE A;  3A2V A;  1YF0 A;  4LLR A;  1X9M B;  1BAY A;  1T3B A;  1VGL A;  3DML A;  3M9J A;  1M7T A;  3GKX A;  3QCP A;  1K0D A;  5F8B A;  4KE3 A;  3APQ A;  3R2Q A;  3VWV A;  3Q19 A;  1B4P A;  2ZUP A;  4WBJ A;  4PUF C;  1TK8 B;  12GS A;  5IOX A;  1QMV A;  3TGZ A;  3P7X A;  2N5F A;  4O32 A;  3D0Z A;  2RUF A;  4EDZ A;  5IQY A;  1EGO A;  2C0D A;  4F9Z A;  4ECI A;  4ILF A;  4JU5 A;  3TJJ A;  2RUE A;  3F8U A;  1S3C A;  4F82 A;  2I3Y A;  1Z7P A;  3GX8 A;  4IHU A;  1SYX A;  1MEK A;  1YJ6 A;  3U5R E;  4K7I A;  3TOT A;  2HXK A;  4K7O A;  4K0N A;  3ZZX A;  3NIV A;  2PPT A;  1BX9 A;  3EMP A;  4TR1 A;  1XW5 A; 
#chains in the Genus database with same CATH topology
 3ZYW A;  3LYK A;  1SJW A;  1W02 A;  1FUT A;  4FYU A;  1G7E A;  2G2Q A;  5ECO B;  3D22 A;  2I4A A;  4G19 A;  3UAR A;  1A23 A;  4BIR A;  1I0X A;  1F6M C;  2R37 A;  3WOD G;  3GRX A;  1ABA A;  5FHI A;  2I9H A;  4HM0 B;  2LNT A;  1ZCP A;  3FSD A;  3NM7 A;  3ROB A;  1AUC A;  3RGA A;  3NUV A;  3UL6 A;  3GZX B;  1IYY A;  1RQM A;  1XWA A;  1WP0 A;  1A67 A;  1SU9 A;  3RDE A;  5D9V A;  3WOF B;  3N54 B;  1T4Y A;  2OAC A;  2FLS A;  1I2E A;  4N6L A;  5CRD A;  1W4N A;  1GSE A;  1YZX A;  2ZHX B;  4FCM A;  2C3Q A;  1YKA A;  1IVX A;  1RHL A;  2VCV A;  1A8Y A;  1B9Y C;  5STD A;  5ECR B;  1XBS A;  1NU3 A;  2W9P A;  1X5D A;  4JED A;  3E9J B;  2VM1 A;  3LTD A;  3JVC A;  1VQ4 3;  4KDY A;  1VF2 A;  4EIP A;  5J4U A;  1SII A;  5EQL A;  5AI1 A;  1RGF A;  4KSO A;  1AXD A;  2HMJ B;  2IWT A;  3EWL A;  1FGT A;  1CQG A;  1HYF A;  2ON7 A;  2QSI A;  1PX7 A;  5ECQ B;  2CG1 A;  1Z1S A;  4L5O A;  2CWT A;  3S29 A;  5IEO A;  3APS A;  2R5G A;  4HM4 B;  5ELJ A;  5G30 A;  3VUR A;  1T00 A;  2GZP A;  3MHE A;  1TP9 A;  1QAF A;  2TRX A;  3GH9 A;  1GSY A;  1AW9 A;  4USS A;  7GSP A;  5I97 A;  2KUC A;  1OE7 A;  3FZ5 A;  4FMA A;  1TU7 A;  1C7H A;  1GNW A;  4HM6 B;  1SL1 B;  2KF6 A;  3D3L A;  1USB A;  5CRW A;  2DC5 A;  2EIO A;  2AAW A;  1K0M A;  1B48 A;  3LWA A;  4KT3 B;  4ISD A;  1I3I A;  4WEY A;  1R4Y A;  4IIA A;  13GS A;  1UCL A;  2C11 A;  3PXM A;  1YI2 3;  4KND A;  4WYK A;  2CKF B;  4BPY A;  1VQQ A;  1QVF 2;  3FG3 A;  4WR5 A;  4Q53 A;  4TX4 A;  3AY8 A;  1GP1 A;  1GLQ A;  4OFT A;  4X0X A;  4BL7 A;  2JDI H;  2VL2 C;  4IW9 A;  1GYB A;  1A0R P;  1BRG A;  5D96 A;  1BG5 A;  3TRX A;  4KFF A;  1RN1 A;  1NWW A;  4TXO A;  4JRR A;  1F37 A;  4XIH A;  4HZB B;  3I43 A;  1ZYQ B;  2QC7 A;  1J2B A;  2Z6B A;  1BU4 A;  2GZZ A;  3IHQ A;  4XS4 A;  4XRA A;  2CVK A;  4MLY A;  2UX0 A;  1S5A A;  3GX0 A;  3RPN A;  8GSS A;  1K3O A;  1GY7 A;  2B3S A;  3Q2P A;  1RNB A;  1O85 A;  2IN3 A;  5ECK B;  1VQK 3;  3KP9 A;  1GOY A;  1K73 4;  4ICY A;  5AIH A;  2HOH A;  4O8S A;  1WE0 A;  1W6G A;  1JKG A;  4EIQ A;  1WMO A;  1J9B A;  2LRC A;  2ES7 A;  5CRH A;  4MZB A;  4PQ1 A;  1ERV A;  3IE3 A;  2BMR B;  2GU3 A;  4TXO B;  4R1K A;  3GV1 A;  2IMJ A;  1B21 A;  3F3Q A;  2XFT A;  3ZFB A;  3BIR A;  1IK3 A;  1CYV A;  1N9E A;  1SJI A;  2C8U A;  1I2G A;  1SD9 A;  5L71 A;  3F4S A;  3NV0 B;  5H5R A;  5CAX A;  3BNB A;  2JU5 A;  4PTS A;  2QEX 3;  3RPP A;  5C00 A;  3F8X A;  3KZQ A;  5D82 A;  2L6D A;  1K0C A;  3GKK A;  1RGK A;  1EOH A;  4MMZ B;  2IMF A;  1BNG A;  4NHW A;  3MDK A;  1XIY A;  3LOR A;  3F6D A;  3EC3 A;  3I0Y A;  3SVA A;  1B8X A;  1W6Y A;  3MG3 A;  3OW2 2;  3BCI A;  5DVB A;  1CQS A;  1PU4 A;  2BU4 A;  2IMD A;  1BSA A;  1QQ2 A;  2YOI A;  1S72 3;  4NPB A;  4F0B A;  2BT3 A;  3NX0 A;  2W9Q A;  1S3R A;  4N6T A;  2LQQ A;  4HU9 A;  4MH2 A;  2V1L A;  1M1X B;  1PL1 A;  2FHE A;  1US1 A;  3DUK A;  4E8H A;  4WWU C;  2IUJ A;  3KM6 A;  3KJY A;  1MTC A;  4YH2 A;  1OPY A;  1VQO 3;  2OE3 A;  3RBT A;  4MJD A;  4EV2 A;  3C1S A;  2CFG A;  4IP1 A;  1DBY A;  2K8S A;  1MDK A;  3HJP A;  1U3A A;  4EUY A;  2OQE C;  3Q3F A;  3TKQ A;  3LT9 A;  1LXE A;  3LOY A;  2PVO C;  4L8P A;  1TIJ A;  1SAR A;  3FH1 A;  4TN8 A;  4BTX A;  1X0R A;  1BIR A;  9RNT A;  1NSW A;  3D79 A;  1HZ1 A;  1XWC A;  2NVL A;  1ERU A;  3F63 A;  3TUE A;  5B6M A;  2F4Y A;  5AIV A;  1AQX A;  5KN1 A;  1M9G A;  2H6Z A;  1JB5 A;  4KFE A;  2X8H A;  1IQY A;  1BNJ A;  2CV4 A;  4MMX B;  2XSH B;  4Z2U A;  1EV4 A;  3PCS A;  4NV5 A;  4J57 E;  5IG0 A;  2HMK B;  3GAX A;  4TRX A;  4ZIJ A;  2MMN A;  3R3E A;  2R3X A;  3DZL A;  1KWI A;  4OCE A;  2JZT A;  3L4N A;  2IA7 A;  4H3U A;  4RZM A;  4G9H A;  5BMU A;  4GQC A;  4MF5 A;  3G7Y A;  1FA3 A;  1O8W A;  2YNX A;  1TI3 A;  2ZCT A;  1HNB A;  5D9X A;  1M9A A;  1AVK A;  2JAD A;  3GZB A;  2GGT A;  3CMA 3;  4DVC A;  1M90 4;  5A4V A;  1IYI A;  2VLV A;  5ID2 A;  1YNV X;  4ZM8 A;  4OWY A;  3FRC A;  3QAV A;  1OF5 B;  2HSH A;  3D4T A;  4ID0 A;  5F05 A;  3UVH A;  1V2A A;  1Q98 A;  2H1D A;  3BLZ A;  3DRN A;  4RQR A;  4WR4 A;  6GST A;  4MCU A;  2MC8 A;  1PD2 1;  2W56 B;  2OBK A;  2RSX A;  4MNN A;  1EA2 A;  3F9U A;  1PRX A;  1WJK A;  3F4T A;  2YX9 A;  2H0I A;  3GSP A;  3A2W A;  1BRJ A;  3DGQ A;  4L8O A;  3F0I A;  2C4J A;  4ZL8 A;  1KQS 2;  9GSS A;  3CPW 2;  1FYS A;  3S28 A;  1G0T A;  4FQU A;  1PQN A;  22GS A;  4O7H A;  2CVD A;  5A5K A;  3Q90 A;  3FZW A;  19GS A;  3TJG A;  1TRP A;  4IT7 A;  2CG0 A;  4LMW A;  3WGX A;  3NQY A;  3L0R A;  3CXC 2;  1GTB A;  1VQL 3;  3P8W A;  3X3Z A;  1OGX A;  1GSD A;  4OO5 A;  1XWB A;  5D9T A;  1YF1 A;  4FYB A;  5BVB A;  1PYL A;  2H6Y A;  2IFQ B;  2RII A;  1FUW A;  1CH0 A;  1SD8 A;  2CW9 A;  1KNG A;  3HJM A;  1HNA A;  3RAZ A;  4EF0 A;  1O7M B;  1UN2 A;  5LCZ A;  4BVY A;  4EDY A;  3EE2 A;  1YVS A;  5B6N A;  2UUG C;  4ML6 A;  1KTE A;  4XHM A;  4BIK A;  1B20 A;  3HI7 A;  5ECN B;  4HUA A;  5FGO A;  1BRN L;  4PNG A;  4PXO A;  5AEW B;  1DUG A;  4K2D A;  4AKY A;  1E6B A;  1JZR A;  3CXG A;  1DMM A;  4K0G A;  1KC8 4;  1AIU A;  3V1W A;  1X1X A;  4IJI A;  4JR6 A;  2GDR A;  4XTS A;  3KCM A;  1OUN A;  1OC9 A;  2HFD A;  3WOE B;  2V41 A;  1BRS A;  3HKR A;  4TOP A;  5EVH A;  1ZX2 A;  4IVF A;  2DML A;  4O02 B;  5HGR A;  1VF4 A;  2A4V A;  1M3J A;  3PZW A;  2WOF A;  1XWG A;  4IJ3 A;  5CP1 A;  2I9W A;  3H51 A;  3EQQ B;  2VCX A;  3CCE 3;  1WTH A;  1Q9E A;  3IC4 A;  5KOX A;  2JQ5 A;  1WMJ A;  1D6U A;  2K0M A;  3GRD A;  5JPP A;  4GWR A;  2PVQ A;  1AQW A;  3QK9 A;  4DEJ A;  1OVN A;  4MEI A;  5ELG A;  2L4Q A;  1GTI A;  4TXV A;  3HVS A;  1RW1 A;  4HI7 A;  4O92 A;  1XCC A;  1EKM A;  1THO A;  1VF3 A;  3GNJ A;  1UGI A;  3H79 A;  3PH9 A;  4GF0 A;  5J9B A;  2A4H A;  2XFS A;  1K28 A;  1B4Q A;  1TU8 A;  3ZRD A;  1SK2 A;  3FY7 A;  11GS A;  1F2E A;  1OC8 A;  3KN4 A;  4DSS B;  2KF5 A;  1BGS A;  1X1W A;  3PS8 A;  2KLX A;  5FT3 A;  2YJ7 A;  3WT1 A;  3W6G A;  3FZ9 A;  2WGO A;  4AJ8 A;  1GUH A;  1YEX A;  4G0K A;  2RBI A;  5HR3 A;  4BA7 A;  6RNT A;  2WFC A;  3APO A;  1MWS A;  4HEA 2;  3TKR A;  1MNL A;  2JSY A;  4MH3 A;  3ZIJ A;  2HI7 A;  2GBX B;  1X5E A;  1K3Y A;  3T0U A;  3MSZ A;  4ZL9 A;  2A15 A;  2H0G A;  3IAS 2;  4HJ2 A;  1XWK A;  1GUM A;  3VK9 A;  1OAZ A;  2ML6 A;  2VLU A;  5DDL A;  3X42 A;  5AEU B;  1NB3 I;  3EUR A;  1Z6M A;  1JB4 A;  3GTU A;  1G96 A;  2HE3 A;  3D5G A;  2X8C A;  1N2A A;  5KOW A;  2KP2 A;  2LJA A;  4KF9 A;  4GB5 A;  3BJ5 A;  4E8E A;  4HQZ A;  1DYU A;  1O7H B;  3UEM A;  3FKA A;  4RI6 A;  2YPM A;  2E2M A;  4MA9 A;  1JRQ A;  3GH6 A;  3GKM A;  1L5G B;  2FNQ A;  1OHP A;  3M3M A;  1UI8 A;  4MZC A;  5GAP D;  3JUM A;  5ENU A;  2HZE A;  1TTO A;  1GY6 A;  3ALA A;  4R4K A;  1FAA A;  1JLW A;  2B5Y A;  1X5C A;  1OYJ A;  1TUH A;  2UGI A;  3P90 A;  2H66 A;  4BVX B;  2J8X B;  3D5I A;  4HU7 A;  1MDJ A;  2B7K A;  1BNI A;  1AV4 A;  4NMU A;  1BJX A;  4PEJ A;  3F4R A;  3QDN A;  1XVW A;  4JF8 A;  1WOU A;  4KA0 A;  3TRP A;  3IR4 A;  5E59 A;  3OR5 A;  2V2G A;  3NXJ A;  5IF6 A;  2VCZ A;  4FR9 A;  2UZ8 A;  3MG1 A;  3LYG A;  3E0U A;  1Z3E A;  3MSO A;  1Q86 4;  1T2H A;  2FWE A;  2GSP A;  3LSZ A;  3UJ1 A;  1DE3 A;  1VQ9 3;  2AAD A;  1U87 A;  5DQY A;  5HR1 A;  4KW6 A;  3S67 A;  3ZML A;  5HFI A;  3EPT A;  2ZNM A;  4POM A;  14GS A;  3EBY A;  5IMC A;  1F3A A;  1WWJ A;  1UCJ A;  2XPD A;  1ZZY A;  1GL8 A;  2HYX A;  2Q07 A;  5IM9 A;  2O8V B;  1NO3 A;  4BL7 B;  1A24 A;  3EX9 A;  1U88 A;  3IBH A;  1XZO A;  5G1L A;  1TFO A;  4TW5 A;  3US3 A;  1GMP A;  2LRT A;  3HA9 A;  3TKS C;  3EBT A;  2VCW A;  2DJJ A;  1GSQ A;  3RHB A;  1Z6N A;  1QFN A;  2HRA A;  4Z2T A;  1B9X C;  1VZZ A;  2L1S A;  2WOH A;  2CAI A;  3KCH A;  2LKU A;  2OBI A;  1GD4 A;  4I5Q A;  16GS A;  1OE8 A;  1PY3 A;  3OWU A;  3SOY A;  5D8I A;  3K0Z A;  1WQL B;  2MBT A;  3FG4 A;  2FGX A;  5F06 A;  3DGY A;  4MPG A;  1TRQ A;  3VF1 A;  2K18 A;  10GS A;  2GLR A;  4MJB A;  2SBL A;  1T8E B;  1DVD A;  3S9F A;  3GWR A;  2B1K A;  4N6V 0;  2VL9 A;  1A90 A;  2FA8 A;  4GST A;  2E0Q A;  3W8S A;  3KII A;  2V32 A;  1RTU A;  3RNT A;  3BNC A;  2EIR A;  4L8E A;  4OUQ A;  2E2G A;  2K9F A;  3M8C A;  3EU3 A;  1RGE A;  4I97 A;  3ISO A;  4LL4 B;  4ZBA A;  1SKW B;  1Q81 4;  3HZP A;  5J5N A;  1ZGN A;  4OO4 A;  3T8U A;  5IMF A;  1LU4 A;  2DIZ A;  1EWX A;  3EU4 A;  1VQ7 3;  2O3O A;  2X64 A;  1FVK A;  3DVW A;  4JR4 A;  3WHO A;  3EIN A;  1WIK A;  2ZA4 A;  4FO5 A;  4ORL A;  3PIN A;  2QIY A;  2DSA A;  1FW1 A;  3PGB A;  4OCF A;  5D93 A;  1TKD B;  2YFI B;  1R4W A;  4TR3 A;  3PCR A;  5IOW A;  4WF4 A;  4G0L A;  3CCR 3;  1B3S A;  4JRF A;  2HMM B;  3LFL A;  4KCA A;  3CCQ 3;  2C10 A;  3A76 A;  3HIG A;  1A8L A;  3L9S A;  4N0Z A;  1I2F A;  1WMN A;  1O7P B;  1GNE A;  2C0G A;  2VOC A;  3C8E A;  1QAL A;  2QA4 3;  2W6J H;  1M99 A;  5IG4 A;  3PR8 A;  3J7Y b;  1GS3 A;  5D83 A;  1BSB A;  4PQH A;  3EN8 A;  1TFK A;  4V2M A;  4G0I A;  2N5B A;  3MG2 A;  4EC0 A;  1SL2 B;  5INY A;  3OWS A;  1Z7R A;  3CTF A;  1FGR A;  3L9U A;  2GS3 A;  4GHO A;  1SK0 A;  4I2T A;  1HQO A;  3C73 A;  4GSS A;  1YJ9 3;  5LC6 A;  4L0U A;  2OOV C;  2HRF A;  2OTL 3;  3IPZ A;  2X99 A;  1CQH A;  4WHA A;  4IN0 A;  1ZYP A;  1W4V A;  4CW9 A;  2H1B A;  2OA7 A;  3DVX A;  1MDI A;  2ALB A;  1LBK A;  5COH A;  4O5R A;  4EYC A;  1BRK A;  4CDO A;  2GSR A;  3VGN A;  3CNM A;  1OH0 A;  1BRH A;  3RDW A;  2EIQ A;  1BSE A;  2V6O A;  1JJ2 2;  2AHE A;  4KSM A;  2F3M A;  3FG1 A;  3ZG0 A;  1SKR B;  1VQ5 3;  2BMX A;  2H0H A;  1GLP A;  2N5A A;  1KD1 4;  3WT2 A;  2VUP A;  4K1U A;  3CU3 A;  3TKS A;  4MPF A;  3TRQ A;  3LJR A;  3WA2 X;  2I1U A;  3UL3 A;  3KMO A;  2RNT A;  5EPF A;  3WYW A;  4O3V A;  2CX0 A;  1G6Y A;  4HKV B;  3EF8 A;  1HNC A;  2H76 A;  3J7Y d;  1I9D A;  4AF2 A;  4MF7 A;  3BU4 A;  4EXJ A;  5D81 A;  1FUS A;  4IBP A;  5IG3 A;  3IPT A;  3A3T A;  1BVI A;  1SPU A;  3CCU 3;  1ZMA A;  3VPQ A;  3D5J A;  2YP6 A;  5DCG A;  4KAE A;  2VL2 A;  3GUR A;  2IY2 A;  4FMB A;  1FGM A;  1U6T A;  3FR3 A;  1LNH A;  1BAO A;  2F8F A;  3EMX A;  2FY6 A;  1V57 A;  2EC4 A;  1PKW A;  3ZVJ A;  1MGW A;  3N8B A;  1Z5Y E;  3HHV A;  3GUS A;  3IA1 A;  3FF2 A;  1MD3 A;  3IV4 A;  4O5U A;  4EW5 A;  2H73 A;  5D9W A;  3TJB A;  3MPH A;  2F5M A;  1YIT 3;  1SQW A;  1X9W B;  3CPO A;  3UVT A;  4JBB A;  2CH9 A;  2BIR A;  2RLI A;  5A4U A;  1TDI A;  2F9S A;  2HSY A;  6GSV A;  2LV3 A;  4YQU A;  1C72 A;  3FR9 A;  4KH7 A;  2VCQ A;  1IVV A;  4QL9 A;  3QPM A;  3WD6 A;  2D42 A;  3CSJ A;  3GSS A;  1I3F A;  2CC3 A;  1BNF A;  1F9M A;  1W89 A;  1XOB A;  3CC4 3;  1ZYN A;  2DBC A;  3KD0 A;  1NHY A;  4L0W A;  2PGT A;  4XRD A;  1NHO A;  3M9K A;  1K0A A;  2LJR A;  1PA3 A;  5GST A;  1STD A;  1Q7Y 4;  2HSM A;  2CFD A;  4NWY A;  3PPU A;  5M19 A;  6STD A;  3KMN A;  2IMI A;  1ACV A;  2LJK A;  3DYR A;  2JZR A;  1U8C B;  2LST A;  1M1K 4;  4GTU A;  1Q40 A;  1J0F A;  1SKS B;  1RJO A;  5GSP A;  1ROA A;  4CY6 A;  8CHO A;  1AAZ A;  1EP8 A;  5JWR B;  6GSY A;  2LYX A;  1BSD A;  3MWZ A;  2FWH A;  2AUV A;  2CFL A;  5D73 A;  2MYG A;  2AB6 A;  3BBY A;  2OE0 A;  4R80 A;  3D21 A;  1JNQ A;  5DAK B;  1E2Y A;  1O73 A;  5G5E A;  1E3R A;  1UCK A;  1YKC A;  4ZXG A;  1EQK A;  1PX6 A;  3ZLP A;  3I69 A;  1G6W A;  5CK6 A;  4MZW A;  3BB9 A;  3HY2 A;  2H71 A;  1LOY A;  2DKI A;  3J7Y k;  2QGV A;  2YWI A;  3IK7 A;  2A2P A;  5IMZ A;  5CRE A;  2TIR A;  4YQV A;  4POL A;  5EY6 A;  3HYP A;  4ZIL A;  2OKA A;  3GIX A;  2GZY A;  4GL6 A;  4FCZ A;  3LGC A;  2KCD A;  5JCW A;  1FOV A;  3ERW A;  1STF I;  2NBS A;  2F8A A;  1RDS A;  3IMA B;  3IHG A;  2FCH A;  3LW9 A;  1RN4 A;  3PYJ A;  2P0M A;  1D6Z A;  2M46 A;  3DM8 A;  2DJ2 A;  1OKD A;  4N6O B;  5LC7 A;  1IDP A;  4KVH A;  4KCE A;  3QAG A;  4POB A;  2R2J A;  1LQM B;  1EUI C;  3TKP A;  3EYT A;  4WP5 A;  3CCL 3;  3V92 A;  4J5K A;  1QVG 2;  1BQ7 A;  1ZGX A;  4K1F A;  4LMV A;  2C80 A;  1JHB A;  1JB2 A;  2LQO A;  3EVI A;  3UBL A;  3D4M A;  5DJL A;  1KSI A;  4O2H A;  3SED A;  1MWR A;  2O9U X;  3QAW A;  1YQ1 A;  2IFQ A;  1GWC A;  3X41 A;  2XF3 A;  1AC1 A;  2GQM A;  4NHZ A;  3BD2 A;  2C0F A;  1V40 A;  1NDO B;  4RNT A;  5DRE A;  2K8V A;  2PN8 A;  1RK4 A;  1LOW A;  2YJH A;  1GSS A;  1Q4J A;  3KIJ A;  2FD3 A;  2YZH A;  2R6K A;  2PMT A;  4KDU A;  2I81 A;  3FZA A;  1K0O A;  1RCL A;  2L4C A;  5M18 A;  4FCJ A;  4XDW A;  4HOJ A;  1U3I A;  4K9Z A;  2KAA A;  2JZS A;  4MMM A;  4WET A;  3FR6 A;  3L78 A;  4KX4 A;  2NDO A;  5IPH A;  1OAC A;  2MBS A;  2R0C A;  3LXZ A;  3ZL5 A;  4RQX A;  2KOK A;  2CFK A;  5KP1 A;  4MDC A;  2K3D A;  1G02 A;  1B2U A;  3K5T A;  3S27 A;  2GT6 A;  3DWV A;  4D73 B;  2OAD A;  1TU5 A;  2L4V A;  1V58 A;  4V1A p;  1G7O A;  1E97 A;  3H93 A;  4MJA A;  5KN0 A;  1SYR A;  3ER7 A;  4CJN A;  2R41 A;  4KUN A;  3O6T A;  4MJE A;  3UMA A;  2F51 A;  2PBJ A;  3K63 A;  1K3L A;  1YIJ 3;  5EL8 A;  1C54 A;  1SL0 B;  3CNX A;  3STD A;  2AV4 A;  4RUV A;  4ZB9 A;  1N8R 4;  4GCI A;  1R26 A;  3K9M C;  4MF6 A;  4TKY A;  3C71 A;  1DSB A;  4NV2 A;  2HLS A;  3F7X A;  5DJM A;  2RM6 A;  4Q5N A;  4MMY B;  1TW9 A;  3GL5 A;  1PGT A;  5KN2 A;  2GEX A;  1PFO A;  3MAK A;  2F56 A;  5IER A;  3AGO A;  5IMV A;  2DJ3 A;  1YJW 3;  1KEB A;  2W04 A;  2YWN A;  1R7H A;  1TK5 B;  3DXB A;  2NPB A;  3N9J A;  5B8A A;  2CQ9 A;  4G2E A;  4V2N A;  2A2S A;  2PZV A;  3B4O A;  1PN0 A;  3I56 3;  2HZF A;  3GHA A;  5J9C A;  2WB9 A;  3KFQ C;  2CAQ A;  3SXX A;  2H19 A;  4EVM A;  5AIG A;  2O89 A;  4IEL A;  5AYR B;  5G31 A;  1A2K A;  5H5Q A;  4EE0 A;  1YY7 A;  2HMN B;  2LTK A;  1W01 A;  2XEP A;  1EG9 B;  1UI7 A;  3NV0 A;  2AYT A;  2WGQ A;  3TB2 A;  2GVP A;  3HK4 A;  4OFM A;  1QMA A;  4TR1 B;  3TCO A;  2IJY A;  3EHC A;  3FGY A;  2C3N A;  1EOG A;  1JLV A;  5G5F A;  4EC6 A;  4FMC A;  2XPE A;  5J41 A;  4EV5 A;  2ZL8 A;  4IQ1 A;  4AGS A;  5RNT A;  1NM3 A;  8RNT A;  1X1U A;  2Y73 A;  3FCS B;  4XB5 A;  1B2X A;  5AII A;  2JL4 A;  3CMI A;  5HR0 A;  1IVU A;  2YFJ B;  1B27 A;  1I70 A;  3DEX A;  3N9H A;  1V9W A;  3CSI A;  3LEF A;  3CCV 3;  1WPI A;  3VLN A;  2IMK A;  4PUR A;  1ULI B;  2F5W A;  1I5G A;  1B2S A;  1MWT A;  3RGR A;  1WRY A;  5C04 A;  1UA5 A;  1OC9 B;  2ZDJ A;  2J9H A;  5GSS A;  2WGR A;  4JE1 A;  4FH8 A;  5DQS A;  2P5Q A;  4WXT A;  4L7K A;  3FEU A;  1O7W B;  1ML6 A;  4CPK A;  2PU9 C;  4HM3 B;  3H8Q A;  3G6E 3;  2E7P A;  1W5Z A;  1DE2 A;  2CT6 A;  2LRN A;  5LNK e;  1R5P A;  1ZL9 A;  3URP A;  1N5P A;  2R4V A;  4X43 A;  4YQM A;  4RBN A;  4P3Y B;  2PUK C;  1RNT A;  2YCD A;  3UJM A;  4ZBD A;  2HML B;  1JBT A;  3KH7 A;  2GSS A;  2QA2 A;  3D6I A;  1S3D A;  4GXZ A;  4AJ6 A;  6GSS A;  2PWJ A;  2B1L A;  5JPU A;  3A5E A;  4EBG A;  1TOF A;  4LZI A;  1O8X A;  3FK8 A;  1ZO2 A;  3CD6 3;  4IPB A;  4RI7 A;  4XS1 A;  2WRT A;  2VL3 A;  4K2X A;  5BXQ A;  3VI7 A;  1HKX A;  3I55 3;  3NOF A;  4XM4 A;  3WMD A;  4OFN A;  2OOV A;  2CK3 H;  1BAN A;  4I6X A;  5HFK A;  3HX8 A;  4PX1 A;  3VWX A;  2IL3 A;  2OJL A;  3FYG A;  3NBR A;  2LQV A;  4LEH A;  1W2Z A;  5CYY A;  5JCG A;  1RN7 A;  2KP1 A;  1TI1 A;  1BNE A;  3UIW A;  1W00 A;  3S5C A;  3MKI A;  1TRV A;  1GY5 A;  3X40 A;  4Z7X A;  3ZVJ D;  2WCI A;  1XXU A;  1VRS D;  4LL1 B;  1JZO A;  5EEO A;  2DJK A;  2MF7 A;  1ZOF A;  4HZ2 A;  2VM2 A;  4HZ4 A;  3WA3 A;  3L9V A;  2FNO A;  4G10 A;  2VD1 A;  1FB6 A;  2L59 A;  2FWF A;  3EN1 B;  2OTJ 3;  5CF1 A;  2P0G A;  1DMQ A;  4FYC A;  2L57 A;  4CHS A;  2CX3 A;  3KTL A;  1XVQ A;  2RFR A;  1GH2 A;  2H72 A;  3NZN A;  1FW7 A;  2P09 A;  3M0F A;  1ASK A;  1GSU A;  3JUQ A;  3V99 A;  4AKZ A;  1NJI 4;  4TR0 A;  4EKZ A;  5BIR A;  4L5L A;  2GEY A;  5KEJ A;  5ELU A;  2JAC A;  1FGQ A;  3LT8 A;  3LXU X;  3ZIT A;  1I8V A;  1A2J A;  1X9S B;  4ACS A;  3EC9 A;  1FOH A;  2V1M A;  2M72 A;  4BWS A;  5B7C A;  3CME 3;  4R9L A;  1FO5 A;  3GKN A;  2YAN A;  3GFK A;  1JV2 B;  3VI5 A;  3UBK A;  2Z76 A;  4LA1 A;  2X49 A;  3VWU A;  3GMF A;  2AJQ B;  4TR4 A;  1J08 A;  3W8J A;  2TRC P;  2VIM A;  5IMD A;  3KSE D;  3V98 A;  1E3V A;  1YEP A;  2KF3 A;  3O8Y A;  2QA1 A;  1RGG A;  2P38 A;  2E2V A;  4N6U A;  1BYE A;  5HR2 A;  4Q5R A;  3FW2 A;  2CA8 A;  2HNL A;  2DLX A;  3ERF A;  2H74 A;  5AN1 A;  5G2Z A;  4ML1 A;  2O87 A;  1SIH A;  4Q5F A;  1IT8 A;  1GOV A;  4A5P A;  3K8N A;  5IEN A;  1RSN A;  3HZ8 A;  3EE1 A;  2HRK A;  5CRG A;  2STD A;  1RRL A;  3AHS A;  4HS1 A;  2CIU A;  4QL7 A;  2WDU A;  3QR6 A;  4WFO A;  5IO2 A;  3PGT A;  4HYZ A;  3VWW A;  2KRT A;  3ZIV A;  5AIX A;  2Z7A A;  1UCI A;  3TKS E;  5H5S A;  1M2A A;  1IYH A;  2QGU A;  3TOU A;  3BNE A;  4KFD A;  1T2I A;  1VQP 3;  5IMA A;  3CC2 3;  3KXO A;  1LOX A;  2REM A;  1H4O A;  1URM A;  2XSO B;  3LXT A;  3E99 A;  5BU4 A;  3FHK A;  3SWL A;  20GS A;  2L5O A;  4IKH A;  1LOV A;  4NRE A;  3QOU A;  5EVO A;  1B2Z A;  4V2L A;  1JN5 B;  3ZTL A;  1IU7 A;  1OC3 A;  1IV7 A;  1RGL A;  5ECI B;  3FF0 A;  2XH9 A;  1RKY A;  1K9M 4;  3LQ7 A;  2WUL A;  4ZBB A;  5ECM B;  7STD A;  3Q74 A;  2B5E A;  3SLU A;  1HYU A;  1MGR A;  3LYP A;  4STD A;  2OE1 A;  2B7J A;  1WMP A;  2INX A;  3ZRE A;  1GSF A;  5M1A A;  2JSZ A;  2XHF A;  5IIZ A;  2YZU A;  2H75 A;  3CC7 3;  4J56 E;  3DY5 A;  3CRT A;  4I8B A;  4CY8 A;  3KGK A;  3SOA A;  3DGO A;  3ECF A;  1EP7 A;  1R5A A;  2BTO T;  3MWH A;  3IJE B;  4HDE A;  1YGW A;  1OHO A;  3TJF A;  3A5W A;  4GLT A;  4IP6 A;  3F40 A;  1THX A;  3DMC A;  1MD4 A;  3LZA A;  2M7O A;  3MYT A;  1NB5 I;  2D2Z A;  4BVX A;  1XG8 A;  2J23 A;  3TDG A;  1IT7 A;  3A5I A;  2MMA A;  4BL2 A;  1TXX A;  4MK3 A;  1BED A;  1TJD A;  2YV7 A;  3I9V 2;  7GSS A;  4HQS A;  6GSP A;  2O85 A;  5AIS A;  1K0N A;  1UW1 A;  2Y74 A;  1OF5 A;  1DE1 A;  1HD2 A;  2BMQ B;  5CXO A;  5KP3 A;  2W03 A;  1UVZ A;  3CSH A;  4XS6 A;  3IAM 2;  1IQX A;  4OK0 A;  1GUL A;  1XW9 A;  1W6C A;  3DIE A;  2BO9 B;  5GZZ B;  2FA4 A;  5DAK A;  3HXS A;  4DSQ A;  1O6J A;  2BNG A;  3ME8 A;  4OD7 A;  4HBR A;  4XCS A;  1BNR A;  1YDK A;  2LS5 A;  3F7S A;  1N8J A;  2YFL B;  3G4S 3;  5HOH A;  3F6F A;  1O7G B;  1W2B 2;  3ERG A;  3GN3 A;  2GQK A;  4PNF A;  1UUG B;  1O81 A;  1SEN A;  1UC7 A;  2Z77 A;  2CX4 A;  4NAX A;  3C1R A;  1XFL A;  1FVJ A;  1RLS A;  1ZS7 A;  2MZC A;  3HD5 A;  3A2X A;  1OHS A;  3ME7 A;  1BOX A;  1K8A 4;  1GRX A;  3U1W A;  4BWQ A;  2VD0 A;  3KH9 A;  3HZ4 A;  1PMT A;  1LJR A;  3HCZ A;  1BRI A;  3KTB A;  4HM7 B;  2H01 A;  5HFG A;  3GST A;  4F0C A;  1XPV A;  3G16 A;  1S3A A;  1EV9 A;  1TRU A;  4LGQ A;  3IK9 A;  3UAP A;  1PSQ A;  2C4B A;  1TK0 B;  5DCH A;  1GUK A;  2XBI A;  1AQZ A;  3VSY A;  3G7J A;  4HM5 B;  3QD9 A;  4HZ9 B;  4KZ1 A;  2P31 A;  1FG4 A;  3RHC A;  4LYL B;  4ZB8 A;  4NHF A;  2OWP A;  3E3E A;  1AVL A;  4HOH A;  5GAN D;  2H1A A;  5AGY A;  3JUO A;  4XDV A;  1GTU A;  2CFW A;  6GSW A;  3GZY B;  1N5H A;  1JFU A;  2GTU A;  5IO0 A;  2IPA A;  5ELA A;  3HVX A;  1A2V A;  3CTG A;  4X4J A;  18GS A;  1OKT A;  5JBS A;  2A2R A;  2VAF A;  1OGZ A;  2F99 A;  4HSC X;  2IIY A;  5A4W A;  3M8N A;  3QRD A;  3QMX A;  2CWU A;  1EEJ A;  3DGM A;  2B6M A;  3AMO A;  2X4A A;  2GSQ A;  3IC8 A;  3D4A A;  5ECS A;  1M2D A;  4XBX A;  4N3V A;  1Y4K A;  4EL1 A;  1ILO A;  1PN9 A;  4FIW A;  4FMD A;  2VCT A;  1A2M A;  1JBR A;  3M1G A;  4D73 A;  3ED3 A;  1M0U A;  2H8L A;  17GS A;  1DVC A;  3DGL A;  2FXT A;  3NM2 A;  2C3T A;  3BOA A;  3IOS A;  2W0Q A;  1CEW I;  4YAP A;  4F03 A;  3NBB A;  1VF1 A;  3I6A A;  3LH4 A;  1UUW B;  3L0H A;  2DKH A;  3G71 3;  5DAL B;  3OX9 A;  4ZB6 A;  1ROV A;  1ON4 A;  1Y25 A;  5IG5 A;  2FWG A;  4RNY A;  3FKF A;  4ECB A;  1JZW A;  1QK8 A;  1TTZ A;  2XR8 B;  3ZFZ A;  3G7I A;  4LMI A;  3SX1 A;  3F14 A;  4XS4 B;  1ST9 A;  2MMO A;  5JWQ B;  3K7C A;  3H3H A;  1RCK A;  3UL5 A;  3FZ4 A;  3GZR A;  2HZE B;  2WO0 A;  4I2U A;  3KZT A;  3TJK A;  1AQV A;  2PER A;  5DRV A;  1FHE A;  2WS2 A;  1GMQ A;  4BTY A;  2WJU A;  2H1G A;  3BCK A;  3Q6O A;  2FGT A;  2V6K A;  4OMV A;  5LD0 A;  3EB8 A;  4KGI A;  1ZYE A;  1GSP A;  4RNZ A;  4GSP A;  1RRH A;  2CX1 A;  1NW2 A;  3GA4 A;  1Q7H A;  3JCM L;  2VLT A;  1IQ8 A;  1GOU A;  1Q82 4;  4Q5Q A;  3UOM A;  2K6V A;  4CDL A;  2CHC A;  1QXH A;  5KN3 A;  4LSO A;  4WF5 A;  1A0F A;  4N10 A;  3KP8 A;  4IGJ A;  4KB3 A;  3H1N A;  4ECC A;  2BMO B;  3KEB A;  3IXR A;  1ISK A;  4X2O A;  1BUQ A;  2BJX A;  5F07 A;  2GXF A;  3F9S A;  1QUW A;  3OV4 A;  4HVN A;  1XOA A;  3C7M A;  3GL3 A;  3HVV A;  2YN1 A;  2XGN A;  5G2G A;  1SJ6 A;  1W7C A;  2H6X A;  2HRN A;  2O7K A;  2HMO B;  3CCS 3;  5KP4 A;  1PL2 A;  3CRU A;  3LTB A;  2X8G A;  4WKW A;  1JN5 A;  1K41 A;  2B5X A;  3ZMK A;  1F8N A;  4J5G A;  4MJC A;  1RGH A;  2GU1 A;  2RM5 A;  4IS0 A;  3VFI A;  3HOH A;  3NBJ A;  4K90 B;  3Q1C A;  2C0E A;  5ID2 B;  2B24 B;  3HJO A;  1SK1 A;  5AIF A;  4BL3 A;  3B8L A;  1GTA A;  3SYU A;  2IUK A;  2YWO A;  1RGC A;  1HU9 A;  3QFB C;  2P5R A;  5IW9 A;  2XRX B;  1EZK A;  3EJV A;  1N8Q A;  1O7N B;  2LNS A;  1Q42 A;  1N9J A;  5JWO B;  2W2C A;  1M9B A;  2MMZ A;  1M2B A;  1GMR A;  1VQ8 3;  5DBQ A;  1A2L A;  3H4K A;  3KE7 A;  3MYD A;  5E4W A;  5IPG A;  4J9A A;  4K7N A;  4QQ7 A;  1FZU A;  3N5O A;  2SAR A;  1VQN 3;  3DXO A;  4EXR A;  2DIY A;  5FW5 A;  2RCD A;  2BHM A;  1I0V A;  1TRW A;  2XGL A;  1V98 A;  2XC2 A;  4EO3 A;  1O7U A;  4QWT A;  2DJ1 A;  3MIX A;  2FUG 2;  1X1Y A;  2L5L A;  1LQG C;  1K0B A;  2W56 A;  4I4K A;  2YV9 A;  3P2A A;  4N6N B;  1EGR A;  4HM1 B;  1EEM A;  3CBU A;  4ULX A;  3WDG B;  4KDX A;  3FLJ A;  4PUA A;  2WZ9 A;  1UGH I;  4GRF A;  1LNI A;  2E2U A;  5CF2 A;  3G0K A;  4R9K A;  6GSU A;  2H70 A;  1JKG B;  4Z2R A;  1JZD A;  3CYN A;  1VQM 3;  3HDC A;  3CCJ 3;  3CQF A;  4N30 A;  3ZFL A;  5G1K A;  1ERT A;  2LUS A;  4ZL7 A;  1MOL A;  2E2T A;  3UNL A;  2PNC A;  2GQL A;  3F3R A;  4DSR A;  2R0G A;  2CVB A;  4MAB A;  2DJ0 A;  1Z9H A;  4O5Q A;  4YKF A;  4F2I A;  4HJL B;  2XBQ A;  2IME A;  5BRT A;  5CO3 A;  1T5Y A;  5HQP A;  1QAK A;  1T1V A;  2G0F A;  1Q40 B;  5IEP A;  1MWU A;  4X1U A;  1T4Z A;  1LRA A;  3BND A;  4K61 A;  3FMW A;  3U97 A;  5DAL A;  2GT5 A;  3O3T A;  1YGE A;  4K5S A;  1LVN A;  5CLK A;  4HJM A;  2R4I A;  2KHP A;  4WBR D;  3WGD A;  6GSX A;  3HII A;  4H61 A;  4HM8 B;  1U5O A;  4CCV A;  2LEG A;  3U6V A;  4H86 A;  5J3R A;  4PGT A;  3T8N A;  4YAV A;  5F0G A;  5A0O B;  2VO4 A;  4JZQ A;  2KXG A;  3GYK A;  1F3B A;  1AY7 A;  4K8M A;  4K1V A;  2RGQ A;  1FB0 A;  2IYJ A;  3LTA A;  1M3I A;  1H75 A;  1XW6 A;  4ECJ A;  3AGN A;  3AHW A;  3AMO B;  2C1Y A;  3B4P A;  1JBS A;  4GQF A;  4NXI A;  3X3Y A;  1NNV A;  3GTU B;  1KBN A;  1GD3 A;  4N0V A;  4TVE A;  4HAA A;  4YKG A;  2QKE A;  4J8T A;  5TGN A;  1V74 A;  3HVN A;  2GST A;  3SBC A;  5ECP B;  2R0P A;  5JCU A;  2B1X B;  4OVM A;  2CZ3 A;  4AJ7 A;  4IQA A;  3QFA C;  2GBW B;  2CWV A;  5CNW A;  1QJG A;  2AAE A;  4X2H A;  4AEQ A;  4K6X A;  4J2F A;  2D1W A;  4U13 A;  3IRA A;  1DMN A;  1QGV A;  2Z9S A;  1BSC A;  5FWG A;  4HM2 B;  2M80 A;  2NTO A;  1DET A;  1TRS A;  4V1A g;  2H30 A;  1UUV B;  1ERW A;  1Y6E A;  4MP4 A;  3OXA A;  1UDI I;  3G8Z A;  1BUJ A;  5ABR A;  2YWM A;  1RMS A;  2P05 A;  7RNT A;  1PKZ A;  3G9B A;  2ON5 A;  1SJZ A;  1RGA A;  1IVW A;  3MNG A;  3O76 A;  5ECL B;  2CZ2 A;  5B8B A;  1ULJ B;  3IDV A;  3B7C A;  2OQE A;  3Q18 A;  4XBT A;  4BTW A;  3DD3 A;  4PQI A;  4DSS A;  3LML A;  3LG6 A;  2HT9 A;  3DKS A;  4N11 A;  3NHX A;  4N6M A;  3WR2 A;  3VPT A;  1T7P B;  3UB1 A;  4POK A;  2K54 A;  1AR0 A;  5ECH B;  4GSN A;  2DMM A;  2L6C A;  3WGE A;  3A2V A;  3DGN A;  2F86 B;  1YF0 A;  3NQZ A;  1YVB I;  4LLR A;  1X9M B;  1BAY A;  3JUN A;  1T3B A;  4DKI A;  1VGL A;  4BVY B;  2OCT A;  3DML A;  3M9J A;  1M7T A;  1IV9 A;  3GKX A;  3QCP A;  1D6Y A;  3JUP A;  1K0D A;  5F8B A;  4KE3 A;  3APQ A;  3R2Q A;  3VWV A;  3Q19 A;  4XBY A;  3DH2 A;  1B4P A;  3D9R A;  2ZUP A;  4WBJ A;  4PUF C;  1TK8 B;  12GS A;  5IOX A;  1QMV A;  3KSP A;  3P7X A;  3TGZ A;  1BNS A;  2N5F A;  3D0Z A;  1PFP A;  4O32 A;  1WNH A;  2RUF A;  4EDZ A;  5IQY A;  1EGO A;  2C0D A;  4F9Z A;  4ECI A;  1OCV A;  4ILF A;  4WYK B;  4JU5 A;  3F8H A;  3TJJ A;  1YHQ 3;  2RUE A;  3F8U A;  1CYU A;  1B2M A;  2F98 A;  1S3C A;  4F82 A;  3ZG5 A;  4BU4 A;  3X3X A;  2I3Y A;  3LTC A;  1Z7P A;  3KKG A;  2ML5 A;  3GX8 A;  4IHU A;  5AYS C;  3OWY A;  1SYX A;  1MEK A;  1VQ6 3;  1TP6 A;  1YJ6 A;  1YJN 3;  3U5R E;  4K7I A;  3TOT A;  3CCM 3;  1R4C A;  2HXK A;  4K7O A;  4K0N A;  3ZZX A;  3NIV A;  2P0X A;  2PPT A;  4G1M B;  1BX9 A;  1A2P A;  2KF4 A;  3EMP A;  4TR1 A;  1XW5 A;  4K5R A;  1FGO A; 
#chains in the Genus database with same CATH homology
 3ZYW A;  3LYK A;  4FYU A;  1G7E A;  2G2Q A;  5ECO B;  3D22 A;  2I4A A;  4G19 A;  3UAR A;  1A23 A;  1F6M C;  2R37 A;  3GRX A;  1ABA A;  5FHI A;  2I9H A;  2LNT A;  1ZCP A;  1AUC A;  1RQM A;  1XWA A;  1WP0 A;  1SU9 A;  5D9V A;  1T4Y A;  2OAC A;  2FLS A;  5CRD A;  1GSE A;  1YZX A;  2C3Q A;  1YKA A;  2VCV A;  1A8Y A;  1B9Y C;  5ECR B;  1XBS A;  1X5D A;  4JED A;  3E9J B;  2VM1 A;  4KDY A;  4EIP A;  1VF2 A;  5J4U A;  4KSO A;  1AXD A;  2IWT A;  3EWL A;  1CQG A;  2ON7 A;  2QSI A;  1PX7 A;  5ECQ B;  4L5O A;  3APS A;  2R5G A;  5G30 A;  3VUR A;  1T00 A;  2GZP A;  1TP9 A;  2TRX A;  3GH9 A;  1GSY A;  1AW9 A;  4USS A;  2KUC A;  1OE7 A;  3FZ5 A;  1TU7 A;  1SL1 B;  1GNW A;  1USB A;  5CRW A;  2DC5 A;  2EIO A;  2AAW A;  1K0M A;  1B48 A;  3LWA A;  4ISD A;  4WEY A;  13GS A;  4KND A;  4BPY A;  4WR5 A;  3AY8 A;  1GP1 A;  1GLQ A;  4OFT A;  4X0X A;  4BL7 A;  2VL2 C;  4IW9 A;  1A0R P;  5D96 A;  1BG5 A;  3TRX A;  4TXO A;  4JRR A;  1F37 A;  4XIH A;  3I43 A;  1ZYQ B;  2QC7 A;  2GZZ A;  3IHQ A;  4XS4 A;  4XRA A;  2CVK A;  4MLY A;  3GX0 A;  8GSS A;  3RPN A;  1K3O A;  2B3S A;  1O85 A;  5ECK B;  2IN3 A;  3KP9 A;  4ICY A;  1WE0 A;  4EIQ A;  1J9B A;  2LRC A;  2ES7 A;  5CRH A;  4MZB A;  4PQ1 A;  1ERV A;  3IE3 A;  4TXO B;  3GV1 A;  3F3Q A;  3ZFB A;  1SJI A;  2C8U A;  1SD9 A;  5L71 A;  3F4S A;  5H5R A;  5CAX A;  2JU5 A;  4PTS A;  3RPP A;  5C00 A;  3KZQ A;  2L6D A;  1K0C A;  3GKK A;  2IMF A;  1EOH A;  4NHW A;  3MDK A;  1XIY A;  3LOR A;  3F6D A;  3EC3 A;  1B8X A;  3BCI A;  5DVB A;  2YOI A;  2IMD A;  1QQ2 A;  4NPB A;  4F0B A;  2LQQ A;  4HU9 A;  4MH2 A;  1PL1 A;  2FHE A;  4E8H A;  3KM6 A;  3KJY A;  1MTC A;  4YH2 A;  2OE3 A;  3RBT A;  3C1S A;  4IP1 A;  1DBY A;  2K8S A;  1MDK A;  3HJP A;  1U3A A;  4EUY A;  3TKQ A;  2PVO C;  4TN8 A;  1X0R A;  1NSW A;  1XWC A;  2NVL A;  3F63 A;  3TUE A;  1ERU A;  5B6M A;  5AIV A;  1AQX A;  5KN1 A;  2H6Z A;  2X8H A;  2CV4 A;  4Z2U A;  1EV4 A;  4NV5 A;  4J57 E;  4TRX A;  4ZIJ A;  2MMN A;  3R3E A;  2R3X A;  4OCE A;  2JZT A;  3L4N A;  4G9H A;  5BMU A;  4GQC A;  4MF5 A;  3G7Y A;  1O8W A;  2YNX A;  1TI3 A;  2ZCT A;  1HNB A;  5D9X A;  1M9A A;  2JAD A;  2GGT A;  4DVC A;  5A4V A;  1IYI A;  2VLV A;  5ID2 A;  4OWY A;  3FRC A;  3QAV A;  2HSH A;  3D4T A;  4ID0 A;  5F05 A;  3UVH A;  1V2A A;  1Q98 A;  2H1D A;  3DRN A;  4RQR A;  4WR4 A;  6GST A;  4MCU A;  1PD2 1;  2OBK A;  4MNN A;  3F9U A;  1PRX A;  1WJK A;  3F4T A;  2H0I A;  3A2W A;  3DGQ A;  3F0I A;  2C4J A;  4ZL8 A;  9GSS A;  1G0T A;  4FQU A;  1PQN A;  22GS A;  4O7H A;  2CVD A;  5A5K A;  19GS A;  3TJG A;  4LMW A;  3WGX A;  1GTB A;  3P8W A;  1GSD A;  4OO5 A;  5D9T A;  1XWB A;  1YF1 A;  4FYB A;  2H6Y A;  2IFQ B;  2RII A;  1SD8 A;  1KNG A;  3HJM A;  1HNA A;  3RAZ A;  4EF0 A;  1UN2 A;  5LCZ A;  4BVY A;  4EDY A;  3EE2 A;  5B6N A;  4ML6 A;  1KTE A;  4XHM A;  5ECN B;  4HUA A;  4PNG A;  4PXO A;  1DUG A;  4K2D A;  1E6B A;  1JZR A;  3CXG A;  4K0G A;  1AIU A;  3V1W A;  4IJI A;  4JR6 A;  2GDR A;  4XTS A;  3KCM A;  1OC9 A;  2HFD A;  3HKR A;  2V41 A;  4TOP A;  4IVF A;  2DML A;  1VF4 A;  2A4V A;  1XWG A;  5CP1 A;  4IJ3 A;  2VCX A;  3IC4 A;  5KOX A;  1WMJ A;  4GWR A;  2PVQ A;  1AQW A;  4DEJ A;  1OVN A;  5ELG A;  2L4Q A;  1GTI A;  4TXV A;  3HVS A;  1RW1 A;  4HI7 A;  4O92 A;  1XCC A;  1THO A;  1VF3 A;  3GNJ A;  3H79 A;  3PH9 A;  4GF0 A;  5J9B A;  2A4H A;  1B4Q A;  1TU8 A;  3ZRD A;  1SK2 A;  3FY7 A;  11GS A;  1F2E A;  1OC8 A;  4DSS B;  2KLX A;  5FT3 A;  2YJ7 A;  3WT1 A;  3W6G A;  3FZ9 A;  4AJ8 A;  1GUH A;  1YEX A;  4G0K A;  5HR3 A;  4BA7 A;  2WFC A;  3APO A;  4HEA 2;  3TKR A;  2JSY A;  4MH3 A;  3ZIJ A;  2HI7 A;  1X5E A;  1K3Y A;  3MSZ A;  4ZL9 A;  2H0G A;  3IAS 2;  4HJ2 A;  1XWK A;  1GUM A;  3VK9 A;  1OAZ A;  5DDL A;  2VLU A;  3EUR A;  1Z6M A;  3GTU A;  2HE3 A;  2X8C A;  1N2A A;  5KOW A;  2KP2 A;  2LJA A;  4KF9 A;  3BJ5 A;  4E8E A;  4HQZ A;  3UEM A;  4RI6 A;  2YPM A;  2E2M A;  4MA9 A;  3GH6 A;  3GKM A;  3M3M A;  4MZC A;  5GAP D;  5ENU A;  2HZE A;  1FAA A;  2B5Y A;  1JLW A;  1OYJ A;  1X5C A;  3P90 A;  2H66 A;  4BVX B;  4HU7 A;  1MDJ A;  2B7K A;  4NMU A;  1BJX A;  3F4R A;  3QDN A;  1XVW A;  1WOU A;  4KA0 A;  3TRP A;  3IR4 A;  5E59 A;  3OR5 A;  2V2G A;  2VCZ A;  2UZ8 A;  3E0U A;  1Z3E A;  2FWE A;  3LSZ A;  3UJ1 A;  1U87 A;  5DQY A;  5HR1 A;  4KW6 A;  3ZML A;  5HFI A;  3EPT A;  2ZNM A;  4POM A;  14GS A;  5IMC A;  1F3A A;  1WWJ A;  2XPD A;  1ZZY A;  1GL8 A;  2HYX A;  5IM9 A;  2O8V B;  4BL7 B;  1A24 A;  1U88 A;  3IBH A;  1XZO A;  5G1L A;  3US3 A;  4TW5 A;  2LRT A;  3HA9 A;  3TKS C;  2VCW A;  2DJJ A;  1GSQ A;  3RHB A;  1Z6N A;  1QFN A;  2HRA A;  4Z2T A;  1B9X C;  2CAI A;  2LKU A;  2OBI A;  4I5Q A;  16GS A;  1OE8 A;  5D8I A;  2MBT A;  2FGX A;  5F06 A;  4MPG A;  2K18 A;  10GS A;  2GLR A;  4MJB A;  1T8E B;  3S9F A;  2B1K A;  2VL9 A;  2FA8 A;  4GST A;  2E0Q A;  3W8S A;  2V32 A;  2EIR A;  4L8E A;  2E2G A;  2K9F A;  4I97 A;  3EU3 A;  1SKW B;  4ZBA A;  3ISO A;  4LL4 B;  5J5N A;  1ZGN A;  4OO4 A;  5IMF A;  1LU4 A;  2DIZ A;  1EWX A;  3EU4 A;  2X64 A;  1FVK A;  3DVW A;  4JR4 A;  3EIN A;  1WIK A;  4FO5 A;  3PIN A;  2DSA A;  1FW1 A;  5D93 A;  4OCF A;  1TKD B;  1R4W A;  4TR3 A;  5IOW A;  4WF4 A;  4G0L A;  3LFL A;  4KCA A;  4N0Z A;  1A8L A;  3L9S A;  1GNE A;  2C0G A;  2VOC A;  3C8E A;  1M99 A;  3PR8 A;  3J7Y b;  4PQH A;  4V2M A;  4G0I A;  2N5B A;  4EC0 A;  1SL2 B;  5INY A;  1Z7R A;  3CTF A;  3L9U A;  2GS3 A;  1SK0 A;  4I2T A;  1HQO A;  3C73 A;  4GSS A;  4L0U A;  2HRF A;  3IPZ A;  2X99 A;  1CQH A;  4IN0 A;  1ZYP A;  1W4V A;  4CW9 A;  2H1B A;  2OA7 A;  3DVX A;  1MDI A;  2ALB A;  1LBK A;  5COH A;  4O5R A;  4CDO A;  2GSR A;  3RDW A;  2EIQ A;  2V6O A;  2AHE A;  4KSM A;  2F3M A;  1SKR B;  2BMX A;  2H0H A;  1GLP A;  2N5A A;  3WT2 A;  2VUP A;  3TKS A;  4MPF A;  3TRQ A;  3LJR A;  2I1U A;  3UL3 A;  3KMO A;  5EPF A;  3WYW A;  1G6Y A;  1HNC A;  2H76 A;  1I9D A;  4AF2 A;  4MF7 A;  4EXJ A;  4IBP A;  3A3T A;  1ZMA A;  3VPQ A;  3D5J A;  2YP6 A;  5DCG A;  4KAE A;  2VL2 A;  3GUR A;  2IY2 A;  1U6T A;  3FR3 A;  2F8F A;  3EMX A;  2FY6 A;  1V57 A;  2EC4 A;  1PKW A;  3ZVJ A;  1Z5Y E;  3HHV A;  3GUS A;  3IA1 A;  1MD3 A;  3IV4 A;  4O5U A;  2H73 A;  5D9W A;  3TJB A;  1X9W B;  3UVT A;  4JBB A;  2RLI A;  5A4U A;  1TDI A;  2F9S A;  2HSY A;  6GSV A;  2LV3 A;  4YQU A;  1C72 A;  3FR9 A;  4KH7 A;  2VCQ A;  4QL9 A;  3QPM A;  3WD6 A;  3CSJ A;  3GSS A;  1W89 A;  1XOB A;  1F9M A;  2DBC A;  3KD0 A;  1ZYN A;  4L0W A;  4XRD A;  1NHY A;  2PGT A;  1NHO A;  3M9K A;  1K0A A;  2LJR A;  1PA3 A;  5GST A;  2HSM A;  4NWY A;  3PPU A;  3KMN A;  2IMI A;  1ACV A;  2LJK A;  3DYR A;  2JZR A;  2LST A;  4GTU A;  1J0F A;  1SKS B;  4CY6 A;  1AAZ A;  1EP8 A;  5JWR B;  6GSY A;  2FWH A;  2AUV A;  5D73 A;  2MYG A;  2AB6 A;  3BBY A;  2OE0 A;  3D21 A;  5DAK B;  1E2Y A;  1O73 A;  5G5E A;  1YKC A;  4ZXG A;  1PX6 A;  3ZLP A;  3I69 A;  1G6W A;  4MZW A;  3HY2 A;  2H71 A;  2DKI A;  3J7Y k;  2QGV A;  2YWI A;  3IK7 A;  5IMZ A;  2A2P A;  5CRE A;  2TIR A;  4YQV A;  4POL A;  5EY6 A;  3HYP A;  4ZIL A;  2OKA A;  3GIX A;  2GZY A;  3LGC A;  5JCW A;  1FOV A;  3ERW A;  2NBS A;  2F8A A;  3IHG A;  2FCH A;  3LW9 A;  2M46 A;  2DJ2 A;  1OKD A;  4KCE A;  3QAG A;  4POB A;  2R2J A;  3TKP A;  3EYT A;  1BQ7 A;  4K1F A;  4LMV A;  2C80 A;  1JHB A;  2LQO A;  3EVI A;  3UBL A;  3D4M A;  5DJL A;  3QAW A;  1YQ1 A;  2IFQ A;  1GWC A;  1AC1 A;  2GQM A;  4NHZ A;  3BD2 A;  2C0F A;  1V40 A;  2K8V A;  2PN8 A;  1RK4 A;  2YJH A;  1GSS A;  1Q4J A;  3KIJ A;  2FD3 A;  2YZH A;  2R6K A;  2PMT A;  4KDU A;  2I81 A;  3FZA A;  1K0O A;  2L4C A;  4HOJ A;  1U3I A;  4K9Z A;  2JZS A;  4MMM A;  4WET A;  3FR6 A;  3L78 A;  4KX4 A;  2NDO A;  5IPH A;  2MBS A;  2R0C A;  3LXZ A;  3ZL5 A;  4RQX A;  2KOK A;  4MDC A;  3DWV A;  4D73 B;  2GT6 A;  2OAD A;  4V1A p;  1G7O A;  1V58 A;  3H93 A;  4MJA A;  5KN0 A;  1SYR A;  4KUN A;  3O6T A;  4MJE A;  3UMA A;  2F51 A;  2PBJ A;  1K3L A;  5EL8 A;  1SL0 B;  2AV4 A;  4RUV A;  4ZB9 A;  4GCI A;  1R26 A;  4MF6 A;  4TKY A;  3C71 A;  1DSB A;  4NV2 A;  2HLS A;  5DJM A;  2RM6 A;  4Q5N A;  3GL5 A;  1TW9 A;  1PGT A;  5KN2 A;  3MAK A;  5IMV A;  2DJ3 A;  1KEB A;  2YWN A;  1R7H A;  1TK5 B;  3DXB A;  2NPB A;  3N9J A;  5B8A A;  2CQ9 A;  4G2E A;  4V2N A;  2A2S A;  1PN0 A;  2HZF A;  3GHA A;  5J9C A;  2WB9 A;  2CAQ A;  2H19 A;  4EVM A;  2O89 A;  4IEL A;  5G31 A;  5H5Q A;  4EE0 A;  1YY7 A;  2LTK A;  2AYT A;  3TB2 A;  2GVP A;  4OFM A;  4TR1 B;  3TCO A;  2IJY A;  2C3N A;  1EOG A;  1JLV A;  5G5F A;  2XPE A;  5J41 A;  4IQ1 A;  4AGS A;  1NM3 A;  2JL4 A;  3CMI A;  5HR0 A;  3DEX A;  1V9W A;  3CSI A;  3LEF A;  1WPI A;  3VLN A;  2IMK A;  4PUR A;  1I5G A;  5C04 A;  1WRY A;  1UA5 A;  1OC9 B;  2J9H A;  5GSS A;  2WGR A;  4JE1 A;  4FH8 A;  5DQS A;  2P5Q A;  4WXT A;  3FEU A;  1ML6 A;  2PU9 C;  3H8Q A;  2E7P A;  1DE2 A;  2CT6 A;  2LRN A;  5LNK e;  1R5P A;  1ZL9 A;  2R4V A;  4X43 A;  4YQM A;  4P3Y B;  2PUK C;  2YCD A;  4ZBD A;  3KH7 A;  2GSS A;  2QA2 A;  3D6I A;  1S3D A;  4GXZ A;  4AJ6 A;  6GSS A;  2PWJ A;  2B1L A;  1TOF A;  1O8X A;  3FK8 A;  4RI7 A;  4XS1 A;  2WRT A;  2VL3 A;  4K2X A;  3VI7 A;  3NOF A;  4OFN A;  4I6X A;  5HFK A;  4PX1 A;  3VWX A;  2IL3 A;  2OJL A;  3FYG A;  5CYY A;  5JCG A;  2KP1 A;  1TI1 A;  3UIW A;  1TRV A;  4Z7X A;  3ZVJ D;  2WCI A;  1XXU A;  1VRS D;  4LL1 B;  1JZO A;  2DJK A;  1ZOF A;  4HZ2 A;  2VM2 A;  4HZ4 A;  3L9V A;  2FNO A;  4G10 A;  2VD1 A;  1FB6 A;  2L59 A;  2FWF A;  2P0G A;  4FYC A;  2L57 A;  4CHS A;  2CX3 A;  3KTL A;  1XVQ A;  1GH2 A;  2H72 A;  3NZN A;  3M0F A;  1GSU A;  4TR0 A;  4EKZ A;  4L5L A;  5KEJ A;  2JAC A;  3ZIT A;  1A2J A;  1X9S B;  4ACS A;  1FOH A;  4BWS A;  2V1M A;  2M72 A;  5B7C A;  1FO5 A;  3GKN A;  2YAN A;  3GFK A;  3VI5 A;  3UBK A;  4LA1 A;  2X49 A;  3VWU A;  3GMF A;  2AJQ B;  4TR4 A;  1J08 A;  3W8J A;  2TRC P;  2VIM A;  5IMD A;  1YEP A;  2QA1 A;  1BYE A;  5HR2 A;  4Q5R A;  3FW2 A;  2CA8 A;  2HNL A;  2DLX A;  3ERF A;  2H74 A;  5AN1 A;  5G2Z A;  4ML1 A;  2O87 A;  4Q5F A;  4A5P A;  3K8N A;  3HZ8 A;  5CRG A;  2HRK A;  4HS1 A;  4QL7 A;  2WDU A;  3QR6 A;  5IO2 A;  3PGT A;  3VWW A;  3ZIV A;  5AIX A;  3TKS E;  5H5S A;  1M2A A;  1IYH A;  3TOU A;  5IMA A;  3KXO A;  2REM A;  1H4O A;  1URM A;  3LXT A;  3FHK A;  3SWL A;  20GS A;  2L5O A;  4IKH A;  3QOU A;  5EVO A;  4V2L A;  3ZTL A;  1OC3 A;  5ECI B;  3LQ7 A;  2WUL A;  4ZBB A;  5ECM B;  3Q74 A;  2B5E A;  1HYU A;  3LYP A;  2OE1 A;  2B7J A;  3ZRE A;  1GSF A;  2JSZ A;  2XHF A;  5IIZ A;  2YZU A;  2H75 A;  4J56 E;  3CRT A;  4I8B A;  4CY8 A;  3KGK A;  1EP7 A;  2BTO T;  1R5A A;  3MWH A;  4HDE A;  3TJF A;  3A5W A;  4GLT A;  4IP6 A;  1THX A;  1MD4 A;  2D2Z A;  4BVX A;  2J23 A;  3TDG A;  3A5I A;  2MMA A;  1TXX A;  4MK3 A;  1BED A;  1TJD A;  2YV7 A;  3I9V 2;  7GSS A;  4HQS A;  2O85 A;  5AIS A;  1K0N A;  1DE1 A;  1HD2 A;  1UVZ A;  3CSH A;  4XS6 A;  3IAM 2;  1GUL A;  1XW9 A;  3DIE A;  5GZZ B;  2FA4 A;  5DAK A;  3HXS A;  4DSQ A;  1O6J A;  3ME8 A;  4OD7 A;  4XCS A;  1YDK A;  2LS5 A;  1N8J A;  3F6F A;  3ERG A;  3GN3 A;  2GQK A;  4PNF A;  1O81 A;  1SEN A;  1UC7 A;  2CX4 A;  4NAX A;  3C1R A;  1XFL A;  1FVJ A;  2MZC A;  3HD5 A;  3A2X A;  3ME7 A;  1GRX A;  4BWQ A;  2VD0 A;  3KH9 A;  3HZ4 A;  1PMT A;  3HCZ A;  1LJR A;  3KTB A;  2H01 A;  5HFG A;  3GST A;  4F0C A;  1XPV A;  1S3A A;  1EV9 A;  1TRU A;  3IK9 A;  3UAP A;  1PSQ A;  1TK0 B;  5DCH A;  1GUK A;  2XBI A;  3G7J A;  3QD9 A;  2P31 A;  1FG4 A;  3RHC A;  4ZB8 A;  3E3E A;  5GAN D;  2H1A A;  5AGY A;  1GTU A;  6GSW A;  1JFU A;  5IO0 A;  2GTU A;  2IPA A;  5ELA A;  3HVX A;  3CTG A;  4X4J A;  18GS A;  1OKT A;  2A2R A;  2VAF A;  2IIY A;  5A4W A;  3M8N A;  3QMX A;  1EEJ A;  2B6M A;  2X4A A;  2GSQ A;  3IC8 A;  5ECS A;  1M2D A;  4EL1 A;  1ILO A;  1PN9 A;  4FIW A;  2VCT A;  1A2M A;  3M1G A;  4D73 A;  3ED3 A;  1M0U A;  2H8L A;  17GS A;  2C3T A;  3IOS A;  3BOA A;  4YAP A;  4F03 A;  1VF1 A;  3I6A A;  3L0H A;  2DKH A;  5DAL B;  4ZB6 A;  1ON4 A;  1Y25 A;  2FWG A;  4ECB A;  3FKF A;  1JZW A;  1QK8 A;  1TTZ A;  3G7I A;  4XS4 B;  1ST9 A;  2MMO A;  5JWQ B;  3FZ4 A;  2HZE B;  4I2U A;  3TJK A;  1AQV A;  2PER A;  1FHE A;  2WS2 A;  2WJU A;  2H1G A;  3BCK A;  3Q6O A;  2V6K A;  4OMV A;  5LD0 A;  4KGI A;  1ZYE A;  1NW2 A;  3GA4 A;  3JCM L;  2VLT A;  4Q5Q A;  3UOM A;  2K6V A;  1QXH A;  5KN3 A;  4WF5 A;  1A0F A;  4N10 A;  3KP8 A;  4IGJ A;  4KB3 A;  3H1N A;  4ECC A;  3KEB A;  3IXR A;  2BJX A;  5F07 A;  1QUW A;  1XOA A;  3C7M A;  3GL3 A;  3HVV A;  2YN1 A;  1SJ6 A;  2HRN A;  2H6X A;  2O7K A;  1PL2 A;  3CRU A;  2X8G A;  4WKW A;  2B5X A;  3ZMK A;  4MJC A;  2RM5 A;  4IS0 A;  3VFI A;  2C0E A;  5ID2 B;  3HJO A;  1SK1 A;  1GTA A;  2YWO A;  3QFB C;  2P5R A;  1EZK A;  2LNS A;  5JWO B;  1M9B A;  2MMZ A;  1M2B A;  5DBQ A;  1A2L A;  3H4K A;  3MYD A;  5E4W A;  5IPG A;  4K7N A;  4QQ7 A;  3N5O A;  2DIY A;  1TRW A;  1V98 A;  2XC2 A;  4EO3 A;  1O7U A;  2DJ1 A;  3MIX A;  2FUG 2;  2L5L A;  1K0B A;  2YV9 A;  3P2A A;  1EGR A;  1EEM A;  3CBU A;  4ULX A;  4KDX A;  4PUA A;  2WZ9 A;  4GRF A;  6GSU A;  2H70 A;  4Z2R A;  1JZD A;  3CYN A;  3HDC A;  4N30 A;  3ZFL A;  5G1K A;  1ERT A;  2LUS A;  4ZL7 A;  2GQL A;  3F3R A;  4DSR A;  2R0G A;  2CVB A;  4MAB A;  2DJ0 A;  1Z9H A;  4O5Q A;  4YKF A;  4F2I A;  2XBQ A;  2IME A;  5BRT A;  5CO3 A;  5HQP A;  2G0F A;  1T1V A;  4X1U A;  1T4Z A;  3FMW A;  5DAL A;  2GT5 A;  3O3T A;  4K5S A;  4HJM A;  2KHP A;  4WBR D;  3WGD A;  6GSX A;  2LEG A;  3U6V A;  4H86 A;  5J3R A;  4PGT A;  4YAV A;  5F0G A;  2VO4 A;  4JZQ A;  3GYK A;  1F3B A;  4K8M A;  1FB0 A;  2IYJ A;  1H75 A;  1XW6 A;  4ECJ A;  2C1Y A;  4GQF A;  4NXI A;  3GTU B;  1KBN A;  4N0V A;  4TVE A;  4YKG A;  2QKE A;  2GST A;  3SBC A;  5ECP B;  2R0P A;  5JCU A;  2CZ3 A;  4AJ7 A;  4IQA A;  3QFA C;  5CNW A;  4K6X A;  4J2F A;  3IRA A;  1QGV A;  2Z9S A;  5FWG A;  2M80 A;  2NTO A;  1TRS A;  4V1A g;  2H30 A;  1ERW A;  1Y6E A;  4MP4 A;  5ABR A;  2YWM A;  1PKZ A;  3G9B A;  2ON5 A;  1SJZ A;  3MNG A;  3O76 A;  5ECL B;  2CZ2 A;  5B8B A;  3IDV A;  3Q18 A;  3DD3 A;  4PQI A;  4DSS A;  3LG6 A;  2HT9 A;  3DKS A;  4N11 A;  3VPT A;  1T7P B;  4POK A;  5ECH B;  4GSN A;  2DMM A;  2L6C A;  3WGE A;  3A2V A;  1YF0 A;  4LLR A;  1X9M B;  1BAY A;  1T3B A;  1VGL A;  4BVY B;  3DML A;  3M9J A;  1M7T A;  3GKX A;  3QCP A;  1K0D A;  5F8B A;  4KE3 A;  3APQ A;  3R2Q A;  3VWV A;  3Q19 A;  1B4P A;  2ZUP A;  4WBJ A;  4PUF C;  1TK8 B;  12GS A;  5IOX A;  1QMV A;  3TGZ A;  3P7X A;  2N5F A;  4O32 A;  3D0Z A;  2RUF A;  4EDZ A;  5IQY A;  1EGO A;  2C0D A;  4F9Z A;  4ECI A;  4ILF A;  4JU5 A;  3TJJ A;  2RUE A;  3F8U A;  1S3C A;  4F82 A;  2I3Y A;  1Z7P A;  3GX8 A;  4IHU A;  1SYX A;  1MEK A;  1YJ6 A;  3U5R E;  4K7I A;  3TOT A;  2HXK A;  4K7O A;  4K0N A;  3ZZX A;  3NIV A;  2PPT A;  1BX9 A;  3EMP A;  4TR1 A;  1XW5 A;  4K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...