5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
5FWGA 3ZLPA 4GF0A 2DIZA 1OAZA 2IY2A 3ZFBA 5C04A 2X8CA 3L0HA 2XPEA 2GT6A 1XWAA 2R37A 3H1NA 4RQRA 2FWHA 3KZQA 3DYRA 2ZUPA 4O32A 1XWKA 4KCEA 5B8BA 3F4RA 4ISDA 3KEBA 1S3AA 3VWUA 2K18A 2YJ7A 4OFMA 4XTSA 3ZREA 1O7UA 4HOJA 3QAWA 1GULA 2LKUA 1PQNA 4OCEA 1PRXA 3F63A 3APOA 2GQMA 1N2AA 3ZRDA 1EP8A 2L5OA 3F8UA 4WEYA 1FG4A 1SU9A 2YV9A 1NHOA 5KN2A 3Q19A 1ZGNA 2JZRA 3DKSA 4IKHA 1KBNA 3QDNA 4MF6A 2N5AA 4MJCA 1GUKA 3IHQA 3F4SA 3GA4A 1Y6EA 2X99A 4F0BA 4MH3A 3GH6A 4EL1A 1YF1A 2LNTA 2MMOA 3QOUA 5B8AA 1ERTA 2HT9A 1E2YA 2DSAA 1SJIA 5DCGA 3KH7A 1SKRB 3KIJA 3F6DA 1B9XC 1K3OA 5J41A 3TJFA 4X1UA 4K1FA 1I5GA 1R7HA 5CNWA 3UEMA 3IRAA 3H8QA 1ERVA 2R4VA 6GSVA 1QGVA 3HZ4A 4DSSA 4E8EA 1K0CA 5ECNB 3DXBA 1A8LA 1A8YA 2H72A 3E3EA 3GRXA 3DIEA 4NWYA 2XBQA 1EEJA 3LJRA 3DVWA 3G9BA 2NVLA 1W4VA 2VCXA 3SBCA 1ML6A 2I4AA 4TOPA 5HFGA 1EP7A 3E9JB 3VPTA 2H0IA 3LG6A 3FW2A 3ME8A 3VWXA 2FD3A 3DRNA 4NPBA 2C3TA 5ELAA 1FO5A 2HZEB 2VIMA 11GSA 1K0NA 2RM5A 5ECIB 4PQIA 5G2ZA 4WR5A 5D9VA 1O8WA 1F3AA 1NHYA 2M46A 2FNOA 2GZPA 3UVTA 5HR0A 4EE0A 2CQ9A 3LYKA 2YANA 2QC7A 3CXGA 2NDOA 4MA9A 3GTUB 2B5XA 4OWYA 22GSA 5E59A 2AHEA 3HVSA 2VLUA 3H93A 1FVJA 2FY6A 2P5QA 2I81A 4HQZA 4MK3A 4AGSA 4IBPA 3QCPA 4LL1B 3SWLA 3O6TA 5EPFA 3DGQA 4LLRA 3PR8A 1X9SB 2PWJA 5H5RA 3GSTA 5F8BA 5B6NA 4GSSA 5F05A 4NV5A 2MMZA 3WT1A 1TK5B 1EGRA 5LNKe 2M80A 4IGJA 1M7TA 2A2SA 1BYEA 5IIZA 3IDVA 2JL4A 14GSA 4I6XA 5COHA 4BVXA 4GXZA 2CAIA 3GL5A 1S3CA 5C00A 3RBTA 2LS5A 4KDXA 4V2MA 4BWSA 2PUKC 2H1DA 4ECCA 3D4MA 4HEA2 2GVPA 2RIIA 5CO3A 4HZ2A 1OKDA 2FGXA 2AUVA 1OC9A 4WETA 2IN3A 2NPBA 1V2AA 2DJKA 3FRCA 1QK8A 3GX8A 1M2DA 2GDRA 4OFTA 2C0GA 4MF5A 2L6CA 2FWEA 3KH9A 1LBKA 2PU9C 2VLVA 3WD6A 1JZWA 3QR6A 1QMVA 1NSWA 3HVXA 4FYUA 4AJ8A 1U87A 1WMJA 2IMDA 2LSTA 1GNEA 3ZTLA 1X0RA 3CRUA 3QFBC 1A0FA 2LUSA 4XS4A 1Z7PA 2D2ZA 4MJBA 2WJUA 2PN8A 4POKA 1PMTA 3MSZA 16GSA 4K7IA 1XWBA 1V98A 3GKXA 3FZ5A 5FHIA 4I2UA 2IIYA 4ECBA 3O76A 2DLXA 3GH9A 4GSNA 1ON4A 13GSA 2O89A 4K6XA 4FYCA 2IMEA 3TOUA 5DALB 4ZL7A 2FLSA 2WFCA 4YQVA 4F03A 3S9FA 1WRYA 1OC9B 3A2XA 3GSSA 4FO5A 5ID2A 1H4OA 1ZZYA 2ALBA 3WGXA 2VM1A 1IYIA 3ZMLA 3UIWA 2LNSA 3C71A 4MMMA 1R5PA 3UVHA 1K0BA 2IL3A 5HQPA 5CAXA 3HA9A 2MMNA 3VPQA 2TRXA 4GRFA 4JZQA 1YQ1A 2VL9A 3GN3A 3P8WA 1PL1A 5LD0A 4N0ZA 4QQ7A 2J9HA 1YDKA 4NHWA 3EYTA 5J4UA 2JADA 1ERWA 3EU3A 2JACA 2K9FA 3HHVA 1BEDA 4WBRD 2R6KA 2C8UA 5AGYA 3KMNA 2LTKA 4OCFA 2V32A 1JHBA 2NBSA 4TXOB 2ON7A 4NV2A 2F8FA 4Q5RA 1SD9A 5J9CA 1GTUA 1TDIA 2JU5A 1SL2B 5D8IA 5CRDA 5IO2A 1DUGA 2GQKA 1OKTA 3FHKA 1PKWA 4D73A 1THXA 1GSFA 4RI7A 3DWVA 1U3AA 4GQFA 4IP1A 3WT2A 4WBJA 2CX3A 2LRNA 5HFKA 3BOAA 2XC2A 1V57A 4ZL8A 3C8EA 3IBHA 4ACSA 3W6GA 1K3LA 2I9HA 4LMWA 4ID0A 5IQYA 4L5LA 4HU9A 2P0GA 4ECIA 1EEMA 4EF0A 2EIRA 2B5YA 1QUWA 2H30A 3ZYWA 3MNGA 5CP1A 5ECQB 3H79A 2H1GA 3GKKA 1AW9A 1AAZA 2B6MA 5ECRB 3IA1A 3CTGA 1S3DA 1SK2A 1HNAA 4TR1A 5IMCA 3VFIA 5ABRA 4PQHA 1J9BA 5HFIA 1YY7A 4KSMA 4HI7A 4JR4A 3UJ1A 1JZRA 3I6AA 3F4TA 3JCML 2HI7A 4EDYA 1TTZA 3GHAA 3BCKA 4ECJA 1TRUA 2B7KA 1ILOA 3ERFA 3GIXA 3C1SA 3HD5A 3HXSA 3CSIA 3RPPA 2C1YA 2LRTA 1HQOA 4ZBDA 4V2LA 4WR4A 4EKZA 2IMKA 4K9ZA 3IAM2 1VF3A 1XW5A 3IXRA 1ZMAA 3TJJA 2OACA 1GRXA 3ZL5A 4GSTA 1TI3A 2CX4A 3ZMKA 3EVIA 5IOXA 9GSSA 3RHCA 4CHSA 1YKAA 3KGKA 2WCIA 3UAPA 2YCDA 1PX6A 1F2EA 1F6MC 1HD2A 2OA7A 1XXUA 2FHEA 5ECSA 2WULA 4FYBA 3TRPA 2X8HA 1A2JA 1B9YC 4MLYA 2REMA 1OC8A 1GLQA 3I9V2 3LXZA 4HU7A 1OE7A 2F8AA 2HSHA 2VD0A 2LEGA 3M9KA 1TU8A 2MZCA 4OMVA 1JZOA 1WOUA 2QSIA 4IVFA 4K7NA 3EC3A 1K3YA 1T00A 4N0VA 3H4KA 2LQOA 1M2BA 2H01A 3FR3A 4TR3A 3TUEA 3UMAA 5IMAA 4KDYA 1TW9A 1Z5YE 2LJKA 4ILFA 1YEPA 3VWVA 5LCZA 3MDKA 2QKEA 2FA4A 1G7EA 3APSA 4N10A 4MZCA 2AV4A 2JSZA 5G30A 2B3SA 3J7Yb 1LU4A 1X5CA 2TRCP 3RPNA 1F9MA 3L9VA 3ZZXA 2OJLA 1MD4A 1U3IA 5AIVA 5IPGA 4TR0A 2E7PA 3QPMA 2O87A 5IMVA 1DBYA 4GCIA 1B48A 1VF2A 4PNFA 1YZXA 1GSEA 1HNCA 2DJ2A 1QQ2A 1TU7A 4ULXA 4KH7A 4CDOA 4PXOA 4F9ZA 3TKRA 3BD2A 3LFLA 3CYNA 1PGTA 2YWMA 1SK1A 3K8NA 4G9HA 2L5LA 3FYGA 5A4UA 3TGZA 3EU4A 3KD0A 4EC0A 1T1VA 5EL8A 5G5EA 3BCIA 3FZ9A 4AF2A 3BBYA 1MDKA 4TVEA 6GSYA 2DJ3A 4EXJA 4AJ6A 4XIHA 3M9JA 1FHEA 3DEXA 3TDGA 3J7Yk 2XPDA 1XOBA 6GSUA 18GSA 4J2FA 2IFQB 4OO5A 2K6VA 4HDEA 5JWOB 3CMIA 5GAPD 5L71A 4AJ7A 1F3BA 3P2AA 5GSSA 7GSSA 2EC4A 1XFLA 4KSOA 4MZWA 3N9JA 1BG5A 3HVVA 3LYPA 2GQLA 2H6XA 5KN3A 3D5JA 5IMFA 4V1Ag 2OE0A 5D73A 1XZOA 4KE3A 1R26A 4LMVA 3U6VA 2RM6A 1R4WA 2C4JA 1V58A 1XW9A 2CT6A 2HRNA 5HR3A 5JCWA 4JRRA 4GWRA 5EVOA 3TRXA 3IPZA 4KCAA 1TRVA 1XW6A 1GLPA 4L0WA 4ZIJA 4MCUA 5F07A 3TJKA 3DMLA 4KGIA 1VF4A 2B7JA 1TJDA 3FEUA 4RUVA 3HJPA 4IELA 3A2WA 4GTUA 1O85A 5F06A 2PMTA 1UVZA 1A2MA 2P31A 4TN8A 4BVYA 1KNGA 1A23A 1O6JA 3IE3A 2HRFA 3CBUA 1G6WA 4I2TA 1T3BA 4E8HA 4XCSA 4J56E 4MABA 1DE1A 5F0GA 3VLNA 2L4CA 4XRDA 1EV9A 2PVQA 2BJXA 1V40A 4KB3A 5HR1A 1X9MB 2V41A 1MDIA 3US3A 3W8JA 1ZCPA 3TKSE 4I97A 1T4ZA 3HCZA 4L8EA 2YV7A 4ML1A 1ZL9A 4PNGA 3Q6OA 2WDUA 1LJRA 4IS0A 3FZ4A 2JZSA 3MWHA 4POBA 1NW2A 3HY2A 1TK0B 2CA8A 2VOCA 2VCTA 4I5QA 3AY8A 1GL8A 1Z9HA 3P7XA 4ZB6A 2H0HA 4MH2A 3V1WA 2B5EA 1QXHA 4O92A 2EIQA 1XVQA 6GSSA 4K8MA 2AYTA 5DCHA 3KJYA 4ZB8A 5ECHB 2JSYA 2R5GA 2WB9A 4IJIA 4H86A 3QD9A 3LWAA 3GFKA 3ZITA 3TCOA 3UBKA 2VM2A 1AQVA 4BL7A 1X9WB 3KMOA 1B4PA 3KP9A 1ACVA 1XWCA 4XS1A 3VWWA 5B6MA 2CAQA 3F6FA 1C72A 3EE2A 2A4VA 3OR5A 4WF5A 2L4QA 2H19A 2I3YA 5INYA 3P90A 2DIYA 2FWGA 2V2GA 4TXOA 3A3TA 4OD7A 3M1GA 1YJ6A 3D21A 4K7OA 2GTUA 2PBJA 4HJMA 2VCWA 5D96A 3EURA 4PURA 2DBCA 1RW1A 5HR2A 5AISA 2KUCA 4MPFA 3KM6A 4XHMA 2H73A 4YH2A 2GSQA 2KHPA 5D9WA 1AUCA 3KP8A 2IMIA 4I8BA 3FR9A 3ZIVA 1GSDA 2FUG2 1OVNA 5IMZA 1XPVA 1GTAA 2H70A 1CQGA 1WPIA 2HZEA 4WF4A 3IOSA 5DQYA 4X0XA 2GSRA 1ZOFA 4TW5A 4CW9A 1AQXA 3C73A 4KX4A 2YWOA 3GV1A 4N11A 4WXTA 4G2EA 4IP6A 1DE2A 5EY6A 1M0UA 2ES7A 4RQXA 1HYUA 3APQA 2K8VA 1XWGA 4PX1A 3FK8A 3GTUA 2H75A 3FY7A 5DAKB 2HYXA 2L59A 3D0ZA 2YZHA 2DJ0A 1TRSA 2J23A 4ZB9A 5G31A 1ABAA 1CQHA 4Q5NA 5G5FA 2DMLA 4KNDA 1EOHA 1J0FA 2MBTA 1WWJA 4DSQA 3QAGA 2OE1A 1TI1A 4Q5QA 1GP1A 2HNLA 3RHBA 1TKDB 2Z9SA 2HE3A 1V9WA 1OYJA 1M9AA 3GL3A 4JU5A 4HUAA 3UOMA 5H5QA 2VCZA 2BMXA 2HZFA 1VF1A 3FKFA 1SKWB 2H1BA 3LORA 2CV4A 2H74A 4TR1B 2VL3A 2OADA 3LSZA 4XRAA 3NZNA 2EIOA 5ECKB 1EWXA 2LJRA 1J08A 4J57E 2TIRA 3WGEA 1UA5A 1JZDA 1FB0A 4L5OA 4GQCA 5JCUA 1WIKA 1H75A 4KUNA 3VURA 2YJHA 1R5AA 17GSA 3GNJA 3KTLA 3ZVJA 2VL2C 2R3XA 2CVDA 4G10A 1AQWA 2C0DA 2OBIA 2V1MA 2C80A 1XBSA 3F9UA 3GURA 2R2JA 1ST9A 4IW9A 1Z7RA 2I1UA 4XS4B 1Q98A 2YZUA 5DQSA 2HFDA 3L9UA 4HZ4A 1OC3A 1K0AA 2XHFA 2VL2A 3FR6A 4YAPA 3WGDA 2IFQA 4POLA 4N30A 2IWTA 5DJLA 4IQ1A 2YN1A 3ZVJD 4TXVA 4V2NA 2MMAA 1SYRA 3F3QA 5H5SA 6GSXA 3TOTA 4Z7XA 4IHUA 1USBA 2CVBA 4BPYA 4OFNA 1QFNA 4HJ2A 2QGVA 2RLIA 4JEDA 1T8EB 2GS3A 1SYXA 2E2MA 2PGTA 2KOKA 1Q4JA 1MDJA 1BAYA 2YNXA 4K0NA 3UBLA 2LQQA 3TJGA 3EINA 4HQSA 3C7MA 1PL2A 2B1LA 1XVWA 1SENA 1UN2A 3KTBA 1TOFA 3QAVA 2HSYA 3IK7A 4F0CA 3KCMA 4TRXA 4JR6A 4K0GA 1EOGA 3ERGA 4MZBA 5J9BA 2MYGA 1EV4A 4F2IA 1N8JA 1FB6A 4ML6A 6GSTA 1KTEA 1MTCA 1TRWA 2VO4A 2OBKA 1RK4A 5A5KA 2H8LA 1X5DA 1JLVA 4NMUA 2IJYA 1FVKA 3HJMA 3VI5A 2CZ3A 3F3RA 2KP2A 1MEKA 3I69A 1TK8B 1G0TA 4XS6A 2V6OA 3EWLA 5D93A 5DBQA 3NOFA 3IR4A 2ON5A 2H1AA 2YWNA 3G7JA 3I43A 3UARA 2L6DA 1A0RP 4ZBAA 3NIVA 4YQMA 2RUFA 4NXIA 3GKMA 2FA8A 5KN1A 3Q74A 3WYWA 3L78A 4JBBA 1SD8A 1FAAA 1G7OA 12GSA 2F3MA 3L4NA 1GSSA 1Z3EA 4BWQA 5ID2B 3M3MA 5IO0A 4MDCA 4FIWA 2ZCTA 2PERA 5CRGA 1EZKA 1SJ6A 3IK9A 2C0FA 2PPTA 2A2RA 1K0MA 3TKSC 2OKAA 1ZYQB 5DAKA 1GTBA 2KP1A 1BJXA 3LXTA 4RI6A 1SL0B 5ECLB 3GMFA 4TR4A 2WGRA 2AJQB 3F0IA 2CZ2A 5IM9A 4O5RA 4G19A 1PA3A 2GT5A 2GSSA 2H71A 2PVOC 3VK9A 3D6IA 4ZL9A 1PN9A 1GH2A 1SJZA 3ERWA 2G2QA 3Q18A 2P5RA 3BJ5A 2X64A 5AIXA 2HXKA 2C3NA 4QL7A 3TKPA 5GSTA 2GZZA 4ZILA 1THOA 3TKQA 4PGTA 1PX7A 2H6YA 1BX9A 10GSA 1WJKA 3VI7A 1A2LA 3GYKA 1Z6NA 1M99A 2M72A 5AN1A 8GSSA 1F37A 5D9XA 1FOVA 2WRTA 3G7IA 2KLXA 5JCGA 3C1RA 5DDLA 2N5BA 4QL9A 4F82A 4KDUA 5IOWA 2JZTA 4ZXGA 1W89A 4WKWA 2X8GA 2BTOT 2YPMA 2VCQA 1URMA 4MJEA 4MF7A 1PSQA 1E6BA 4KAEA 1XIYA 2IPAA 1AC1A 2C0EA 3D4TA 1XOAA 3ZFLA 3LEFA 5G1LA 3DD3A 4EVMA 3U5RE 5B7CA 3TJBA 4LA1A 3UL3A 1G6YA 2OE3A 3GX0A 4MPGA 5DALA 5GAND 2VD1A 4DEJA 1GSQA 4K2DA 19GSA 4ZBBA 3HYPA 2VLTA 1GUHA 5ECMB 4LL4B 1YEXA 2O8VB 2GGTA 1B8XA 1RQMA 2B1KA 2NTOA 3LGCA 4MP4A 1XCCA 2YOIA 3IV4A 2IYJA 1UC7A 2AAWA 4IJ3A 5ECPB 3E0UA 3CSHA 1I9DA 2ZNMA 4TKYA 4X43A 4P3YB 3DVXA 3D22A 1ERUA 2H76A 3HZ8A 4GLTA 5G1KA 3A2VA 3O3TA 2G0FA 1U88A 2VAFA 3FZAA 4HS1A 5CRHA 3GKNA 1T7PB 3L9SA 3MAKA 2C3QA 1GSYA 1BQ7A 2YP6A 1T4YA 5ECOB 1WE0A 3LQ7A 6GSWA 4MJAA 5CREA 3TB2A 1VRSD 2FCHA 4NHZA 3M8NA 5E4WA 5IPHA 4L0UA 5J5NA 2GLRA 3CTFA 4EDZA 3KXOA 3HKRA 1SK0A 3CSJA 4O7HA 4DSRA 2E0QA 20GSA 4EUYA 2O85A 4D73B 2F9SA 4YQUA 3EMXA 1Z6MA 3HDCA 1WP0A 2H66A 2O7KA 1GTIA 5IMDA 4EO3A 2AB6A 1SL1B 1Y25A 4V1Ap 4KW6A 3ISOA 4Q5FA 1YF0A 2V6KA 1KEBA 3N5OA 1PD21 2F51A 4PQ1A 4DVCA 3IAS2 4BA7A 2IMFA 1NM3A 5KN0A 1O81A 3EMPA 5JWQB 5ENUA 2WS2A 3GUSA 5KEJA 1VGLA 3A5WA 1A24A 1MD3A 4FH8A 5J3RA 5CRWA 1JLWA 3RDWA 1JFUA 3M0FA 2VCVA 3CRTA 2RUEA 1HNBA 3QMXA 2HLSA 5D9TA 2DC5A 5FT3A 5DVBA 1K0OA 1K0DA 1ZYEA 1EGOA 1DSBA 1O8XA 1X5EA 4OO4A 3TRQA 2E2GA 2YWIA 4PUAA 1GWCA 4IQAA 2VUPA 2L57A 2LRCA 2WZ9A 2GSTA 1M2AA 2XBIA 5A4WA 3G7YA 1B4QA 5CYYA 4IN0A 1O73A 1SKSB 3ZIJA 1AXDA 3PH9A 1AIUA 1U6TA 3ME7A 2LJAA 2H6ZA 3W8SA 3R2QA 2K8SA 5JWRB 1IYHA 4KA0A 5ELGA 1OE8A 1GSUA 2FWFA 4PUFC 2DMMA 1TXXA 3ED3A 3HJOA 4POMA 3IC4A 5DJMA 1GNWA 2GZYA 2CVKA 2DJ1A 2H0GA 2LV3A 3PGTA 4JE1A 3QFAC 2N5FA 2DJJA 3RAZA 1TP9A 3PINA 4NAXA 1GUMA 1FW1A 1PKZA 1YKCA 5GZZB 4DSSB 2MBSA 3TKSA 5A4VA 1M9BA 4YAVA
chains in the Genus database with same CATH superfamily
4I4KA 5FWGA 3ZLPA 4GF0A 3WHOA 2DIZA 1RGGA 2CW9A 1OAZA 2IY2A 3ZFBA 3NM7A 3FG3A 5C04A 1YIT3 2RGQA 2X8CA 3L0HA 2XPEA 2GT6A 1XWAA 2R37A 3H1NA 4RQRA 2FWHA 3KZQA 2F56A 4X2OA 1SIIA 3DYRA 2ZUPA 1VQP3 4O32A 3B4PA 3PGBA 1XWKA 4KCEA 5B8BA 1R4CA 1T2HA 3HX8A 3F4RA 5RNTA 4ISDA 2R0PA 1NB3I 3KEBA 3FMWA 1S3AA 3VWUA 2K18A 2YJ7A 4OFMA 1W2B2 4XTSA 3AHSA 3ZREA 1O7UA 1YJ93 2XEPA 1S5AA 3BIRA 2QA2A 4HOJA 3QAWA 3IPTA 4FMAA 1GULA 2W04A 2LKUA 1PQNA 4OCEA 1OH0A 1PRXA 3F63A 3IHGA 3APOA 1LNIA 2GQMA 1LQGC 3BNCA 1N2AA 3ZRDA 3UJMA 5IENA 1EP8A 1BUJA 2L5OA 3F8UA 1T2IA 4WEYA 1FG4A 1SU9A 2YV9A 1DMQA 1NHOA 5KN2A 3Q19A 1ZGNA 2JZRA 3DKSA 4IKHA 4LEHA 2BMQB 4BIRA 1KBNA 5BMUA 4HSCX 3QDNA 3CCR3 4MF6A 4HOHA 3NBRA 2E2UA 2N5AA 4MJCA 2WO0A 1WMNA 4HM8B 1GUKA 3EC9A 3IHQA 4FCMA 3F4SA 5M1AA 3GA4A 1Y6EA 2X99A 3MHEA 4F0BA 4MH3A 3GH6A 3HI7A 1JB2A 4EL1A 1YF1A 3SOAA 4RZMA 5G2GA 2LNTA 2MMOA 3QOUA 5B8AA 3KZTA 1ERTA 2HMKB 4RNTA 2HT9A 4YKFA 1E2YA 1RJOA 2DSAA 1SJIA 5DCGA 4IT7A 3KH7A 1SKRB 3KIJA 3F6DA 1B9XC 5AIIA 1Y4KA 1K3OA 3DY5A 5J41A 2P09A 4HM3B 4N6MA 3TJFA 4X1UA 4K1FA 1I5GA 1B2SA 4CDLA 1R7HA 5CNWA 3UEMA 2JQ5A 3IRAA 3H8QA 4WWUC 2HOHA 1ERVA 2R4VA 6GSVA 3CXC2 1QGVA 3HZ4A 4DSSA 1Q814 1S3RA 3KCHA 1LVNA 4E8EA 1K0CA 2QA43 5ECNB 3DXBA 1SPUA 4HM6B 1SQWA 3D5IA 1RMSA 9RNTA 5FGOA 1A8LA 2I9WA 1A8YA 2H72A 1UW1A 3E3EA 1BSDA 3URPA 2J8XB 3SOYA 1UCJA 3GRXA 3DIEA 4NWYA 3H3HA 1EEJA 3CC43 2F99A 2XBQA 3LJRA 3DVWA 5ELUA 3G9BA 2NVLA 1W4VA 1BOXA 5CXOA 3NBJA 2VCXA 1DMMA 1GSPA 1MWRA 3SBCA 1ML6A 4N6LA 1FW7A 2I4AA 4TOPA 5HFGA 5BRTA 1HU9A 4FMCA 1EP7A 3E9JB 3VPTA 2H0IA 3LG6A 3FW2A 3ME8A 1JBRA 3VWXA 3FCSB 4FQUA 2FD3A 4FR9A 3DGOA 1KQS2 2CFKA 3DRNA 4RNYA 4N6V0 1TTOA 4NPBA 2C3TA 5ELAA 1B2XA 1FO5A 4LZIA 2HZEB 1UUVB 3CPW2 1XG8A 2VIMA 4R9LA 4GHOA 11GSA 1K0NA 2RM5A 2QIYA 5ECIB 4PQIA 5G2ZA 4WR5A 5D9VA 1O8WA 5M18A 3BNDA 1F3AA 4HM0B 1NHYA 2M46A 2FNOA 2GZPA 5TGNA 5LC7A 3UVTA 5HR0A 4EE0A 1GY6A 3KE7A 1RCLA 1R4YA 2CQ9A 1GY5A 5IF6A 3CCQ3 1LQMB 3LYKA 2YANA 3ECFA 3OW22 2QC7A 3CXGA 2NDOA 1E3RA 4MA9A 3GTUB 2B5XA 4OWYA 1SARA 22GSA 3ZG0A 5E59A 2AHEA 3HVSA 2VLUA 3H93A 1FVJA 2X4AA 2FY6A 2P5QA 2L1SA 1KSIA 2I81A 2JDIH 2KF4A 4HQZA 4MK3A 2GBXB 4AGSA 4IBPA 3QCPA 4LL1B 3SWLA 3O6TA 5EPFA 1AY7A 3DGQA 3L0RA 4LLRA 3PR8A 2XR8B 1X9SB 2PWJA 5H5RA 3GSTA 5F8BA 4EXRA 5B6NA 3B4OA 1RNTA 4GSSA 3MSOA 5F05A 4G0LA 4NV5A 2MMZA 3WT1A 1TK5B 1EGRA 4Q53A 5LNKe 2M80A 4IGJA 1BRKA 1EA2A 1M7TA 2A2SA 1BYEA 5IIZA 1I0VA 3IDVA 2JL4A 1Q40A 5D83A 4K61A 14GSA 3S27A 4I6XA 5COHA 4BVXA 4GXZA 1IDPA 2CAIA 8CHOA 1I3FA 3GL5A 1I8VA 1S3CA 5C00A 3MYTA 1T5YA 3RBTA 2LS5A 3FLJA 4KDXA 4V2MA 4BWSA 2PUKC 3VSYA 2H1DA 4ECCA 3MG3A 3D4MA 4HEA2 1RSNA 2GVPA 2RIIA 5CO3A 3NHXA 4HZ2A 1OKDA 2FGXA 2AUVA 1OC9A 4WETA 2IN3A 2NPBA 1V2AA 5IEOA 2DJKA 3FRCA 1QK8A 1CEWI 3GX8A 1QMAA 1M2DA 2GDRA 4OFTA 2C0GA 4MF5A 2L6CA 3S28A 2F86B 3RNTA 2FWEA 3KH9A 1LBKA 2PU9C 5EEOA 3J7Yd 2VLVA 3WD6A 1JZWA 3QR6A 4XDVA 5BIRA 1QMVA 1NSWA 3HVXA 4FYUA 3SLUA 4AJ8A 1FUSA 1U87A 2XFTA 1O7GB 1WMJA 2IMDA 3X40A 2LSTA 1GNEA 1NU3A 3ZTLA 1X0RA 3CRUA 3QFBC 4EIPA 1A0FA 2LUSA 2WGQA 4XS4A 1DETA 1Z7PA 2D2ZA 3EQQB 4MJBA 2LQVA 4J5KA 2XRXB 2WJUA 2W9PA 3AHWA 3PXMA 4BTXA 2PN8A 3WMDA 3D79A 4POKA 3JUQA 1PMTA 1X1UA 3MSZA 16GSA 4K7IA 1XWBA 1V98A 3GKXA 3FZ5A 2BU4A 1M3JA 2FXTA 1QAFA 3MIXA 5FHIA 1VQK3 4I2UA 2IIYA 4ECBA 3O76A 2DLXA 3GH9A 4GSNA 1ON4A 1I2FA 3EX9A 13GSA 5D81A 2O89A 2X49A 3WODG 4K6XA 1QALA 3B7CA 4FYCA 2IMEA 3TOUA 5DALB 4ZL7A 1LOVA 1B2UA 2FLSA 1PN0A 1ROVA 1Q7Y4 3GRDA 2WFCA 4YQVA 4J8TA 4F03A 3S9FA 1WRYA 1OC9B 3A2XA 3IMAB 1B27A 1DVCA 3G713 3GSSA 1IQYA 3DGMA 4FO5A 2CWVA 5ID2A 2CG0A 1UGIA 1H4OA 5AYRB 4HM5B 1ZZYA 2ALBA 2ML5A 3CCU3 3WGXA 2VM1A 1IYIA 3ZMLA 1OHPA 1UCIA 3UIWA 1M3IA 2LNSA 4NREA 3C71A 4MMMA 1W01A 1ZGXA 1R5PA 1LOWA 3UVHA 1K0BA 2IL3A 4O02B 5HQPA 2INXA 2HSMA 5CAXA 2BO9B 1BRGA 3LTBA 3HA9A 2MMNA 3VPQA 2TRXA 1BRHA 2V1LA 1JKGB 2HMJB 4GRFA 3WR2A 4JZQA 2FGTA 1YQ1A 1JN5A 2ZHXB 2VL9A 3GN3A 1X1YA 3STDA 3U1WA 1D6YA 3D4AA 3P8WA 1PL1A 5LD0A 2F5MA 4N0ZA 2J9HA 4QQ7A 2A4HA 1JBTA 1YDKA 4NHWA 1RGLA 3EYTA 2IA7A 1WNHA 5J4UA 1FGQA 1WMPA 2JADA 4HJLB 1US1A 3T0UA 1ERWA 3EU3A 2JACA 2K9FA 3HHVA 1AVKA 1BEDA 2OTL3 4WBRD 3V98A 4WYKA 2R6KA 1MGRA 1GD3A 1Q7HA 3CC23 2C8UA 5AGYA 3KMNA 2LTKA 4OCFA 2V32A 3UL6A 1JHBA 2NBSA 4RNZA 2GEYA 2WOFA 4TXOB 3CME3 2ON7A 4NV2A 2F8FA 4Q5RA 1SD9A 5J9CA 1GTUA 1TDIA 2JU5A 1SL2B 5D8IA 5CRDA 5IO2A 1DUGA 2GQKA 3IC8A 3G0KA 1OKTA 1UI7A 3FHKA 1BANA 2CHCA 1OCVA 1CYUA 1PKWA 4D73A 4L8OA 1J2BA 1THXA 3HZPA 1QJGA 1GSFA 3AMOB 4RI7A 4EC6A 4RBNA 3DWVA 1U3AA 4GQFA 2W56B 4IP1A 3WT2A 1BSEA 4WBJA 2CX3A 2LRNA 5HFKA 3BOAA 4JF8A 2XC2A 4BL7B 2IUKA 1V57A 7RNTA 4ZL8A 2M7OA 3C8EA 3IBHA 4ACSA 4K1UA 3AMOA 1DE3A 3N54B 3W6GA 1OGXA 6STDA 1K3LA 2I9HA 4LMWA 4ID0A 5IQYA 4L5LA 4HU9A 1ZS7A 2P0GA 4ECIA 1E97A 1EEMA 3KN4A 1B20A 2OQEC 4EF0A 2EIRA 5EVHA 2XGLA 3EBYA 5I97A 2B5YA 2OWPA 1QUWA 2H30A 3DUKA 3ZYWA 3PZWA 1VQ93 3MNGA 3N9HA 5CP1A 1MWTA 5ECQB 3H79A 3D5GA 2H1GA 3GKKA 5DREA 1AW9A 1AAZA 1AVLA 2B6MA 1Q40B 5ECRB 3IA1A 2GBWB 3CTGA 3DGLA 5GSPA 1S3DA 4K1VA 1SK2A 1HNAA 4TR1A 5IMCA 3VFIA 2QEX3 3LOYA 1A67A 5ABRA 4PQHA 4GL6A 1J9BA 5HFIA 1YY7A 4KSMA 1BRNL 4HI7A 3HIIA 3DMCA 4JR4A 3UJ1A 1ZYNA 1JZRA 3I6AA 3F4TA 3JCML 2HI7A 3EPTA 4EDYA 1TTZA 2UZ8A 3GHAA 1OF5B 3G16A 1TRPA 3BCKA 2BT3A 3G6E3 4ECJA 1IVVA 1TRUA 2B7KA 1ILOA 3ERFA 3GIXA 3C1SA 3OWYA 3I0YA 4BL3A 3HD5A 2BHMA 3HXSA 3CSIA 3RPPA 2C1YA 2LRTA 1GMPA 5IG0A 1RTUA 4KVHA 1HQOA 1I3IA 4ZBDA 4V2LA 3K5TA 4WR4A 4XDWA 3T8NA 4EKZA 1LNHA 2CFGA 1YJW3 2IMKA 2QGUA 4K9ZA 3IAM2 3WOEB 5LC6A 1VF3A 1XW5A 3IXRA 2CG1A 1ZMAA 2CKFB 3TJJA 2OACA 5CF1A 1GRXA 1GYBA 1GMQA 4GSTA 3ZL5A 1TI3A 2CX4A 3ZMKA 3EVIA 2Z6BA 3HK4A 5IOXA 9GSSA 3BNBA 3RHCA 4CHSA 1YKAA 3KGKA 2WCIA 3BLZA 3LTAA 3UAPA 1E3VA 4HBRA 2YCDA 1PX6A 1F2EA 1F6MC 1HD2A 2OA7A 1XXUA 1TFOA 2FHEA 5ECSA 1B2ZA 2WULA 3OXAA 3X3ZA 4FYBA 4MJDA 1K734 1A2JA 2X8HA 2AADA 4N6NB 4XBXA 1B9YC 3TRPA 3K9MC 4MLYA 5AYSC 2REMA 1OC8A 1GLQA 1OPYA 3I9V2 3LXZA 4HU7A 1OE7A 2F8AA 2HSHA 2VD0A 1Q864 2LEGA 4LGQA 3M9KA 2W6JH 1TU8A 2MZCA 1RHLA 4OMVA 1JZOA 1WOUA 2QSIA 4IVFA 4K7NA 3EC3A 3UL5A 1K3YA 4USSA 1T00A 4N0VA 3H4KA 1N9JA 1YHQ3 2LQOA 1M2BA 2H01A 3FR3A 2YFIB 4TR3A 3TUEA 5BXQA 3UMAA 5IMAA 4KDYA 1TW9A 1Z5YE 2PNCA 5CF2A 1EG9B 1VQL3 1N8R4 4STDA 4MMXB 1PY3A 2LJKA 4ILFA 3NV0B 5KP4A 2KF6A 4AKYA 4R9KA 1YEPA 3VWVA 5LCZA 3K63A 1BIRA 3MDKA 2QKEA 2FA4A 2W9QA 1G7EA 3S29A 3APSA 1SJWA 1BNGA 3SXXA 4N10A 4MZCA 2AV4A 2JSZA 5G30A 3GZXB 2B3SA 1N5PA 2HMLB 1LU4A 3J7Yb 1W6YA 1X5CA 2TRCP 1GOVA 3S5CA 3EE1A 4Z2TA 3RPNA 1F9MA 1BNFA 3D3LA 1ROAA 4EIQA 2KXGA 3L9VA 3ZZXA 2OJLA 2P0MA 4FMDA 1MD4A 1U3IA 3X3YA 4FCZA 5AIVA 5IPGA 4TR0A 2E7PA 3QPMA 2O87A 4HAAA 1TP6A 1FGTA 3OWSA 5AI1A 5IMVA 3GWRA 1DBYA 1FGMA 4GCIA 1B48A 3BNEA 1VF2A 1BUQA 4PNFA 1YZXA 2Z76A 1GSEA 1HNCA 2DJ2A 5KP1A 1QQ2A 1TU7A 4ULXA 4J9AA 4KH7A 1PU4A 3FF0A 4CDOA 1AR0A 3BB9A 4PXOA 4F9ZA 3M8CA 3TKRA 3BD2A 1CQSA 3LFLA 3QK9A 2BMRB 3CYNA 1PGTA 2YWMA 1KD14 1SK1A 3D9RA 3K8NA 4G9HA 4O8SA 2L5LA 3FYGA 5A4UA 3Q3FA 8RNTA 3EU4A 3KD0A 3TGZA 1BNJA 4EC0A 1T1VA 5EL8A 4MNNA 5G5EA 3BCIA 3FSDA 3FZ9A 2CK3H 1ASKA 4AF2A 3BBYA 1W4NA 1MDKA 4TVEA 6GSYA 2DJ3A 5KOXA 4EXJA 1IK3A 5ELJA 4AJ6A 4XIHA 1LOYA 3M9JA 1FHEA 3DEXA 2P05A 3TDGA 3J7Yk 2XPDA 1XOBA 6GSUA 4A5PA 18GSA 3F40A 5FW5A 4J2FA 2IFQB 3GZBA 1CYVA 4OO5A 2K6VA 4HDEA 5JWOB 2A15A 3CMIA 5GAPD 5L71A 4AJ7A 3G8ZA 1F3BA 3P2AA 1UCKA 5GSSA 7GSSA 1TU5A 1SIHA 4CJNA 2PZVA 1RLSA 2EC4A 4PTSA 2RCDA 1XFLA 2GSPA 4YKGA 4XM4A 4KSOA 3LZAA 4MZWA 3NV0A 3N9JA 3GSPA 1BG5A 3HVVA 3LYPA 1VQN3 2GQLA 2H6XA 2GU3A 5KN3A 3D5JA 1W2ZA 4EV2A 5IMFA 4V1Ag 1VQM3 2OE0A 1WTHA 3MYDA 5D73A 2YX9A 1XZOA 2Y73A 3V99A 3EN1B 4KE3A 1R26A 4LMVA 1W6GA 2RM6A 1R4WA 2C4JA 3U6VA 1V58A 1XW9A 2CT6A 2HRNA 3DXOA 5HR3A 4XB5A 1K41A 5JCWA 4JRRA 1G96A 4GWRA 5EVOA 3TRXA 3IPZA 4KCAA 1TRVA 1XW6A 2AAEA 1GLPA 4L0WA 1JV2B 4ZIJA 4MCUA 5F07A 1IQ8A 3TJKA 1X1WA 3DMLA 1RKYA 4KGIA 1VF4A 2YFJB 3LYGA 2CX0A 2B7JA 2QA1A 1TJDA 2R0CA 3FEUA 4RUVA 2DKIA 3HJPA 4IELA 3A2WA 1JBSA 4GTUA 1O85A 3NXJA 2LYXA 3CU3A 4L8PA 5F06A 1JB5A 2PMTA 1UVZA 1A2MA 2P31A 4TN8A 3CCM3 1KNGA 4BVYA 4KT3B 1A23A 1O6JA 1ISKA 3IE3A 1UDII 1FUWA 2HRFA 1ULIB 1Z1SA 3CBUA 3NM2A 1G6WA 1OHSA 5JPUA 6GSPA 4I2TA 1T3BA 4E8HA 1EQKA 1UUGB 1FZUA 5BVBA 4J56E 4MABA 4XCSA 1DE1A 1IYYA 5F0GA 3VLNA 1M1XB 3QRDA 2ZL8A 1C7HA 2L4CA 4XRDA 4EW5A 1EV9A 3LTCA 2PVQA 2BJXA 1V40A 4KB3A 1K9M4 5HR1A 1X9MB 2V41A 1MDIA 3US3A 1RCKA 3W8JA 1NNVA 2K0MA 5BU4A 1ZCPA 3TKSE 1TRQA 6RNTA 4I97A 1RRHA 4FMBA 1T4ZA 3HCZA 4L8EA 2YV7A 4ML1A 1ZL9A 4PNGA 1A2VA 3Q6OA 2WDUA 3SYUA 1LJRA 4IS0A 3FZ4A 2KF3A 2JZSA 3MWHA 4POBA 1RN1A 3K7CA 1NW2A 4WP5A 3MKIA 3X3XA 3HY2A 4AEQA 4G0KA 1TK0B 2CA8A 1AQZA 2VOCA 2VCTA 4I5QA 5KP3A 4LSOA 3AY8A 1GL8A 3NBBA 1Z9HA 3P7XA 4ZB6A 4Z2RA 2H0HA 4MH2A 3V1WA 2B5EA 4MEIA 1QXHA 4O92A 2EIQA 1XVQA 6GSSA 4K8MA 2AYTA 5DCHA 3KJYA 3CCV3 4ZB8A 1L5GB 1LXEA 1AV4A 1OACA 3IJEB 2JSYA 2R5GA 2WB9A 4IJIA 5ECHB 2O9UX 4H86A 3BU4A 3QD9A 2SBLA 3LWAA 3GFKA 3ZITA 1ULJB 3TCOA 3UBKA 2VM2A 1MNLA 1AQVA 3CQFA 4BL7A 3X42A 1X9WB 1UI8A 3NQZA 3KMOA 1B4PA 3KP9A 1DYUA 1GS3A 1ACVA 1XWCA 4XS1A 3VWWA 5B6MA 2CFLA 3CCS3 2CAQA 3F6FA 1C72A 3EE2A 3RGRA 2A4VA 2KAAA 3NQYA 1JN5B 3OR5A 4WF5A 1IT8A 2L4QA 3A76A 2H19A 3G4S3 2I3YA 3P90A 1W02A 2DIYA 5INYA 1VQ63 2FWGA 4G1MB 2V2GA 3A3TA 4TXOA 4R80A 3EJVA 1FYSA 4OD7A 3M1GA 1YJ6A 3D21A 4K7OA 2GTUA 2PBJA 4HJMA 2VCWA 5D96A 3EURA 4PURA 2DBCA 1RW1A 5HR2A 5AISA 2KUCA 4MPFA 3KM6A 1IU7A 1RGAA 4XHMA 2H73A 4YH2A 2GSQA 2KHPA 3KSPA 4HVNA 3WA3A 4FCJA 1AUCA 5D9WA 3KP8A 4WYKB 2IMIA 4I8BA 4K5SA 2F5WA 1YVBI 3FR9A 3AGNA 3ZIVA 1GSDA 2FUG2 1OVNA 4HM2B 5IMZA 2C4BA 3GZYB 2W56A 1XPVA 3CD63 5AEWB 1GY7A 1GTAA 2H70A 3WA2X 1CQGA 3MG2A 1YNVX 1WPIA 2HZEA 4WF4A 3IOSA 5DQYA 1WQLB 4X0XA 2GSRA 1ZOFA 4TW5A 4CW9A 1AQXA 3S67A 3C73A 3VF1A 4KX4A 4K2XA 2YWOA 3EB8A 3WDGB 3GV1A 4N11A 4WXTA 1JNQA 4G2EA 4R1KA 4IP6A 1DE2A 5EY6A 1PFOA 3EBTA 1LOXA 1HYFA 1M0UA 1MOLA 2ES7A 4RQXA 1HYUA 3APQA 5D82A 7STDA 2K8VA 1OHOA 5HGRA 1XWGA 4PX1A 3FK8A 3GTUA 3DGNA 2H75A 3FY7A 5DAKB 1N5HA 2D42A 2HYXA 2L59A 3OX9A 3F9SA 3D0ZA 3KSED 1PYLA 2GEXA 2DJ0A 2YZHA 1TRSA 2IMJA 3N8BA 2J23A 4ZB9A 5G31A 4K5RA 2YFLB 1UCLA 1M9GA 1ABAA 1GMRA 1CQHA 4Q5NA 2STDA 1TUHA 3MWZA 5G5FA 3UB1A 3PCRA 2DMLA 4CCVA 1EOHA 4KNDA 1J0FA 2MBTA 1WWJA 4DSQA 2IUJA 3QAGA 4EBGA 1BRSA 3FG4A 5STDA 1YVSA 2OE1A 1TI1A 4Q5QA 1QAKA 1MWSA 1GP1A 2HNLA 3RHBA 1TKDB 1B3SA 2Z9SA 3ER7A 2HE3A 1V9WA 1OYJA 1M9AA 2R0GA 3GL3A 4JU5A 4HUAA 4KZ1A 3UOMA 5H5QA 2VCZA 1W00A 2BMXA 2HZFA 3OWUA 1VF1A 3FKFA 1SKWB 1YJN3 2H1BA 3LORA 1BU4A 3CNXA 4CY6A 2CV4A 2H74A 4HM7B 1D6UA 3RDEA 3F7XA 1M1K4 4TR1B 2VL3A 4OK0A 1GD4A 2OADA 3LSZA 3K0ZA 4XRAA 3NZNA 4HM1B 2EIOA 5ECKB 1EWXA 2RSXA 2WOHA 2XGNA 3JUOA 2LJRA 4KFFA 2KRTA 1J08A 4J57E 1A90A 2TIRA 4O2HA 3WGEA 1U5OA 2D1WA 4PEJA 1UA5A 1O7WB 1JZDA 4MMZB 1FB0A 4L5OA 4GQCA 5JCUA 1WIKA 1H75A 2OCTA 4KUNA 3VURA 2YJHA 1WMOA 1FA3A 1R5AA 17GSA 3GNJA 3KTLA 3ZVJA 2W0QA 2VL2C 2R3XA 4MMYB 1HZ1A 1BAOA 3AGOA 4KFDA 2CVDA 4G10A 3DGYA 1AQWA 5AIFA 2C0DA 1IQXA 2OBIA 1I2EA 2V1MA 2C80A 3LT8A 1XBSA 1VQ83 3F9UA 3GURA 1JB4A 2R2JA 3DM8A 1ST9A 4IW9A 1Z7RA 2I1UA 1ZX2A 4XS4B 1TFKA 1Q98A 1MWUA 2YZUA 4O5UA 5DQSA 1LRAA 2HFDA 3L9UA 4HZ4A 1OC3A 1K0AA 1FUTA 2XHFA 2VL2A 4XBYA 3FGYA 1RGCA 1O7NB 3FR6A 4YAPA 3WGDA 2W2CA 2IFQA 1NWWA 1NDOB 4POLA 4BIKA 4N30A 1BNSA 2IWTA 4HM4B 1FGOA 1RRLA 2R41A 5DJLA 4IQ1A 2YN1A 3ZVJD 4TXVA 5EQLA 4V2NA 4K90B 2MMAA 3JVCA 1V74A 3DH2A 2HMOB 1SYRA 3F3QA 1BNEA 4X4JA 3GZRA 5H5SA 6GSXA 5IG5A 4L7KA 1FGRA 4G0IA 1N9EA 3JUPA 1KC84 3TOTA 1S723 4Z7XA 4IHUA 1JJ22 1USBA 2BMOB 2L4VA 2BNGA 3T8UA 2CVBA 4BPYA 4OFNA 1QFNA 4HJ2A 2QGVA 2RLIA 2R4IA 4JEDA 1T8EB 2GS3A 1SYXA 4IIAA 2E2MA 2PGTA 2KOKA 1Q4JA 1MDJA 1BAYA 2YNXA 4K0NA 3UBLA 1HKXA 1STDA 2LQQA 3MG1A 3TJGA 1YIJ3 1NB5I 3EINA 4HQSA 3DZLA 3C7MA 1PL2A 2B1LA 2CFDA 1XVWA 1SENA 7GSPA 1UUWB 1Q9EA 3ROBA 1UN2A 3KTBA 1TOFA 3QAVA 4TX4A 2HSYA 3IK7A 4F0CA 3KCMA 4TRXA 4JR6A 1O7MB 4K0GA 3ZFZA 4HZ9B 2XF3A 3F8HA 3WOFB 1EOGA 3ERGA 2A2PA 4MZBA 1BSAA 5J9BA 2RNTA 2MYGA 3VGNA 2XSHB 4AKZA 1EV4A 4F2IA 1N8JA 1FB6A 4ML6A 6GSTA 3ALAA 1KTEA 1MTCA 1TRWA 2VO4A 4HZBB 1RK4A 2OBKA 5A5KA 2H8LA 1B2MA 2CH9A 1X5DA 3CC73 1JLVA 5IERA 4KF9A 4NMUA 2IJYA 5HOHA 1FVKA 3HJMA 3VI5A 2HMNB 2CZ3A 3F3RA 2KP2A 1Q42A 1MEKA 3I69A 1TK8B 4H3UA 3FG1A 1G0TA 3NX0A 4XS6A 2V6OA 4ICYA 3EWLA 5D93A 5DBQA 3RGAA 1EKMA 3NOFA 2GXFA 1K8A4 2ON5A 3IR4A 1IV7A 4DKIA 2H1AA 2YWNA 3G7JA 3PYJA 3I43A 1IVXA 1NO3A 2CWUA 2E2VA 3UARA 2L6DA 1A0RP 2F98A 2K3DA 4ZBAA 2UX0A 4LMIA 1D6ZA 3NIVA 4YQMA 3CCJ3 2RUFA 4GSPA 1ZYPA 4NXIA 3GKMA 1U8CB 1VQ53 2FA8A 5KN1A 3E99A 3Q74A 3WYWA 1KWIA 1QVG2 3L78A 4JBBA 1SD8A 1FAAA 1G7OA 12GSA 2F3MA 3L4NA 3CCL3 1GSSA 2ZDJA 1Z3EA 4BWQA 5ID2B 3M3MA 5IO0A 4MDCA 5JPPA 3JUNA 4FIWA 2ZCTA 3LW9A 2PERA 3B8LA 1UGHI 5CRGA 4IPBA 1EZKA 1SJ6A 3JUMA 3IK9A 2OQEA 3CMA3 1BRIA 3F7SA 2C0FA 2PPTA 3FF2A 2A2RA 1K0MA 3TKSC 2OKAA 1ZYQB 5DAKA 4Z2UA 2DKHA 1GTBA 2KP1A 2Z77A 4N3VA 2K54A 1A2KA 1BJXA 1YI23 4X2HA 2Z7AA 2HRKA 3LXTA 4RI6A 1BNRA 4EV5A 5JBSA 1SL0B 5ECLB 3GMFA 4TR4A 2WGRA 2AJQB 1B21A 4NHFA 3Q2PA 2CFWA 3F0IA 2CZ2A 1W7CA 5AIHA 1JKGA 5IM9A 1IVUA 4O5RA 4G19A 1M904 1PA3A 1TIJA 2GT5A 2GSSA 2H71A 2C10A 2PVOC 2MC8A 3VK9A 2BIRA 3D6IA 4ZL9A 1PN9A 1GH2A 1SJZA 3ERWA 5AEUB 2G2QA 3Q18A 2P5RA 3BJ5A 1BSBA 2X64A 5AIXA 2HXKA 2C3NA 4QL7A 3TKPA 1Q824 5GSTA 2GZZA 4ZILA 1THOA 2SARA 1BGSA 3TKQA 4PGTA 1OGZA 1PX7A 1QVF2 4OUQA 1VQQA 2H6YA 5IG3A 1BX9A 10GSA 3KIIA 1WJKA 2P0XA 3VI7A 5IW9A 1A2LA 3GYKA 1Z6NA 2OTJ3 4HYZA 4KFEA 1M99A 3X41A 2M72A 5AN1A 8GSSA 1F37A 4HKVB 4BTWA 3LMLA 5D9XA 1FOVA 2WRTA 1O7PB 3G7IA 2KLXA 1I0XA 5JCGA 3C1RA 3LH4A 5DDLA 3A5EA 2N5BA 4QL9A 3SEDA 4F82A 4KDUA 4ORLA 5IG4A 5CK6A 5IOWA 2JZTA 4ZXGA 1EUIC 4N6TA 1W89A 4WKWA 2X8GA 3MPHA 2BTOT 2YPMA 2VCQA 2CIUA 3F8XA 1URMA 4MF7A 4MJEA 1PSQA 1E6BA 1PFPA 1RN4A 1A2PA 4KAEA 1XIYA 4OVMA 2IPAA 3HVNA 1AC1A 3EHCA 2C0EA 3D4TA 2F4YA 1XOAA 1I70A 3OV4A 1F8NA 3ZFLA 3LEFA 5G1LA 3FKAA 2XH9A 3DD3A 4EVMA 3U5RE 4N6UA 5B7CA 3TJBA 2ZA4A 4LA1A 3U97A 4CY8A 3UL3A 3H51A 1G6YA 2OE3A 3GX0A 4MPGA 5DALA 5GAND 2VD1A 3EN8A 4DEJA 1GSQA 1W5ZA 4K2DA 4H61A 19GSA 4ZBBA 3HYPA 2VLTA 1GUHA 5ECMB 4LL4B 1FOHA 1YEXA 1RN7A 4QWTA 4BU4A 1BSCA 1RGHA 2GGTA 2O8VB 1B8XA 3I563 1RQMA 2CC3A 2B1KA 2NTOA 3LGCA 4MP4A 1XCCA 2UUGC 2YOIA 3IV4A 1N8QA 2IYJA 3R3EA 3HOHA 4O3VA 2O3OA 3FH1A 4J5GA 1UC7A 2AAWA 4IJ3A 1ZO2A 5ECPB 3FZWA 3CSHA 3E0UA 1I9DA 2ZNMA 1G02A 1I2GA 4TKYA 2HRAA 4X43A 2KF5A 2P38A 4P3YB 1K28A 3DVXA 3D22A 1ERUA 2H76A 3HZ8A 4GLTA 5G1KA 3A2VA 3O3TA 2G0FA 1OF5A 1U88A 2VAFA 3FZAA 2WGOA 2E2TA 1X1XA 3LTDA 1IV9A 4BTYA 4HS1A 5CRHA 5AIGA 1RNBA 3GKNA 2B1XB 1GOUA 1T7PB 3L9SA 3MAKA 2C11A 2C3QA 1GSYA 1BQ7A 2YP6A 2CWTA 1T4YA 5ECOB 1WE0A 3EF8A 3NUVA 3LQ7A 6GSWA 4MJAA 4BL2A 4LYLB 1VQ73 1O7HB 5CREA 3TB2A 1VRSD 2FCHA 4NHZA 3M8NA 5E4WA 5IPHA 4O5QA 3SVAA 3HIGA 1BVIA 2XSOB 4L0UA 5J5NA 2GLRA 3CTFA 4EDZA 3KXOA 1JRQA 1BRJA 3HKRA 3F14A 3A5IA 1SK0A 1STFI 3CNMA 3CSJA 4O7HA 2E0QA 4DSRA 1VZZA 20GSA 4EUYA 1IT7A 4U13A 2O85A 4D73B 2F9SA 4YQUA 3EMXA 5DRVA 1Z6MA 3HDCA 1WP0A 5KOWA 4JRFA 2H66A 2Y74A 2O7KA 1GTIA 5IMDA 4GB5A 4EO3A 2AB6A 1VQ43 1SL1B 3PCSA 3O8YA 1Y25A 4V1Ap 4KW6A 3ISOA 4Q5FA 5A0OB 4BVXB 1YF0A 2V6KA 1KEBA 1RDSA 3N5OA 1YGWA 1PD21 4WFOA 1NJI4 2F51A 4PQ1A 4DVCA 3IAS2 4BA7A 2IMFA 1NM3A 1YGEA 2RBIA 5KN0A 1O81A 3EMPA 3Q90A 5JWQB 4ZM8A 3V92A 2WS2A 5ENUA 1MGWA 1C54A 4R4KA 3Q1CA 3GUSA 4N6OB 5KEJA 1VGLA 3A5WA 1A24A 1MD3A 4FH8A 5J3RA 3ZG5A 5CRWA 1W6CA 3LT9A 1JLWA 2CX1A 3RDWA 1JFUA 3M0FA 2VCVA 3CRTA 2RUEA 1HNBA 3QMXA 3LXUX 2HLSA 2XFSA 2B24B 5D9TA 2DC5A 5FT3A 4BVYB 1CH0A 3UNLA 5DVBA 1K0OA 1K0DA 1ZYEA 1RGKA 1EGOA 1DSBA 1O8XA 2RFRA 1X5EA 4OO4A 3TRQA 1GOYA 2E2GA 4CPKA 2YWIA 4PUAA 4EYCA 1GWCA 3I553 4IQAA 2VUPA 2W03A 1DMNA 3GAXA 1BNIA 2GU1A 2L57A 2LRCA 2WZ9A 2GSTA 4WHAA 1VQO3 1M2AA 2XBIA 5A4WA 1OUNA 2MF7A 5IEPA 3SX1A 3KFQC 1IVWA 3G7YA 1B4QA 5CYYA 2HMMB 4IN0A 1O73A 3PPUA 1SKSB 3ZIJA 1AXDA 3CCE3 3PH9A 1AIUA 1U6TA 3ME7A 2OOVC 3KKGA 2LJAA 2H6ZA 3W8SA 3R2QA 2K8SA 2KCDA 5JWRB 1IYHA 4KA0A 5ELGA 1OE8A 1GSUA 2FWFA 4PUFC 3CPOA 2DMMA 1TXXA 3ED3A 3HJOA 4POMA 3IC4A 5M19A 5DJMA 1RGEA 2Q07A 1GNWA 2UGIA 2GZYA 2CVKA 2ML6A 1DVDA 2DJ1A 2H0GA 3PS8A 2LV3A 3PGTA 4JE1A 3QFAC 2N5FA 2DJJA 3RAZA 1TP9A 5CLKA 3PINA 4NAXA 2FNQA 1GUMA 1RGFA 2OOVA 1FW1A 1PKZA 1YKCA 5GZZB 4DSSB 2MBSA 3TKSA 4XBTA 5A4VA 1M9BA 4YAVA
chains in the Genus database with same CATH topology
5FWGA 3ZLPA 4GF0A 2DIZA 1OAZA 2IY2A 3ZFBA 5C04A 2X8CA 3L0HA 2XPEA 2GT6A 1XWAA 2R37A 3H1NA 4RQRA 2FWHA 3KZQA 3DYRA 2ZUPA 4O32A 1XWKA 4KCEA 5B8BA 3F4RA 4ISDA 2R0PA 3KEBA 3FMWA 1S3AA 3VWUA 2K18A 2YJ7A 4OFMA 4XTSA 3ZREA 1O7UA 2QA2A 4HOJA 3QAWA 1GULA 2LKUA 1PQNA 4OCEA 1PRXA 3F63A 3IHGA 3APOA 2GQMA 1N2AA 3ZRDA 1EP8A 2L5OA 3F8UA 4WEYA 1FG4A 1SU9A 2YV9A 1NHOA 5KN2A 3Q19A 1ZGNA 2JZRA 3DKSA 4IKHA 1KBNA 5BMUA 3QDNA 4MF6A 2N5AA 4MJCA 1GUKA 3IHQA 3F4SA 3GA4A 1Y6EA 2X99A 4F0BA 4MH3A 3GH6A 4EL1A 1YF1A 2LNTA 2MMOA 3QOUA 5B8AA 1ERTA 2HT9A 4YKFA 1E2YA 2DSAA 1SJIA 5DCGA 3KH7A 1SKRB 3KIJA 3F6DA 1B9XC 1K3OA 5J41A 3TJFA 4X1UA 4K1FA 1I5GA 1R7HA 5CNWA 3UEMA 3IRAA 3H8QA 1ERVA 2R4VA 6GSVA 1QGVA 3HZ4A 4DSSA 4E8EA 1K0CA 5ECNB 3DXBA 1A8LA 1A8YA 2H72A 3E3EA 3GRXA 3DIEA 4NWYA 2XBQA 1EEJA 3LJRA 3DVWA 3G9BA 2NVLA 1W4VA 2VCXA 3SBCA 1ML6A 2I4AA 4TOPA 5HFGA 5BRTA 1EP7A 3E9JB 3VPTA 2H0IA 3LG6A 3FW2A 3ME8A 3VWXA 4FQUA 2FD3A 3DRNA 4NPBA 2C3TA 5ELAA 1FO5A 2HZEB 2VIMA 11GSA 1K0NA 2RM5A 5ECIB 4PQIA 5G2ZA 4WR5A 5D9VA 1O8WA 1F3AA 1NHYA 2M46A 2FNOA 2GZPA 3UVTA 5HR0A 4EE0A 2CQ9A 3LYKA 2YANA 2QC7A 3CXGA 2NDOA 4MA9A 3GTUB 2B5XA 4OWYA 22GSA 5E59A 2AHEA 3HVSA 2VLUA 3H93A 1FVJA 2X4AA 2FY6A 2P5QA 2I81A 4HQZA 4MK3A 4AGSA 4IBPA 3QCPA 4LL1B 3SWLA 3O6TA 5EPFA 3DGQA 4LLRA 3PR8A 1X9SB 2PWJA 5H5RA 3GSTA 5F8BA 5B6NA 4GSSA 5F05A 4G0LA 4NV5A 2MMZA 3WT1A 1TK5B 1EGRA 5LNKe 2M80A 4IGJA 1M7TA 2A2SA 1BYEA 5IIZA 3IDVA 2JL4A 14GSA 4I6XA 5COHA 4BVXA 4GXZA 2CAIA 3GL5A 1S3CA 5C00A 3RBTA 2LS5A 4KDXA 4V2MA 4BWSA 2PUKC 2H1DA 4ECCA 3D4MA 4HEA2 2GVPA 2RIIA 5CO3A 4HZ2A 1OKDA 2FGXA 2AUVA 1OC9A 4WETA 2IN3A 2NPBA 1V2AA 2DJKA 3FRCA 1QK8A 3GX8A 1M2DA 2GDRA 4OFTA 2C0GA 4MF5A 2L6CA 2FWEA 3KH9A 1LBKA 2PU9C 2VLVA 3WD6A 1JZWA 3QR6A 1QMVA 1NSWA 3HVXA 4FYUA 4AJ8A 1U87A 1WMJA 2IMDA 2LSTA 1GNEA 3ZTLA 1X0RA 3CRUA 3QFBC 4EIPA 1A0FA 2LUSA 4XS4A 1Z7PA 2D2ZA 4MJBA 2WJUA 2PN8A 4POKA 1PMTA 3MSZA 16GSA 4K7IA 1XWBA 1V98A 3GKXA 3FZ5A 3MIXA 5FHIA 4I2UA 2IIYA 4ECBA 3O76A 2DLXA 3GH9A 4GSNA 1ON4A 13GSA 2O89A 2X49A 4K6XA 4FYCA 2IMEA 3TOUA 5DALB 4ZL7A 2FLSA 1PN0A 2WFCA 4YQVA 4F03A 3S9FA 1WRYA 1OC9B 3A2XA 3GSSA 4FO5A 5ID2A 1H4OA 1ZZYA 2ALBA 3WGXA 2VM1A 1IYIA 3ZMLA 3UIWA 2LNSA 3C71A 4MMMA 1R5PA 3UVHA 1K0BA 2IL3A 5HQPA 2HSMA 5CAXA 3HA9A 2MMNA 3VPQA 2TRXA 4GRFA 4JZQA 1YQ1A 2VL9A 3GN3A 3P8WA 1PL1A 5LD0A 4N0ZA 4QQ7A 2J9HA 2A4HA 1YDKA 4NHWA 3EYTA 5J4UA 2JADA 1ERWA 3EU3A 2JACA 2K9FA 3HHVA 1BEDA 4WBRD 2R6KA 2C8UA 5AGYA 3KMNA 2LTKA 4OCFA 2V32A 1JHBA 2NBSA 4TXOB 2ON7A 4NV2A 2F8FA 4Q5RA 1SD9A 5J9CA 1GTUA 1TDIA 2JU5A 1SL2B 5D8IA 5CRDA 5IO2A 1DUGA 2GQKA 3IC8A 1OKTA 3FHKA 1PKWA 4D73A 1THXA 1GSFA 4RI7A 3DWVA 1U3AA 4GQFA 4IP1A 3WT2A 4WBJA 2CX3A 2LRNA 5HFKA 3BOAA 2XC2A 4BL7B 1V57A 4ZL8A 3C8EA 3IBHA 4ACSA 3W6GA 1K3LA 2I9HA 4LMWA 4ID0A 5IQYA 4L5LA 4HU9A 2P0GA 4ECIA 1EEMA 4EF0A 2EIRA 2B5YA 1QUWA 2H30A 3ZYWA 3MNGA 5CP1A 5ECQB 3H79A 2H1GA 3GKKA 1AW9A 1AAZA 2B6MA 5ECRB 3IA1A 3CTGA 1S3DA 1SK2A 1HNAA 4TR1A 5IMCA 3VFIA 5ABRA 4PQHA 1J9BA 5HFIA 1YY7A 4KSMA 4HI7A 4JR4A 3UJ1A 1ZYNA 1JZRA 3I6AA 3F4TA 3JCML 2HI7A 3EPTA 4EDYA 1TTZA 2UZ8A 3GHAA 3BCKA 4ECJA 1TRUA 2B7KA 1ILOA 3ERFA 3GIXA 3C1SA 3HD5A 3HXSA 3CSIA 3RPPA 2C1YA 2LRTA 1HQOA 4ZBDA 4V2LA 4WR4A 4EKZA 2IMKA 4K9ZA 3IAM2 1VF3A 1XW5A 3IXRA 1ZMAA 3TJJA 2OACA 1GRXA 3ZL5A 4GSTA 1TI3A 2CX4A 3ZMKA 3EVIA 5IOXA 9GSSA 3RHCA 4CHSA 1YKAA 3KGKA 2WCIA 3UAPA 2YCDA 1PX6A 1F2EA 1F6MC 1HD2A 2OA7A 1XXUA 2FHEA 5ECSA 2WULA 4FYBA 3TRPA 2X8HA 1A2JA 1B9YC 4MLYA 2REMA 1OC8A 1GLQA 3I9V2 3LXZA 4HU7A 1OE7A 2F8AA 2HSHA 2VD0A 2LEGA 3M9KA 1TU8A 2MZCA 4OMVA 1JZOA 1WOUA 2QSIA 4IVFA 4K7NA 3EC3A 1K3YA 4USSA 1T00A 4N0VA 3H4KA 2LQOA 1M2BA 2H01A 3FR3A 4TR3A 3TUEA 3UMAA 5IMAA 4KDYA 1TW9A 1Z5YE 2LJKA 4ILFA 1YEPA 3VWVA 5LCZA 3MDKA 2QKEA 2FA4A 1G7EA 3APSA 4N10A 4MZCA 2AV4A 2JSZA 5G30A 2B3SA 3J7Yb 1LU4A 1X5CA 2TRCP 4Z2TA 3RPNA 1F9MA 4EIQA 3L9VA 3ZZXA 2OJLA 1MD4A 1U3IA 5AIVA 5IPGA 4TR0A 2E7PA 3QPMA 2O87A 5IMVA 1DBYA 4GCIA 1B48A 1VF2A 4PNFA 1YZXA 1GSEA 1HNCA 2DJ2A 1QQ2A 1TU7A 4ULXA 4KH7A 4CDOA 4PXOA 4F9ZA 3TKRA 3BD2A 3LFLA 3CYNA 1PGTA 2YWMA 1SK1A 3K8NA 4G9HA 2L5LA 3FYGA 5A4UA 3TGZA 3EU4A 3KD0A 4EC0A 1T1VA 5EL8A 4MNNA 5G5EA 3BCIA 3FZ9A 4AF2A 3BBYA 1MDKA 4TVEA 6GSYA 2DJ3A 5KOXA 4EXJA 4AJ6A 4XIHA 3M9JA 1FHEA 3DEXA 3TDGA 3J7Yk 2XPDA 1XOBA 6GSUA 4A5PA 18GSA 4J2FA 2IFQB 4OO5A 2K6VA 4HDEA 5JWOB 3CMIA 5GAPD 5L71A 4AJ7A 1F3BA 3P2AA 5GSSA 7GSSA 2EC4A 4PTSA 1XFLA 4YKGA 4KSOA 4MZWA 3N9JA 1BG5A 3HVVA 3LYPA 2GQLA 2H6XA 5KN3A 3D5JA 5IMFA 4V1Ag 2OE0A 5D73A 3MYDA 1XZOA 4KE3A 1R26A 4LMVA 3U6VA 2RM6A 1R4WA 2C4JA 1V58A 1XW9A 2CT6A 2HRNA 5HR3A 5JCWA 4JRRA 4GWRA 5EVOA 3TRXA 3IPZA 4KCAA 1TRVA 1XW6A 1GLPA 4L0WA 4ZIJA 4MCUA 5F07A 3TJKA 3DMLA 4KGIA 1VF4A 2B7JA 2QA1A 1TJDA 2R0CA 3FEUA 4RUVA 2DKIA 3HJPA 4IELA 3A2WA 4GTUA 1O85A 5F06A 2PMTA 1UVZA 1A2MA 2P31A 4TN8A 4BVYA 1KNGA 1A23A 1O6JA 3IE3A 2HRFA 3CBUA 1G6WA 4I2TA 1T3BA 4E8HA 4XCSA 4J56E 4MABA 1DE1A 5F0GA 3VLNA 2L4CA 4XRDA 1EV9A 2PVQA 2BJXA 1V40A 4KB3A 5HR1A 1X9MB 2V41A 1MDIA 3US3A 3W8JA 1ZCPA 3TKSE 4I97A 1T4ZA 3HCZA 4L8EA 2YV7A 4ML1A 1ZL9A 4PNGA 3Q6OA 2WDUA 1LJRA 4IS0A 3FZ4A 2JZSA 3MWHA 4POBA 1NW2A 3HY2A 4G0KA 1TK0B 2CA8A 2VOCA 2VCTA 4I5QA 3AY8A 1GL8A 1Z9HA 3P7XA 4ZB6A 4Z2RA 2H0HA 4MH2A 3V1WA 2B5EA 1QXHA 4O92A 2EIQA 1XVQA 6GSSA 4K8MA 2AYTA 5DCHA 3KJYA 4ZB8A 5ECHB 2JSYA 2R5GA 2WB9A 4IJIA 4H86A 3QD9A 3LWAA 3GFKA 3ZITA 3TCOA 3UBKA 2VM2A 1AQVA 4BL7A 1X9WB 3KMOA 1B4PA 3KP9A 1ACVA 1XWCA 4XS1A 3VWWA 5B6MA 2CAQA 3F6FA 1C72A 3EE2A 2A4VA 3OR5A 4WF5A 2L4QA 2H19A 2I3YA 5INYA 3P90A 2DIYA 2FWGA 2V2GA 4TXOA 3A3TA 4OD7A 3M1GA 1YJ6A 3D21A 4K7OA 2GTUA 2PBJA 4HJMA 2VCWA 5D96A 3EURA 4PURA 2DBCA 1RW1A 5HR2A 5AISA 2KUCA 4MPFA 3KM6A 4XHMA 2H73A 4YH2A 2GSQA 2KHPA 5D9WA 1AUCA 3KP8A 2IMIA 4I8BA 4K5SA 3FR9A 3ZIVA 1GSDA 2FUG2 1OVNA 5IMZA 1XPVA 1GTAA 2H70A 1CQGA 1WPIA 2HZEA 4WF4A 3IOSA 5DQYA 4X0XA 2GSRA 1ZOFA 4TW5A 4CW9A 1AQXA 3C73A 4KX4A 4K2XA 2YWOA 3GV1A 4N11A 4WXTA 4G2EA 4IP6A 1DE2A 5EY6A 1M0UA 2ES7A 4RQXA 1HYUA 3APQA 2K8VA 1XWGA 4PX1A 3FK8A 3GTUA 2H75A 3FY7A 5DAKB 2HYXA 2L59A 3D0ZA 2YZHA 2DJ0A 1TRSA 2J23A 4ZB9A 5G31A 4K5RA 1ABAA 1CQHA 4Q5NA 5G5FA 2DMLA 4KNDA 1EOHA 1J0FA 2MBTA 1WWJA 4DSQA 3QAGA 2OE1A 1TI1A 4Q5QA 1GP1A 2HNLA 3RHBA 1TKDB 2Z9SA 2HE3A 1V9WA 1OYJA 1M9AA 2R0GA 3GL3A 4JU5A 4HUAA 3UOMA 5H5QA 2VCZA 2BMXA 2HZFA 1VF1A 3FKFA 1SKWB 2H1BA 3LORA 4CY6A 2CV4A 2H74A 4TR1B 2VL3A 2OADA 3LSZA 4XRAA 3NZNA 2EIOA 5ECKB 1EWXA 2LJRA 1J08A 4J57E 2TIRA 3WGEA 1UA5A 1JZDA 1FB0A 4L5OA 4GQCA 5JCUA 1WIKA 1H75A 4KUNA 3VURA 2YJHA 1R5AA 17GSA 3GNJA 3KTLA 3ZVJA 2VL2C 2R3XA 2CVDA 4G10A 1AQWA 2C0DA 2OBIA 2V1MA 2C80A 1XBSA 3F9UA 3GURA 2R2JA 1ST9A 4IW9A 1Z7RA 2I1UA 4XS4B 1Q98A 2YZUA 4O5UA 5DQSA 2HFDA 3L9UA 4HZ4A 1OC3A 1K0AA 2XHFA 2VL2A 3FR6A 4YAPA 3WGDA 2IFQA 4POLA 4N30A 2IWTA 5DJLA 4IQ1A 2YN1A 3ZVJD 4TXVA 4V2NA 2MMAA 1SYRA 3F3QA 5H5SA 4X4JA 6GSXA 4G0IA 3TOTA 4Z7XA 4IHUA 1USBA 2CVBA 4BPYA 4OFNA 1QFNA 4HJ2A 2QGVA 2RLIA 4JEDA 1T8EB 2GS3A 1SYXA 2E2MA 2PGTA 2KOKA 1Q4JA 1MDJA 1BAYA 2YNXA 4K0NA 3UBLA 2LQQA 3TJGA 3EINA 4HQSA 3C7MA 1PL2A 2B1LA 1XVWA 1SENA 1UN2A 3KTBA 1TOFA 3QAVA 2HSYA 3IK7A 4F0CA 3KCMA 4TRXA 4JR6A 4K0GA 1EOGA 3ERGA 2A2PA 4MZBA 5J9BA 2MYGA 1EV4A 4F2IA 1N8JA 1FB6A 4ML6A 6GSTA 1KTEA 1MTCA 1TRWA 2VO4A 2OBKA 1RK4A 5A5KA 2H8LA 1X5DA 1JLVA 4KF9A 4NMUA 2IJYA 1FVKA 3HJMA 3VI5A 2CZ3A 3F3RA 2KP2A 1MEKA 3I69A 1TK8B 1G0TA 4XS6A 2V6OA 4ICYA 3EWLA 5D93A 5DBQA 3NOFA 3IR4A 2ON5A 2H1AA 2YWNA 3G7JA 3I43A 3UARA 2L6DA 1A0RP 4ZBAA 3NIVA 4YQMA 2RUFA 1ZYPA 4NXIA 3GKMA 2FA8A 5KN1A 3Q74A 3WYWA 3L78A 4JBBA 1SD8A 1FAAA 1G7OA 12GSA 2F3MA 3L4NA 1GSSA 1Z3EA 4BWQA 5ID2B 3M3MA 5IO0A 4MDCA 4FIWA 2ZCTA 3LW9A 2PERA 5CRGA 1EZKA 1SJ6A 3IK9A 2C0FA 2PPTA 2A2RA 1K0MA 3TKSC 2OKAA 1ZYQB 5DAKA 4Z2UA 2DKHA 1GTBA 2KP1A 1BJXA 2HRKA 3LXTA 4RI6A 1SL0B 5ECLB 3GMFA 4TR4A 2WGRA 2AJQB 3F0IA 2CZ2A 5IM9A 4O5RA 4G19A 1PA3A 2GT5A 2GSSA 2H71A 2PVOC 3VK9A 3D6IA 4ZL9A 1PN9A 1GH2A 1SJZA 3ERWA 2G2QA 3Q18A 2P5RA 3BJ5A 2X64A 5AIXA 2HXKA 2C3NA 4QL7A 3TKPA 5GSTA 2GZZA 4ZILA 1THOA 3TKQA 4PGTA 1PX7A 2H6YA 1BX9A 10GSA 1WJKA 3VI7A 1A2LA 3GYKA 1Z6NA 1M99A 2M72A 5AN1A 8GSSA 1F37A 5D9XA 1FOVA 2WRTA 3G7IA 2KLXA 5JCGA 3C1RA 5DDLA 2N5BA 4QL9A 4F82A 4KDUA 5IOWA 2JZTA 4ZXGA 1W89A 4WKWA 2X8GA 2BTOT 2YPMA 2VCQA 1URMA 4MJEA 4MF7A 1PSQA 1E6BA 4KAEA 1XIYA 2IPAA 1AC1A 2C0EA 3D4TA 1XOAA 3ZFLA 3LEFA 5G1LA 3DD3A 4EVMA 3U5RE 5B7CA 3TJBA 4LA1A 4CY8A 3UL3A 1G6YA 2OE3A 3GX0A 4MPGA 5DALA 5GAND 2VD1A 4DEJA 1GSQA 4K2DA 19GSA 4ZBBA 3HYPA 2VLTA 1GUHA 5ECMB 4LL4B 1FOHA 1YEXA 2O8VB 2GGTA 1B8XA 1RQMA 2B1KA 2NTOA 3LGCA 4MP4A 1XCCA 2YOIA 3IV4A 2IYJA 3R3EA 1UC7A 2AAWA 4IJ3A 5ECPB 3E0UA 3CSHA 1I9DA 2ZNMA 4TKYA 2HRAA 4X43A 4P3YB 3DVXA 3D22A 1ERUA 2H76A 3HZ8A 4GLTA 5G1KA 3A2VA 3O3TA 2G0FA 1U88A 2VAFA 3FZAA 4HS1A 5CRHA 3GKNA 1T7PB 3L9SA 3MAKA 2C3QA 1GSYA 1BQ7A 2YP6A 1T4YA 5ECOB 1WE0A 3LQ7A 6GSWA 4MJAA 5CREA 3TB2A 1VRSD 2FCHA 4NHZA 3M8NA 5E4WA 5IPHA 4O5QA 4L0UA 5J5NA 2GLRA 3CTFA 4EDZA 3KXOA 3HKRA 3A5IA 1SK0A 3CSJA 4O7HA 4DSRA 2E0QA 20GSA 4EUYA 2O85A 4D73B 2F9SA 4YQUA 3EMXA 1Z6MA 3HDCA 1WP0A 5KOWA 2H66A 2O7KA 1GTIA 5IMDA 4EO3A 2AB6A 1SL1B 1Y25A 4V1Ap 4KW6A 3ISOA 4Q5FA 4BVXB 1YF0A 2V6KA 1KEBA 3N5OA 1PD21 2F51A 4PQ1A 4DVCA 3IAS2 4BA7A 2IMFA 1NM3A 5KN0A 1O81A 3EMPA 5JWQB 5ENUA 2WS2A 3GUSA 5KEJA 1VGLA 3A5WA 1A24A 1MD3A 4FH8A 5J3RA 5CRWA 1JLWA 3RDWA 1JFUA 3M0FA 2VCVA 3CRTA 2RUEA 1HNBA 3QMXA 2HLSA 5D9TA 2DC5A 5FT3A 4BVYB 5DVBA 1K0OA 1K0DA 1ZYEA 1EGOA 1DSBA 1O8XA 1X5EA 4OO4A 3TRQA 2E2GA 2YWIA 4PUAA 1GWCA 4IQAA 2VUPA 2L57A 2LRCA 2WZ9A 2GSTA 1M2AA 2XBIA 5A4WA 3G7YA 1B4QA 5CYYA 4IN0A 1O73A 3PPUA 1SKSB 3ZIJA 1AXDA 3PH9A 1AIUA 1U6TA 3ME7A 2LJAA 2H6ZA 3W8SA 3R2QA 2K8SA 5JWRB 1IYHA 4KA0A 5ELGA 1OE8A 1GSUA 2FWFA 4PUFC 2DMMA 1TXXA 3ED3A 3HJOA 4POMA 3IC4A 5DJMA 1GNWA 2GZYA 2CVKA 2DJ1A 2H0GA 2LV3A 3PGTA 4JE1A 3QFAC 2N5FA 2DJJA 3RAZA 1TP9A 3PINA 4NAXA 1GUMA 1FW1A 1PKZA 1YKCA 5GZZB 4DSSB 2MBSA 3TKSA 5A4VA 1M9BA 4YAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWG A;  3ZLP A;  4GF0 A;  2DIZ A;  1OAZ A;  2IY2 A;  3ZFB A;  5C04 A;  2X8C A;  3L0H A;  2XPE A;  2GT6 A;  1XWA A;  2R37 A;  3H1N A;  4RQR A;  2FWH A;  3KZQ A;  3DYR A;  2ZUP A;  4O32 A;  1XWK A;  4KCE A;  5B8B A;  3F4R A;  4ISD A;  3KEB A;  1S3A A;  3VWU A;  2K18 A;  2YJ7 A;  4OFM A;  4XTS A;  3ZRE A;  1O7U A;  4HOJ A;  3QAW A;  1GUL A;  2LKU A;  1PQN A;  4OCE A;  1PRX A;  3F63 A;  3APO A;  2GQM A;  1N2A A;  3ZRD A;  1EP8 A;  2L5O A;  3F8U A;  4WEY A;  1FG4 A;  1SU9 A;  2YV9 A;  1NHO A;  5KN2 A;  3Q19 A;  1ZGN A;  2JZR A;  3DKS A;  4IKH A;  1KBN A;  3QDN A;  4MF6 A;  2N5A A;  4MJC A;  1GUK A;  3IHQ A;  3F4S A;  3GA4 A;  1Y6E A;  2X99 A;  4F0B A;  4MH3 A;  3GH6 A;  4EL1 A;  1YF1 A;  2LNT A;  2MMO A;  3QOU A;  5B8A A;  1ERT A;  2HT9 A;  1E2Y A;  2DSA A;  1SJI A;  5DCG A;  3KH7 A;  1SKR B;  3KIJ A;  3F6D A;  1B9X C;  1K3O A;  5J41 A;  3TJF A;  4X1U A;  4K1F A;  1I5G A;  1R7H A;  5CNW A;  3UEM A;  3IRA A;  3H8Q A;  1ERV A;  2R4V A;  6GSV A;  1QGV A;  3HZ4 A;  4DSS A;  4E8E A;  1K0C A;  5ECN B;  3DXB A;  1A8L A;  1A8Y A;  2H72 A;  3E3E A;  3GRX A;  3DIE A;  4NWY A;  2XBQ A;  1EEJ A;  3LJR A;  3DVW A;  3G9B A;  2NVL A;  1W4V A;  2VCX A;  3SBC A;  1ML6 A;  2I4A A;  4TOP A;  5HFG A;  1EP7 A;  3E9J B;  3VPT A;  2H0I A;  3LG6 A;  3FW2 A;  3ME8 A;  3VWX A;  2FD3 A;  3DRN A;  4NPB A;  2C3T A;  5ELA A;  1FO5 A;  2HZE B;  2VIM A;  11GS A;  1K0N A;  2RM5 A;  5ECI B;  4PQI A;  5G2Z A;  4WR5 A;  5D9V A;  1O8W A;  1F3A A;  1NHY A;  2M46 A;  2FNO A;  2GZP A;  3UVT A;  5HR0 A;  4EE0 A;  2CQ9 A;  3LYK A;  2YAN A;  2QC7 A;  3CXG A;  2NDO A;  4MA9 A;  3GTU B;  2B5X A;  4OWY A;  22GS A;  5E59 A;  2AHE A;  3HVS A;  2VLU A;  3H93 A;  1FVJ A;  2FY6 A;  2P5Q A;  2I81 A;  4HQZ A;  4MK3 A;  4AGS A;  4IBP A;  3QCP A;  4LL1 B;  3SWL A;  3O6T A;  5EPF A;  3DGQ A;  4LLR A;  3PR8 A;  1X9S B;  2PWJ A;  5H5R A;  3GST A;  5F8B A;  5B6N A;  4GSS A;  5F05 A;  4NV5 A;  2MMZ A;  3WT1 A;  1TK5 B;  1EGR A;  5LNK e;  2M80 A;  4IGJ A;  1M7T A;  2A2S A;  1BYE A;  5IIZ A;  3IDV A;  2JL4 A;  14GS A;  4I6X A;  5COH A;  4BVX A;  4GXZ A;  2CAI A;  3GL5 A;  1S3C A;  5C00 A;  3RBT A;  2LS5 A;  4KDX A;  4V2M A;  4BWS A;  2PUK C;  2H1D A;  4ECC A;  3D4M A;  4HEA 2;  2GVP A;  2RII A;  5CO3 A;  4HZ2 A;  1OKD A;  2FGX A;  2AUV A;  1OC9 A;  4WET A;  2IN3 A;  2NPB A;  1V2A A;  2DJK A;  3FRC A;  1QK8 A;  3GX8 A;  1M2D A;  2GDR A;  4OFT A;  2C0G A;  4MF5 A;  2L6C A;  2FWE A;  3KH9 A;  1LBK A;  2PU9 C;  2VLV A;  3WD6 A;  1JZW A;  3QR6 A;  1QMV A;  1NSW A;  3HVX A;  4FYU A;  4AJ8 A;  1U87 A;  1WMJ A;  2IMD A;  2LST A;  1GNE A;  3ZTL A;  1X0R A;  3CRU A;  3QFB C;  1A0F A;  2LUS A;  4XS4 A;  1Z7P A;  2D2Z A;  4MJB A;  2WJU A;  2PN8 A;  4POK A;  1PMT A;  3MSZ A;  16GS A;  4K7I A;  1XWB A;  1V98 A;  3GKX A;  3FZ5 A;  5FHI A;  4I2U A;  2IIY A;  4ECB A;  3O76 A;  2DLX A;  3GH9 A;  4GSN A;  1ON4 A;  13GS A;  2O89 A;  4K6X A;  4FYC A;  2IME A;  3TOU A;  5DAL B;  4ZL7 A;  2FLS A;  2WFC A;  4YQV A;  4F03 A;  3S9F A;  1WRY A;  1OC9 B;  3A2X A;  3GSS A;  4FO5 A;  5ID2 A;  1H4O A;  1ZZY A;  2ALB A;  3WGX A;  2VM1 A;  1IYI A;  3ZML A;  3UIW A;  2LNS A;  3C71 A;  4MMM A;  1R5P A;  3UVH A;  1K0B A;  2IL3 A;  5HQP A;  5CAX A;  3HA9 A;  2MMN A;  3VPQ A;  2TRX A;  4GRF A;  4JZQ A;  1YQ1 A;  2VL9 A;  3GN3 A;  3P8W A;  1PL1 A;  5LD0 A;  4N0Z A;  4QQ7 A;  2J9H A;  1YDK A;  4NHW A;  3EYT A;  5J4U A;  2JAD A;  1ERW A;  3EU3 A;  2JAC A;  2K9F A;  3HHV A;  1BED A;  4WBR D;  2R6K A;  2C8U A;  5AGY A;  3KMN A;  2LTK A;  4OCF A;  2V32 A;  1JHB A;  2NBS A;  4TXO B;  2ON7 A;  4NV2 A;  2F8F A;  4Q5R A;  1SD9 A;  5J9C A;  1GTU A;  1TDI A;  2JU5 A;  1SL2 B;  5D8I A;  5CRD A;  5IO2 A;  1DUG A;  2GQK A;  1OKT A;  3FHK A;  1PKW A;  4D73 A;  1THX A;  1GSF A;  4RI7 A;  3DWV A;  1U3A A;  4GQF A;  4IP1 A;  3WT2 A;  4WBJ A;  2CX3 A;  2LRN A;  5HFK A;  3BOA A;  2XC2 A;  1V57 A;  4ZL8 A;  3C8E A;  3IBH A;  4ACS A;  3W6G A;  1K3L A;  2I9H A;  4LMW A;  4ID0 A;  5IQY A;  4L5L A;  4HU9 A;  2P0G A;  4ECI A;  1EEM A;  4EF0 A;  2EIR A;  2B5Y A;  1QUW A;  2H30 A;  3ZYW A;  3MNG A;  5CP1 A;  5ECQ B;  3H79 A;  2H1G A;  3GKK A;  1AW9 A;  1AAZ A;  2B6M A;  5ECR B;  3IA1 A;  3CTG A;  1S3D A;  1SK2 A;  1HNA A;  4TR1 A;  5IMC A;  3VFI A;  5ABR A;  4PQH A;  1J9B A;  5HFI A;  1YY7 A;  4KSM A;  4HI7 A;  4JR4 A;  3UJ1 A;  1JZR A;  3I6A A;  3F4T A;  3JCM L;  2HI7 A;  4EDY A;  1TTZ A;  3GHA A;  3BCK A;  4ECJ A;  1TRU A;  2B7K A;  1ILO A;  3ERF A;  3GIX A;  3C1S A;  3HD5 A;  3HXS A;  3CSI A;  3RPP A;  2C1Y A;  2LRT A;  1HQO A;  4ZBD A;  4V2L A;  4WR4 A;  4EKZ A;  2IMK A;  4K9Z A;  3IAM 2;  1VF3 A;  1XW5 A;  3IXR A;  1ZMA A;  3TJJ A;  2OAC A;  1GRX A;  3ZL5 A;  4GST A;  1TI3 A;  2CX4 A;  3ZMK A;  3EVI A;  5IOX A;  9GSS A;  3RHC A;  4CHS A;  1YKA A;  3KGK A;  2WCI A;  3UAP A;  2YCD A;  1PX6 A;  1F2E A;  1F6M C;  1HD2 A;  2OA7 A;  1XXU A;  2FHE A;  5ECS A;  2WUL A;  4FYB A;  3TRP A;  2X8H A;  1A2J A;  1B9Y C;  4MLY A;  2REM A;  1OC8 A;  1GLQ A;  3I9V 2;  3LXZ A;  4HU7 A;  1OE7 A;  2F8A A;  2HSH A;  2VD0 A;  2LEG A;  3M9K A;  1TU8 A;  2MZC A;  4OMV A;  1JZO A;  1WOU A;  2QSI A;  4IVF A;  4K7N A;  3EC3 A;  1K3Y A;  1T00 A;  4N0V A;  3H4K A;  2LQO A;  1M2B A;  2H01 A;  3FR3 A;  4TR3 A;  3TUE A;  3UMA A;  5IMA A;  4KDY A;  1TW9 A;  1Z5Y E;  2LJK A;  4ILF A;  1YEP A;  3VWV A;  5LCZ A;  3MDK A;  2QKE A;  2FA4 A;  1G7E A;  3APS A;  4N10 A;  4MZC A;  2AV4 A;  2JSZ A;  5G30 A;  2B3S A;  3J7Y b;  1LU4 A;  1X5C A;  2TRC P;  3RPN A;  1F9M A;  3L9V A;  3ZZX A;  2OJL A;  1MD4 A;  1U3I A;  5AIV A;  5IPG A;  4TR0 A;  2E7P A;  3QPM A;  2O87 A;  5IMV A;  1DBY A;  4GCI A;  1B48 A;  1VF2 A;  4PNF A;  1YZX A;  1GSE A;  1HNC A;  2DJ2 A;  1QQ2 A;  1TU7 A;  4ULX A;  4KH7 A;  4CDO A;  4PXO A;  4F9Z A;  3TKR A;  3BD2 A;  3LFL A;  3CYN A;  1PGT A;  2YWM A;  1SK1 A;  3K8N A;  4G9H A;  2L5L A;  3FYG A;  5A4U A;  3TGZ A;  3EU4 A;  3KD0 A;  4EC0 A;  1T1V A;  5EL8 A;  5G5E A;  3BCI A;  3FZ9 A;  4AF2 A;  3BBY A;  1MDK A;  4TVE A;  6GSY A;  2DJ3 A;  4EXJ A;  4AJ6 A;  4XIH A;  3M9J A;  1FHE A;  3DEX A;  3TDG A;  3J7Y k;  2XPD A;  1XOB A;  6GSU A;  18GS A;  4J2F A;  2IFQ B;  4OO5 A;  2K6V A;  4HDE A;  5JWO B;  3CMI A;  5GAP D;  5L71 A;  4AJ7 A;  1F3B A;  3P2A A;  5GSS A;  7GSS A;  2EC4 A;  1XFL A;  4KSO A;  4MZW A;  3N9J A;  1BG5 A;  3HVV A;  3LYP A;  2GQL A;  2H6X A;  5KN3 A;  3D5J A;  5IMF A;  4V1A g;  2OE0 A;  5D73 A;  1XZO A;  4KE3 A;  1R26 A;  4LMV A;  3U6V A;  2RM6 A;  1R4W A;  2C4J A;  1V58 A;  1XW9 A;  2CT6 A;  2HRN A;  5HR3 A;  5JCW A;  4JRR A;  4GWR A;  5EVO A;  3TRX A;  3IPZ A;  4KCA A;  1TRV A;  1XW6 A;  1GLP A;  4L0W A;  4ZIJ A;  4MCU A;  5F07 A;  3TJK A;  3DML A;  4KGI A;  1VF4 A;  2B7J A;  1TJD A;  3FEU A;  4RUV A;  3HJP A;  4IEL A;  3A2W A;  4GTU A;  1O85 A;  5F06 A;  2PMT A;  1UVZ A;  1A2M A;  2P31 A;  4TN8 A;  4BVY A;  1KNG A;  1A23 A;  1O6J A;  3IE3 A;  2HRF A;  3CBU A;  1G6W A;  4I2T A;  1T3B A;  4E8H A;  4XCS A;  4J56 E;  4MAB A;  1DE1 A;  5F0G A;  3VLN A;  2L4C A;  4XRD A;  1EV9 A;  2PVQ A;  2BJX A;  1V40 A;  4KB3 A;  5HR1 A;  1X9M B;  2V41 A;  1MDI A;  3US3 A;  3W8J A;  1ZCP A;  3TKS E;  4I97 A;  1T4Z A;  3HCZ A;  4L8E A;  2YV7 A;  4ML1 A;  1ZL9 A;  4PNG A;  3Q6O A;  2WDU A;  1LJR A;  4IS0 A;  3FZ4 A;  2JZS A;  3MWH A;  4POB A;  1NW2 A;  3HY2 A;  1TK0 B;  2CA8 A;  2VOC A;  2VCT A;  4I5Q A;  3AY8 A;  1GL8 A;  1Z9H A;  3P7X A;  4ZB6 A;  2H0H A;  4MH2 A;  3V1W A;  2B5E A;  1QXH A;  4O92 A;  2EIQ A;  1XVQ A;  6GSS A;  4K8M A;  2AYT A;  5DCH A;  3KJY A;  4ZB8 A;  5ECH B;  2JSY A;  2R5G A;  2WB9 A;  4IJI A;  4H86 A;  3QD9 A;  3LWA A;  3GFK A;  3ZIT A;  3TCO A;  3UBK A;  2VM2 A;  1AQV A;  4BL7 A;  1X9W B;  3KMO A;  1B4P A;  3KP9 A;  1ACV A;  1XWC A;  4XS1 A;  3VWW A;  5B6M A;  2CAQ A;  3F6F A;  1C72 A;  3EE2 A;  2A4V A;  3OR5 A;  4WF5 A;  2L4Q A;  2H19 A;  2I3Y A;  5INY A;  3P90 A;  2DIY A;  2FWG A;  2V2G A;  4TXO A;  3A3T A;  4OD7 A;  3M1G A;  1YJ6 A;  3D21 A;  4K7O A;  2GTU A;  2PBJ A;  4HJM A;  2VCW A;  5D96 A;  3EUR A;  4PUR A;  2DBC A;  1RW1 A;  5HR2 A;  5AIS A;  2KUC A;  4MPF A;  3KM6 A;  4XHM A;  2H73 A;  4YH2 A;  2GSQ A;  2KHP A;  5D9W A;  1AUC A;  3KP8 A;  2IMI A;  4I8B A;  3FR9 A;  3ZIV A;  1GSD A;  2FUG 2;  1OVN A;  5IMZ A;  1XPV A;  1GTA A;  2H70 A;  1CQG A;  1WPI A;  2HZE A;  4WF4 A;  3IOS A;  5DQY A;  4X0X A;  2GSR A;  1ZOF A;  4TW5 A;  4CW9 A;  1AQX A;  3C73 A;  4KX4 A;  2YWO A;  3GV1 A;  4N11 A;  4WXT A;  4G2E A;  4IP6 A;  1DE2 A;  5EY6 A;  1M0U A;  2ES7 A;  4RQX A;  1HYU A;  3APQ A;  2K8V A;  1XWG A;  4PX1 A;  3FK8 A;  3GTU A;  2H75 A;  3FY7 A;  5DAK B;  2HYX A;  2L59 A;  3D0Z A;  2YZH A;  2DJ0 A;  1TRS A;  2J23 A;  4ZB9 A;  5G31 A;  1ABA A;  1CQH A;  4Q5N A;  5G5F A;  2DML A;  4KND A;  1EOH A;  1J0F A;  2MBT A;  1WWJ A;  4DSQ A;  3QAG A;  2OE1 A;  1TI1 A;  4Q5Q A;  1GP1 A;  2HNL A;  3RHB A;  1TKD B;  2Z9S A;  2HE3 A;  1V9W A;  1OYJ A;  1M9A A;  3GL3 A;  4JU5 A;  4HUA A;  3UOM A;  5H5Q A;  2VCZ A;  2BMX A;  2HZF A;  1VF1 A;  3FKF A;  1SKW B;  2H1B A;  3LOR A;  2CV4 A;  2H74 A;  4TR1 B;  2VL3 A;  2OAD A;  3LSZ A;  4XRA A;  3NZN A;  2EIO A;  5ECK B;  1EWX A;  2LJR A;  1J08 A;  4J57 E;  2TIR A;  3WGE A;  1UA5 A;  1JZD A;  1FB0 A;  4L5O A;  4GQC A;  5JCU A;  1WIK A;  1H75 A;  4KUN A;  3VUR A;  2YJH A;  1R5A A;  17GS A;  3GNJ A;  3KTL A;  3ZVJ A;  2VL2 C;  2R3X A;  2CVD A;  4G10 A;  1AQW A;  2C0D A;  2OBI A;  2V1M A;  2C80 A;  1XBS A;  3F9U A;  3GUR A;  2R2J A;  1ST9 A;  4IW9 A;  1Z7R A;  2I1U A;  4XS4 B;  1Q98 A;  2YZU A;  5DQS A;  2HFD A;  3L9U A;  4HZ4 A;  1OC3 A;  1K0A A;  2XHF A;  2VL2 A;  3FR6 A;  4YAP A;  3WGD A;  2IFQ A;  4POL A;  4N30 A;  2IWT A;  5DJL A;  4IQ1 A;  2YN1 A;  3ZVJ D;  4TXV A;  4V2N A;  2MMA A;  1SYR A;  3F3Q A;  5H5S A;  6GSX A;  3TOT A;  4Z7X A;  4IHU A;  1USB A;  2CVB A;  4BPY A;  4OFN A;  1QFN A;  4HJ2 A;  2QGV A;  2RLI A;  4JED A;  1T8E B;  2GS3 A;  1SYX A;  2E2M A;  2PGT A;  2KOK A;  1Q4J A;  1MDJ A;  1BAY A;  2YNX A;  4K0N A;  3UBL A;  2LQQ A;  3TJG A;  3EIN A;  4HQS A;  3C7M A;  1PL2 A;  2B1L A;  1XVW A;  1SEN A;  1UN2 A;  3KTB A;  1TOF A;  3QAV A;  2HSY A;  3IK7 A;  4F0C A;  3KCM A;  4TRX A;  4JR6 A;  4K0G A;  1EOG A;  3ERG A;  4MZB A;  5J9B A;  2MYG A;  1EV4 A;  4F2I A;  1N8J A;  1FB6 A;  4ML6 A;  6GST A;  1KTE A;  1MTC A;  1TRW A;  2VO4 A;  2OBK A;  1RK4 A;  5A5K A;  2H8L A;  1X5D A;  1JLV A;  4NMU A;  2IJY A;  1FVK A;  3HJM A;  3VI5 A;  2CZ3 A;  3F3R A;  2KP2 A;  1MEK A;  3I69 A;  1TK8 B;  1G0T A;  4XS6 A;  2V6O A;  3EWL A;  5D93 A;  5DBQ A;  3NOF A;  3IR4 A;  2ON5 A;  2H1A A;  2YWN A;  3G7J A;  3I43 A;  3UAR A;  2L6D A;  1A0R P;  4ZBA A;  3NIV A;  4YQM A;  2RUF A;  4NXI A;  3GKM A;  2FA8 A;  5KN1 A;  3Q74 A;  3WYW A;  3L78 A;  4JBB A;  1SD8 A;  1FAA A;  1G7O A;  12GS A;  2F3M A;  3L4N A;  1GSS A;  1Z3E A;  4BWQ A;  5ID2 B;  3M3M A;  5IO0 A;  4MDC A;  4FIW A;  2ZCT A;  2PER A;  5CRG A;  1EZK A;  1SJ6 A;  3IK9 A;  2C0F A;  2PPT A;  2A2R A;  1K0M A;  3TKS C;  2OKA A;  1ZYQ B;  5DAK A;  1GTB A;  2KP1 A;  1BJX A;  3LXT A;  4RI6 A;  1SL0 B;  5ECL B;  3GMF A;  4TR4 A;  2WGR A;  2AJQ B;  3F0I A;  2CZ2 A;  5IM9 A;  4O5R A;  4G19 A;  1PA3 A;  2GT5 A;  2GSS A;  2H71 A;  2PVO C;  3VK9 A;  3D6I A;  4ZL9 A;  1PN9 A;  1GH2 A;  1SJZ A;  3ERW A;  2G2Q A;  3Q18 A;  2P5R A;  3BJ5 A;  2X64 A;  5AIX A;  2HXK A;  2C3N A;  4QL7 A;  3TKP A;  5GST A;  2GZZ A;  4ZIL A;  1THO A;  3TKQ A;  4PGT A;  1PX7 A;  2H6Y A;  1BX9 A;  10GS A;  1WJK A;  3VI7 A;  1A2L A;  3GYK A;  1Z6N A;  1M99 A;  2M72 A;  5AN1 A;  8GSS A;  1F37 A;  5D9X A;  1FOV A;  2WRT A;  3G7I A;  2KLX A;  5JCG A;  3C1R A;  5DDL A;  2N5B A;  4QL9 A;  4F82 A;  4KDU A;  5IOW A;  2JZT A;  4ZXG A;  1W89 A;  4WKW A;  2X8G A;  2BTO T;  2YPM A;  2VCQ A;  1URM A;  4MJE A;  4MF7 A;  1PSQ A;  1E6B A;  4KAE A;  1XIY A;  2IPA A;  1AC1 A;  2C0E A;  3D4T A;  1XOA A;  3ZFL A;  3LEF A;  5G1L A;  3DD3 A;  4EVM A;  3U5R E;  5B7C A;  3TJB A;  4LA1 A;  3UL3 A;  1G6Y A;  2OE3 A;  3GX0 A;  4MPG A;  5DAL A;  5GAN D;  2VD1 A;  4DEJ A;  1GSQ A;  4K2D A;  19GS A;  4ZBB A;  3HYP A;  2VLT A;  1GUH A;  5ECM B;  4LL4 B;  1YEX A;  2O8V B;  2GGT A;  1B8X A;  1RQM A;  2B1K A;  2NTO A;  3LGC A;  4MP4 A;  1XCC A;  2YOI A;  3IV4 A;  2IYJ A;  1UC7 A;  2AAW A;  4IJ3 A;  5ECP B;  3E0U A;  3CSH A;  1I9D A;  2ZNM A;  4TKY A;  4X43 A;  4P3Y B;  3DVX A;  3D22 A;  1ERU A;  2H76 A;  3HZ8 A;  4GLT A;  5G1K A;  3A2V A;  3O3T A;  2G0F A;  1U88 A;  2VAF A;  3FZA A;  4HS1 A;  5CRH A;  3GKN A;  1T7P B;  3L9S A;  3MAK A;  2C3Q A;  1GSY A;  1BQ7 A;  2YP6 A;  1T4Y A;  5ECO B;  1WE0 A;  3LQ7 A;  6GSW A;  4MJA A;  5CRE A;  3TB2 A;  1VRS D;  2FCH A;  4NHZ A;  3M8N A;  5E4W A;  5IPH A;  4L0U A;  5J5N A;  2GLR A;  3CTF A;  4EDZ A;  3KXO A;  3HKR A;  1SK0 A;  3CSJ A;  4O7H A;  4DSR A;  2E0Q A;  20GS A;  4EUY A;  2O85 A;  4D73 B;  2F9S A;  4YQU A;  3EMX A;  1Z6M A;  3HDC A;  1WP0 A;  2H66 A;  2O7K A;  1GTI A;  5IMD A;  4EO3 A;  2AB6 A;  1SL1 B;  1Y25 A;  4V1A p;  4KW6 A;  3ISO A;  4Q5F A;  1YF0 A;  2V6K A;  1KEB A;  3N5O A;  1PD2 1;  2F51 A;  4PQ1 A;  4DVC A;  3IAS 2;  4BA7 A;  2IMF A;  1NM3 A;  5KN0 A;  1O81 A;  3EMP A;  5JWQ B;  5ENU A;  2WS2 A;  3GUS A;  5KEJ A;  1VGL A;  3A5W A;  1A24 A;  1MD3 A;  4FH8 A;  5J3R A;  5CRW A;  1JLW A;  3RDW A;  1JFU A;  3M0F A;  2VCV A;  3CRT A;  2RUE A;  1HNB A;  3QMX A;  2HLS A;  5D9T A;  2DC5 A;  5FT3 A;  5DVB A;  1K0O A;  1K0D A;  1ZYE A;  1EGO A;  1DSB A;  1O8X A;  1X5E A;  4OO4 A;  3TRQ A;  2E2G A;  2YWI A;  4PUA A;  1GWC A;  4IQA A;  2VUP A;  2L57 A;  2LRC A;  2WZ9 A;  2GST A;  1M2A A;  2XBI A;  5A4W A;  3G7Y A;  1B4Q A;  5CYY A;  4IN0 A;  1O73 A;  1SKS B;  3ZIJ A;  1AXD A;  3PH9 A;  1AIU A;  1U6T A;  3ME7 A;  2LJA A;  2H6Z A;  3W8S A;  3R2Q A;  2K8S A;  5JWR B;  1IYH A;  4KA0 A;  5ELG A;  1OE8 A;  1GSU A;  2FWF A;  4PUF C;  2DMM A;  1TXX A;  3ED3 A;  3HJO A;  4POM A;  3IC4 A;  5DJM A;  1GNW A;  2GZY A;  2CVK A;  2DJ1 A;  2H0G A;  2LV3 A;  3PGT A;  4JE1 A;  3QFA C;  2N5F A;  2DJJ A;  3RAZ A;  1TP9 A;  3PIN A;  4NAX A;  1GUM A;  1FW1 A;  1PKZ A;  1YKC A;  5GZZ B;  4DSS B;  2MBS A;  3TKS A;  5A4V A;  1M9B A;  4YAV A; 
#chains in the Genus database with same CATH topology
 4I4K A;  5FWG A;  3ZLP A;  4GF0 A;  3WHO A;  2DIZ A;  1RGG A;  2CW9 A;  1OAZ A;  2IY2 A;  3ZFB A;  3NM7 A;  3FG3 A;  5C04 A;  1YIT 3;  2RGQ A;  2X8C A;  3L0H A;  2XPE A;  2GT6 A;  1XWA A;  2R37 A;  3H1N A;  4RQR A;  2FWH A;  3KZQ A;  2F56 A;  4X2O A;  1SII A;  3DYR A;  2ZUP A;  1VQP 3;  4O32 A;  3B4P A;  3PGB A;  1XWK A;  4KCE A;  5B8B A;  1R4C A;  1T2H A;  3HX8 A;  3F4R A;  5RNT A;  4ISD A;  2R0P A;  1NB3 I;  3KEB A;  3FMW A;  1S3A A;  3VWU A;  2K18 A;  2YJ7 A;  4OFM A;  1W2B 2;  4XTS A;  3AHS A;  3ZRE A;  1O7U A;  1YJ9 3;  2XEP A;  1S5A A;  3BIR A;  2QA2 A;  4HOJ A;  3QAW A;  3IPT A;  4FMA A;  1GUL A;  2W04 A;  2LKU A;  1PQN A;  4OCE A;  1OH0 A;  1PRX A;  3F63 A;  3IHG A;  3APO A;  1LNI A;  2GQM A;  1LQG C;  3BNC A;  1N2A A;  3ZRD A;  3UJM A;  5IEN A;  1EP8 A;  1BUJ A;  2L5O A;  3F8U A;  1T2I A;  4WEY A;  1FG4 A;  1SU9 A;  2YV9 A;  1DMQ A;  1NHO A;  5KN2 A;  3Q19 A;  1ZGN A;  2JZR A;  3DKS A;  4IKH A;  4LEH A;  2BMQ B;  4BIR A;  1KBN A;  5BMU A;  4HSC X;  3QDN A;  3CCR 3;  4MF6 A;  4HOH A;  3NBR A;  2E2U A;  2N5A A;  4MJC A;  2WO0 A;  1WMN A;  4HM8 B;  1GUK A;  3EC9 A;  3IHQ A;  4FCM A;  3F4S A;  5M1A A;  3GA4 A;  1Y6E A;  2X99 A;  3MHE A;  4F0B A;  4MH3 A;  3GH6 A;  3HI7 A;  1JB2 A;  4EL1 A;  1YF1 A;  3SOA A;  4RZM A;  5G2G A;  2LNT A;  2MMO A;  3QOU A;  5B8A A;  3KZT A;  1ERT A;  2HMK B;  4RNT A;  2HT9 A;  4YKF A;  1E2Y A;  1RJO A;  2DSA A;  1SJI A;  5DCG A;  4IT7 A;  3KH7 A;  1SKR B;  3KIJ A;  3F6D A;  1B9X C;  5AII A;  1Y4K A;  1K3O A;  3DY5 A;  5J41 A;  2P09 A;  4HM3 B;  4N6M A;  3TJF A;  4X1U A;  4K1F A;  1I5G A;  1B2S A;  4CDL A;  1R7H A;  5CNW A;  3UEM A;  2JQ5 A;  3IRA A;  3H8Q A;  4WWU C;  2HOH A;  1ERV A;  2R4V A;  6GSV A;  3CXC 2;  1QGV A;  3HZ4 A;  4DSS A;  1Q81 4;  1S3R A;  3KCH A;  1LVN A;  4E8E A;  1K0C A;  2QA4 3;  5ECN B;  3DXB A;  1SPU A;  4HM6 B;  1SQW A;  3D5I A;  1RMS A;  9RNT A;  5FGO A;  1A8L A;  2I9W A;  1A8Y A;  2H72 A;  1UW1 A;  3E3E A;  1BSD A;  3URP A;  2J8X B;  3SOY A;  1UCJ A;  3GRX A;  3DIE A;  4NWY A;  3H3H A;  1EEJ A;  3CC4 3;  2F99 A;  2XBQ A;  3LJR A;  3DVW A;  5ELU A;  3G9B A;  2NVL A;  1W4V A;  1BOX A;  5CXO A;  3NBJ A;  2VCX A;  1DMM A;  1GSP A;  1MWR A;  3SBC A;  1ML6 A;  4N6L A;  1FW7 A;  2I4A A;  4TOP A;  5HFG A;  5BRT A;  1HU9 A;  4FMC A;  1EP7 A;  3E9J B;  3VPT A;  2H0I A;  3LG6 A;  3FW2 A;  3ME8 A;  1JBR A;  3VWX A;  3FCS B;  4FQU A;  2FD3 A;  4FR9 A;  3DGO A;  1KQS 2;  2CFK A;  3DRN A;  4RNY A;  4N6V 0;  1TTO A;  4NPB A;  2C3T A;  5ELA A;  1B2X A;  1FO5 A;  4LZI A;  2HZE B;  1UUV B;  3CPW 2;  1XG8 A;  2VIM A;  4R9L A;  4GHO A;  11GS A;  1K0N A;  2RM5 A;  2QIY A;  5ECI B;  4PQI A;  5G2Z A;  4WR5 A;  5D9V A;  1O8W A;  5M18 A;  3BND A;  1F3A A;  4HM0 B;  1NHY A;  2M46 A;  2FNO A;  2GZP A;  5TGN A;  5LC7 A;  3UVT A;  5HR0 A;  4EE0 A;  1GY6 A;  3KE7 A;  1RCL A;  1R4Y A;  2CQ9 A;  1GY5 A;  5IF6 A;  3CCQ 3;  1LQM B;  3LYK A;  2YAN A;  3ECF A;  3OW2 2;  2QC7 A;  3CXG A;  2NDO A;  1E3R A;  4MA9 A;  3GTU B;  2B5X A;  4OWY A;  1SAR A;  22GS A;  3ZG0 A;  5E59 A;  2AHE A;  3HVS A;  2VLU A;  3H93 A;  1FVJ A;  2X4A A;  2FY6 A;  2P5Q A;  2L1S A;  1KSI A;  2I81 A;  2JDI H;  2KF4 A;  4HQZ A;  4MK3 A;  2GBX B;  4AGS A;  4IBP A;  3QCP A;  4LL1 B;  3SWL A;  3O6T A;  5EPF A;  1AY7 A;  3DGQ A;  3L0R A;  4LLR A;  3PR8 A;  2XR8 B;  1X9S B;  2PWJ A;  5H5R A;  3GST A;  5F8B A;  4EXR A;  5B6N A;  3B4O A;  1RNT A;  4GSS A;  3MSO A;  5F05 A;  4G0L A;  4NV5 A;  2MMZ A;  3WT1 A;  1TK5 B;  1EGR A;  4Q53 A;  5LNK e;  2M80 A;  4IGJ A;  1BRK A;  1EA2 A;  1M7T A;  2A2S A;  1BYE A;  5IIZ A;  1I0V A;  3IDV A;  2JL4 A;  1Q40 A;  5D83 A;  4K61 A;  14GS A;  3S27 A;  4I6X A;  5COH A;  4BVX A;  4GXZ A;  1IDP A;  2CAI A;  8CHO A;  1I3F A;  3GL5 A;  1I8V A;  1S3C A;  5C00 A;  3MYT A;  1T5Y A;  3RBT A;  2LS5 A;  3FLJ A;  4KDX A;  4V2M A;  4BWS A;  2PUK C;  3VSY A;  2H1D A;  4ECC A;  3MG3 A;  3D4M A;  4HEA 2;  1RSN A;  2GVP A;  2RII A;  5CO3 A;  3NHX A;  4HZ2 A;  1OKD A;  2FGX A;  2AUV A;  1OC9 A;  4WET A;  2IN3 A;  2NPB A;  1V2A A;  5IEO A;  2DJK A;  3FRC A;  1QK8 A;  1CEW I;  3GX8 A;  1QMA A;  1M2D A;  2GDR A;  4OFT A;  2C0G A;  4MF5 A;  2L6C A;  3S28 A;  2F86 B;  3RNT A;  2FWE A;  3KH9 A;  1LBK A;  2PU9 C;  5EEO A;  3J7Y d;  2VLV A;  3WD6 A;  1JZW A;  3QR6 A;  4XDV A;  5BIR A;  1QMV A;  1NSW A;  3HVX A;  4FYU A;  3SLU A;  4AJ8 A;  1FUS A;  1U87 A;  2XFT A;  1O7G B;  1WMJ A;  2IMD A;  3X40 A;  2LST A;  1GNE A;  1NU3 A;  3ZTL A;  1X0R A;  3CRU A;  3QFB C;  4EIP A;  1A0F A;  2LUS A;  2WGQ A;  4XS4 A;  1DET A;  1Z7P A;  2D2Z A;  3EQQ B;  4MJB A;  2LQV A;  4J5K A;  2XRX B;  2WJU A;  2W9P A;  3AHW A;  3PXM A;  4BTX A;  2PN8 A;  3WMD A;  3D79 A;  4POK A;  3JUQ A;  1PMT A;  1X1U A;  3MSZ A;  16GS A;  4K7I A;  1XWB A;  1V98 A;  3GKX A;  3FZ5 A;  2BU4 A;  1M3J A;  2FXT A;  1QAF A;  3MIX A;  5FHI A;  1VQK 3;  4I2U A;  2IIY A;  4ECB A;  3O76 A;  2DLX A;  3GH9 A;  4GSN A;  1ON4 A;  1I2F A;  3EX9 A;  13GS A;  5D81 A;  2O89 A;  2X49 A;  3WOD G;  4K6X A;  1QAL A;  3B7C A;  4FYC A;  2IME A;  3TOU A;  5DAL B;  4ZL7 A;  1LOV A;  1B2U A;  2FLS A;  1PN0 A;  1ROV A;  1Q7Y 4;  3GRD A;  2WFC A;  4YQV A;  4J8T A;  4F03 A;  3S9F A;  1WRY A;  1OC9 B;  3A2X A;  3IMA B;  1B27 A;  1DVC A;  3G71 3;  3GSS A;  1IQY A;  3DGM A;  4FO5 A;  2CWV A;  5ID2 A;  2CG0 A;  1UGI A;  1H4O A;  5AYR B;  4HM5 B;  1ZZY A;  2ALB A;  2ML5 A;  3CCU 3;  3WGX A;  2VM1 A;  1IYI A;  3ZML A;  1OHP A;  1UCI A;  3UIW A;  1M3I A;  2LNS A;  4NRE A;  3C71 A;  4MMM A;  1W01 A;  1ZGX A;  1R5P A;  1LOW A;  3UVH A;  1K0B A;  2IL3 A;  4O02 B;  5HQP A;  2INX A;  2HSM A;  5CAX A;  2BO9 B;  1BRG A;  3LTB A;  3HA9 A;  2MMN A;  3VPQ A;  2TRX A;  1BRH A;  2V1L A;  1JKG B;  2HMJ B;  4GRF A;  3WR2 A;  4JZQ A;  2FGT A;  1YQ1 A;  1JN5 A;  2ZHX B;  2VL9 A;  3GN3 A;  1X1Y A;  3STD A;  3U1W A;  1D6Y A;  3D4A A;  3P8W A;  1PL1 A;  5LD0 A;  2F5M A;  4N0Z A;  2J9H A;  4QQ7 A;  2A4H A;  1JBT A;  1YDK A;  4NHW A;  1RGL A;  3EYT A;  2IA7 A;  1WNH A;  5J4U A;  1FGQ A;  1WMP A;  2JAD A;  4HJL B;  1US1 A;  3T0U A;  1ERW A;  3EU3 A;  2JAC A;  2K9F A;  3HHV A;  1AVK A;  1BED A;  2OTL 3;  4WBR D;  3V98 A;  4WYK A;  2R6K A;  1MGR A;  1GD3 A;  1Q7H A;  3CC2 3;  2C8U A;  5AGY A;  3KMN A;  2LTK A;  4OCF A;  2V32 A;  3UL6 A;  1JHB A;  2NBS A;  4RNZ A;  2GEY A;  2WOF A;  4TXO B;  3CME 3;  2ON7 A;  4NV2 A;  2F8F A;  4Q5R A;  1SD9 A;  5J9C A;  1GTU A;  1TDI A;  2JU5 A;  1SL2 B;  5D8I A;  5CRD A;  5IO2 A;  1DUG A;  2GQK A;  3IC8 A;  3G0K A;  1OKT A;  1UI7 A;  3FHK A;  1BAN A;  2CHC A;  1OCV A;  1CYU A;  1PKW A;  4D73 A;  4L8O A;  1J2B A;  1THX A;  3HZP A;  1QJG A;  1GSF A;  3AMO B;  4RI7 A;  4EC6 A;  4RBN A;  3DWV A;  1U3A A;  4GQF A;  2W56 B;  4IP1 A;  3WT2 A;  1BSE A;  4WBJ A;  2CX3 A;  2LRN A;  5HFK A;  3BOA A;  4JF8 A;  2XC2 A;  4BL7 B;  2IUK A;  1V57 A;  7RNT A;  4ZL8 A;  2M7O A;  3C8E A;  3IBH A;  4ACS A;  4K1U A;  3AMO A;  1DE3 A;  3N54 B;  3W6G A;  1OGX A;  6STD A;  1K3L A;  2I9H A;  4LMW A;  4ID0 A;  5IQY A;  4L5L A;  4HU9 A;  1ZS7 A;  2P0G A;  4ECI A;  1E97 A;  1EEM A;  3KN4 A;  1B20 A;  2OQE C;  4EF0 A;  2EIR A;  5EVH A;  2XGL A;  3EBY A;  5I97 A;  2B5Y A;  2OWP A;  1QUW A;  2H30 A;  3DUK A;  3ZYW A;  3PZW A;  1VQ9 3;  3MNG A;  3N9H A;  5CP1 A;  1MWT A;  5ECQ B;  3H79 A;  3D5G A;  2H1G A;  3GKK A;  5DRE A;  1AW9 A;  1AAZ A;  1AVL A;  2B6M A;  1Q40 B;  5ECR B;  3IA1 A;  2GBW B;  3CTG A;  3DGL A;  5GSP A;  1S3D A;  4K1V A;  1SK2 A;  1HNA A;  4TR1 A;  5IMC A;  3VFI A;  2QEX 3;  3LOY A;  1A67 A;  5ABR A;  4PQH A;  4GL6 A;  1J9B A;  5HFI A;  1YY7 A;  4KSM A;  1BRN L;  4HI7 A;  3HII A;  3DMC A;  4JR4 A;  3UJ1 A;  1ZYN A;  1JZR A;  3I6A A;  3F4T A;  3JCM L;  2HI7 A;  3EPT A;  4EDY A;  1TTZ A;  2UZ8 A;  3GHA A;  1OF5 B;  3G16 A;  1TRP A;  3BCK A;  2BT3 A;  3G6E 3;  4ECJ A;  1IVV A;  1TRU A;  2B7K A;  1ILO A;  3ERF A;  3GIX A;  3C1S A;  3OWY A;  3I0Y A;  4BL3 A;  3HD5 A;  2BHM A;  3HXS A;  3CSI A;  3RPP A;  2C1Y A;  2LRT A;  1GMP A;  5IG0 A;  1RTU A;  4KVH A;  1HQO A;  1I3I A;  4ZBD A;  4V2L A;  3K5T A;  4WR4 A;  4XDW A;  3T8N A;  4EKZ A;  1LNH A;  2CFG A;  1YJW 3;  2IMK A;  2QGU A;  4K9Z A;  3IAM 2;  3WOE B;  5LC6 A;  1VF3 A;  1XW5 A;  3IXR A;  2CG1 A;  1ZMA A;  2CKF B;  3TJJ A;  2OAC A;  5CF1 A;  1GRX A;  1GYB A;  1GMQ A;  4GST A;  3ZL5 A;  1TI3 A;  2CX4 A;  3ZMK A;  3EVI A;  2Z6B A;  3HK4 A;  5IOX A;  9GSS A;  3BNB A;  3RHC A;  4CHS A;  1YKA A;  3KGK A;  2WCI A;  3BLZ A;  3LTA A;  3UAP A;  1E3V A;  4HBR A;  2YCD A;  1PX6 A;  1F2E A;  1F6M C;  1HD2 A;  2OA7 A;  1XXU A;  1TFO A;  2FHE A;  5ECS A;  1B2Z A;  2WUL A;  3OXA A;  3X3Z A;  4FYB A;  4MJD A;  1K73 4;  1A2J A;  2X8H A;  2AAD A;  4N6N B;  4XBX A;  1B9Y C;  3TRP A;  3K9M C;  4MLY A;  5AYS C;  2REM A;  1OC8 A;  1GLQ A;  1OPY A;  3I9V 2;  3LXZ A;  4HU7 A;  1OE7 A;  2F8A A;  2HSH A;  2VD0 A;  1Q86 4;  2LEG A;  4LGQ A;  3M9K A;  2W6J H;  1TU8 A;  2MZC A;  1RHL A;  4OMV A;  1JZO A;  1WOU A;  2QSI A;  4IVF A;  4K7N A;  3EC3 A;  3UL5 A;  1K3Y A;  4USS A;  1T00 A;  4N0V A;  3H4K A;  1N9J A;  1YHQ 3;  2LQO A;  1M2B A;  2H01 A;  3FR3 A;  2YFI B;  4TR3 A;  3TUE A;  5BXQ A;  3UMA A;  5IMA A;  4KDY A;  1TW9 A;  1Z5Y E;  2PNC A;  5CF2 A;  1EG9 B;  1VQL 3;  1N8R 4;  4STD A;  4MMX B;  1PY3 A;  2LJK A;  4ILF A;  3NV0 B;  5KP4 A;  2KF6 A;  4AKY A;  4R9K A;  1YEP A;  3VWV A;  5LCZ A;  3K63 A;  1BIR A;  3MDK A;  2QKE A;  2FA4 A;  2W9Q A;  1G7E A;  3S29 A;  3APS A;  1SJW A;  1BNG A;  3SXX A;  4N10 A;  4MZC A;  2AV4 A;  2JSZ A;  5G30 A;  3GZX B;  2B3S A;  1N5P A;  2HML B;  1LU4 A;  3J7Y b;  1W6Y A;  1X5C A;  2TRC P;  1GOV A;  3S5C A;  3EE1 A;  4Z2T A;  3RPN A;  1F9M A;  1BNF A;  3D3L A;  1ROA A;  4EIQ A;  2KXG A;  3L9V A;  3ZZX A;  2OJL A;  2P0M A;  4FMD A;  1MD4 A;  1U3I A;  3X3Y A;  4FCZ A;  5AIV A;  5IPG A;  4TR0 A;  2E7P A;  3QPM A;  2O87 A;  4HAA A;  1TP6 A;  1FGT A;  3OWS A;  5AI1 A;  5IMV A;  3GWR A;  1DBY A;  1FGM A;  4GCI A;  1B48 A;  3BNE A;  1VF2 A;  1BUQ A;  4PNF A;  1YZX A;  2Z76 A;  1GSE A;  1HNC A;  2DJ2 A;  5KP1 A;  1QQ2 A;  1TU7 A;  4ULX A;  4J9A A;  4KH7 A;  1PU4 A;  3FF0 A;  4CDO A;  1AR0 A;  3BB9 A;  4PXO A;  4F9Z A;  3M8C A;  3TKR A;  3BD2 A;  1CQS A;  3LFL A;  3QK9 A;  2BMR B;  3CYN A;  1PGT A;  2YWM A;  1KD1 4;  1SK1 A;  3D9R A;  3K8N A;  4G9H A;  4O8S A;  2L5L A;  3FYG A;  5A4U A;  3Q3F A;  8RNT A;  3EU4 A;  3KD0 A;  3TGZ A;  1BNJ A;  4EC0 A;  1T1V A;  5EL8 A;  4MNN A;  5G5E A;  3BCI A;  3FSD A;  3FZ9 A;  2CK3 H;  1ASK A;  4AF2 A;  3BBY A;  1W4N A;  1MDK A;  4TVE A;  6GSY A;  2DJ3 A;  5KOX A;  4EXJ A;  1IK3 A;  5ELJ A;  4AJ6 A;  4XIH A;  1LOY A;  3M9J A;  1FHE A;  3DEX A;  2P05 A;  3TDG A;  3J7Y k;  2XPD A;  1XOB A;  6GSU A;  4A5P A;  18GS A;  3F40 A;  5FW5 A;  4J2F A;  2IFQ B;  3GZB A;  1CYV A;  4OO5 A;  2K6V A;  4HDE A;  5JWO B;  2A15 A;  3CMI A;  5GAP D;  5L71 A;  4AJ7 A;  3G8Z A;  1F3B A;  3P2A A;  1UCK A;  5GSS A;  7GSS A;  1TU5 A;  1SIH A;  4CJN A;  2PZV A;  1RLS A;  2EC4 A;  4PTS A;  2RCD A;  1XFL A;  2GSP A;  4YKG A;  4XM4 A;  4KSO A;  3LZA A;  4MZW A;  3NV0 A;  3N9J A;  3GSP A;  1BG5 A;  3HVV A;  3LYP A;  1VQN 3;  2GQL A;  2H6X A;  2GU3 A;  5KN3 A;  3D5J A;  1W2Z A;  4EV2 A;  5IMF A;  4V1A g;  1VQM 3;  2OE0 A;  1WTH A;  3MYD A;  5D73 A;  2YX9 A;  1XZO A;  2Y73 A;  3V99 A;  3EN1 B;  4KE3 A;  1R26 A;  4LMV A;  1W6G A;  2RM6 A;  1R4W A;  2C4J A;  3U6V A;  1V58 A;  1XW9 A;  2CT6 A;  2HRN A;  3DXO A;  5HR3 A;  4XB5 A;  1K41 A;  5JCW A;  4JRR A;  1G96 A;  4GWR A;  5EVO A;  3TRX A;  3IPZ A;  4KCA A;  1TRV A;  1XW6 A;  2AAE A;  1GLP A;  4L0W A;  1JV2 B;  4ZIJ A;  4MCU A;  5F07 A;  1IQ8 A;  3TJK A;  1X1W A;  3DML A;  1RKY A;  4KGI A;  1VF4 A;  2YFJ B;  3LYG A;  2CX0 A;  2B7J A;  2QA1 A;  1TJD A;  2R0C A;  3FEU A;  4RUV A;  2DKI A;  3HJP A;  4IEL A;  3A2W A;  1JBS A;  4GTU A;  1O85 A;  3NXJ A;  2LYX A;  3CU3 A;  4L8P A;  5F06 A;  1JB5 A;  2PMT A;  1UVZ A;  1A2M A;  2P31 A;  4TN8 A;  3CCM 3;  1KNG A;  4BVY A;  4KT3 B;  1A23 A;  1O6J A;  1ISK A;  3IE3 A;  1UDI I;  1FUW A;  2HRF A;  1ULI B;  1Z1S A;  3CBU A;  3NM2 A;  1G6W A;  1OHS A;  5JPU A;  6GSP A;  4I2T A;  1T3B A;  4E8H A;  1EQK A;  1UUG B;  1FZU A;  5BVB A;  4J56 E;  4MAB A;  4XCS A;  1DE1 A;  1IYY A;  5F0G A;  3VLN A;  1M1X B;  3QRD A;  2ZL8 A;  1C7H A;  2L4C A;  4XRD A;  4EW5 A;  1EV9 A;  3LTC A;  2PVQ A;  2BJX A;  1V40 A;  4KB3 A;  1K9M 4;  5HR1 A;  1X9M B;  2V41 A;  1MDI A;  3US3 A;  1RCK A;  3W8J A;  1NNV A;  2K0M A;  5BU4 A;  1ZCP A;  3TKS E;  1TRQ A;  6RNT A;  4I97 A;  1RRH A;  4FMB A;  1T4Z A;  3HCZ A;  4L8E A;  2YV7 A;  4ML1 A;  1ZL9 A;  4PNG A;  1A2V A;  3Q6O A;  2WDU A;  3SYU A;  1LJR A;  4IS0 A;  3FZ4 A;  2KF3 A;  2JZS A;  3MWH A;  4POB A;  1RN1 A;  3K7C A;  1NW2 A;  4WP5 A;  3MKI A;  3X3X A;  3HY2 A;  4AEQ A;  4G0K A;  1TK0 B;  2CA8 A;  1AQZ A;  2VOC A;  2VCT A;  4I5Q A;  5KP3 A;  4LSO A;  3AY8 A;  1GL8 A;  3NBB A;  1Z9H A;  3P7X A;  4ZB6 A;  4Z2R A;  2H0H A;  4MH2 A;  3V1W A;  2B5E A;  4MEI A;  1QXH A;  4O92 A;  2EIQ A;  1XVQ A;  6GSS A;  4K8M A;  2AYT A;  5DCH A;  3KJY A;  3CCV 3;  4ZB8 A;  1L5G B;  1LXE A;  1AV4 A;  1OAC A;  3IJE B;  2JSY A;  2R5G A;  2WB9 A;  4IJI A;  5ECH B;  2O9U X;  4H86 A;  3BU4 A;  3QD9 A;  2SBL A;  3LWA A;  3GFK A;  3ZIT A;  1ULJ B;  3TCO A;  3UBK A;  2VM2 A;  1MNL A;  1AQV A;  3CQF A;  4BL7 A;  3X42 A;  1X9W B;  1UI8 A;  3NQZ A;  3KMO A;  1B4P A;  3KP9 A;  1DYU A;  1GS3 A;  1ACV A;  1XWC A;  4XS1 A;  3VWW A;  5B6M A;  2CFL A;  3CCS 3;  2CAQ A;  3F6F A;  1C72 A;  3EE2 A;  3RGR A;  2A4V A;  2KAA A;  3NQY A;  1JN5 B;  3OR5 A;  4WF5 A;  1IT8 A;  2L4Q A;  3A76 A;  2H19 A;  3G4S 3;  2I3Y A;  3P90 A;  1W02 A;  2DIY A;  5INY A;  1VQ6 3;  2FWG A;  4G1M B;  2V2G A;  3A3T A;  4TXO A;  4R80 A;  3EJV A;  1FYS A;  4OD7 A;  3M1G A;  1YJ6 A;  3D21 A;  4K7O A;  2GTU A;  2PBJ A;  4HJM A;  2VCW A;  5D96 A;  3EUR A;  4PUR A;  2DBC A;  1RW1 A;  5HR2 A;  5AIS A;  2KUC A;  4MPF A;  3KM6 A;  1IU7 A;  1RGA A;  4XHM A;  2H73 A;  4YH2 A;  2GSQ A;  2KHP A;  3KSP A;  4HVN A;  3WA3 A;  4FCJ A;  1AUC A;  5D9W A;  3KP8 A;  4WYK B;  2IMI A;  4I8B A;  4K5S A;  2F5W A;  1YVB I;  3FR9 A;  3AGN A;  3ZIV A;  1GSD A;  2FUG 2;  1OVN A;  4HM2 B;  5IMZ A;  2C4B A;  3GZY B;  2W56 A;  1XPV A;  3CD6 3;  5AEW B;  1GY7 A;  1GTA A;  2H70 A;  3WA2 X;  1CQG A;  3MG2 A;  1YNV X;  1WPI A;  2HZE A;  4WF4 A;  3IOS A;  5DQY A;  1WQL B;  4X0X A;  2GSR A;  1ZOF A;  4TW5 A;  4CW9 A;  1AQX A;  3S67 A;  3C73 A;  3VF1 A;  4KX4 A;  4K2X A;  2YWO A;  3EB8 A;  3WDG B;  3GV1 A;  4N11 A;  4WXT A;  1JNQ A;  4G2E A;  4R1K A;  4IP6 A;  1DE2 A;  5EY6 A;  1PFO A;  3EBT A;  1LOX A;  1HYF A;  1M0U A;  1MOL A;  2ES7 A;  4RQX A;  1HYU A;  3APQ A;  5D82 A;  7STD A;  2K8V A;  1OHO A;  5HGR A;  1XWG A;  4PX1 A;  3FK8 A;  3GTU A;  3DGN A;  2H75 A;  3FY7 A;  5DAK B;  1N5H A;  2D42 A;  2HYX A;  2L59 A;  3OX9 A;  3F9S A;  3D0Z A;  3KSE D;  1PYL A;  2GEX A;  2DJ0 A;  2YZH A;  1TRS A;  2IMJ A;  3N8B A;  2J23 A;  4ZB9 A;  5G31 A;  4K5R A;  2YFL B;  1UCL A;  1M9G A;  1ABA A;  1GMR A;  1CQH A;  4Q5N A;  2STD A;  1TUH A;  3MWZ A;  5G5F A;  3UB1 A;  3PCR A;  2DML A;  4CCV A;  1EOH A;  4KND A;  1J0F A;  2MBT A;  1WWJ A;  4DSQ A;  2IUJ A;  3QAG A;  4EBG A;  1BRS A;  3FG4 A;  5STD A;  1YVS A;  2OE1 A;  1TI1 A;  4Q5Q A;  1QAK A;  1MWS A;  1GP1 A;  2HNL A;  3RHB A;  1TKD B;  1B3S A;  2Z9S A;  3ER7 A;  2HE3 A;  1V9W A;  1OYJ A;  1M9A A;  2R0G A;  3GL3 A;  4JU5 A;  4HUA A;  4KZ1 A;  3UOM A;  5H5Q A;  2VCZ A;  1W00 A;  2BMX A;  2HZF A;  3OWU A;  1VF1 A;  3FKF A;  1SKW B;  1YJN 3;  2H1B A;  3LOR A;  1BU4 A;  3CNX A;  4CY6 A;  2CV4 A;  2H74 A;  4HM7 B;  1D6U A;  3RDE A;  3F7X A;  1M1K 4;  4TR1 B;  2VL3 A;  4OK0 A;  1GD4 A;  2OAD A;  3LSZ A;  3K0Z A;  4XRA A;  3NZN A;  4HM1 B;  2EIO A;  5ECK B;  1EWX A;  2RSX A;  2WOH A;  2XGN A;  3JUO A;  2LJR A;  4KFF A;  2KRT A;  1J08 A;  4J57 E;  1A90 A;  2TIR A;  4O2H A;  3WGE A;  1U5O A;  2D1W A;  4PEJ A;  1UA5 A;  1O7W B;  1JZD A;  4MMZ B;  1FB0 A;  4L5O A;  4GQC A;  5JCU A;  1WIK A;  1H75 A;  2OCT A;  4KUN A;  3VUR A;  2YJH A;  1WMO A;  1FA3 A;  1R5A A;  17GS A;  3GNJ A;  3KTL A;  3ZVJ A;  2W0Q A;  2VL2 C;  2R3X A;  4MMY B;  1HZ1 A;  1BAO A;  3AGO A;  4KFD A;  2CVD A;  4G10 A;  3DGY A;  1AQW A;  5AIF A;  2C0D A;  1IQX A;  2OBI A;  1I2E A;  2V1M A;  2C80 A;  3LT8 A;  1XBS A;  1VQ8 3;  3F9U A;  3GUR A;  1JB4 A;  2R2J A;  3DM8 A;  1ST9 A;  4IW9 A;  1Z7R A;  2I1U A;  1ZX2 A;  4XS4 B;  1TFK A;  1Q98 A;  1MWU A;  2YZU A;  4O5U A;  5DQS A;  1LRA A;  2HFD A;  3L9U A;  4HZ4 A;  1OC3 A;  1K0A A;  1FUT A;  2XHF A;  2VL2 A;  4XBY A;  3FGY A;  1RGC A;  1O7N B;  3FR6 A;  4YAP A;  3WGD A;  2W2C A;  2IFQ A;  1NWW A;  1NDO B;  4POL A;  4BIK A;  4N30 A;  1BNS A;  2IWT A;  4HM4 B;  1FGO A;  1RRL A;  2R41 A;  5DJL A;  4IQ1 A;  2YN1 A;  3ZVJ D;  4TXV A;  5EQL A;  4V2N A;  4K90 B;  2MMA A;  3JVC A;  1V74 A;  3DH2 A;  2HMO B;  1SYR A;  3F3Q A;  1BNE A;  4X4J A;  3GZR A;  5H5S A;  6GSX A;  5IG5 A;  4L7K A;  1FGR A;  4G0I A;  1N9E A;  3JUP A;  1KC8 4;  3TOT A;  1S72 3;  4Z7X A;  4IHU A;  1JJ2 2;  1USB A;  2BMO B;  2L4V A;  2BNG A;  3T8U A;  2CVB A;  4BPY A;  4OFN A;  1QFN A;  4HJ2 A;  2QGV A;  2RLI A;  2R4I A;  4JED A;  1T8E B;  2GS3 A;  1SYX A;  4IIA A;  2E2M A;  2PGT A;  2KOK A;  1Q4J A;  1MDJ A;  1BAY A;  2YNX A;  4K0N A;  3UBL A;  1HKX A;  1STD A;  2LQQ A;  3MG1 A;  3TJG A;  1YIJ 3;  1NB5 I;  3EIN A;  4HQS A;  3DZL A;  3C7M A;  1PL2 A;  2B1L A;  2CFD A;  1XVW A;  1SEN A;  7GSP A;  1UUW B;  1Q9E A;  3ROB A;  1UN2 A;  3KTB A;  1TOF A;  3QAV A;  4TX4 A;  2HSY A;  3IK7 A;  4F0C A;  3KCM A;  4TRX A;  4JR6 A;  1O7M B;  4K0G A;  3ZFZ A;  4HZ9 B;  2XF3 A;  3F8H A;  3WOF B;  1EOG A;  3ERG A;  2A2P A;  4MZB A;  1BSA A;  5J9B A;  2RNT A;  2MYG A;  3VGN A;  2XSH B;  4AKZ A;  1EV4 A;  4F2I A;  1N8J A;  1FB6 A;  4ML6 A;  6GST A;  3ALA A;  1KTE A;  1MTC A;  1TRW A;  2VO4 A;  4HZB B;  1RK4 A;  2OBK A;  5A5K A;  2H8L A;  1B2M A;  2CH9 A;  1X5D A;  3CC7 3;  1JLV A;  5IER A;  4KF9 A;  4NMU A;  2IJY A;  5HOH A;  1FVK A;  3HJM A;  3VI5 A;  2HMN B;  2CZ3 A;  3F3R A;  2KP2 A;  1Q42 A;  1MEK A;  3I69 A;  1TK8 B;  4H3U A;  3FG1 A;  1G0T A;  3NX0 A;  4XS6 A;  2V6O A;  4ICY A;  3EWL A;  5D93 A;  5DBQ A;  3RGA A;  1EKM A;  3NOF A;  2GXF A;  1K8A 4;  2ON5 A;  3IR4 A;  1IV7 A;  4DKI A;  2H1A A;  2YWN A;  3G7J A;  3PYJ A;  3I43 A;  1IVX A;  1NO3 A;  2CWU A;  2E2V A;  3UAR A;  2L6D A;  1A0R P;  2F98 A;  2K3D A;  4ZBA A;  2UX0 A;  4LMI A;  1D6Z A;  3NIV A;  4YQM A;  3CCJ 3;  2RUF A;  4GSP A;  1ZYP A;  4NXI A;  3GKM A;  1U8C B;  1VQ5 3;  2FA8 A;  5KN1 A;  3E99 A;  3Q74 A;  3WYW A;  1KWI A;  1QVG 2;  3L78 A;  4JBB A;  1SD8 A;  1FAA A;  1G7O A;  12GS A;  2F3M A;  3L4N A;  3CCL 3;  1GSS A;  2ZDJ A;  1Z3E A;  4BWQ A;  5ID2 B;  3M3M A;  5IO0 A;  4MDC A;  5JPP A;  3JUN A;  4FIW A;  2ZCT A;  3LW9 A;  2PER A;  3B8L A;  1UGH I;  5CRG A;  4IPB A;  1EZK A;  1SJ6 A;  3JUM A;  3IK9 A;  2OQE A;  3CMA 3;  1BRI A;  3F7S A;  2C0F A;  2PPT A;  3FF2 A;  2A2R A;  1K0M A;  3TKS C;  2OKA A;  1ZYQ B;  5DAK A;  4Z2U A;  2DKH A;  1GTB A;  2KP1 A;  2Z77 A;  4N3V A;  2K54 A;  1A2K A;  1BJX A;  1YI2 3;  4X2H A;  2Z7A A;  2HRK A;  3LXT A;  4RI6 A;  1BNR A;  4EV5 A;  5JBS A;  1SL0 B;  5ECL B;  3GMF A;  4TR4 A;  2WGR A;  2AJQ B;  1B21 A;  4NHF A;  3Q2P A;  2CFW A;  3F0I A;  2CZ2 A;  1W7C A;  5AIH A;  1JKG A;  5IM9 A;  1IVU A;  4O5R A;  4G19 A;  1M90 4;  1PA3 A;  1TIJ A;  2GT5 A;  2GSS A;  2H71 A;  2C10 A;  2PVO C;  2MC8 A;  3VK9 A;  2BIR A;  3D6I A;  4ZL9 A;  1PN9 A;  1GH2 A;  1SJZ A;  3ERW A;  5AEU B;  2G2Q A;  3Q18 A;  2P5R A;  3BJ5 A;  1BSB A;  2X64 A;  5AIX A;  2HXK A;  2C3N A;  4QL7 A;  3TKP A;  1Q82 4;  5GST A;  2GZZ A;  4ZIL A;  1THO A;  2SAR A;  1BGS A;  3TKQ A;  4PGT A;  1OGZ A;  1PX7 A;  1QVF 2;  4OUQ A;  1VQQ A;  2H6Y A;  5IG3 A;  1BX9 A;  10GS A;  3KII A;  1WJK A;  2P0X A;  3VI7 A;  5IW9 A;  1A2L A;  3GYK A;  1Z6N A;  2OTJ 3;  4HYZ A;  4KFE A;  1M99 A;  3X41 A;  2M72 A;  5AN1 A;  8GSS A;  1F37 A;  4HKV B;  4BTW A;  3LML A;  5D9X A;  1FOV A;  2WRT A;  1O7P B;  3G7I A;  2KLX A;  1I0X A;  5JCG A;  3C1R A;  3LH4 A;  5DDL A;  3A5E A;  2N5B A;  4QL9 A;  3SED A;  4F82 A;  4KDU A;  4ORL A;  5IG4 A;  5CK6 A;  5IOW A;  2JZT A;  4ZXG A;  1EUI C;  4N6T A;  1W89 A;  4WKW A;  2X8G A;  3MPH A;  2BTO T;  2YPM A;  2VCQ A;  2CIU A;  3F8X A;  1URM A;  4MF7 A;  4MJE A;  1PSQ A;  1E6B A;  1PFP A;  1RN4 A;  1A2P A;  4KAE A;  1XIY A;  4OVM A;  2IPA A;  3HVN A;  1AC1 A;  3EHC A;  2C0E A;  3D4T A;  2F4Y A;  1XOA A;  1I70 A;  3OV4 A;  1F8N A;  3ZFL A;  3LEF A;  5G1L A;  3FKA A;  2XH9 A;  3DD3 A;  4EVM A;  3U5R E;  4N6U A;  5B7C A;  3TJB A;  2ZA4 A;  4LA1 A;  3U97 A;  4CY8 A;  3UL3 A;  3H51 A;  1G6Y A;  2OE3 A;  3GX0 A;  4MPG A;  5DAL A;  5GAN D;  2VD1 A;  3EN8 A;  4DEJ A;  1GSQ A;  1W5Z A;  4K2D A;  4H61 A;  19GS A;  4ZBB A;  3HYP A;  2VLT A;  1GUH A;  5ECM B;  4LL4 B;  1FOH A;  1YEX A;  1RN7 A;  4QWT A;  4BU4 A;  1BSC A;  1RGH A;  2GGT A;  2O8V B;  1B8X A;  3I56 3;  1RQM A;  2CC3 A;  2B1K A;  2NTO A;  3LGC A;  4MP4 A;  1XCC A;  2UUG C;  2YOI A;  3IV4 A;  1N8Q A;  2IYJ A;  3R3E A;  3HOH A;  4O3V A;  2O3O A;  3FH1 A;  4J5G A;  1UC7 A;  2AAW A;  4IJ3 A;  1ZO2 A;  5ECP B;  3FZW A;  3CSH A;  3E0U A;  1I9D A;  2ZNM A;  1G02 A;  1I2G A;  4TKY A;  2HRA A;  4X43 A;  2KF5 A;  2P38 A;  4P3Y B;  1K28 A;  3DVX A;  3D22 A;  1ERU A;  2H76 A;  3HZ8 A;  4GLT A;  5G1K A;  3A2V A;  3O3T A;  2G0F A;  1OF5 A;  1U88 A;  2VAF A;  3FZA A;  2WGO A;  2E2T A;  1X1X A;  3LTD A;  1IV9 A;  4BTY A;  4HS1 A;  5CRH A;  5AIG A;  1RNB A;  3GKN A;  2B1X B;  1GOU A;  1T7P B;  3L9S A;  3MAK A;  2C11 A;  2C3Q A;  1GSY A;  1BQ7 A;  2YP6 A;  2CWT A;  1T4Y A;  5ECO B;  1WE0 A;  3EF8 A;  3NUV A;  3LQ7 A;  6GSW A;  4MJA A;  4BL2 A;  4LYL B;  1VQ7 3;  1O7H B;  5CRE A;  3TB2 A;  1VRS D;  2FCH A;  4NHZ A;  3M8N A;  5E4W A;  5IPH A;  4O5Q A;  3SVA A;  3HIG A;  1BVI A;  2XSO B;  4L0U A;  5J5N A;  2GLR A;  3CTF A;  4EDZ A;  3KXO A;  1JRQ A;  1BRJ A;  3HKR A;  3F14 A;  3A5I A;  1SK0 A;  1STF I;  3CNM A;  3CSJ A;  4O7H A;  2E0Q A;  4DSR A;  1VZZ A;  20GS A;  4EUY A;  1IT7 A;  4U13 A;  2O85 A;  4D73 B;  2F9S A;  4YQU A;  3EMX A;  5DRV A;  1Z6M A;  3HDC A;  1WP0 A;  5KOW A;  4JRF A;  2H66 A;  2Y74 A;  2O7K A;  1GTI A;  5IMD A;  4GB5 A;  4EO3 A;  2AB6 A;  1VQ4 3;  1SL1 B;  3PCS A;  3O8Y A;  1Y25 A;  4V1A p;  4KW6 A;  3ISO A;  4Q5F A;  5A0O B;  4BVX B;  1YF0 A;  2V6K A;  1KEB A;  1RDS A;  3N5O A;  1YGW A;  1PD2 1;  4WFO A;  1NJI 4;  2F51 A;  4PQ1 A;  4DVC A;  3IAS 2;  4BA7 A;  2IMF A;  1NM3 A;  1YGE A;  2RBI A;  5KN0 A;  1O81 A;  3EMP A;  3Q90 A;  5JWQ B;  4ZM8 A;  3V92 A;  2WS2 A;  5ENU A;  1MGW A;  1C54 A;  4R4K A;  3Q1C A;  3GUS A;  4N6O B;  5KEJ A;  1VGL A;  3A5W A;  1A24 A;  1MD3 A;  4FH8 A;  5J3R A;  3ZG5 A;  5CRW A;  1W6C A;  3LT9 A;  1JLW A;  2CX1 A;  3RDW A;  1JFU A;  3M0F A;  2VCV A;  3CRT A;  2RUE A;  1HNB A;  3QMX A;  3LXU X;  2HLS A;  2XFS A;  2B24 B;  5D9T A;  2DC5 A;  5FT3 A;  4BVY B;  1CH0 A;  3UNL A;  5DVB A;  1K0O A;  1K0D A;  1ZYE A;  1RGK A;  1EGO A;  1DSB A;  1O8X A;  2RFR A;  1X5E A;  4OO4 A;  3TRQ A;  1GOY A;  2E2G A;  4CPK A;  2YWI A;  4PUA A;  4EYC A;  1GWC A;  3I55 3;  4IQA A;  2VUP A;  2W03 A;  1DMN A;  3GAX A;  1BNI A;  2GU1 A;  2L57 A;  2LRC A;  2WZ9 A;  2GST A;  4WHA A;  1VQO 3;  1M2A A;  2XBI A;  5A4W A;  1OUN A;  2MF7 A;  5IEP A;  3SX1 A;  3KFQ C;  1IVW A;  3G7Y A;  1B4Q A;  5CYY A;  2HMM B;  4IN0 A;  1O73 A;  3PPU A;  1SKS B;  3ZIJ A;  1AXD A;  3CCE 3;  3PH9 A;  1AIU A;  1U6T A;  3ME7 A;  2OOV C;  3KKG A;  2LJA A;  2H6Z A;  3W8S A;  3R2Q A;  2K8S A;  2KCD A;  5JWR B;  1IYH A;  4KA0 A;  5ELG A;  1OE8 A;  1GSU A;  2FWF A;  4PUF C;  3CPO A;  2DMM A;  1TXX A;  3ED3 A;  3HJO A;  4POM A;  3IC4 A;  5M19 A;  5DJM A;  1RGE A;  2Q07 A;  1GNW A;  2UGI A;  2GZY A;  2CVK A;  2ML6 A;  1DVD A;  2DJ1 A;  2H0G A;  3PS8 A;  2LV3 A;  3PGT A;  4JE1 A;  3QFA C;  2N5F A;  2DJJ A;  3RAZ A;  1TP9 A;  5CLK A;  3PIN A;  4NAX A;  2FNQ A;  1GUM A;  1RGF A;  2OOV A;  1FW1 A;  1PKZ A;  1YKC A;  5GZZ B;  4DSS B;  2MBS A;  3TKS A;  4XBT A;  5A4V A;  1M9B A;  4YAV A; 
#chains in the Genus database with same CATH homology
 5FWG A;  3ZLP A;  4GF0 A;  2DIZ A;  1OAZ A;  2IY2 A;  3ZFB A;  5C04 A;  2X8C A;  3L0H A;  2XPE A;  2GT6 A;  1XWA A;  2R37 A;  3H1N A;  4RQR A;  2FWH A;  3KZQ A;  3DYR A;  2ZUP A;  4O32 A;  1XWK A;  4KCE A;  5B8B A;  3F4R A;  4ISD A;  2R0P A;  3KEB A;  3FMW A;  1S3A A;  3VWU A;  2K18 A;  2YJ7 A;  4OFM A;  4XTS A;  3ZRE A;  1O7U A;  2QA2 A;  4HOJ A;  3QAW A;  1GUL A;  2LKU A;  1PQN A;  4OCE A;  1PRX A;  3F63 A;  3IHG A;  3APO A;  2GQM A;  1N2A A;  3ZRD A;  1EP8 A;  2L5O A;  3F8U A;  4WEY A;  1FG4 A;  1SU9 A;  2YV9 A;  1NHO A;  5KN2 A;  3Q19 A;  1ZGN A;  2JZR A;  3DKS A;  4IKH A;  1KBN A;  5BMU A;  3QDN A;  4MF6 A;  2N5A A;  4MJC A;  1GUK A;  3IHQ A;  3F4S A;  3GA4 A;  1Y6E A;  2X99 A;  4F0B A;  4MH3 A;  3GH6 A;  4EL1 A;  1YF1 A;  2LNT A;  2MMO A;  3QOU A;  5B8A A;  1ERT A;  2HT9 A;  4YKF A;  1E2Y A;  2DSA A;  1SJI A;  5DCG A;  3KH7 A;  1SKR B;  3KIJ A;  3F6D A;  1B9X C;  1K3O A;  5J41 A;  3TJF A;  4X1U A;  4K1F A;  1I5G A;  1R7H A;  5CNW A;  3UEM A;  3IRA A;  3H8Q A;  1ERV A;  2R4V A;  6GSV A;  1QGV A;  3HZ4 A;  4DSS A;  4E8E A;  1K0C A;  5ECN B;  3DXB A;  1A8L A;  1A8Y A;  2H72 A;  3E3E A;  3GRX A;  3DIE A;  4NWY A;  2XBQ A;  1EEJ A;  3LJR A;  3DVW A;  3G9B A;  2NVL A;  1W4V A;  2VCX A;  3SBC A;  1ML6 A;  2I4A A;  4TOP A;  5HFG A;  5BRT A;  1EP7 A;  3E9J B;  3VPT A;  2H0I A;  3LG6 A;  3FW2 A;  3ME8 A;  3VWX A;  4FQU A;  2FD3 A;  3DRN A;  4NPB A;  2C3T A;  5ELA A;  1FO5 A;  2HZE B;  2VIM A;  11GS A;  1K0N A;  2RM5 A;  5ECI B;  4PQI A;  5G2Z A;  4WR5 A;  5D9V A;  1O8W A;  1F3A A;  1NHY A;  2M46 A;  2FNO A;  2GZP A;  3UVT A;  5HR0 A;  4EE0 A;  2CQ9 A;  3LYK A;  2YAN A;  2QC7 A;  3CXG A;  2NDO A;  4MA9 A;  3GTU B;  2B5X A;  4OWY A;  22GS A;  5E59 A;  2AHE A;  3HVS A;  2VLU A;  3H93 A;  1FVJ A;  2X4A A;  2FY6 A;  2P5Q A;  2I81 A;  4HQZ A;  4MK3 A;  4AGS A;  4IBP A;  3QCP A;  4LL1 B;  3SWL A;  3O6T A;  5EPF A;  3DGQ A;  4LLR A;  3PR8 A;  1X9S B;  2PWJ A;  5H5R A;  3GST A;  5F8B A;  5B6N A;  4GSS A;  5F05 A;  4G0L A;  4NV5 A;  2MMZ A;  3WT1 A;  1TK5 B;  1EGR A;  5LNK e;  2M80 A;  4IGJ A;  1M7T A;  2A2S A;  1BYE A;  5IIZ A;  3IDV A;  2JL4 A;  14GS A;  4I6X A;  5COH A;  4BVX A;  4GXZ A;  2CAI A;  3GL5 A;  1S3C A;  5C00 A;  3RBT A;  2LS5 A;  4KDX A;  4V2M A;  4BWS A;  2PUK C;  2H1D A;  4ECC A;  3D4M A;  4HEA 2;  2GVP A;  2RII A;  5CO3 A;  4HZ2 A;  1OKD A;  2FGX A;  2AUV A;  1OC9 A;  4WET A;  2IN3 A;  2NPB A;  1V2A A;  2DJK A;  3FRC A;  1QK8 A;  3GX8 A;  1M2D A;  2GDR A;  4OFT A;  2C0G A;  4MF5 A;  2L6C A;  2FWE A;  3KH9 A;  1LBK A;  2PU9 C;  2VLV A;  3WD6 A;  1JZW A;  3QR6 A;  1QMV A;  1NSW A;  3HVX A;  4FYU A;  4AJ8 A;  1U87 A;  1WMJ A;  2IMD A;  2LST A;  1GNE A;  3ZTL A;  1X0R A;  3CRU A;  3QFB C;  4EIP A;  1A0F A;  2LUS A;  4XS4 A;  1Z7P A;  2D2Z A;  4MJB A;  2WJU A;  2PN8 A;  4POK A;  1PMT A;  3MSZ A;  16GS A;  4K7I A;  1XWB A;  1V98 A;  3GKX A;  3FZ5 A;  3MIX A;  5FHI A;  4I2U A;  2IIY A;  4ECB A;  3O76 A;  2DLX A;  3GH9 A;  4GSN A;  1ON4 A;  13GS A;  2O89 A;  2X49 A;  4K6X A;  4FYC A;  2IME A;  3TOU A;  5DAL B;  4ZL7 A;  2FLS A;  1PN0 A;  2WFC A;  4YQV A;  4F03 A;  3S9F A;  1WRY A;  1OC9 B;  3A2X A;  3GSS A;  4FO5 A;  5ID2 A;  1H4O A;  1ZZY A;  2ALB A;  3WGX A;  2VM1 A;  1IYI A;  3ZML A;  3UIW A;  2LNS A;  3C71 A;  4MMM A;  1R5P A;  3UVH A;  1K0B A;  2IL3 A;  5HQP A;  2HSM A;  5CAX A;  3HA9 A;  2MMN A;  3VPQ A;  2TRX A;  4GRF A;  4JZQ A;  1YQ1 A;  2VL9 A;  3GN3 A;  3P8W A;  1PL1 A;  5LD0 A;  4N0Z A;  4QQ7 A;  2J9H A;  2A4H A;  1YDK A;  4NHW A;  3EYT A;  5J4U A;  2JAD A;  1ERW A;  3EU3 A;  2JAC A;  2K9F A;  3HHV A;  1BED A;  4WBR D;  2R6K A;  2C8U A;  5AGY A;  3KMN A;  2LTK A;  4OCF A;  2V32 A;  1JHB A;  2NBS A;  4TXO B;  2ON7 A;  4NV2 A;  2F8F A;  4Q5R A;  1SD9 A;  5J9C A;  1GTU A;  1TDI A;  2JU5 A;  1SL2 B;  5D8I A;  5CRD A;  5IO2 A;  1DUG A;  2GQK A;  3IC8 A;  1OKT A;  3FHK A;  1PKW A;  4D73 A;  1THX A;  1GSF A;  4RI7 A;  3DWV A;  1U3A A;  4GQF A;  4IP1 A;  3WT2 A;  4WBJ A;  2CX3 A;  2LRN A;  5HFK A;  3BOA A;  2XC2 A;  4BL7 B;  1V57 A;  4ZL8 A;  3C8E A;  3IBH A;  4ACS A;  3W6G A;  1K3L A;  2I9H A;  4LMW A;  4ID0 A;  5IQY A;  4L5L A;  4HU9 A;  2P0G A;  4ECI A;  1EEM A;  4EF0 A;  2EIR A;  2B5Y A;  1QUW A;  2H30 A;  3ZYW A;  3MNG A;  5CP1 A;  5ECQ B;  3H79 A;  2H1G A;  3GKK A;  1AW9 A;  1AAZ A;  2B6M A;  5ECR B;  3IA1 A;  3CTG A;  1S3D A;  1SK2 A;  1HNA A;  4TR1 A;  5IMC A;  3VFI A;  5ABR A;  4PQH A;  1J9B A;  5HFI A;  1YY7 A;  4KSM A;  4HI7 A;  4JR4 A;  3UJ1 A;  1ZYN A;  1JZR A;  3I6A A;  3F4T A;  3JCM L;  2HI7 A;  3EPT A;  4EDY A;  1TTZ A;  2UZ8 A;  3GHA A;  3BCK A;  4ECJ A;  1TRU A;  2B7K A;  1ILO A;  3ERF A;  3GIX A;  3C1S A;  3HD5 A;  3HXS A;  3CSI A;  3RPP A;  2C1Y A;  2LRT A;  1HQO A;  4ZBD A;  4V2L A;  4WR4 A;  4EKZ A;  2IMK A;  4K9Z A;  3IAM 2;  1VF3 A;  1XW5 A;  3IXR A;  1ZMA A;  3TJJ A;  2OAC A;  1GRX A;  3ZL5 A;  4GST A;  1TI3 A;  2CX4 A;  3ZMK A;  3EVI A;  5IOX A;  9GSS A;  3RHC A;  4CHS A;  1YKA A;  3KGK A;  2WCI A;  3UAP A;  2YCD A;  1PX6 A;  1F2E A;  1F6M C;  1HD2 A;  2OA7 A;  1XXU A;  2FHE A;  5ECS A;  2WUL A;  4FYB A;  3TRP A;  2X8H A;  1A2J A;  1B9Y C;  4MLY A;  2REM A;  1OC8 A;  1GLQ A;  3I9V 2;  3LXZ A;  4HU7 A;  1OE7 A;  2F8A A;  2HSH A;  2VD0 A;  2LEG A;  3M9K A;  1TU8 A;  2MZC A;  4OMV A;  1JZO A;  1WOU A;  2QSI A;  4IVF A;  4K7N A;  3EC3 A;  1K3Y A;  4USS A;  1T00 A;  4N0V A;  3H4K A;  2LQO A;  1M2B A;  2H01 A;  3FR3 A;  4TR3 A;  3TUE A;  3UMA A;  5IMA A;  4KDY A;  1TW9 A;  1Z5Y E;  2LJK A;  4ILF A;  1YEP A;  3VWV A;  5LCZ A;  3MDK A;  2QKE A;  2FA4 A;  1G7E A;  3APS A;  4N10 A;  4MZC A;  2AV4 A;  2JSZ A;  5G30 A;  2B3S A;  3J7Y b;  1LU4 A;  1X5C A;  2TRC P;  4Z2T A;  3RPN A;  1F9M A;  4EIQ A;  3L9V A;  3ZZX A;  2OJL A;  1MD4 A;  1U3I A;  5AIV A;  5IPG A;  4TR0 A;  2E7P A;  3QPM A;  2O87 A;  5IMV A;  1DBY A;  4GCI A;  1B48 A;  1VF2 A;  4PNF A;  1YZX A;  1GSE A;  1HNC A;  2DJ2 A;  1QQ2 A;  1TU7 A;  4ULX A;  4KH7 A;  4CDO A;  4PXO A;  4F9Z A;  3TKR A;  3BD2 A;  3LFL A;  3CYN A;  1PGT A;  2YWM A;  1SK1 A;  3K8N A;  4G9H A;  2L5L A;  3FYG A;  5A4U A;  3TGZ A;  3EU4 A;  3KD0 A;  4EC0 A;  1T1V A;  5EL8 A;  4MNN A;  5G5E A;  3BCI A;  3FZ9 A;  4AF2 A;  3BBY A;  1MDK A;  4TVE A;  6GSY A;  2DJ3 A;  5KOX A;  4EXJ A;  4AJ6 A;  4XIH A;  3M9J A;  1FHE A;  3DEX A;  3TDG A;  3J7Y k;  2XPD A;  1XOB A;  6GSU A;  4A5P A;  18GS A;  4J2F A;  2IFQ B;  4OO5 A;  2K6V A;  4HDE A;  5JWO B;  3CMI A;  5GAP D;  5L71 A;  4AJ7 A;  1F3B A;  3P2A A;  5GSS A;  7GSS A;  2EC4 A;  4PTS A;  1XFL A;  4YKG A;  4KSO A;  4MZW A;  3N9J A;  1BG5 A;  3HVV A;  3LYP A;  2GQL A;  2H6X A;  5KN3 A;  3D5J A;  5IMF A;  4V1A g;  2OE0 A;  5D73 A;  3MYD A;  1XZO A;  4KE3 A;  1R26 A;  4LMV A;  3U6V A;  2RM6 A;  1R4W A;  2C4J A;  1V58 A;  1XW9 A;  2CT6 A;  2HRN A;  5HR3 A;  5JCW A;  4JRR A;  4GWR A;  5EVO A;  3TRX A;  3IPZ A;  4KCA A;  1TRV A;  1XW6 A;  1GLP A;  4L0W A;  4ZIJ A;  4MCU A;  5F07 A;  3TJK A;  3DML A;  4KGI A;  1VF4 A;  2B7J A;  2QA1 A;  1TJD A;  2R0C A;  3FEU A;  4RUV A;  2DKI A;  3HJP A;  4IEL A;  3A2W A;  4GTU A;  1O85 A;  5F06 A;  2PMT A;  1UVZ A;  1A2M A;  2P31 A;  4TN8 A;  4BVY A;  1KNG A;  1A23 A;  1O6J A;  3IE3 A;  2HRF A;  3CBU A;  1G6W A;  4I2T A;  1T3B A;  4E8H A;  4XCS A;  4J56 E;  4MAB A;  1DE1 A;  5F0G A;  3VLN A;  2L4C A;  4XRD A;  1EV9 A;  2PVQ A;  2BJX A;  1V40 A;  4KB3 A;  5HR1 A;  1X9M B;  2V41 A;  1MDI A;  3US3 A;  3W8J A;  1ZCP A;  3TKS E;  4I97 A;  1T4Z A;  3HCZ A;  4L8E A;  2YV7 A;  4ML1 A;  1ZL9 A;  4PNG A;  3Q6O A;  2WDU A;  1LJR A;  4IS0 A;  3FZ4 A;  2JZS A;  3MWH A;  4POB A;  1NW2 A;  3HY2 A;  4G0K A;  1TK0 B;  2CA8 A;  2VOC A;  2VCT A;  4I5Q A;  3AY8 A;  1GL8 A;  1Z9H A;  3P7X A;  4ZB6 A;  4Z2R A;  2H0H A;  4MH2 A;  3V1W A;  2B5E A;  1QXH A;  4O92 A;  2EIQ A;  1XVQ A;  6GSS A;  4K8M A;  2AYT A;  5DCH A;  3KJY A;  4ZB8 A;  5ECH B;  2JSY A;  2R5G A;  2WB9 A;  4IJI A;  4H86 A;  3QD9 A;  3LWA A;  3GFK A;  3ZIT A;  3TCO A;  3UBK A;  2VM2 A;  1AQV A;  4BL7 A;  1X9W B;  3KMO A;  1B4P A;  3KP9 A;  1ACV A;  1XWC A;  4XS1 A;  3VWW A;  5B6M A;  2CAQ A;  3F6F A;  1C72 A;  3EE2 A;  2A4V A;  3OR5 A;  4WF5 A;  2L4Q A;  2H19 A;  2I3Y A;  5INY A;  3P90 A;  2DIY A;  2FWG A;  2V2G A;  4TXO A;  3A3T A;  4OD7 A;  3M1G A;  1YJ6 A;  3D21 A;  4K7O A;  2GTU A;  2PBJ A;  4HJM A;  2VCW A;  5D96 A;  3EUR A;  4PUR A;  2DBC A;  1RW1 A;  5HR2 A;  5AIS A;  2KUC A;  4MPF A;  3KM6 A;  4XHM A;  2H73 A;  4YH2 A;  2GSQ A;  2KHP A;  5D9W A;  1AUC A;  3KP8 A;  2IMI A;  4I8B A;  4K5S A;  3FR9 A;  3ZIV A;  1GSD A;  2FUG 2;  1OVN A;  5IMZ A;  1XPV A;  1GTA A;  2H70 A;  1CQG A;  1WPI A;  2HZE A;  4WF4 A;  3IOS A;  5DQY A;  4X0X A;  2GSR A;  1ZOF A;  4TW5 A;  4CW9 A;  1AQX A;  3C73 A;  4KX4 A;  4K2X A;  2YWO A;  3GV1 A;  4N11 A;  4WXT A;  4G2E A;  4IP6 A;  1DE2 A;  5EY6 A;  1M0U A;  2ES7 A;  4RQX A;  1HYU A;  3APQ A;  2K8V A;  1XWG A;  4PX1 A;  3FK8 A;  3GTU A;  2H75 A;  3FY7 A;  5DAK B;  2HYX A;  2L59 A;  3D0Z A;  2YZH A;  2DJ0 A;  1TRS A;  2J23 A;  4ZB9 A;  5G31 A;  4K5R A;  1ABA A;  1CQH A;  4Q5N A;  5G5F A;  2DML A;  4KND A;  1EOH A;  1J0F A;  2MBT A;  1WWJ A;  4DSQ A;  3QAG A;  2OE1 A;  1TI1 A;  4Q5Q A;  1GP1 A;  2HNL A;  3RHB A;  1TKD B;  2Z9S A;  2HE3 A;  1V9W A;  1OYJ A;  1M9A A;  2R0G A;  3GL3 A;  4JU5 A;  4HUA A;  3UOM A;  5H5Q A;  2VCZ A;  2BMX A;  2HZF A;  1VF1 A;  3FKF A;  1SKW B;  2H1B A;  3LOR A;  4CY6 A;  2CV4 A;  2H74 A;  4TR1 B;  2VL3 A;  2OAD A;  3LSZ A;  4XRA A;  3NZN A;  2EIO A;  5ECK B;  1EWX A;  2LJR A;  1J08 A;  4J57 E;  2TIR A;  3WGE A;  1UA5 A;  1JZD A;  1FB0 A;  4L5O A;  4GQC A;  5JCU A;  1WIK A;  1H75 A;  4KUN A;  3VUR A;  2YJH A;  1R5A A;  17GS A;  3GNJ A;  3KTL A;  3ZVJ A;  2VL2 C;  2R3X A;  2CVD A;  4G10 A;  1AQW A;  2C0D A;  2OBI A;  2V1M A;  2C80 A;  1XBS A;  3F9U A;  3GUR A;  2R2J A;  1ST9 A;  4IW9 A;  1Z7R A;  2I1U A;  4XS4 B;  1Q98 A;  2YZU A;  4O5U A;  5DQS A;  2HFD A;  3L9U A;  4HZ4 A;  1OC3 A;  1K0A A;  2XHF A;  2VL2 A;  3FR6 A;  4YAP A;  3WGD A;  2IFQ A;  4POL A;  4N30 A;  2IWT A;  5DJL A;  4IQ1 A;  2YN1 A;  3ZVJ D;  4TXV A;  4V2N A;  2MMA A;  1SYR A;  3F3Q A;  5H5S A;  4X4J A;  6GSX A;  4G0I A;  3TOT A;  4Z7X A;  4IHU A;  1USB A;  2CVB A;  4BPY A;  4OFN A;  1QFN A;  4HJ2 A;  2QGV A;  2RLI A;  4JED A;  1T8E B;  2GS3 A;  1SYX A;  2E2M A;  2PGT A;  2KOK A;  1Q4J A;  1MDJ A;  1BAY A;  2YNX A;  4K0N A;  3UBL A;  2LQQ A;  3TJG A;  3EIN A;  4HQS A;  3C7M A;  1PL2 A;  2B1L A;  1XVW A;  1SEN A;  1UN2 A;  3KTB A;  1TOF A;  3QAV A;  2HSY A;  3IK7 A;  4F0C A;  3KCM A;  4TRX A;  4JR6 A;  4K0G A;  1EOG A;  3ERG A;  2A2P A;  4MZB A;  5J9B A;  2MYG A;  1EV4 A;  4F2I A;  1N8J A;  1FB6 A;  4ML6 A;  6GST A;  1KTE A;  1MTC A;  1TRW A;  2VO4 A;  2OBK A;  1RK4 A;  5A5K A;  2H8L A;  1X5D A;  1JLV A;  4KF9 A;  4NMU A;  2IJY A;  1FVK A;  3HJM A;  3VI5 A;  2CZ3 A;  3F3R A;  2KP2 A;  1MEK A;  3I69 A;  1TK8 B;  1G0T A;  4XS6 A;  2V6O A;  4ICY A;  3EWL A;  5D93 A;  5DBQ A;  3NOF A;  3IR4 A;  2ON5 A;  2H1A A;  2YWN A;  3G7J A;  3I43 A;  3UAR A;  2L6D A;  1A0R P;  4ZBA A;  3NIV A;  4YQM A;  2RUF A;  1ZYP A;  4NXI A;  3GKM A;  2FA8 A;  5KN1 A;  3Q74 A;  3WYW A;  3L78 A;  4JBB A;  1SD8 A;  1FAA A;  1G7O A;  12GS A;  2F3M A;  3L4N A;  1GSS A;  1Z3E A;  4BWQ A;  5ID2 B;  3M3M A;  5IO0 A;  4MDC A;  4FIW A;  2ZCT A;  3LW9 A;  2PER A;  5CRG A;  1EZK A;  1SJ6 A;  3IK9 A;  2C0F A;  2PPT A;  2A2R A;  1K0M A;  3TKS C;  2OKA A;  1ZYQ B;  5DAK A;  4Z2U A;  2DKH A;  1GTB A;  2KP1 A;  1BJX A;  2HRK A;  3LXT A;  4RI6 A;  1SL0 B;  5ECL B;  3GMF A;  4TR4 A;  2WGR A;  2AJQ B;  3F0I A;  2CZ2 A;  5IM9 A;  4O5R A;  4G19 A;  1PA3 A;  2GT5 A;  2GSS A;  2H71 A;  2PVO C;  3VK9 A;  3D6I A;  4ZL9 A;  1PN9 A;  1GH2 A;  1SJZ A;  3ERW A;  2G2Q A;  3Q18 A;  2P5R A;  3BJ5 A;  2X64 A;  5AIX A;  2HXK A;  2C3N A;  4QL7 A;  3TKP A;  5GST A;  2GZZ A;  4ZIL A;  1THO A;  3TKQ A;  4PGT A;  1PX7 A;  2H6Y A;  1BX9 A;  10GS A;  1WJK A;  3VI7 A;  1A2L A;  3GYK A;  1Z6N A;  1M99 A;  2M72 A;  5AN1 A;  8GSS A;  1F37 A;  5D9X A;  1FOV A;  2WRT A;  3G7I A;  2KLX A;  5JCG A;  3C1R A;  5DDL A;  2N5B A;  4QL9 A;  4F82 A;  4KDU A;  5IOW A;  2JZT A;  4ZXG A;  1W89 A;  4WKW A;  2X8G A;  2BTO T;  2YPM A;  2VCQ A;  1URM A;  4MJE A;  4MF7 A;  1PSQ A;  1E6B A;  4KAE A;  1XIY A;  2IPA A;  1AC1 A;  2C0E A;  3D4T A;  1XOA A;  3ZFL A;  3LEF A;  5G1L A;  3DD3 A;  4EVM A;  3U5R E;  5B7C A;  3TJB A;  4LA1 A;  4CY8 A;  3UL3 A;  1G6Y A;  2OE3 A;  3GX0 A;  4MPG A;  5DAL A;  5GAN D;  2VD1 A;  4DEJ A;  1GSQ A;  4K2D A;  19GS A;  4ZBB A;  3HYP A;  2VLT A;  1GUH A;  5ECM B;  4LL4 B;  1FOH A;  1YEX A;  2O8V B;  2GGT A;  1B8X A;  1RQM A;  2B1K A;  2NTO A;  3LGC A;  4MP4 A;  1XCC A;  2YOI A;  3IV4 A;  2IYJ A;  3R3E A;  1UC7 A;  2AAW A;  4IJ3 A;  5ECP B;  3E0U A;  3CSH A;  1I9D A;  2ZNM A;  4TKY A;  2HRA A;  4X43 A;  4P3Y B;  3DVX A;  3D22 A;  1ERU A;  2H76 A;  3HZ8 A;  4GLT A;  5G1K A;  3A2V A;  3O3T A;  2G0F A;  1U88 A;  2VAF A;  3FZA A;  4HS1 A;  5CRH A;  3GKN A;  1T7P B;  3L9S A;  3MAK A;  2C3Q A;  1GSY A;  1BQ7 A;  2YP6 A;  1T4Y A;  5ECO B;  1WE0 A;  3LQ7 A;  6GSW A;  4MJA A;  5CRE A;  3TB2 A;  1VRS D;  2FCH A;  4NHZ A;  3M8N A;  5E4W A;  5IPH A;  4O5Q A;  4L0U A;  5J5N A;  2GLR A;  3CTF A;  4EDZ A;  3KXO A;  3HKR A;  3A5I A;  1SK0 A;  3CSJ A;  4O7H A;  4DSR A;  2E0Q A;  20GS A;  4EUY A;  2O85 A;  4D73 B;  2F9S A;  4YQU A;  3EMX A;  1Z6M A;  3HDC A;  1WP0 A;  5KOW A;  2H66 A;  2O7K A;  1GTI A;  5IMD A;  4EO3 A;  2AB6 A;  1SL1 B;  1Y25 A;  4V1A p;  4KW6 A;  3ISO A;  4Q5F A;  4BVX B;  1YF0 A;  2V6K A;  1KEB A;  3N5O A;  1PD2 1;  2F51 A;  4PQ1 A;  4DVC A;  3IAS 2;  4BA7 A;  2IMF A;  1NM3 A;  5KN0 A;  1O81 A;  3EMP A;  5JWQ B;  5ENU A;  2WS2 A;  3GUS A;  5KEJ A;  1VGL A;  3A5W A;  1A24 A;  1MD3 A;  4FH8 A;  5J3R A;  5CRW A;  1JLW A;  3RDW A;  1JFU A;  3M0F A;  2VCV A;  3CRT A;  2RUE A;  1HNB A;  3QMX A;  2HLS A;  5D9T A;  2DC5 A;  5FT3 A;  4BVY B;  5DVB A;  1K0O A;  1K0D A;  1ZYE A;  1EGO A;  1DSB A;  1O8X A;  1X5E A;  4OO4 A;  3TRQ A;  2E2G A;  2YWI A;  4PUA A;  1GWC A;  4IQA A;  2VUP A;  2L57 A;  2LRC A;  2WZ9 A;  2GST A;  1M2A A;  2XBI A;  5A4W A;  3G7Y A;  1B4Q A;  5CYY A;  4IN0 A;  1O73 A;  3PPU A;  1SKS B;  3ZIJ A;  1AXD A;  3PH9 A;  1AIU A;  1U6T A;  3ME7 A;  2LJA A;  2H6Z A;  3W8S A;  3R2Q A;  2K8S A;  5JWR B;  1IYH A;  4KA0 A;  5ELG A;  1OE8 A;  1GSU A;  2FWF A;  4PUF C;  2DMM A;  1TXX A;  3ED3 A;  3HJO A;  4POM A;  3IC4 A;  5DJM A;  1GNW A;  2GZY A;  2CVK A;  2DJ1 A;  2H0G A;  2LV3 A;  3PGT A;  4JE1 A;  3QFA C;  2N5F A;  2DJJ A;  3RAZ A;  1TP9 A;  3PIN A;  4NAX A;  1GUM A;  1FW1 A;  1PKZ A;  1YKC A;  5GZZ B;  4DSS B;  2MBS A;  3TKS A;  5A4V A;  1M9B A;  4YAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...