5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
5HR3A 4XHMA 3LJRA 3LXTA 1FVJA 1SKRB 2FWHA 5JWRB 3EMXA 2K18A 2L5LA 4NHZA 2L5OA 1GWCA 2HXKA 3IHQA 3ZMKA 5HFGA 4GF0A 3TRQA 2IMKA 4O7HA 1T4YA 3G7YA 4QL7A 1G7OA 4GSSA 1V58A 1VF2A 2RUEA 1EP8A 2HZFA 3AY8A 3IA1A 2OACA 3D22A 1IYIA 4ZL7A 2RM6A 4YQUA 3PGTA 1PKWA 2JZSA 2GSSA 1BG5A 3Q18A 1AXDA 3VWXA 3FZ4A 1GSYA 2GSRA 2I3YA 4TR4A 4HJMA 4ZBDA 1ZCPA 2XBQA 2OE0A 4Q5FA 1GUKA 4LA1A 1MDJA 1ML6A 1BAYA 1TK8B 1G0TA 1SL0B 3QMXA 1SENA 4Z7XA 2CZ2A 5HR1A 1BQ7A 1ERVA 5ECIB 2DMLA 3A2VA 5B8BA 1B9YC 1Y6EA 2I4AA 3WT2A 2YV9A 1ON4A 5FHIA 1M99A 4G2EA 4V2NA 3DIEA 4WKWA 4IP6A 5EY6A 2CX4A 2H1DA 2LUSA 1OE7A 1O73A 2XPDA 1GSFA 1AQXA 2YOIA 5J3RA 3F3RA 4V2LA 4NWYA 1YKCA 2L59A 6GSTA 2A2SA 1TRWA 1SKSB 2AAWA 4QQ7A 2B7JA 4X43A 4EXJA 1BYEA 1AQWA 3C8EA 3GX8A 4I6XA 1TU8A 5INYA 2HYXA 2B1LA 1SD8A 1JZOA 5DDLA 2PN8A 1JLVA 1Z9HA 3HVSA 5CNWA 1WOUA 2RLIA 2E2GA 1V98A 3M9KA 4POBA 3FYGA 2B5YA 2PVQA 3HYPA 1OKTA 4TW5A 2OA7A 3KP9A 2IY2A 2X8CA 3Q74A 1XWKA 4FO5A 4KSMA 3UJ1A 1EV9A 1XCCA 4PNFA 1GTUA 1K0DA 5IMDA 1YF0A 2IMFA 4POKA 4F9ZA 1Z7PA 5JCUA 4JU5A 3UMAA 1YKAA 2XPEA 1LBKA 4MA9A 3HY2A 1U3AA 2HSYA 1LU4A 3U6VA 1GSDA 2PUKC 1SYXA 1XWBA 1YDKA 1KNGA 3GL5A 3EE2A 2I1UA 4CHSA 4ZBAA 3QAWA 1PX7A 1EP7A 3L9SA 11GSA 4L8EA 5E4WA 2AHEA 1TRVA 3F3QA 5ECNB 4KA0A 3CTGA 1J9BA 1ILOA 1ZMAA 4ACSA 4AJ7A 3KP8A 5IIZA 4ZB9A 4XTSA 1O7UA 4MPFA 3ZIVA 7GSSA 3VI5A 2J9HA 1NHYA 5B6MA 5ELAA 1XWAA 4HU9A 1AUCA 1X5CA 3GH6A 4K7OA 18GSA 1UA5A 3N5OA 2HE3A 3D21A 2MMZA 3IR4A 1VF4A 3BD2A 3DD3A 3ZRDA 1FAAA 1B8XA 2M46A 4HZ4A 1YY7A 3H8QA 2C1YA 12GSA 3GRXA 5DBQA 5GAND 2VO4A 5A4WA 4WEYA 4LLRA 4GRFA 5C00A 2CVKA 6GSYA 4FIWA 3BJ5A 2L4CA 3UL3A 2IPAA 4PUFC 3US3A 4XRAA 2HNLA 5AN1A 1PKZA 1GSUA 1R5PA 2H70A 3G7JA 2YV7A 1T3BA 5L71A 1PGTA 2CVBA 4GLTA 4TN8A 2VL9A 1YEPA 1O8XA 4RQRA 1WPIA 2LRCA 2MMAA 4KX4A 2VCZA 2CV4A 2GQKA 3GL3A 4N10A 3I9V2 1R7HA 2GQMA 5AISA 4DSSB 1H75A 1A0FA 2IN3A 2KOKA 5ELGA 1QXHA 5J4UA 3NZNA 2FLSA 1BJXA 2HFDA 19GSA 4P3YB 2VAFA 1EGRA 3D0ZA 1KBNA 3QAVA 1F3BA 3U5RE 4HU7A 2G2QA 1XOBA 3HD5A 2MBTA 2H6ZA 3D6IA 3QDNA 1TW9A 2AB6A 2F3MA 2VCWA 2DIZA 2EC4A 3IDVA 4NPBA 3QR6A 1VRSD 4GQCA 4ILFA 2DJJA 5AIVA 1ZGNA 2H76A 2MBSA 2B1KA 2R37A 3GKKA 1I5GA 1Z6NA 4BA7A 1OE8A 1OC9B 1HYUA 3O6TA 3ZFLA 3KMNA 2PPTA 4EDZA 4NHWA 3KJYA 4E8HA 5ECPB 4KE3A 3M0FA 1PL1A 4X0XA 1GP1A 3FY7A 2A2RA 4IJ3A 3QOUA 3HZ4A 1WRYA 1T8EB 1GTIA 2YANA 2E7PA 2GTUA 4ECCA 4AF2A 1Y25A 3QCPA 3KEBA 2C0GA 5D8IA 2VLUA 1GUHA 5IPGA 5DQYA 4TXVA 2H30A 1ERTA 3KTBA 2JZRA 5GSSA 1Z7RA 1F6MC 2WZ9A 4F82A 3UAPA 3VPQA 1J0FA 5EPFA 3GH9A 2FA4A 4KAEA 4ZXGA 2REMA 4KB3A 3TJKA 1XVQA 20GSA 5KN1A 3ME7A 1NM3A 4BPYA 3HDCA 5G1LA 3PINA 2H6XA 4K8MA 4BL7A 5D9VA 2HRFA 2PERA 2IJYA 2YCDA 5A5KA 4WBJA 2CZ3A 3LFLA 5FT3A 1HNCA 4MJCA 3GTUB 4MF6A 3VURA 5G5FA 1TRSA 3F0IA 4KGIA 1SL2B 1K0MA 1PN9A 3RHBA 4MCUA 1M2AA 1EEMA 1TP9A 2CAQA 4O32A 1R4WA 4RI6A 4XIHA 1FO5A 5JWQB 1XFLA 3Q6OA 4DEJA 1M7TA 3CSHA 4WR5A 3F4TA 1X5DA 2B5XA 3GKNA 2E0QA 2HRNA 2VCVA 3BBYA 5KN2A 2WJUA 1MTCA 2PWJA 3QAGA 4QL9A 4F0CA 2XHFA 2MMOA 4DSSA 5B7CA 3J7Yk 4NV2A 1R26A 2FY6A 3TKSE 4X1UA 6GSXA 2OBKA 5HFKA 3UBLA 4JR6A 4KNDA 1ZYEA 5DJMA 5HR2A 4G9HA 4ML6A 3F4RA 4MZWA 5G30A 1YEXA 4K9ZA 4ID0A 4L5LA 1XZOA 2ZUPA 3MNGA 4WF5A 1M9AA 4YH2A 2GZZA 3A2WA 1MD4A 2QKEA 3ZVJD 1GL8A 4XS1A 1ERUA 1XWGA 5CRGA 3FW2A 3PR8A 3FKFA 1QUWA 1GTAA 3TCOA 3GUSA 4PX1A 5ID2B 5KEJA 3KH7A 1W89A 3ZZXA 3KD0A 1DUGA 1EV4A 4TRXA 2C0FA 1OC9A 4CDOA 1V40A 3BOAA 1VF1A 4JBBA 4L5OA 3V1WA 3GMFA 4I97A 1PL2A 3EU4A 4LL1B 1XXUA 1M2DA 4GSNA 2L57A 4KW6A 1KTEA 2EIRA 5DAKA 5JWOB 4I2TA 1F2EA 2GZYA 2LNSA 5ECHB 4IJIA 2P31A 2CA8A 3HHVA 5HFIA 5J41A 3GX0A 2I81A 5LNKe 2F9SA 5HR0A 1R5AA 4PQIA 2VLVA 4IKHA 3ERGA 2VL2C 1PSQA 1C72A 3TKPA 2H1GA 2FWEA 3C71A 4MLYA 2IMIA 2DMMA 2C3NA 2YJ7A 5FWGA 1LJRA 3KCMA 2OE3A 3I43A 1HNBA 2XC2A 3DYRA 1XOAA 2EIQA 4WBRD 3LEFA 2VL2A 4BWSA 3MDKA 3IK7A 4EKZA 2KP2A 4ZBBA 2IYJA 2CT6A 3L78A 5CREA 4I8BA 2F8FA 4Q5QA 4YQMA 2JU5A 2V1MA 4RQXA 1K0BA 5ABRA 3O3TA 1YF1A 4EDYA 4OFNA 1DE2A 2N5FA 2D2ZA 1YZXA 3HXSA 3UIWA 1SKWB 4K1FA 2E2MA 2V6KA 2IMDA 3FRCA 5GAPD 1GTBA 1A2MA 3P2AA 2LV3A 1A2JA 3LQ7A 4HZ2A 1K0NA 4MF7A 5DCGA 1GNWA 3CRTA 2LQOA 5IPHA 2B5EA 2RM5A 1GSSA 4IP1A 4ISDA 4MP4A 2WS2A 5D96A 5ECQB 1XW5A 4IHUA 3ERFA 1M9BA 1AIUA 4FYBA 3C7MA 2PGTA 5CRWA 2F8AA 4K7NA 2H0GA 3WYWA 1Z5YE 1F37A 1JZRA 3CYNA 1UC7A 3HJMA 1S3AA 2C4JA 3DEXA 1XBSA 4EUYA 2TRCP 5CP1A 2LJRA 1TKDB 1YQ1A 4MZBA 4KDXA 3MSZA 1WJKA 3RPNA 5CRDA 5H5SA 1B4PA 3GV1A 2JSZA 2LS5A 3L0HA 4OMVA 3NOFA 2FWFA 2HZEB 1NW2A 1VGLA 2EIOA 2AUVA 1EOGA 3GIXA 3PH9A 4F2IA 4TR1B 4F0BA 2WULA 2X8HA 2C3QA 3DRNA 4IN0A 4H86A 2OJLA 5ID2A 4YAPA 3FK8A 4PURA 3CTFA 2HT9A 3EWLA 1TOFA 1MEKA 2WB9A 1V2AA 1U87A 4HEA2 2X8GA 4EO3A 1H4OA 2OADA 4MF5A 3WGDA 3H1NA 4DVCA 3K8NA 5AGYA 1TXXA 3MAKA 1I9DA 4TVEA 3ZFBA 4K0NA 1SU9A 1K3LA 4HJ2A 1QK8A 4L0UA 3ZITA 5LCZA 4TKYA 5ECRB 1N8JA 2GS3A 3VWVA 3ZTLA 4PQHA 2IIYA 4XS6A 3ME8A 4D73B 2NPBA 2H1AA 1O8WA 1TK0B 3IC4A 2YZUA 4WXTA 2JZTA 4IQAA 1M0UA 2WFCA 3UOMA 3EU3A 1B48A 5H5RA 1GLPA 1ZL9A 3FHKA 2DJ0A 3TOUA 2H66A 4LMVA 3GNJA 2AJQB 2LNTA 1MDIA 2VIMA 5J9CA 2H01A 4MDCA 2VOCA 4J56E 4AJ8A 1THOA 4OWYA 2V6OA 5G31A 5J5NA 1BEDA 4MH3A 3BCIA 4XS4B 1THXA 1K0AA 3HA9A 1QMVA 2FCHA 3DGQA 2DJ3A 2C0EA 5COHA 2QC7A 1BX9A 5D73A 4POLA 4HS1A 4KUNA 1SK0A 1FB6A 4AJ6A 1OVNA 2P5RA 3TJFA 4ECJA 2K6VA 2YNXA 4IS0A 2LJAA 1HD2A 2A4VA 1GLQA 3VWUA 1GRXA 3FR9A 3ZMLA 1E2YA 1SYRA 3FZAA 1A24A 1WP0A 3EURA 3TKSC 2H0IA 2WCIA 5F07A 4EL1A 3QPMA 1MD3A 2VCTA 2GSTA 3D4TA 1WMJA 1V57A 3LXZA 3UVTA 4ZL9A 4PNGA 2VM1A 4POMA 2HZEA 5A4VA 2K8VA 2C80A 2R3XA 1A0RP 2V32A 4Q5NA 1NHOA 3TRXA 3RHCA 3EINA 4ZB8A 3HKRA 2H71A 4MH2A 5CAXA 3GFKA 1A8LA 2CQ9A 3HVXA 3KM6A 4ZILA 3VK9A 3VWWA 3TJGA 3VI7A 3M8NA 1UN2A 4V2MA 2IL3A 4JRRA 1AQVA 1U88A 2PVOC 4HQZA 3UVHA 4ZB6A 3GHAA 2GLRA 2ZNMA 4MJBA 3GSTA 1ZYQB 3TOTA 1VF3A 4KDYA 5IO2A 3IOSA 1SJ6A 14GSA 2CAIA 1N2AA 2ON5A 3IPZA 2AV4A 4N0ZA 3ERWA 2GZPA 5D9WA 2C3TA 1RK4A 2GVPA 2NDOA 2O89A 2ZCTA 3WGEA 2MYGA 2LKUA 3TRPA 4D73A 13GSA 4OFTA 1TI3A 3S9FA 3TUEA 4XCSA 1XVWA 1Q4JA 3LGCA 5B8AA 4DSRA 5GZZB 3L4NA 3DKSA 4NMUA 4XRDA 4OFMA 4MJEA 4WETA 2DJKA 2M72A 1PX6A 1FW1A 4O5RA 5D9XA 3IV4A 4IVFA 1TDIA 2FD3A 1QFNA 5HQPA 2YWNA 1T7PB 1Z6MA 2TIRA 3F8UA 3LG6A 2QSIA 1K3OA 4XS4A 1XPVA 2O7KA 4N0VA 5G1KA 4LMWA 3G9BA 2IWTA 1TI1A 2B7KA 3GKXA 2LSTA 3TDGA 3CBUA 4HI7A 4MMMA 3QFBC 4K2DA 1G6YA 1SD9A 2H19A 1CQHA 4KSOA 2MMNA 2H0HA 3D4MA 1T00A 4TXOB 4PUAA 1B4QA 1QGVA 4EVMA 2DJ1A 3W8JA 1GNEA 4OCFA 2GQLA 3CSIA 3HCZA 3C73A 3GSSA 2LRTA 2FA8A 2H75A 3DXBA 2R6KA 1X0RA 2ES7A 2ON7A 2L6DA 3APSA 4BWQA 3EMPA 4E8EA 2L6CA 2JACA 4MJAA 2VM2A 5ECSA 4PGTA 1URMA 2FHEA 2LJKA 4KCEA 5F0GA 2AYTA 3RPPA 3WGXA 4MABA 1JFUA 4V1Ap 1OYJA 1X5EA 1XIYA 5DJLA 4K0GA 3RDWA 3G7IA 1TTZA 2H1BA 4V1Ag 3H4KA 2IFQB 3F9UA 5C04A 1RW1A 3P90A 2MZCA 1B9XC 4KH7A 1TJDA 5IM9A 5A4UA 3HVVA 1Q98A 3L9VA 1WE0A 1O6JA 1NSWA 1RQMA 1FB0A 1DBYA 5CYYA 17GSA 4MPGA 2DLXA 3IAM2 5DCHA 4NAXA 3F4SA 5G5EA 3FZ5A 1SJZA 3VLNA 1EZKA 3KMOA 1GUMA 2M80A 5ECMB 1ABAA 3J7Yb 5F06A 3C1SA 4KDUA 2GGTA 4ML1A 9GSSA 3IRAA 2RUFA 3NIVA 2B3SA 2NBSA 3CSJA 4FYUA 4N11A 1PA3A 3CRUA 2BMXA 1USBA 4NXIA 5J9BA 4MZCA 2HLSA 4HUAA 4YQVA 4FYCA 2G0FA 3I6AA 5F05A 4KCAA 3GTUA 1EOHA 3LYKA 4FH8A 3DMLA 3ZYWA 2FNOA 2I9HA 1W4VA 3IXRA 3KIJA 5LD0A 2BJXA 2L4QA 3TKRA 1JLWA 3KH9A 3RBTA 3LORA 1S3CA 4CW9A 2WDUA 1ST9A 1DE1A 1TK5B 1TRUA 2C8UA 1JZDA 3DVWA 4GTUA 5IOXA 3VFIA 1T1VA 4Q5RA 1V9WA 2O85A 5GSTA 4JEDA 2R2JA 4TR3A 1ZZYA 4OCEA 3UARA 4HOJA 3CMIA 5ECOB 5JCGA 3ZLPA 2DC5A 4TXOA 3ED3A 3HJOA 16GSA 4G19A 5IMZA 1TU7A 3FEUA 4JZQA 3P8WA 3TJJA 1K0OA 5IO0A 1M2BA 4OO5A 3Q19A 1FG4A 4OO4A 4PXOA 3APOA 1FOVA 3DWVA 1K0CA 5IOWA 2YPMA 1OC8A 2IFQA 4EC0A 3GA4A 4ULXA 2GSQA 3L9UA 4ECIA 2YJHA 1A23A 4J2FA 1U3IA 4GWRA 2DSAA 3I69A 2VD0A 3O76A 2PU9C 3TJBA 3KZQA 3JCML 1QQ2A 3FZ9A 1O85A 4K7IA 2YZHA 3HJPA 2OBIA 3LWAA 1E6BA 1F9MA 1KEBA 3HZ8A 2DIYA 2VLTA 3EYTA 3LSZA 2KUCA 2CX3A 2PBJA 3D5JA 4WR4A 2YWMA 3F6FA 3M3MA 2HSHA 1MDKA 3W6GA 3OR5A 4HQSA 3A3TA 3KXOA 4OD7A 3EC3A 2H73A 3VPTA 1X9SB 1HQOA 3ZIJA 4IQ1A 4TR0A 5B6NA 2LTKA 1WWJA 2DJ2A 2H8LA 4AGSA 3IE3A 2H6YA 2V2GA 4F03A 2N5BA 4O92A 1GSQA 1SJIA 1PD21 1XWCA 5IMVA 3M1GA 1OAZA 5IMAA 3P7XA 1OKDA 2VCQA 2V41A 2DBCA 4J57E 5G2ZA 5CO3A 2RIIA 4ZL8A 1PRXA 3KGKA 3IAS2 3F6DA 2NVLA 1ZOFA 3ZREA 4JE1A 2X64A 3FR3A 3TGZA 1GSEA 1K3YA 3W8SA 4G10A 4IW9A 1S3DA 3FR6A 2YN1A 5DALB 3F63A 1YJ6A 3C1RA 3BCKA 1GH2A 1JZWA 2TRXA 1XW9A 4HDEA 5F8BA 1A8YA 2Z9SA 4GQFA 3ISOA 2KP1A 4ECBA 4NV5A 3E0UA 4IGJA 2KLXA 2JL4A 1F3AA 2VL3A 3UEMA 2QGVA 1AW9A 5IMCA 1OC3A 2KHPA 2ALBA 1J08A 3GURA 3A5WA 3WT1A 2FGXA 3R2QA 2N5AA 5ECKB 1SK1A 4RUVA 5EL8A 5KN0A 2YWIA 3RAZA 6GSSA 1PQNA 4YAVA 4TR1A 1JHBA 1XW6A 2R4VA 2O8VB 10GSA 2OKAA 3TKSA 1U6TA 2HI7A 2LEGA 3TB2A 2K9FA 3H93A 5D9TA 2FWGA 2LRNA 5IQYA 5DAKB 1EWXA 1PMTA 3DVXA 6GSUA 1SK2A 2XBIA 3N9JA 4EE0A 6GSVA 1UVZA 5JCWA 5ENUA 3LYPA 3M9JA 5CRHA 2B6MA 3ZL5A 2P5QA 2GDRA 1IYHA 1SL1B 4K6XA 4I5QA 1HNAA 3GKMA 5ECLB 1CQGA 3EVIA 3QD9A 2LQQA 4EF0A 2WRTA 4WF4A 3TKQA 2NTOA 2GT5A 5KN3A 4N30A 4IBPA 4RI7A 3A2XA 1AC1A 1EGOA 3E3EA 2JADA 5H5QA 2IMEA 2BTOT 4TOPA 1AAZA 6GSWA 2X99A 2VCXA 1FHEA 3MWHA 1G6WA 2H72A 2J23A 3ZVJA 1WIKA 3CXGA 4BVXA 1X9MB 2R5GA 3IK9A 2C0DA 4IELA 5D93A 3UBKA 3KTLA 2O87A 5DQSA 4I2UA 1GULA 3SBCA 4MK3A 1A2LA 3GYKA 4GCIA 1FVKA 2VD1A 1ERWA 2FUG2 5EVOA 4ZIJA 3GN3A 2GT6A 2YP6A 5DVBA 2P0GA 1Z3EA 2VUPA 1T4ZA 2YWOA 5E59A 5AIXA 3IBHA 4LL4B 5DALA 3APQA 2K8SA 3E9JB 2OE1A 3H79A 4JR4A 2H74A 2F51A 3QFAC 2CVDA 4DSQA 4BVYA 2JSYA 1EEJA 2WGRA 5IMFA 3SWLA 22GSA 4PQ1A 8GSSA 1G7EA 1O81A 4GXZA 1ACVA 1DSBA 4GSTA 2PMTA 1X9WB 4L0WA 3WD6A
chains in the Genus database with same CATH superfamily
5HR3A 1TUHA 1BAOA 3LJRA 1B20A 1TU5A 4XHMA 3LXTA 1FVJA 1SKRB 2FWHA 5JWRB 1V74A 3EMXA 2K18A 2L5LA 1IYYA 4NHZA 4KZ1A 2L5OA 1GWCA 1UW1A 1IVXA 2HXKA 2SBLA 3IHQA 1MOLA 1TP6A 3ZMKA 5HFGA 4EBGA 4GF0A 3TRQA 2IMKA 4KFDA 1WMNA 4O7HA 2CKFB 1GS3A 4ZM8A 3A5EA 1T4YA 3G7YA 4QL7A 1G7OA 3UL5A 4GSSA 1V58A 1VF2A 2RUEA 1EP8A 2HZFA 3AY8A 3B7CA 1A67A 2KF6A 4OVMA 3KE7A 3IA1A 2OACA 3D22A 4LZIA 3PCSA 3STDA 1IYIA 2BU4A 4ZL7A 2RM6A 1W2ZA 6GSPA 4YQUA 5AEUB 3PGTA 1PKWA 1VQ43 3G4S3 2GSSA 1TIJA 2JZSA 3FMWA 1BG5A 3Q18A 1AXDA 1AVKA 3VWXA 5FW5A 3FZ4A 1GSYA 1CH0A 1W01A 1PYLA 3FZWA 2GSRA 4MMXB 3S5CA 2I3YA 4TR4A 4HJMA 4ZBDA 2ZDJA 1ZCPA 3PXMA 2XBQA 1T2IA 2OE0A 1BRGA 1GUKA 4Q5FA 4LA1A 1MDJA 1ML6A 1BAYA 1TK8B 1G0TA 1SL0B 3UL6A 3QMXA 1BNFA 4CCVA 1SENA 4Z7XA 1EG9B 5BU4A 2CZ2A 5HR1A 1BQ7A 1ERVA 5ECIB 2DMLA 1RNBA 1Y4KA 3A2VA 5B8BA 1JV2B 1B9YC 1G02A 1Y6EA 2I4AA 3WT2A 2RBIA 2YV9A 1GY5A 1ON4A 5FHIA 1M99A 9RNTA 4G2EA 4V2NA 3DIEA 4WKWA 2RGQA 1DE3A 4IP6A 4CDLA 1KWIA 5IG3A 5EY6A 1QAKA 2CX4A 2H1DA 2LUSA 1OE7A 1O73A 2XPDA 1GSFA 4CPKA 1AQXA 2YOIA 3B4PA 5J3RA 3F3RA 4V2LA 5CF2A 4NWYA 2P0MA 3KZTA 1RGGA 1YKCA 2L59A 6GSTA 2A2SA 1TRWA 4HBRA 5ELJA 4Z2RA 1SKSB 2AAWA 4QQ7A 2B7JA 4X43A 4K5RA 4EXJA 1BYEA 3DGNA 1AQWA 2CFWA 3C8EA 3GX8A 1LQMB 1I2FA 1ROAA 3D5IA 1TU8A 4I6XA 5HGRA 3K5TA 4IT7A 4DKIA 2CFDA 5INYA 1STDA 2HMNB 2B1LA 2HYXA 1DVCA 4OK0A 3NQYA 3DGLA 1SD8A 1JZOA 4Q53A 2X4AA 1X1WA 1NNVA 5DDLA 1S3RA 2PN8A 3EPTA 3QK9A 1JLVA 1K41A 1Z9HA 3HVSA 5CNWA 1WOUA 2RLIA 2E2GA 1V98A 3M9KA 4POBA 3FYGA 1UCKA 3WOFB 2CX0A 2B5YA 2PVQA 3LXUX 1OKTA 3FGYA 3HYPA 2BHMA 2OA7A 3KP9A 4TW5A 3VGNA 2IY2A 3EN8A 1RCKA 2X8CA 3Q74A 1XWKA 4FO5A 2RCDA 3F40A 4KSMA 2XFSA 3UJ1A 1KC84 1EV9A 1XCCA 4PNFA 2P38A 5LC7A 1GTUA 1K0DA 5IMDA 1YF0A 2C4BA 2IMFA 4POKA 4F9ZA 1Z7PA 4KFFA 5JCUA 3ALAA 4JU5A 3UMAA 1YKAA 1XG8A 3JUOA 2XPEA 1LBKA 4MA9A 3NV0B 3HY2A 1U3AA 1QJGA 2HSYA 1LU4A 3JUPA 3U6VA 1GSDA 2XGNA 2PUKC 1SYXA 1XWBA 3T8NA 3GZXB 1YDKA 1JN5B 1KNGA 3GL5A 1ZX2A 3EE2A 2I1UA 3A76A 4CHSA 4ZBAA 5KOXA 1BSEA 1ASKA 3QAWA 2UGIA 3CQFA 4N6TA 4RNZA 4WHAA 1PX7A 3ROBA 1EP7A 2DKIA 3L9SA 11GSA 4JRFA 4L8EA 5E4WA 1OHSA 5EQLA 2AHEA 4HM7B 1TRVA 3F3QA 5ECNB 5BXQA 2CH9A 5AEWB 4KA0A 3CTGA 4XBTA 1J9BA 1ILOA 1ZMAA 4ACSA 3G6E3 4H3UA 4AJ7A 3KP8A 3NQZA 4CJNA 5IIZA 4ZB9A 4XTSA 3AHWA 4WP5A 1O7UA 3CCR3 4MPFA 4HKVB 3ZIVA 3HIIA 7GSSA 3VI5A 2J9HA 3GAXA 1NHYA 5B6MA 1YJN3 1VQ73 4BTWA 1M9GA 5ELAA 1XWAA 4HU9A 1AUCA 1X5CA 3GH6A 4K7OA 18GSA 1UA5A 3N5OA 2HE3A 3D21A 2MMZA 3DUKA 3IR4A 1I2EA 1VF4A 3BD2A 3DD3A 3ZRDA 1FAAA 1BOXA 1AY7A 4AEQA 1B8XA 1B2UA 2M46A 4HZ4A 1YY7A 1IQYA 2C1YA 3H8QA 12GSA 1Q9EA 3GRXA 4GB5A 5DBQA 5GAND 4BL7B 2VO4A 1VQN3 5A4WA 3HI7A 4WEYA 4LLRA 4GRFA 1N9JA 5JBSA 5C00A 5IEOA 2CVKA 6GSYA 5KOWA 4LGQA 4FIWA 1K9M4 1M3IA 3BJ5A 2L4CA 3UL3A 2CWTA 2WGQA 2IPAA 4PUFC 2OTJ3 3US3A 1OGZA 4XRAA 2HNLA 5AN1A 1PKZA 1GSUA 1R5PA 2H70A 3G7JA 2YV7A 1T3BA 4EIQA 5L71A 1PGTA 2CVBA 1VQO3 4GLTA 2VL9A 4TN8A 1YEPA 1O8XA 2UZ8A 4RQRA 3CC73 1WPIA 2LRCA 2MMAA 4KX4A 2VCZA 4ICYA 2CV4A 4XB5A 3EX9A 2GQKA 3GL3A 4N10A 3I9V2 4MEIA 1R7HA 2GQMA 5AISA 4DSSB 1H75A 1A0FA 2IN3A 4R9LA 2KOKA 2M7OA 1DMQA 3LTDA 5ELGA 1QXHA 5J4UA 4BL3A 3NZNA 1IU7A 2FLSA 5AI1A 1YVBI 4FMAA 4HM8B 1BJXA 2HFDA 4HM2B 19GSA 4P3YB 2VAFA 1RDSA 4YKGA 1EGRA 3D0ZA 2QA1A 2STDA 2F5WA 3Q3FA 5CXOA 1KBNA 3QAVA 1F3BA 1JB4A 3ZG0A 3U5RE 4HU7A 1D6YA 1ULJB 2G2QA 1GMPA 1XOBA 3HD5A 4AKYA 2MBTA 1HU9A 2YFJB 2H6ZA 3D6IA 2XRXB 3QDNA 2GEYA 1TW9A 2AB6A 2F3MA 1GOUA 1RHLA 3KIIA 2VCWA 2DIZA 3KN4A 2EC4A 3CME3 3IDVA 1X1XA 4NPBA 3QR6A 1VRSD 4GQCA 4ILFA 1AV4A 2DJJA 4L8OA 5AIVA 2W2CA 1BNRA 1ZGNA 2KF3A 2H76A 2B1KA 3NV0A 2MBSA 2R37A 3GKKA 1I5GA 1Z6NA 4HOHA 4BA7A 1OE8A 1OC9B 2LQVA 3SOAA 1HYUA 1JN5A 1I0VA 3O6TA 3ZFLA 3KMNA 2PPTA 4EDZA 4STDA 4NHWA 1NB3I 1W02A 3KJYA 4E8HA 2PNCA 5ECPB 4KE3A 3M0FA 5M1AA 1PL1A 3GZRA 2RNTA 4X0XA 4BIRA 1GP1A 3OWUA 3BNCA 3FY7A 2A2RA 3FKAA 3KSED 4IJ3A 3H51A 3QOUA 3HZ4A 1WRYA 1T8EB 2LYXA 1GTIA 1QVG2 2YANA 2E7PA 2GTUA 1U5OA 3EF8A 4ECCA 1K8A4 4AF2A 4K1UA 3GZBA 1OUNA 1Y25A 3QCPA 1ZYNA 1D6UA 1W7CA 3KEBA 5CK6A 2C0GA 5D8IA 2VLUA 1FGMA 1GUHA 3HVNA 5IPGA 1AQZA 5DQYA 4TXVA 2H30A 1ERTA 3KTBA 2JZRA 5GSSA 1Z7RA 1F6MC 2WZ9A 4F82A 3UAPA 3VPQA 1J0FA 5EPFA 3GH9A 2FA4A 4KAEA 2X49A 4ZXGA 2REMA 4KB3A 3TJKA 3K63A 1YHQ3 1XVQA 20GSA 1SPUA 5KN1A 2A2PA 3ME7A 1NM3A 4BPYA 2HSMA 3HDCA 4XBYA 1BRIA 5G1LA 5AYRB 3PINA 2H6XA 4K8MA 5BMUA 1UCJA 3CPOA 4BL7A 1YJ93 5D9VA 2HRFA 2PERA 3HOHA 4HVNA 2IJYA 2YCDA 5A5KA 3EE1A 4WBJA 2HRKA 2CZ3A 3LFLA 1BU4A 5FT3A 2P05A 5IERA 1BUQA 2D42A 1HNCA 4MJCA 3GTUB 4MF6A 3VURA 1B21A 2FNQA 4HYZA 1C7HA 5G5FA 1TRSA 3F0IA 2A15A 1M904 4KGIA 1SL2B 3BNBA 1K0MA 1M3JA 1PN9A 4MCUA 1M2AA 3RHBA 2HMMB 1EEMA 1TP9A 1EKMA 3G0KA 1IVWA 1OHPA 2CAQA 4O32A 3IJEB 4HAAA 1R4WA 4RI6A 4XIHA 1FO5A 5JWQB 1XFLA 3Q6OA 4DEJA 1M7TA 1OACA 3CSHA 1UI7A 4XDVA 5KP3A 4WR5A 1MWTA 3F4TA 1X5DA 4K2XA 2B5XA 3GKNA 3MHEA 2E0QA 2HRNA 1NWWA 2VCVA 3BBYA 5KN2A 2WJUA 1MTCA 2PWJA 3LT9A 3QAGA 4QL9A 3FLJA 4F0CA 2D1WA 2XHFA 3K7CA 2MMOA 4DSSA 5B7CA 2QEX3 1WNHA 3J7Yk 4NV2A 1R26A 3SYUA 2MC8A 2FY6A 3TKSE 2HRAA 4X1UA 3UNLA 1DVDA 6GSXA 2OBKA 5HFKA 1W6CA 4K5SA 3UBLA 4JR6A 1U8CB 3FG1A 4KNDA 1ZYEA 5DJMA 1KD14 5HR2A 4G9HA 4ML6A 3F4RA 3WDGB 3GZYB 4MZWA 5G30A 1YEXA 3ER7A 2KAAA 4K9ZA 2KF4A 4ID0A 4L5LA 3WOEB 1XZOA 2ZUPA 3MNGA 4WF5A 1M9AA 4YH2A 2GZZA 5EEOA 3A2WA 1MD4A 3D79A 2QKEA 3ZVJD 1AR0A 4XS1A 1GL8A 1IV9A 1ERUA 3EB8A 3T0UA 1XWGA 3FW2A 5CRGA 1BSCA 1YGWA 1IVUA 1JB2A 3LT8A 3PR8A 1T5YA 4XBXA 1QUWA 3FKFA 3SVAA 5CLKA 5AIHA 4HSCX 1YGEA 1LNIA 4O8SA 2HOHA 3FF2A 1GTAA 3TCOA 3GUSA 1IT8A 3MWZA 3CC43 4PX1A 5ID2B 5KEJA 3KH7A 2OCTA 1W89A 3ZZXA 3UB1A 4YKFA 2CG1A 3IHGA 2WGOA 3KD0A 1DUGA 5HOHA 2BMOB 1Q7Y4 3DY5A 8CHOA 3I0YA 1EV4A 4TRXA 2C0FA 1OC9A 4CDOA 1V40A 2BMRB 2F99A 1ZO2A 1WMPA 1MGRA 2R4IA 1VF1A 3BOAA 4JBBA 4L5OA 3K0ZA 3V1WA 3GMFA 4I97A 1OHOA 1PL2A 1UI8A 3EU4A 5FGOA 3LTAA 4LL1B 2R41A 1XXUA 1M2DA 4GSNA 2L57A 4KW6A 1BRNL 1KTEA 2EIRA 3BNEA 5DAKA 4CY8A 5JWOB 4I2TA 2XGLA 5G2GA 1W4NA 1F2EA 2GZYA 2LNSA 5ECHB 4IJIA 2P31A 4JF8A 1HYFA 2CA8A 3HHVA 3CU3A 5HFIA 5J41A 3WMDA 3GX0A 2W56B 2I81A 5LNKe 2F9SA 5HR0A 1R5AA 4PQIA 2VLVA 4IKHA 3ERGA 2VL2C 1PSQA 1C72A 3TKPA 1AVLA 3RDEA 3BNDA 3G16A 2H1GA 2FWEA 1UCIA 3C71A 3Q2PA 4MLYA 3DZLA 1RGAA 4EV5A 1GOVA 3OWYA 2IMIA 2DMMA 2C3NA 3QRDA 2ML5A 4LEHA 1N8QA 2YJ7A 4HZ9B 5FWGA 1LJRA 3KCMA 1QVF2 2OE3A 3I43A 2CIUA 1HNBA 2XC2A 1SJWA 3LTBA 3DYRA 1XOAA 2EIQA 3KSPA 4WBRD 3LEFA 2VL2A 4BWSA 3MDKA 4G1MB 3IK7A 4EKZA 2KP2A 4ZBBA 2IYJA 2CT6A 3OW22 4RZMA 1K28A 3L78A 5CREA 3KKGA 4I8BA 1GD4A 2F8FA 4Q5QA 1GSPA 2BIRA 4YQMA 2JU5A 2V1MA 4RQXA 1K0BA 5ABRA 3O3TA 1M1K4 1YF1A 4EDYA 4OFNA 1DE2A 1TFKA 2N5FA 2D2ZA 3LZAA 1YZXA 2E2VA 1SARA 2XEPA 3HXSA 3UIWA 4MMZB 1EQKA 4K1FA 1SKWB 2E2MA 2V6KA 3F7SA 2IMDA 3PPUA 3SEDA 3FRCA 2CX1A 2F56A 5GAPD 1BRJA 1GTBA 1A2MA 3P2AA 1T2HA 2LV3A 1A2JA 3LQ7A 4HZ2A 1K0NA 4MF7A 5DCGA 1GNWA 3CRTA 2LQOA 1IQ8A 5CF1A 5IPHA 2B5EA 1LOVA 2RM5A 1JJ22 1GSSA 1ZYPA 4IP1A 4ISDA 4MP4A 3HIGA 3CCJ3 4R80A 2WS2A 1YIT3 3B4OA 5D96A 1XW5A 5ECQB 1Q824 4IHUA 3ERFA 1M9BA 1RKYA 1AIUA 1BRKA 2F86B 2RSXA 4FYBA 3C7MA 5EVHA 3I563 2PGTA 5CRWA 2F8AA 4PTSA 4WFOA 1PFOA 4K7NA 2H0GA 3WYWA 1Z5YE 1F37A 1KQS2 1JZRA 3CYNA 1UC7A 3HJMA 1S3AA 2C4JA 3DEXA 1XBSA 4EUYA 5M19A 1DYUA 1NU3A 2TRCP 5CP1A 3Q90A 1GMQA 2LJRA 1TKDB 1YQ1A 4MZBA 4KDXA 3MSZA 1WJKA 3RPNA 5CRDA 3JVCA 5H5SA 1STFI 1PFPA 1B4PA 3GV1A 2JSZA 2LS5A 1B27A 3L0HA 2W9QA 4OMVA 3FF0A 3NOFA 2FWFA 2HZEB 3CC23 1NW2A 1VGLA 2EIOA 2AUVA 1EOGA 3GIXA 3PH9A 4F2IA 4TR1B 3N9HA 4F0BA 2WULA 2X8HA 2C3QA 3DRNA 2DKHA 4OUQA 1O7NB 3URPA 4IN0A 4H86A 1I3FA 3EHCA 2OJLA 5ID2A 4YAPA 1LVNA 3FK8A 4PURA 1I70A 4U13A 3CTFA 2HT9A 3EWLA 1TOFA 1MEKA 4BTXA 2WB9A 3MG3A 4Z2UA 4BU4A 4LSOA 2CHCA 1V2AA 1B3SA 1RCLA 1U87A 4HEA2 2X8GA 4EO3A 3B8LA 3MIXA 1H4OA 3CCS3 2OADA 5GSPA 4MF5A 2BT3A 3WGDA 3H1NA 4DVCA 4FCMA 3K8NA 5AGYA 2K3DA 1TTOA 1TXXA 2MF7A 3MAKA 1I9DA 4TVEA 3ZFBA 4K0NA 3KCHA 1E3RA 1SU9A 4N3VA 2IMJA 2SARA 1K3LA 4HJ2A 3X3XA 1QK8A 2W56A 4L0UA 3ZITA 5LCZA 5M18A 4TKYA 4FCZA 1YVSA 5ECRB 1N8JA 2GS3A 2FGTA 3VWVA 3ZTLA 2BMQB 4K90B 4PQHA 1RRLA 1QALA 2IIYA 3S67A 5AYSC 1JNQA 3HK4A 3H3HA 4XS6A 1MWSA 3ME8A 3F7XA 3GSPA 4D73B 2QIYA 1UGIA 2NPBA 2H1AA 1O8WA 1TK0B 3IC4A 1IVVA 2YZUA 4WXTA 2IA7A 2JZTA 4IQAA 1X1YA 1M0UA 2WFCA 3UOMA 1FUWA 3EU3A 1B48A 5H5RA 4BVXB 1GLPA 1ZL9A 3FHKA 1FGRA 1IQXA 2DJ0A 3TOUA 1TRQA 2H66A 1O7MB 4EYCA 4LMVA 3GNJA 2AJQB 2LNTA 1MDIA 2VIMA 1IDPA 4N6NB 5J9CA 2H01A 4MDCA 2VOCA 3E99A 1IT7A 1JBTA 4J56E 4AJ8A 1THOA 4OWYA 4WYKB 2V6OA 5G31A 5J5NA 3X41A 1BEDA 4K1VA 1RN4A 4MH3A 3BCIA 4XS4B 1THXA 4BIKA 1K0AA 3HA9A 1QMVA 2FCHA 3I553 3DGQA 2OWPA 2DJ3A 1FYSA 2C0EA 5COHA 2RFRA 2QC7A 1KSIA 1BX9A 5D73A 3HZPA 4POLA 4HS1A 4KUNA 4O3VA 1VQ83 1SK0A 2K0MA 1FB6A 4AJ6A 1OVNA 3AGOA 3FCSB 2P5RA 3TJFA 4ECJA 1RMSA 2F5MA 3JUQA 4R9KA 2WO0A 2K6VA 3NBBA 2YNXA 4IS0A 1BRHA 2O3OA 2LJAA 1HD2A 2ZHXB 2A4VA 1CYUA 1GLQA 3VWUA 1GRXA 3FR9A 3ZMLA 1E2YA 3K9MC 1SYRA 3FZAA 1A24A 1WP0A 3EURA 3TKSC 2H0IA 1BNJA 2WCIA 5AIGA 5BIRA 5F07A 4EL1A 3QPMA 1MD3A 2VCTA 3SLUA 1JB5A 3AMOB 2B24B 3AGNA 1W6GA 3VF1A 1W2B2 2GSTA 1J2BA 3D4TA 5A0OB 2C10A 1UUVB 1WMJA 1BGSA 1V57A 3LXZA 3UVTA 4ZL9A 1VQL3 4PNGA 2VM1A 3GWRA 4POMA 1ZGXA 3CCV3 3PS8A 4RBNA 2HZEA 5A4VA 2K8VA 5JPUA 2C80A 3Q1CA 1I3IA 5KP1A 2R3XA 1A0RP 5BRTA 2V32A 4LMIA 4Q5NA 1NHOA 1CEWI 1VZZA 2QA43 3TRXA 3F8HA 4O5QA 3RHCA 3EINA 4ZB8A 3HKRA 4BL2A 2H71A 4MH2A 5CAXA 3GFKA 4EC6A 4RNTA 1A8LA 2CQ9A 3HVXA 3EN1B 4G0IA 3KM6A 4HM5B 7RNTA 4ZILA 3VK9A 3VWWA 2J8XB 3TJGA 3VI7A 3JUNA 3M8NA 3MG2A 1GOYA 1UN2A 4V2MA 2IL3A 4JRRA 3JUMA 1AQVA 1U88A 2CC3A 2PVOC 4HQZA 3UVHA 4L7KA 3GHAA 4ZB6A 2GLRA 2ZNMA 1BVIA 4MJBA 1RGEA 3GSTA 1ZYQB 3TOTA 3GRDA 1VF3A 4XM4A 2KXGA 3X42A 1BRSA 4KDYA 5IO2A 6RNTA 3IOSA 1SJ6A 2W9PA 14GSA 1M1XB 2CAIA 1N2AA 2ON5A 1SQWA 3IPZA 2AV4A 4N0ZA 3ERWA 2GZPA 3PCRA 5D9WA 3N54B 2C3TA 4R4KA 1OF5B 2L4VA 1O7WB 1RK4A 3D5GA 2GVPA 3J7Yd 2NDOA 2O89A 2ZCTA 4NREA 3WGEA 4X4JA 2MYGA 1OPYA 2GU1A 2LKUA 3TRPA 4D73A 2W03A 13GSA 4OFTA 3LTCA 1I0XA 5ELUA 1TI3A 2GU3A 3S9FA 3LW9A 3TUEA 4XCSA 4HM4B 1XVWA 3OWSA 1PY3A 3KFQC 1Q4JA 3LGCA 5B8AA 4KFEA 4DSRA 1I8VA 5GZZB 3L4NA 3DKSA 1NB5I 4NMUA 4XRDA 4OFMA 2XR8B 3FG4A 4MJEA 4WETA 2DJKA 1SIIA 2M72A 2CG0A 1PX6A 1FW1A 3BLZA 4O5RA 5D9XA 1BUJA 3IV4A 4IVFA 1VQK3 4GHOA 1TDIA 2FD3A 3NBJA 1QFNA 5HQPA 2YWNA 3G713 3WHOA 1OH0A 1I2GA 1T7PB 1Z6MA 1B2XA 4KVHA 2TIRA 2OTL3 3F8UA 3LG6A 2QSIA 1K3OA 1VQQA 4XS4A 4LYLB 2CFGA 1XPVA 2O7KA 1MGWA 4N0VA 5G1KA 3DH2A 4LMWA 3G9BA 2IWTA 1TI1A 2B7KA 1GY6A 1QAFA 3GKXA 3TDGA 2LSTA 3CBUA 4HI7A 4MMMA 4J5KA 3QFBC 4K2DA 1G6YA 5IEPA 1JBSA 1SD9A 2H19A 1VQ63 1CQHA 4KSOA 2MMNA 1RGHA 4HM3B 2H0HA 3D4MA 1T00A 4TXOB 5IG4A 4PUAA 1B4QA 1Q42A 1QGVA 4EVMA 2DJ1A 3W8JA 1GNEA 3L0RA 4OCFA 2GQLA 3CSIA 1LOXA 4HM0B 3HCZA 2R0PA 3C73A 2WOFA 3GSSA 2LRTA 1FGQA 2FA8A 2H75A 3DXBA 2R6KA 1E3VA 1X0RA 2BNGA 2ES7A 2ON7A 2I9WA 4N6V0 2GEXA 4G0LA 3U97A 2L6DA 3APSA 4HJLB 3EMPA 4BWQA 4E8EA 5IENA 1LXEA 2L6CA 2HMJB 2JACA 4MJAA 4O5UA 2VM2A 5STDA 5ECSA 4PGTA 1URMA 2FHEA 2XF3A 3AMOA 1BIRA 2LJKA 4KCEA 5F0GA 2AYTA 3RPPA 2P0XA 3WGXA 4MABA 1JFUA 4V1Ap 1OYJA 1Q40B 1X5EA 1XIYA 5DJLA 3DXOA 4K0GA 3F8XA 3RDWA 3G7IA 1TTZA 1VQ53 1BNGA 2H1BA 4V1Ag 1OGXA 2IFQB 1TFOA 3A5IA 3H4KA 3F9UA 5C04A 1RW1A 3P90A 2MZCA 3MYTA 2JQ5A 1B9XC 4GSPA 3V92A 3FG3A 4EW5A 3WODG 1SIHA 4KH7A 1TJDA 5IM9A 5A4UA 2Z6BA 1FGOA 3HVVA 1Q98A 4FMDA 3L9VA 3DGOA 1IK3A 4L8PA 1O6JA 1WE0A 1NSWA 1RQMA 4O02B 4N6LA 5IF6A 5RNTA 1FB0A 1DBYA 5CYYA 4X2OA 1ZS7A 17GSA 4MPGA 1RGCA 1W5ZA 2DLXA 1UDII 3F9SA 3IAM2 5DCHA 4NAXA 3F4SA 8RNTA 3FZ5A 5G5EA 4J5GA 1SJZA 1VQM3 1YI23 3VLNA 3CCQ3 1RN1A 1RSNA 3EBYA 1EZKA 3KMOA 1GUMA 4MJDA 2M80A 5ECMB 1ABAA 3J7Yb 3MG1A 5F06A 3C1SA 4KDUA 2GGTA 4ML1A 9GSSA 3LYGA 1RN7A 3IRAA 2RUFA 3NIVA 2B3SA 2NBSA 1VQ93 1F8NA 1OF5A 3CSJA 1JKGB 1TRPA 4FYUA 4N11A 1PA3A 3CRUA 2BMXA 2CFLA 5IG0A 1USBA 4NXIA 5J9BA 4MZCA 4Z2TA 2HLSA 1A90A 4HUAA 1WQLB 3DGYA 4YQVA 4FYCA 2G0FA 3I6AA 1HZ1A 3CMA3 1RLSA 4CY6A 5F05A 2XSHB 1NJI4 4KCAA 5TGNA 3GTUA 2YFLB 1EOHA 1PU4A 3LYKA 4TX4A 4MNNA 4FH8A 3DMLA 3NM7A 4R1KA 1L5GB 3ZYWA 2FNOA 2I9HA 1RGFA 1W4VA 3IXRA 3KIJA 5LD0A 3CCL3 5LC6A 2BJXA 2L4QA 3TKRA 1JLWA 4BTYA 3KH9A 3RBTA 3LORA 1ISKA 1S3CA 5IG5A 3CCU3 4CW9A 3LH4A 2WDUA 2XH9A 1ST9A 1DE1A 1TK5B 1TRUA 5D82A 1LNHA 2C8UA 2OQEC 5JPPA 1JZDA 3DVWA 1Q7HA 4GTUA 5IOXA 2W04A 1WTHA 3VFIA 1T1VA 4Q5RA 1V9WA 2O85A 5GSTA 1Q814 4JEDA 2KRTA 5DRVA 2R2JA 4TR3A 1ZZYA 4OCEA 3DGMA 3N8BA 4FQUA 3UARA 1YNVX 4HOJA 3CMIA 5ECOB 1UGHI 1LOWA 5JCGA 3ZLPA 2DC5A 2GXFA 4TXOA 3ED3A 2OQEA 3ECFA 4HM1B 1B2SA 3HJOA 16GSA 1N9EA 2GBXB 1BNEA 1K734 4G19A 1Z1SA 3IC8A 5IMZA 5KP4A 1TU7A 1N5PA 3FEUA 4JZQA 4USSA 3P8WA 2F4YA 4KF9A 3TJJA 1K0OA 5IO0A 4IIAA 1M2BA 4OO5A 3Q19A 3MYDA 1FG4A 2V1LA 2JDIH 1FOHA 5I97A 4OO4A 3VSYA 4PXOA 3CNMA 3APOA 1FOVA 2Y74A 5D81A 3PZWA 3DWVA 1RGLA 1Q40A 1K0CA 5IOWA 1FUTA 5IW9A 2HMOB 2UX0A 1PN0A 1RRHA 2YPMA 1OC8A 2IFQA 4EC0A 1RGKA 3GA4A 4ULXA 2GSQA 3MPHA 3L9UA 4ECIA 2Q07A 2YJHA 1S5AA 3S27A 1A23A 4J2FA 1U3IA 4GWRA 3DMCA 2DSAA 3I69A 1CYVA 2VD0A 3O76A 2PU9C 1YJW3 3TJBA 3KZQA 3JCML 1QQ2A 4FCJA 3FZ9A 1O85A 4K7IA 2YZHA 3HJPA 2OBIA 4MMYB 1OCVA 3LWAA 1E6BA 1F9MA 1KEBA 4ORLA 3HZ8A 2DIYA 3CCM3 1ROVA 2VLTA 1Q864 3EYTA 1IV7A 1DMNA 3LSZA 1EA2A 2KUCA 1US1A 1BSBA 5DREA 2CX3A 2PBJA 3D5JA 4WR4A 2YWMA 1R4CA 4I4KA 2R0GA 3F6FA 3M3MA 2HSHA 1MDKA 3W6GA 3OR5A 4HQSA 3A3TA 3S28A 2CK3H 3KXOA 4OD7A 2KF5A 2H73A 3SX1A 1ULIB 3EC3A 3VPTA 1X9SB 3D4AA 3NX0A 1HQOA 3ZIJA 4IQ1A 4TR0A 5B6NA 1B2ZA 2LTKA 1WWJA 3BB9A 1NDOB 2DJ2A 1RJOA 2H8LA 3PGBA 3IE3A 4AGSA 2H6YA 1G96A 2V2GA 4F03A 2Z77A 1NO3A 1JKGA 2N5BA 4O92A 1GSQA 1SJIA 1PD21 1RNTA 1MWUA 1XWCA 5IMVA 4HZBB 2K54A 2ZA4A 3M1GA 1RTUA 1OAZA 5IMAA 1LQGC 3D3LA 3CCE3 3P7XA 1OKDA 4PEJA 2A4HA 2VCQA 2XFTA 2V41A 1FUSA 3X3YA 2DBCA 4J57E 5G2ZA 1O7HB 1MWRA 2YFIB 5CO3A 2RIIA 5AIFA 4ZL8A 3RGRA 3EBTA 1FW7A 5D83A 1PRXA 3KGKA 2HMLB 3IAS2 3F6DA 2NVLA 4EXRA 3CPW2 1ZOFA 2Z7AA 4XDWA 3ZREA 1FGTA 4JE1A 2X64A 3FR3A 3TGZA 3SXXA 3OV4A 3X40A 1GSEA 3SOYA 3EC9A 1K3YA 2C11A 3W8SA 2F98A 4G10A 4IW9A 1S3DA 3FR6A 2YN1A 3G8ZA 5DALB 1BNIA 3F63A 1YJ6A 3C1RA 2AADA 2CWVA 1X1UA 3BCKA 4J8TA 1GH2A 2IUJA 1JZWA 2TRXA 1R4YA 1XW9A 1GYBA 4BVYB 4HDEA 5F8BA 1A8YA 2Z9SA 1N8R4 4GQFA 3ISOA 2KP1A 4ECBA 3HX8A 3O8YA 4NV5A 3E0UA 4IGJA 2FXTA 1UUGB 3NXJA 1FA3A 2JL4A 1F3AA 2KLXA 2VL3A 3UEMA 2QGVA 1AW9A 5IMCA 1OC3A 2KHPA 2ALBA 1YIJ3 3BU4A 4A5PA 1J08A 1WMOA 1VQP3 3RNTA 2E2UA 3GURA 3A5WA 4QWTA 3WT1A 2FGXA 3R2QA 2L1SA 2N5AA 3D9RA 5ECKB 1BNSA 1SK1A 3NBRA 4NHFA 4RUVA 5EL8A 2OOVC 5KN0A 2YWIA 2YX9A 3RAZA 6GSSA 1PQNA 4YAVA 4TR1A 1JHBA 1XW6A 2R4VA 2O8VB 3IPTA 10GSA 2W6JH 3MSOA 2ZL8A 1U6TA 2OKAA 3TKSA 2HI7A 3MKIA 2LEGA 3TB2A 3WA2X 1DETA 2AAEA 4FR9A 2K9FA 3H93A 5D9TA 3FSDA 1GY7A 3ZG5A 2FWGA 3AHSA 2LRNA 1B2MA 3CD63 5IQYA 2HMKB 5DAKB 2E2TA 4WWUC 1MNLA 4GL6A 2P09A 1EWXA 1PMTA 3DVXA 6GSUA 1SK2A 2OOVA 2XBIA 3N9JA 3IMAB 4EE0A 4EIPA 2CW9A 3DM8A 4FMBA 1UVZA 6GSVA 1LRAA 5JCWA 5ENUA 3LYPA 3M9JA 5CRHA 2B6MA 3ZL5A 2P5QA 2GDRA 1IYHA 1EUIC 3ZFZA 1SL1B 4K6XA 2WOHA 4I5QA 3NUVA 4RNYA 1QMAA 1HNAA 4EV2A 3GKMA 5ECLB 1CQGA 3EVIA 1A2KA 1W00A 2UUGC 3OXAA 4X2HA 3QD9A 1UCLA 1LOYA 3PYJA 2LQQA 4EF0A 4H61A 3V98A 2WRTA 4WF4A 3TKQA 3NHXA 2NTOA 1FZUA 2GT5A 1W6YA 5KN3A 2QA2A 4N30A 1DMMA 4IBPA 4RI7A 1E97A 3X3ZA 2XSOB 3A2XA 1AC1A 1EGOA 4N6UA 3E3EA 2JADA 5H5QA 2IMEA 2BTOT 4TOPA 4N6MA 1AAZA 4G0KA 3UJMA 1BANA 5BVBA 6GSWA 2X99A 1GMRA 2VCXA 1FHEA 3MWHA 3LMLA 1G6WA 2H72A 2J23A 6STDA 3ZVJA 1BSDA 1CQSA 3U1WA 1JBRA 1WIKA 3CXGA 3EJVA 4BVXA 1X9MB 2QGUA 3F14A 2R5GA 2Z76A 3IK9A 1C54A 2C0DA 4IELA 7STDA 5D93A 2BO9B 2INXA 3UBKA 1UUWB 1D6ZA 3KTLA 2O87A 5DQSA 2B1XB 7GSPA 3BIRA 3T8UA 2ML6A 4N6OB 4FMCA 4I2UA 2CWUA 1GULA 3CNXA 3EQQB 3SBCA 4WYKA 4HM6B 4MK3A 3S29A 3V99A 3CXC2 2O9UX 1A2LA 3GYKA 3WA3A 1A2PA 4GCIA 1FVKA 2R0CA 2VD1A 3NM2A 1ERWA 1A2VA 4KT3B 2FUG2 5EVOA 4ZIJA 3GN3A 1JRQA 2GT6A 4O2HA 2YP6A 3OX9A 5AIIA 2W0QA 5DVBA 2P0GA 1Z3EA 2VUPA 1T4ZA 3WR2A 2GBWB 4K61A 2YWOA 5E59A 1BSAA 5AIXA 3IBHA 4LL4B 5DALA 3RGAA 2Y73A 3APQA 2K8SA 3E9JB 2OE1A 2IUKA 1S723 3H79A 4JR4A 2H74A 2F51A 4AKZA 3R3EA 3QFAC 1N5HA 2CVDA 4DSQA 4BVYA 2KCDA 3M8CA 2JSYA 1EEJA 2CFKA 3FH1A 1O7GB 2WGRA 1GD3A 5IMFA 3SWLA 2PZVA 2GSPA 22GSA 4PQ1A 3LOYA 8GSSA 4IPBA 1G7EA 1O81A 4GXZA 1HKXA 1ACVA 4J9AA 1DSBA 4GSTA 2PMTA 1X9WB 4L0WA 3WD6A 1O7PB
chains in the Genus database with same CATH topology
5HR3A 4XHMA 3LJRA 3LXTA 1FVJA 1SKRB 2FWHA 5JWRB 3EMXA 2K18A 2L5LA 4NHZA 2L5OA 1GWCA 2HXKA 3IHQA 3ZMKA 5HFGA 4GF0A 3TRQA 2IMKA 4O7HA 1T4YA 3G7YA 4QL7A 1G7OA 4GSSA 1V58A 1VF2A 2RUEA 1EP8A 2HZFA 3AY8A 3IA1A 2OACA 3D22A 1IYIA 4ZL7A 2RM6A 4YQUA 3PGTA 1PKWA 2JZSA 2GSSA 3FMWA 1BG5A 3Q18A 1AXDA 3VWXA 3FZ4A 1GSYA 2GSRA 2I3YA 4TR4A 4HJMA 4ZBDA 1ZCPA 2XBQA 2OE0A 4Q5FA 1GUKA 4LA1A 1MDJA 1ML6A 1BAYA 1TK8B 1G0TA 1SL0B 3QMXA 1SENA 4Z7XA 2CZ2A 5HR1A 1BQ7A 1ERVA 5ECIB 2DMLA 3A2VA 5B8BA 1B9YC 1Y6EA 2I4AA 3WT2A 2YV9A 1ON4A 5FHIA 1M99A 4G2EA 4V2NA 3DIEA 4WKWA 4IP6A 5EY6A 2CX4A 2H1DA 2LUSA 1OE7A 1O73A 2XPDA 1GSFA 1AQXA 2YOIA 5J3RA 3F3RA 4V2LA 4NWYA 1YKCA 2L59A 6GSTA 2A2SA 1TRWA 4Z2RA 1SKSB 2AAWA 4QQ7A 2B7JA 4X43A 4K5RA 4EXJA 1BYEA 1AQWA 3C8EA 3GX8A 4I6XA 1TU8A 5INYA 2HYXA 2B1LA 1SD8A 1JZOA 2X4AA 5DDLA 2PN8A 3EPTA 1JLVA 1Z9HA 3HVSA 5CNWA 1WOUA 2RLIA 2E2GA 1V98A 3M9KA 4POBA 3FYGA 2B5YA 2PVQA 3HYPA 1OKTA 4TW5A 2OA7A 3KP9A 2IY2A 2X8CA 3Q74A 1XWKA 4FO5A 4KSMA 3UJ1A 1EV9A 1XCCA 4PNFA 1GTUA 1K0DA 5IMDA 1YF0A 2IMFA 4POKA 4F9ZA 1Z7PA 5JCUA 4JU5A 3UMAA 1YKAA 2XPEA 1LBKA 4MA9A 3HY2A 1U3AA 2HSYA 1LU4A 3U6VA 1GSDA 2PUKC 1SYXA 1XWBA 1YDKA 1KNGA 3GL5A 3EE2A 2I1UA 4CHSA 4ZBAA 5KOXA 3QAWA 1PX7A 1EP7A 2DKIA 3L9SA 11GSA 4L8EA 5E4WA 2AHEA 1TRVA 3F3QA 5ECNB 4KA0A 3CTGA 1J9BA 1ILOA 1ZMAA 4ACSA 4AJ7A 3KP8A 5IIZA 4ZB9A 4XTSA 1O7UA 4MPFA 3ZIVA 7GSSA 3VI5A 2J9HA 1NHYA 5B6MA 5ELAA 1XWAA 4HU9A 1AUCA 1X5CA 3GH6A 4K7OA 18GSA 1UA5A 3N5OA 2HE3A 3D21A 2MMZA 3IR4A 1VF4A 3BD2A 3DD3A 3ZRDA 1FAAA 1B8XA 2M46A 4HZ4A 1YY7A 3H8QA 2C1YA 12GSA 3GRXA 5DBQA 5GAND 4BL7B 2VO4A 5A4WA 4WEYA 4LLRA 4GRFA 5C00A 2CVKA 6GSYA 5KOWA 4FIWA 3BJ5A 2L4CA 3UL3A 2IPAA 4PUFC 3US3A 4XRAA 2HNLA 5AN1A 1PKZA 1GSUA 1R5PA 2H70A 3G7JA 2YV7A 1T3BA 4EIQA 5L71A 1PGTA 2CVBA 4GLTA 4TN8A 2VL9A 1YEPA 1O8XA 2UZ8A 4RQRA 1WPIA 2LRCA 2MMAA 4KX4A 2VCZA 4ICYA 2CV4A 2GQKA 3GL3A 4N10A 3I9V2 1R7HA 2GQMA 5AISA 4DSSB 1H75A 1A0FA 2IN3A 2KOKA 5ELGA 1QXHA 5J4UA 3NZNA 2FLSA 1BJXA 2HFDA 19GSA 4P3YB 2VAFA 4YKGA 1EGRA 3D0ZA 2QA1A 1KBNA 3QAVA 1F3BA 3U5RE 4HU7A 2G2QA 1XOBA 3HD5A 2MBTA 2H6ZA 3D6IA 3QDNA 1TW9A 2AB6A 2F3MA 2VCWA 2DIZA 2EC4A 3IDVA 4NPBA 3QR6A 1VRSD 4GQCA 4ILFA 2DJJA 5AIVA 1ZGNA 2H76A 2MBSA 2B1KA 2R37A 3GKKA 1I5GA 1Z6NA 4BA7A 1OE8A 1OC9B 1HYUA 3O6TA 3ZFLA 3KMNA 2PPTA 4EDZA 4NHWA 3KJYA 4E8HA 5ECPB 4KE3A 3M0FA 1PL1A 4X0XA 1GP1A 3FY7A 2A2RA 4IJ3A 3QOUA 3HZ4A 1WRYA 1T8EB 1GTIA 2YANA 2E7PA 2GTUA 4ECCA 4AF2A 1Y25A 3QCPA 1ZYNA 3KEBA 2C0GA 5D8IA 2VLUA 1GUHA 5IPGA 5DQYA 4TXVA 2H30A 1ERTA 3KTBA 2JZRA 5GSSA 1Z7RA 1F6MC 2WZ9A 4F82A 3UAPA 3VPQA 1J0FA 5EPFA 3GH9A 2FA4A 4KAEA 2X49A 4ZXGA 2REMA 4KB3A 3TJKA 1XVQA 20GSA 5KN1A 2A2PA 3ME7A 1NM3A 4BPYA 2HSMA 3HDCA 5G1LA 3PINA 2H6XA 4K8MA 5BMUA 4BL7A 5D9VA 2HRFA 2PERA 2IJYA 2YCDA 5A5KA 4WBJA 2HRKA 2CZ3A 3LFLA 5FT3A 1HNCA 4MJCA 3GTUB 4MF6A 3VURA 5G5FA 1TRSA 3F0IA 4KGIA 1SL2B 1K0MA 1PN9A 3RHBA 4MCUA 1M2AA 1EEMA 1TP9A 2CAQA 4O32A 1R4WA 4RI6A 4XIHA 1FO5A 5JWQB 1XFLA 3Q6OA 4DEJA 1M7TA 3CSHA 4WR5A 3F4TA 1X5DA 4K2XA 2B5XA 3GKNA 2E0QA 2HRNA 2VCVA 3BBYA 5KN2A 2WJUA 1MTCA 2PWJA 3QAGA 4QL9A 4F0CA 2XHFA 2MMOA 4DSSA 5B7CA 3J7Yk 4NV2A 1R26A 2FY6A 3TKSE 2HRAA 4X1UA 6GSXA 2OBKA 5HFKA 4K5SA 3UBLA 4JR6A 4KNDA 1ZYEA 5DJMA 5HR2A 4G9HA 4ML6A 3F4RA 4MZWA 5G30A 1YEXA 4K9ZA 4ID0A 4L5LA 1XZOA 2ZUPA 3MNGA 4WF5A 1M9AA 4YH2A 2GZZA 3A2WA 1MD4A 2QKEA 3ZVJD 1GL8A 4XS1A 1ERUA 1XWGA 5CRGA 3FW2A 3PR8A 3FKFA 1QUWA 1GTAA 3TCOA 3GUSA 4PX1A 5ID2B 5KEJA 3KH7A 1W89A 3ZZXA 4YKFA 3IHGA 3KD0A 1DUGA 1EV4A 4TRXA 2C0FA 1OC9A 4CDOA 1V40A 3BOAA 1VF1A 4JBBA 4L5OA 3V1WA 3GMFA 4I97A 1PL2A 3EU4A 4LL1B 1XXUA 1M2DA 4GSNA 2L57A 4KW6A 1KTEA 2EIRA 5DAKA 4CY8A 5JWOB 4I2TA 1F2EA 2GZYA 2LNSA 5ECHB 4IJIA 2P31A 2CA8A 3HHVA 5HFIA 5J41A 3GX0A 2I81A 5LNKe 2F9SA 5HR0A 1R5AA 4PQIA 2VLVA 4IKHA 3ERGA 2VL2C 1PSQA 1C72A 3TKPA 2H1GA 2FWEA 3C71A 4MLYA 2IMIA 2DMMA 2C3NA 2YJ7A 5FWGA 1LJRA 3KCMA 2OE3A 3I43A 1HNBA 2XC2A 3DYRA 1XOAA 2EIQA 4WBRD 3LEFA 2VL2A 4BWSA 3MDKA 3IK7A 4EKZA 2KP2A 4ZBBA 2IYJA 2CT6A 3L78A 5CREA 4I8BA 2F8FA 4Q5QA 4YQMA 2JU5A 2V1MA 4RQXA 1K0BA 5ABRA 3O3TA 1YF1A 4EDYA 4OFNA 1DE2A 2N5FA 2D2ZA 1YZXA 3HXSA 3UIWA 1SKWB 4K1FA 2E2MA 2V6KA 2IMDA 3PPUA 3FRCA 5GAPD 1GTBA 1A2MA 3P2AA 2LV3A 1A2JA 3LQ7A 4HZ2A 1K0NA 4MF7A 5DCGA 1GNWA 3CRTA 2LQOA 5IPHA 2B5EA 2RM5A 1GSSA 1ZYPA 4IP1A 4ISDA 4MP4A 2WS2A 5D96A 5ECQB 1XW5A 4IHUA 3ERFA 1M9BA 1AIUA 4FYBA 3C7MA 2PGTA 5CRWA 2F8AA 4PTSA 4K7NA 2H0GA 3WYWA 1Z5YE 1F37A 1JZRA 3CYNA 1UC7A 3HJMA 1S3AA 2C4JA 3DEXA 1XBSA 4EUYA 2TRCP 5CP1A 2LJRA 1TKDB 1YQ1A 4MZBA 4KDXA 3MSZA 1WJKA 3RPNA 5CRDA 5H5SA 1B4PA 3GV1A 2JSZA 2LS5A 3L0HA 4OMVA 3NOFA 2FWFA 2HZEB 1NW2A 1VGLA 2EIOA 2AUVA 1EOGA 3GIXA 3PH9A 4F2IA 4TR1B 4F0BA 2WULA 2X8HA 2C3QA 3DRNA 2DKHA 4IN0A 4H86A 2OJLA 5ID2A 4YAPA 3FK8A 4PURA 3CTFA 2HT9A 3EWLA 1TOFA 1MEKA 2WB9A 4Z2UA 1V2AA 1U87A 4HEA2 2X8GA 4EO3A 3MIXA 1H4OA 2OADA 4MF5A 3WGDA 3H1NA 4DVCA 3K8NA 5AGYA 1TXXA 3MAKA 1I9DA 4TVEA 3ZFBA 4K0NA 1SU9A 1K3LA 4HJ2A 1QK8A 4L0UA 3ZITA 5LCZA 4TKYA 5ECRB 1N8JA 2GS3A 3VWVA 3ZTLA 4PQHA 2IIYA 4XS6A 3ME8A 4D73B 2NPBA 2H1AA 1O8WA 1TK0B 3IC4A 2YZUA 4WXTA 2JZTA 4IQAA 1M0UA 2WFCA 3UOMA 3EU3A 1B48A 5H5RA 4BVXB 1GLPA 1ZL9A 3FHKA 2DJ0A 3TOUA 2H66A 4LMVA 3GNJA 2AJQB 2LNTA 1MDIA 2VIMA 5J9CA 2H01A 4MDCA 2VOCA 4J56E 4AJ8A 1THOA 4OWYA 2V6OA 5G31A 5J5NA 1BEDA 4MH3A 3BCIA 4XS4B 1THXA 1K0AA 3HA9A 1QMVA 2FCHA 3DGQA 2DJ3A 2C0EA 5COHA 2QC7A 1BX9A 5D73A 4POLA 4HS1A 4KUNA 1SK0A 1FB6A 4AJ6A 1OVNA 2P5RA 3TJFA 4ECJA 2K6VA 2YNXA 4IS0A 2LJAA 1HD2A 2A4VA 1GLQA 3VWUA 1GRXA 3FR9A 3ZMLA 1E2YA 1SYRA 3FZAA 1A24A 1WP0A 3EURA 3TKSC 2H0IA 2WCIA 5F07A 4EL1A 3QPMA 1MD3A 2VCTA 2GSTA 3D4TA 1WMJA 1V57A 3LXZA 3UVTA 4ZL9A 4PNGA 2VM1A 4POMA 2HZEA 5A4VA 2K8VA 2C80A 2R3XA 1A0RP 5BRTA 2V32A 4Q5NA 1NHOA 3TRXA 4O5QA 3RHCA 3EINA 4ZB8A 3HKRA 2H71A 4MH2A 5CAXA 3GFKA 1A8LA 2CQ9A 3HVXA 4G0IA 3KM6A 4ZILA 3VK9A 3VWWA 3TJGA 3VI7A 3M8NA 1UN2A 4V2MA 2IL3A 4JRRA 1AQVA 1U88A 2PVOC 4HQZA 3UVHA 4ZB6A 3GHAA 2GLRA 2ZNMA 4MJBA 3GSTA 1ZYQB 3TOTA 1VF3A 4KDYA 5IO2A 3IOSA 1SJ6A 14GSA 2CAIA 1N2AA 2ON5A 3IPZA 2AV4A 4N0ZA 3ERWA 2GZPA 5D9WA 2C3TA 1RK4A 2GVPA 2NDOA 2O89A 2ZCTA 3WGEA 4X4JA 2MYGA 2LKUA 3TRPA 4D73A 13GSA 4OFTA 1TI3A 3S9FA 3LW9A 3TUEA 4XCSA 1XVWA 1Q4JA 3LGCA 5B8AA 4DSRA 5GZZB 3L4NA 3DKSA 4NMUA 4XRDA 4OFMA 4MJEA 4WETA 2DJKA 2M72A 1PX6A 1FW1A 4O5RA 5D9XA 3IV4A 4IVFA 1TDIA 2FD3A 1QFNA 5HQPA 2YWNA 1T7PB 1Z6MA 2TIRA 3F8UA 3LG6A 2QSIA 1K3OA 4XS4A 1XPVA 2O7KA 4N0VA 5G1KA 4LMWA 3G9BA 2IWTA 1TI1A 2B7KA 3GKXA 2LSTA 3TDGA 3CBUA 4HI7A 4MMMA 3QFBC 4K2DA 1G6YA 1SD9A 2H19A 1CQHA 4KSOA 2MMNA 2H0HA 3D4MA 1T00A 4TXOB 4PUAA 1B4QA 1QGVA 4EVMA 2DJ1A 3W8JA 1GNEA 4OCFA 2GQLA 3CSIA 3HCZA 2R0PA 3C73A 3GSSA 2LRTA 2FA8A 2H75A 3DXBA 2R6KA 1X0RA 2ES7A 2ON7A 4G0LA 2L6DA 3APSA 4BWQA 3EMPA 4E8EA 2L6CA 2JACA 4MJAA 4O5UA 2VM2A 5ECSA 4PGTA 1URMA 2FHEA 2LJKA 4KCEA 5F0GA 2AYTA 3RPPA 3WGXA 4MABA 1JFUA 4V1Ap 1OYJA 1X5EA 1XIYA 5DJLA 4K0GA 3RDWA 3G7IA 1TTZA 2H1BA 4V1Ag 3H4KA 2IFQB 3A5IA 3F9UA 5C04A 1RW1A 3P90A 2MZCA 1B9XC 4KH7A 1TJDA 5IM9A 5A4UA 3HVVA 1Q98A 3L9VA 1WE0A 1O6JA 1NSWA 1RQMA 1FB0A 1DBYA 5CYYA 17GSA 4MPGA 2DLXA 3IAM2 5DCHA 4NAXA 3F4SA 5G5EA 3FZ5A 1SJZA 3VLNA 1EZKA 3KMOA 1GUMA 2M80A 5ECMB 1ABAA 3J7Yb 5F06A 3C1SA 4KDUA 2GGTA 4ML1A 9GSSA 3IRAA 2RUFA 3NIVA 2B3SA 2NBSA 3CSJA 4FYUA 4N11A 1PA3A 3CRUA 2BMXA 1USBA 4NXIA 5J9BA 4MZCA 4Z2TA 2HLSA 4HUAA 4YQVA 4FYCA 2G0FA 3I6AA 4CY6A 5F05A 4KCAA 3GTUA 1EOHA 3LYKA 4MNNA 4FH8A 3DMLA 3ZYWA 2FNOA 2I9HA 1W4VA 3IXRA 3KIJA 5LD0A 2BJXA 2L4QA 3TKRA 1JLWA 3KH9A 3RBTA 3LORA 1S3CA 4CW9A 2WDUA 1ST9A 1DE1A 1TK5B 1TRUA 2C8UA 1JZDA 3DVWA 4GTUA 5IOXA 3VFIA 1T1VA 4Q5RA 1V9WA 2O85A 5GSTA 4JEDA 2R2JA 4TR3A 1ZZYA 4OCEA 3UARA 4FQUA 4HOJA 3CMIA 5ECOB 5JCGA 3ZLPA 2DC5A 4TXOA 3ED3A 3HJOA 16GSA 4G19A 5IMZA 3IC8A 1TU7A 3FEUA 4JZQA 4USSA 3P8WA 4KF9A 3TJJA 1K0OA 5IO0A 1M2BA 4OO5A 3Q19A 3MYDA 1FG4A 1FOHA 4OO4A 4PXOA 3APOA 1FOVA 3DWVA 1K0CA 5IOWA 1PN0A 2YPMA 1OC8A 2IFQA 4EC0A 3GA4A 4ULXA 2GSQA 3L9UA 4ECIA 2YJHA 1A23A 4J2FA 1U3IA 4GWRA 2DSAA 3I69A 2VD0A 3O76A 2PU9C 3TJBA 3KZQA 3JCML 1QQ2A 3FZ9A 1O85A 4K7IA 2YZHA 3HJPA 2OBIA 3LWAA 1E6BA 1F9MA 1KEBA 3HZ8A 2DIYA 2VLTA 3EYTA 3LSZA 2KUCA 2CX3A 2PBJA 3D5JA 4WR4A 2YWMA 2R0GA 3F6FA 3M3MA 2HSHA 1MDKA 3W6GA 3OR5A 4HQSA 3A3TA 3KXOA 4OD7A 3EC3A 2H73A 3VPTA 1X9SB 1HQOA 3ZIJA 4IQ1A 4TR0A 5B6NA 2LTKA 1WWJA 2DJ2A 2H8LA 4AGSA 3IE3A 2H6YA 2V2GA 4F03A 2N5BA 4O92A 1GSQA 1SJIA 1PD21 1XWCA 5IMVA 3M1GA 1OAZA 5IMAA 3P7XA 1OKDA 2A4HA 2VCQA 2V41A 2DBCA 4J57E 5G2ZA 5CO3A 2RIIA 4ZL8A 1PRXA 3KGKA 3IAS2 3F6DA 2NVLA 1ZOFA 3ZREA 4JE1A 2X64A 3FR3A 3TGZA 1GSEA 1K3YA 3W8SA 4G10A 4IW9A 1S3DA 3FR6A 2YN1A 5DALB 3F63A 1YJ6A 3C1RA 3BCKA 1GH2A 1JZWA 2TRXA 1XW9A 4BVYB 4HDEA 5F8BA 1A8YA 2Z9SA 4GQFA 3ISOA 2KP1A 4ECBA 4NV5A 3E0UA 4IGJA 2KLXA 2JL4A 1F3AA 2VL3A 3UEMA 2QGVA 1AW9A 5IMCA 1OC3A 2KHPA 2ALBA 4A5PA 1J08A 3GURA 3A5WA 3WT1A 2FGXA 3R2QA 2N5AA 5ECKB 1SK1A 4RUVA 5EL8A 5KN0A 2YWIA 3RAZA 6GSSA 1PQNA 4YAVA 4TR1A 1JHBA 1XW6A 2R4VA 2O8VB 10GSA 2OKAA 3TKSA 1U6TA 2HI7A 2LEGA 3TB2A 2K9FA 3H93A 5D9TA 2FWGA 2LRNA 5IQYA 5DAKB 1EWXA 1PMTA 3DVXA 6GSUA 1SK2A 2XBIA 3N9JA 4EE0A 4EIPA 1UVZA 6GSVA 5JCWA 5ENUA 3LYPA 3M9JA 5CRHA 2B6MA 3ZL5A 2P5QA 2GDRA 1IYHA 1SL1B 4K6XA 4I5QA 1HNAA 3GKMA 5ECLB 1CQGA 3EVIA 3QD9A 2LQQA 4EF0A 2WRTA 4WF4A 3TKQA 2NTOA 2GT5A 5KN3A 2QA2A 4N30A 4IBPA 4RI7A 3A2XA 1AC1A 1EGOA 3E3EA 2JADA 5H5QA 2IMEA 2BTOT 4TOPA 1AAZA 4G0KA 6GSWA 2X99A 2VCXA 1FHEA 3MWHA 1G6WA 2H72A 2J23A 3ZVJA 1WIKA 3CXGA 4BVXA 1X9MB 2R5GA 3IK9A 2C0DA 4IELA 5D93A 3UBKA 3KTLA 2O87A 5DQSA 4I2UA 1GULA 3SBCA 4MK3A 1A2LA 3GYKA 4GCIA 1FVKA 2R0CA 2VD1A 1ERWA 2FUG2 5EVOA 4ZIJA 3GN3A 2GT6A 2YP6A 5DVBA 2P0GA 1Z3EA 2VUPA 1T4ZA 2YWOA 5E59A 5AIXA 3IBHA 4LL4B 5DALA 3APQA 2K8SA 3E9JB 2OE1A 3H79A 4JR4A 2H74A 2F51A 3R3EA 3QFAC 2CVDA 4DSQA 4BVYA 2JSYA 1EEJA 2WGRA 5IMFA 3SWLA 22GSA 4PQ1A 8GSSA 1G7EA 1O81A 4GXZA 1ACVA 1DSBA 4GSTA 2PMTA 1X9WB 4L0WA 3WD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HR3 A;  4XHM A;  3LJR A;  3LXT A;  1FVJ A;  1SKR B;  2FWH A;  5JWR B;  3EMX A;  2K18 A;  2L5L A;  4NHZ A;  2L5O A;  1GWC A;  2HXK A;  3IHQ A;  3ZMK A;  5HFG A;  4GF0 A;  3TRQ A;  2IMK A;  4O7H A;  1T4Y A;  3G7Y A;  4QL7 A;  1G7O A;  4GSS A;  1V58 A;  1VF2 A;  2RUE A;  1EP8 A;  2HZF A;  3AY8 A;  3IA1 A;  2OAC A;  3D22 A;  1IYI A;  4ZL7 A;  2RM6 A;  4YQU A;  3PGT A;  1PKW A;  2JZS A;  2GSS A;  1BG5 A;  3Q18 A;  1AXD A;  3VWX A;  3FZ4 A;  1GSY A;  2GSR A;  2I3Y A;  4TR4 A;  4HJM A;  4ZBD A;  1ZCP A;  2XBQ A;  2OE0 A;  4Q5F A;  1GUK A;  4LA1 A;  1MDJ A;  1ML6 A;  1BAY A;  1TK8 B;  1G0T A;  1SL0 B;  3QMX A;  1SEN A;  4Z7X A;  2CZ2 A;  5HR1 A;  1BQ7 A;  1ERV A;  5ECI B;  2DML A;  3A2V A;  5B8B A;  1B9Y C;  1Y6E A;  2I4A A;  3WT2 A;  2YV9 A;  1ON4 A;  5FHI A;  1M99 A;  4G2E A;  4V2N A;  3DIE A;  4WKW A;  4IP6 A;  5EY6 A;  2CX4 A;  2H1D A;  2LUS A;  1OE7 A;  1O73 A;  2XPD A;  1GSF A;  1AQX A;  2YOI A;  5J3R A;  3F3R A;  4V2L A;  4NWY A;  1YKC A;  2L59 A;  6GST A;  2A2S A;  1TRW A;  1SKS B;  2AAW A;  4QQ7 A;  2B7J A;  4X43 A;  4EXJ A;  1BYE A;  1AQW A;  3C8E A;  3GX8 A;  4I6X A;  1TU8 A;  5INY A;  2HYX A;  2B1L A;  1SD8 A;  1JZO A;  5DDL A;  2PN8 A;  1JLV A;  1Z9H A;  3HVS A;  5CNW A;  1WOU A;  2RLI A;  2E2G A;  1V98 A;  3M9K A;  4POB A;  3FYG A;  2B5Y A;  2PVQ A;  3HYP A;  1OKT A;  4TW5 A;  2OA7 A;  3KP9 A;  2IY2 A;  2X8C A;  3Q74 A;  1XWK A;  4FO5 A;  4KSM A;  3UJ1 A;  1EV9 A;  1XCC A;  4PNF A;  1GTU A;  1K0D A;  5IMD A;  1YF0 A;  2IMF A;  4POK A;  4F9Z A;  1Z7P A;  5JCU A;  4JU5 A;  3UMA A;  1YKA A;  2XPE A;  1LBK A;  4MA9 A;  3HY2 A;  1U3A A;  2HSY A;  1LU4 A;  3U6V A;  1GSD A;  2PUK C;  1SYX A;  1XWB A;  1YDK A;  1KNG A;  3GL5 A;  3EE2 A;  2I1U A;  4CHS A;  4ZBA A;  3QAW A;  1PX7 A;  1EP7 A;  3L9S A;  11GS A;  4L8E A;  5E4W A;  2AHE A;  1TRV A;  3F3Q A;  5ECN B;  4KA0 A;  3CTG A;  1J9B A;  1ILO A;  1ZMA A;  4ACS A;  4AJ7 A;  3KP8 A;  5IIZ A;  4ZB9 A;  4XTS A;  1O7U A;  4MPF A;  3ZIV A;  7GSS A;  3VI5 A;  2J9H A;  1NHY A;  5B6M A;  5ELA A;  1XWA A;  4HU9 A;  1AUC A;  1X5C A;  3GH6 A;  4K7O A;  18GS A;  1UA5 A;  3N5O A;  2HE3 A;  3D21 A;  2MMZ A;  3IR4 A;  1VF4 A;  3BD2 A;  3DD3 A;  3ZRD A;  1FAA A;  1B8X A;  2M46 A;  4HZ4 A;  1YY7 A;  3H8Q A;  2C1Y A;  12GS A;  3GRX A;  5DBQ A;  5GAN D;  2VO4 A;  5A4W A;  4WEY A;  4LLR A;  4GRF A;  5C00 A;  2CVK A;  6GSY A;  4FIW A;  3BJ5 A;  2L4C A;  3UL3 A;  2IPA A;  4PUF C;  3US3 A;  4XRA A;  2HNL A;  5AN1 A;  1PKZ A;  1GSU A;  1R5P A;  2H70 A;  3G7J A;  2YV7 A;  1T3B A;  5L71 A;  1PGT A;  2CVB A;  4GLT A;  4TN8 A;  2VL9 A;  1YEP A;  1O8X A;  4RQR A;  1WPI A;  2LRC A;  2MMA A;  4KX4 A;  2VCZ A;  2CV4 A;  2GQK A;  3GL3 A;  4N10 A;  3I9V 2;  1R7H A;  2GQM A;  5AIS A;  4DSS B;  1H75 A;  1A0F A;  2IN3 A;  2KOK A;  5ELG A;  1QXH A;  5J4U A;  3NZN A;  2FLS A;  1BJX A;  2HFD A;  19GS A;  4P3Y B;  2VAF A;  1EGR A;  3D0Z A;  1KBN A;  3QAV A;  1F3B A;  3U5R E;  4HU7 A;  2G2Q A;  1XOB A;  3HD5 A;  2MBT A;  2H6Z A;  3D6I A;  3QDN A;  1TW9 A;  2AB6 A;  2F3M A;  2VCW A;  2DIZ A;  2EC4 A;  3IDV A;  4NPB A;  3QR6 A;  1VRS D;  4GQC A;  4ILF A;  2DJJ A;  5AIV A;  1ZGN A;  2H76 A;  2MBS A;  2B1K A;  2R37 A;  3GKK A;  1I5G A;  1Z6N A;  4BA7 A;  1OE8 A;  1OC9 B;  1HYU A;  3O6T A;  3ZFL A;  3KMN A;  2PPT A;  4EDZ A;  4NHW A;  3KJY A;  4E8H A;  5ECP B;  4KE3 A;  3M0F A;  1PL1 A;  4X0X A;  1GP1 A;  3FY7 A;  2A2R A;  4IJ3 A;  3QOU A;  3HZ4 A;  1WRY A;  1T8E B;  1GTI A;  2YAN A;  2E7P A;  2GTU A;  4ECC A;  4AF2 A;  1Y25 A;  3QCP A;  3KEB A;  2C0G A;  5D8I A;  2VLU A;  1GUH A;  5IPG A;  5DQY A;  4TXV A;  2H30 A;  1ERT A;  3KTB A;  2JZR A;  5GSS A;  1Z7R A;  1F6M C;  2WZ9 A;  4F82 A;  3UAP A;  3VPQ A;  1J0F A;  5EPF A;  3GH9 A;  2FA4 A;  4KAE A;  4ZXG A;  2REM A;  4KB3 A;  3TJK A;  1XVQ A;  20GS A;  5KN1 A;  3ME7 A;  1NM3 A;  4BPY A;  3HDC A;  5G1L A;  3PIN A;  2H6X A;  4K8M A;  4BL7 A;  5D9V A;  2HRF A;  2PER A;  2IJY A;  2YCD A;  5A5K A;  4WBJ A;  2CZ3 A;  3LFL A;  5FT3 A;  1HNC A;  4MJC A;  3GTU B;  4MF6 A;  3VUR A;  5G5F A;  1TRS A;  3F0I A;  4KGI A;  1SL2 B;  1K0M A;  1PN9 A;  3RHB A;  4MCU A;  1M2A A;  1EEM A;  1TP9 A;  2CAQ A;  4O32 A;  1R4W A;  4RI6 A;  4XIH A;  1FO5 A;  5JWQ B;  1XFL A;  3Q6O A;  4DEJ A;  1M7T A;  3CSH A;  4WR5 A;  3F4T A;  1X5D A;  2B5X A;  3GKN A;  2E0Q A;  2HRN A;  2VCV A;  3BBY A;  5KN2 A;  2WJU A;  1MTC A;  2PWJ A;  3QAG A;  4QL9 A;  4F0C A;  2XHF A;  2MMO A;  4DSS A;  5B7C A;  3J7Y k;  4NV2 A;  1R26 A;  2FY6 A;  3TKS E;  4X1U A;  6GSX A;  2OBK A;  5HFK A;  3UBL A;  4JR6 A;  4KND A;  1ZYE A;  5DJM A;  5HR2 A;  4G9H A;  4ML6 A;  3F4R A;  4MZW A;  5G30 A;  1YEX A;  4K9Z A;  4ID0 A;  4L5L A;  1XZO A;  2ZUP A;  3MNG A;  4WF5 A;  1M9A A;  4YH2 A;  2GZZ A;  3A2W A;  1MD4 A;  2QKE A;  3ZVJ D;  1GL8 A;  4XS1 A;  1ERU A;  1XWG A;  5CRG A;  3FW2 A;  3PR8 A;  3FKF A;  1QUW A;  1GTA A;  3TCO A;  3GUS A;  4PX1 A;  5ID2 B;  5KEJ A;  3KH7 A;  1W89 A;  3ZZX A;  3KD0 A;  1DUG A;  1EV4 A;  4TRX A;  2C0F A;  1OC9 A;  4CDO A;  1V40 A;  3BOA A;  1VF1 A;  4JBB A;  4L5O A;  3V1W A;  3GMF A;  4I97 A;  1PL2 A;  3EU4 A;  4LL1 B;  1XXU A;  1M2D A;  4GSN A;  2L57 A;  4KW6 A;  1KTE A;  2EIR A;  5DAK A;  5JWO B;  4I2T A;  1F2E A;  2GZY A;  2LNS A;  5ECH B;  4IJI A;  2P31 A;  2CA8 A;  3HHV A;  5HFI A;  5J41 A;  3GX0 A;  2I81 A;  5LNK e;  2F9S A;  5HR0 A;  1R5A A;  4PQI A;  2VLV A;  4IKH A;  3ERG A;  2VL2 C;  1PSQ A;  1C72 A;  3TKP A;  2H1G A;  2FWE A;  3C71 A;  4MLY A;  2IMI A;  2DMM A;  2C3N A;  2YJ7 A;  5FWG A;  1LJR A;  3KCM A;  2OE3 A;  3I43 A;  1HNB A;  2XC2 A;  3DYR A;  1XOA A;  2EIQ A;  4WBR D;  3LEF A;  2VL2 A;  4BWS A;  3MDK A;  3IK7 A;  4EKZ A;  2KP2 A;  4ZBB A;  2IYJ A;  2CT6 A;  3L78 A;  5CRE A;  4I8B A;  2F8F A;  4Q5Q A;  4YQM A;  2JU5 A;  2V1M A;  4RQX A;  1K0B A;  5ABR A;  3O3T A;  1YF1 A;  4EDY A;  4OFN A;  1DE2 A;  2N5F A;  2D2Z A;  1YZX A;  3HXS A;  3UIW A;  1SKW B;  4K1F A;  2E2M A;  2V6K A;  2IMD A;  3FRC A;  5GAP D;  1GTB A;  1A2M A;  3P2A A;  2LV3 A;  1A2J A;  3LQ7 A;  4HZ2 A;  1K0N A;  4MF7 A;  5DCG A;  1GNW A;  3CRT A;  2LQO A;  5IPH A;  2B5E A;  2RM5 A;  1GSS A;  4IP1 A;  4ISD A;  4MP4 A;  2WS2 A;  5D96 A;  5ECQ B;  1XW5 A;  4IHU A;  3ERF A;  1M9B A;  1AIU A;  4FYB A;  3C7M A;  2PGT A;  5CRW A;  2F8A A;  4K7N A;  2H0G A;  3WYW A;  1Z5Y E;  1F37 A;  1JZR A;  3CYN A;  1UC7 A;  3HJM A;  1S3A A;  2C4J A;  3DEX A;  1XBS A;  4EUY A;  2TRC P;  5CP1 A;  2LJR A;  1TKD B;  1YQ1 A;  4MZB A;  4KDX A;  3MSZ A;  1WJK A;  3RPN A;  5CRD A;  5H5S A;  1B4P A;  3GV1 A;  2JSZ A;  2LS5 A;  3L0H A;  4OMV A;  3NOF A;  2FWF A;  2HZE B;  1NW2 A;  1VGL A;  2EIO A;  2AUV A;  1EOG A;  3GIX A;  3PH9 A;  4F2I A;  4TR1 B;  4F0B A;  2WUL A;  2X8H A;  2C3Q A;  3DRN A;  4IN0 A;  4H86 A;  2OJL A;  5ID2 A;  4YAP A;  3FK8 A;  4PUR A;  3CTF A;  2HT9 A;  3EWL A;  1TOF A;  1MEK A;  2WB9 A;  1V2A A;  1U87 A;  4HEA 2;  2X8G A;  4EO3 A;  1H4O A;  2OAD A;  4MF5 A;  3WGD A;  3H1N A;  4DVC A;  3K8N A;  5AGY A;  1TXX A;  3MAK A;  1I9D A;  4TVE A;  3ZFB A;  4K0N A;  1SU9 A;  1K3L A;  4HJ2 A;  1QK8 A;  4L0U A;  3ZIT A;  5LCZ A;  4TKY A;  5ECR B;  1N8J A;  2GS3 A;  3VWV A;  3ZTL A;  4PQH A;  2IIY A;  4XS6 A;  3ME8 A;  4D73 B;  2NPB A;  2H1A A;  1O8W A;  1TK0 B;  3IC4 A;  2YZU A;  4WXT A;  2JZT A;  4IQA A;  1M0U A;  2WFC A;  3UOM A;  3EU3 A;  1B48 A;  5H5R A;  1GLP A;  1ZL9 A;  3FHK A;  2DJ0 A;  3TOU A;  2H66 A;  4LMV A;  3GNJ A;  2AJQ B;  2LNT A;  1MDI A;  2VIM A;  5J9C A;  2H01 A;  4MDC A;  2VOC A;  4J56 E;  4AJ8 A;  1THO A;  4OWY A;  2V6O A;  5G31 A;  5J5N A;  1BED A;  4MH3 A;  3BCI A;  4XS4 B;  1THX A;  1K0A A;  3HA9 A;  1QMV A;  2FCH A;  3DGQ A;  2DJ3 A;  2C0E A;  5COH A;  2QC7 A;  1BX9 A;  5D73 A;  4POL A;  4HS1 A;  4KUN A;  1SK0 A;  1FB6 A;  4AJ6 A;  1OVN A;  2P5R A;  3TJF A;  4ECJ A;  2K6V A;  2YNX A;  4IS0 A;  2LJA A;  1HD2 A;  2A4V A;  1GLQ A;  3VWU A;  1GRX A;  3FR9 A;  3ZML A;  1E2Y A;  1SYR A;  3FZA A;  1A24 A;  1WP0 A;  3EUR A;  3TKS C;  2H0I A;  2WCI A;  5F07 A;  4EL1 A;  3QPM A;  1MD3 A;  2VCT A;  2GST A;  3D4T A;  1WMJ A;  1V57 A;  3LXZ A;  3UVT A;  4ZL9 A;  4PNG A;  2VM1 A;  4POM A;  2HZE A;  5A4V A;  2K8V A;  2C80 A;  2R3X A;  1A0R P;  2V32 A;  4Q5N A;  1NHO A;  3TRX A;  3RHC A;  3EIN A;  4ZB8 A;  3HKR A;  2H71 A;  4MH2 A;  5CAX A;  3GFK A;  1A8L A;  2CQ9 A;  3HVX A;  3KM6 A;  4ZIL A;  3VK9 A;  3VWW A;  3TJG A;  3VI7 A;  3M8N A;  1UN2 A;  4V2M A;  2IL3 A;  4JRR A;  1AQV A;  1U88 A;  2PVO C;  4HQZ A;  3UVH A;  4ZB6 A;  3GHA A;  2GLR A;  2ZNM A;  4MJB A;  3GST A;  1ZYQ B;  3TOT A;  1VF3 A;  4KDY A;  5IO2 A;  3IOS A;  1SJ6 A;  14GS A;  2CAI A;  1N2A A;  2ON5 A;  3IPZ A;  2AV4 A;  4N0Z A;  3ERW A;  2GZP A;  5D9W A;  2C3T A;  1RK4 A;  2GVP A;  2NDO A;  2O89 A;  2ZCT A;  3WGE A;  2MYG A;  2LKU A;  3TRP A;  4D73 A;  13GS A;  4OFT A;  1TI3 A;  3S9F A;  3TUE A;  4XCS A;  1XVW A;  1Q4J A;  3LGC A;  5B8A A;  4DSR A;  5GZZ B;  3L4N A;  3DKS A;  4NMU A;  4XRD A;  4OFM A;  4MJE A;  4WET A;  2DJK A;  2M72 A;  1PX6 A;  1FW1 A;  4O5R A;  5D9X A;  3IV4 A;  4IVF A;  1TDI A;  2FD3 A;  1QFN A;  5HQP A;  2YWN A;  1T7P B;  1Z6M A;  2TIR A;  3F8U A;  3LG6 A;  2QSI A;  1K3O A;  4XS4 A;  1XPV A;  2O7K A;  4N0V A;  5G1K A;  4LMW A;  3G9B A;  2IWT A;  1TI1 A;  2B7K A;  3GKX A;  2LST A;  3TDG A;  3CBU A;  4HI7 A;  4MMM A;  3QFB C;  4K2D A;  1G6Y A;  1SD9 A;  2H19 A;  1CQH A;  4KSO A;  2MMN A;  2H0H A;  3D4M A;  1T00 A;  4TXO B;  4PUA A;  1B4Q A;  1QGV A;  4EVM A;  2DJ1 A;  3W8J A;  1GNE A;  4OCF A;  2GQL A;  3CSI A;  3HCZ A;  3C73 A;  3GSS A;  2LRT A;  2FA8 A;  2H75 A;  3DXB A;  2R6K A;  1X0R A;  2ES7 A;  2ON7 A;  2L6D A;  3APS A;  4BWQ A;  3EMP A;  4E8E A;  2L6C A;  2JAC A;  4MJA A;  2VM2 A;  5ECS A;  4PGT A;  1URM A;  2FHE A;  2LJK A;  4KCE A;  5F0G A;  2AYT A;  3RPP A;  3WGX A;  4MAB A;  1JFU A;  4V1A p;  1OYJ A;  1X5E A;  1XIY A;  5DJL A;  4K0G A;  3RDW A;  3G7I A;  1TTZ A;  2H1B A;  4V1A g;  3H4K A;  2IFQ B;  3F9U A;  5C04 A;  1RW1 A;  3P90 A;  2MZC A;  1B9X C;  4KH7 A;  1TJD A;  5IM9 A;  5A4U A;  3HVV A;  1Q98 A;  3L9V A;  1WE0 A;  1O6J A;  1NSW A;  1RQM A;  1FB0 A;  1DBY A;  5CYY A;  17GS A;  4MPG A;  2DLX A;  3IAM 2;  5DCH A;  4NAX A;  3F4S A;  5G5E A;  3FZ5 A;  1SJZ A;  3VLN A;  1EZK A;  3KMO A;  1GUM A;  2M80 A;  5ECM B;  1ABA A;  3J7Y b;  5F06 A;  3C1S A;  4KDU A;  2GGT A;  4ML1 A;  9GSS A;  3IRA A;  2RUF A;  3NIV A;  2B3S A;  2NBS A;  3CSJ A;  4FYU A;  4N11 A;  1PA3 A;  3CRU A;  2BMX A;  1USB A;  4NXI A;  5J9B A;  4MZC A;  2HLS A;  4HUA A;  4YQV A;  4FYC A;  2G0F A;  3I6A A;  5F05 A;  4KCA A;  3GTU A;  1EOH A;  3LYK A;  4FH8 A;  3DML A;  3ZYW A;  2FNO A;  2I9H A;  1W4V A;  3IXR A;  3KIJ A;  5LD0 A;  2BJX A;  2L4Q A;  3TKR A;  1JLW A;  3KH9 A;  3RBT A;  3LOR A;  1S3C A;  4CW9 A;  2WDU A;  1ST9 A;  1DE1 A;  1TK5 B;  1TRU A;  2C8U A;  1JZD A;  3DVW A;  4GTU A;  5IOX A;  3VFI A;  1T1V A;  4Q5R A;  1V9W A;  2O85 A;  5GST A;  4JED A;  2R2J A;  4TR3 A;  1ZZY A;  4OCE A;  3UAR A;  4HOJ A;  3CMI A;  5ECO B;  5JCG A;  3ZLP A;  2DC5 A;  4TXO A;  3ED3 A;  3HJO A;  16GS A;  4G19 A;  5IMZ A;  1TU7 A;  3FEU A;  4JZQ A;  3P8W A;  3TJJ A;  1K0O A;  5IO0 A;  1M2B A;  4OO5 A;  3Q19 A;  1FG4 A;  4OO4 A;  4PXO A;  3APO A;  1FOV A;  3DWV A;  1K0C A;  5IOW A;  2YPM A;  1OC8 A;  2IFQ A;  4EC0 A;  3GA4 A;  4ULX A;  2GSQ A;  3L9U A;  4ECI A;  2YJH A;  1A23 A;  4J2F A;  1U3I A;  4GWR A;  2DSA A;  3I69 A;  2VD0 A;  3O76 A;  2PU9 C;  3TJB A;  3KZQ A;  3JCM L;  1QQ2 A;  3FZ9 A;  1O85 A;  4K7I A;  2YZH A;  3HJP A;  2OBI A;  3LWA A;  1E6B A;  1F9M A;  1KEB A;  3HZ8 A;  2DIY A;  2VLT A;  3EYT A;  3LSZ A;  2KUC A;  2CX3 A;  2PBJ A;  3D5J A;  4WR4 A;  2YWM A;  3F6F A;  3M3M A;  2HSH A;  1MDK A;  3W6G A;  3OR5 A;  4HQS A;  3A3T A;  3KXO A;  4OD7 A;  3EC3 A;  2H73 A;  3VPT A;  1X9S B;  1HQO A;  3ZIJ A;  4IQ1 A;  4TR0 A;  5B6N A;  2LTK A;  1WWJ A;  2DJ2 A;  2H8L A;  4AGS A;  3IE3 A;  2H6Y A;  2V2G A;  4F03 A;  2N5B A;  4O92 A;  1GSQ A;  1SJI A;  1PD2 1;  1XWC A;  5IMV A;  3M1G A;  1OAZ A;  5IMA A;  3P7X A;  1OKD A;  2VCQ A;  2V41 A;  2DBC A;  4J57 E;  5G2Z A;  5CO3 A;  2RII A;  4ZL8 A;  1PRX A;  3KGK A;  3IAS 2;  3F6D A;  2NVL A;  1ZOF A;  3ZRE A;  4JE1 A;  2X64 A;  3FR3 A;  3TGZ A;  1GSE A;  1K3Y A;  3W8S A;  4G10 A;  4IW9 A;  1S3D A;  3FR6 A;  2YN1 A;  5DAL B;  3F63 A;  1YJ6 A;  3C1R A;  3BCK A;  1GH2 A;  1JZW A;  2TRX A;  1XW9 A;  4HDE A;  5F8B A;  1A8Y A;  2Z9S A;  4GQF A;  3ISO A;  2KP1 A;  4ECB A;  4NV5 A;  3E0U A;  4IGJ A;  2KLX A;  2JL4 A;  1F3A A;  2VL3 A;  3UEM A;  2QGV A;  1AW9 A;  5IMC A;  1OC3 A;  2KHP A;  2ALB A;  1J08 A;  3GUR A;  3A5W A;  3WT1 A;  2FGX A;  3R2Q A;  2N5A A;  5ECK B;  1SK1 A;  4RUV A;  5EL8 A;  5KN0 A;  2YWI A;  3RAZ A;  6GSS A;  1PQN A;  4YAV A;  4TR1 A;  1JHB A;  1XW6 A;  2R4V A;  2O8V B;  10GS A;  2OKA A;  3TKS A;  1U6T A;  2HI7 A;  2LEG A;  3TB2 A;  2K9F A;  3H93 A;  5D9T A;  2FWG A;  2LRN A;  5IQY A;  5DAK B;  1EWX A;  1PMT A;  3DVX A;  6GSU A;  1SK2 A;  2XBI A;  3N9J A;  4EE0 A;  6GSV A;  1UVZ A;  5JCW A;  5ENU A;  3LYP A;  3M9J A;  5CRH A;  2B6M A;  3ZL5 A;  2P5Q A;  2GDR A;  1IYH A;  1SL1 B;  4K6X A;  4I5Q A;  1HNA A;  3GKM A;  5ECL B;  1CQG A;  3EVI A;  3QD9 A;  2LQQ A;  4EF0 A;  2WRT A;  4WF4 A;  3TKQ A;  2NTO A;  2GT5 A;  5KN3 A;  4N30 A;  4IBP A;  4RI7 A;  3A2X A;  1AC1 A;  1EGO A;  3E3E A;  2JAD A;  5H5Q A;  2IME A;  2BTO T;  4TOP A;  1AAZ A;  6GSW A;  2X99 A;  2VCX A;  1FHE A;  3MWH A;  1G6W A;  2H72 A;  2J23 A;  3ZVJ A;  1WIK A;  3CXG A;  4BVX A;  1X9M B;  2R5G A;  3IK9 A;  2C0D A;  4IEL A;  5D93 A;  3UBK A;  3KTL A;  2O87 A;  5DQS A;  4I2U A;  1GUL A;  3SBC A;  4MK3 A;  1A2L A;  3GYK A;  4GCI A;  1FVK A;  2VD1 A;  1ERW A;  2FUG 2;  5EVO A;  4ZIJ A;  3GN3 A;  2GT6 A;  2YP6 A;  5DVB A;  2P0G A;  1Z3E A;  2VUP A;  1T4Z A;  2YWO A;  5E59 A;  5AIX A;  3IBH A;  4LL4 B;  5DAL A;  3APQ A;  2K8S A;  3E9J B;  2OE1 A;  3H79 A;  4JR4 A;  2H74 A;  2F51 A;  3QFA C;  2CVD A;  4DSQ A;  4BVY A;  2JSY A;  1EEJ A;  2WGR A;  5IMF A;  3SWL A;  22GS A;  4PQ1 A;  8GSS A;  1G7E A;  1O81 A;  4GXZ A;  1ACV A;  1DSB A;  4GST A;  2PMT A;  1X9W B;  4L0W A;  3WD6 A; 
#chains in the Genus database with same CATH topology
 5HR3 A;  1TUH A;  1BAO A;  3LJR A;  1B20 A;  1TU5 A;  4XHM A;  3LXT A;  1FVJ A;  1SKR B;  2FWH A;  5JWR B;  1V74 A;  3EMX A;  2K18 A;  2L5L A;  1IYY A;  4NHZ A;  4KZ1 A;  2L5O A;  1GWC A;  1UW1 A;  1IVX A;  2HXK A;  2SBL A;  3IHQ A;  1MOL A;  1TP6 A;  3ZMK A;  5HFG A;  4EBG A;  4GF0 A;  3TRQ A;  2IMK A;  4KFD A;  1WMN A;  4O7H A;  2CKF B;  1GS3 A;  4ZM8 A;  3A5E A;  1T4Y A;  3G7Y A;  4QL7 A;  1G7O A;  3UL5 A;  4GSS A;  1V58 A;  1VF2 A;  2RUE A;  1EP8 A;  2HZF A;  3AY8 A;  3B7C A;  1A67 A;  2KF6 A;  4OVM A;  3KE7 A;  3IA1 A;  2OAC A;  3D22 A;  4LZI A;  3PCS A;  3STD A;  1IYI A;  2BU4 A;  4ZL7 A;  2RM6 A;  1W2Z A;  6GSP A;  4YQU A;  5AEU B;  3PGT A;  1PKW A;  1VQ4 3;  3G4S 3;  2GSS A;  1TIJ A;  2JZS A;  3FMW A;  1BG5 A;  3Q18 A;  1AXD A;  1AVK A;  3VWX A;  5FW5 A;  3FZ4 A;  1GSY A;  1CH0 A;  1W01 A;  1PYL A;  3FZW A;  2GSR A;  4MMX B;  3S5C A;  2I3Y A;  4TR4 A;  4HJM A;  4ZBD A;  2ZDJ A;  1ZCP A;  3PXM A;  2XBQ A;  1T2I A;  2OE0 A;  1BRG A;  1GUK A;  4Q5F A;  4LA1 A;  1MDJ A;  1ML6 A;  1BAY A;  1TK8 B;  1G0T A;  1SL0 B;  3UL6 A;  3QMX A;  1BNF A;  4CCV A;  1SEN A;  4Z7X A;  1EG9 B;  5BU4 A;  2CZ2 A;  5HR1 A;  1BQ7 A;  1ERV A;  5ECI B;  2DML A;  1RNB A;  1Y4K A;  3A2V A;  5B8B A;  1JV2 B;  1B9Y C;  1G02 A;  1Y6E A;  2I4A A;  3WT2 A;  2RBI A;  2YV9 A;  1GY5 A;  1ON4 A;  5FHI A;  1M99 A;  9RNT A;  4G2E A;  4V2N A;  3DIE A;  4WKW A;  2RGQ A;  1DE3 A;  4IP6 A;  4CDL A;  1KWI A;  5IG3 A;  5EY6 A;  1QAK A;  2CX4 A;  2H1D A;  2LUS A;  1OE7 A;  1O73 A;  2XPD A;  1GSF A;  4CPK A;  1AQX A;  2YOI A;  3B4P A;  5J3R A;  3F3R A;  4V2L A;  5CF2 A;  4NWY A;  2P0M A;  3KZT A;  1RGG A;  1YKC A;  2L59 A;  6GST A;  2A2S A;  1TRW A;  4HBR A;  5ELJ A;  4Z2R A;  1SKS B;  2AAW A;  4QQ7 A;  2B7J A;  4X43 A;  4K5R A;  4EXJ A;  1BYE A;  3DGN A;  1AQW A;  2CFW A;  3C8E A;  3GX8 A;  1LQM B;  1I2F A;  1ROA A;  3D5I A;  1TU8 A;  4I6X A;  5HGR A;  3K5T A;  4IT7 A;  4DKI A;  2CFD A;  5INY A;  1STD A;  2HMN B;  2B1L A;  2HYX A;  1DVC A;  4OK0 A;  3NQY A;  3DGL A;  1SD8 A;  1JZO A;  4Q53 A;  2X4A A;  1X1W A;  1NNV A;  5DDL A;  1S3R A;  2PN8 A;  3EPT A;  3QK9 A;  1JLV A;  1K41 A;  1Z9H A;  3HVS A;  5CNW A;  1WOU A;  2RLI A;  2E2G A;  1V98 A;  3M9K A;  4POB A;  3FYG A;  1UCK A;  3WOF B;  2CX0 A;  2B5Y A;  2PVQ A;  3LXU X;  1OKT A;  3FGY A;  3HYP A;  2BHM A;  2OA7 A;  3KP9 A;  4TW5 A;  3VGN A;  2IY2 A;  3EN8 A;  1RCK A;  2X8C A;  3Q74 A;  1XWK A;  4FO5 A;  2RCD A;  3F40 A;  4KSM A;  2XFS A;  3UJ1 A;  1KC8 4;  1EV9 A;  1XCC A;  4PNF A;  2P38 A;  5LC7 A;  1GTU A;  1K0D A;  5IMD A;  1YF0 A;  2C4B A;  2IMF A;  4POK A;  4F9Z A;  1Z7P A;  4KFF A;  5JCU A;  3ALA A;  4JU5 A;  3UMA A;  1YKA A;  1XG8 A;  3JUO A;  2XPE A;  1LBK A;  4MA9 A;  3NV0 B;  3HY2 A;  1U3A A;  1QJG A;  2HSY A;  1LU4 A;  3JUP A;  3U6V A;  1GSD A;  2XGN A;  2PUK C;  1SYX A;  1XWB A;  3T8N A;  3GZX B;  1YDK A;  1JN5 B;  1KNG A;  3GL5 A;  1ZX2 A;  3EE2 A;  2I1U A;  3A76 A;  4CHS A;  4ZBA A;  5KOX A;  1BSE A;  1ASK A;  3QAW A;  2UGI A;  3CQF A;  4N6T A;  4RNZ A;  4WHA A;  1PX7 A;  3ROB A;  1EP7 A;  2DKI A;  3L9S A;  11GS A;  4JRF A;  4L8E A;  5E4W A;  1OHS A;  5EQL A;  2AHE A;  4HM7 B;  1TRV A;  3F3Q A;  5ECN B;  5BXQ A;  2CH9 A;  5AEW B;  4KA0 A;  3CTG A;  4XBT A;  1J9B A;  1ILO A;  1ZMA A;  4ACS A;  3G6E 3;  4H3U A;  4AJ7 A;  3KP8 A;  3NQZ A;  4CJN A;  5IIZ A;  4ZB9 A;  4XTS A;  3AHW A;  4WP5 A;  1O7U A;  3CCR 3;  4MPF A;  4HKV B;  3ZIV A;  3HII A;  7GSS A;  3VI5 A;  2J9H A;  3GAX A;  1NHY A;  5B6M A;  1YJN 3;  1VQ7 3;  4BTW A;  1M9G A;  5ELA A;  1XWA A;  4HU9 A;  1AUC A;  1X5C A;  3GH6 A;  4K7O A;  18GS A;  1UA5 A;  3N5O A;  2HE3 A;  3D21 A;  2MMZ A;  3DUK A;  3IR4 A;  1I2E A;  1VF4 A;  3BD2 A;  3DD3 A;  3ZRD A;  1FAA A;  1BOX A;  1AY7 A;  4AEQ A;  1B8X A;  1B2U A;  2M46 A;  4HZ4 A;  1YY7 A;  1IQY A;  2C1Y A;  3H8Q A;  12GS A;  1Q9E A;  3GRX A;  4GB5 A;  5DBQ A;  5GAN D;  4BL7 B;  2VO4 A;  1VQN 3;  5A4W A;  3HI7 A;  4WEY A;  4LLR A;  4GRF A;  1N9J A;  5JBS A;  5C00 A;  5IEO A;  2CVK A;  6GSY A;  5KOW A;  4LGQ A;  4FIW A;  1K9M 4;  1M3I A;  3BJ5 A;  2L4C A;  3UL3 A;  2CWT A;  2WGQ A;  2IPA A;  4PUF C;  2OTJ 3;  3US3 A;  1OGZ A;  4XRA A;  2HNL A;  5AN1 A;  1PKZ A;  1GSU A;  1R5P A;  2H70 A;  3G7J A;  2YV7 A;  1T3B A;  4EIQ A;  5L71 A;  1PGT A;  2CVB A;  1VQO 3;  4GLT A;  2VL9 A;  4TN8 A;  1YEP A;  1O8X A;  2UZ8 A;  4RQR A;  3CC7 3;  1WPI A;  2LRC A;  2MMA A;  4KX4 A;  2VCZ A;  4ICY A;  2CV4 A;  4XB5 A;  3EX9 A;  2GQK A;  3GL3 A;  4N10 A;  3I9V 2;  4MEI A;  1R7H A;  2GQM A;  5AIS A;  4DSS B;  1H75 A;  1A0F A;  2IN3 A;  4R9L A;  2KOK A;  2M7O A;  1DMQ A;  3LTD A;  5ELG A;  1QXH A;  5J4U A;  4BL3 A;  3NZN A;  1IU7 A;  2FLS A;  5AI1 A;  1YVB I;  4FMA A;  4HM8 B;  1BJX A;  2HFD A;  4HM2 B;  19GS A;  4P3Y B;  2VAF A;  1RDS A;  4YKG A;  1EGR A;  3D0Z A;  2QA1 A;  2STD A;  2F5W A;  3Q3F A;  5CXO A;  1KBN A;  3QAV A;  1F3B A;  1JB4 A;  3ZG0 A;  3U5R E;  4HU7 A;  1D6Y A;  1ULJ B;  2G2Q A;  1GMP A;  1XOB A;  3HD5 A;  4AKY A;  2MBT A;  1HU9 A;  2YFJ B;  2H6Z A;  3D6I A;  2XRX B;  3QDN A;  2GEY A;  1TW9 A;  2AB6 A;  2F3M A;  1GOU A;  1RHL A;  3KII A;  2VCW A;  2DIZ A;  3KN4 A;  2EC4 A;  3CME 3;  3IDV A;  1X1X A;  4NPB A;  3QR6 A;  1VRS D;  4GQC A;  4ILF A;  1AV4 A;  2DJJ A;  4L8O A;  5AIV A;  2W2C A;  1BNR A;  1ZGN A;  2KF3 A;  2H76 A;  2B1K A;  3NV0 A;  2MBS A;  2R37 A;  3GKK A;  1I5G A;  1Z6N A;  4HOH A;  4BA7 A;  1OE8 A;  1OC9 B;  2LQV A;  3SOA A;  1HYU A;  1JN5 A;  1I0V A;  3O6T A;  3ZFL A;  3KMN A;  2PPT A;  4EDZ A;  4STD A;  4NHW A;  1NB3 I;  1W02 A;  3KJY A;  4E8H A;  2PNC A;  5ECP B;  4KE3 A;  3M0F A;  5M1A A;  1PL1 A;  3GZR A;  2RNT A;  4X0X A;  4BIR A;  1GP1 A;  3OWU A;  3BNC A;  3FY7 A;  2A2R A;  3FKA A;  3KSE D;  4IJ3 A;  3H51 A;  3QOU A;  3HZ4 A;  1WRY A;  1T8E B;  2LYX A;  1GTI A;  1QVG 2;  2YAN A;  2E7P A;  2GTU A;  1U5O A;  3EF8 A;  4ECC A;  1K8A 4;  4AF2 A;  4K1U A;  3GZB A;  1OUN A;  1Y25 A;  3QCP A;  1ZYN A;  1D6U A;  1W7C A;  3KEB A;  5CK6 A;  2C0G A;  5D8I A;  2VLU A;  1FGM A;  1GUH A;  3HVN A;  5IPG A;  1AQZ A;  5DQY A;  4TXV A;  2H30 A;  1ERT A;  3KTB A;  2JZR A;  5GSS A;  1Z7R A;  1F6M C;  2WZ9 A;  4F82 A;  3UAP A;  3VPQ A;  1J0F A;  5EPF A;  3GH9 A;  2FA4 A;  4KAE A;  2X49 A;  4ZXG A;  2REM A;  4KB3 A;  3TJK A;  3K63 A;  1YHQ 3;  1XVQ A;  20GS A;  1SPU A;  5KN1 A;  2A2P A;  3ME7 A;  1NM3 A;  4BPY A;  2HSM A;  3HDC A;  4XBY A;  1BRI A;  5G1L A;  5AYR B;  3PIN A;  2H6X A;  4K8M A;  5BMU A;  1UCJ A;  3CPO A;  4BL7 A;  1YJ9 3;  5D9V A;  2HRF A;  2PER A;  3HOH A;  4HVN A;  2IJY A;  2YCD A;  5A5K A;  3EE1 A;  4WBJ A;  2HRK A;  2CZ3 A;  3LFL A;  1BU4 A;  5FT3 A;  2P05 A;  5IER A;  1BUQ A;  2D42 A;  1HNC A;  4MJC A;  3GTU B;  4MF6 A;  3VUR A;  1B21 A;  2FNQ A;  4HYZ A;  1C7H A;  5G5F A;  1TRS A;  3F0I A;  2A15 A;  1M90 4;  4KGI A;  1SL2 B;  3BNB A;  1K0M A;  1M3J A;  1PN9 A;  4MCU A;  1M2A A;  3RHB A;  2HMM B;  1EEM A;  1TP9 A;  1EKM A;  3G0K A;  1IVW A;  1OHP A;  2CAQ A;  4O32 A;  3IJE B;  4HAA A;  1R4W A;  4RI6 A;  4XIH A;  1FO5 A;  5JWQ B;  1XFL A;  3Q6O A;  4DEJ A;  1M7T A;  1OAC A;  3CSH A;  1UI7 A;  4XDV A;  5KP3 A;  4WR5 A;  1MWT A;  3F4T A;  1X5D A;  4K2X A;  2B5X A;  3GKN A;  3MHE A;  2E0Q A;  2HRN A;  1NWW A;  2VCV A;  3BBY A;  5KN2 A;  2WJU A;  1MTC A;  2PWJ A;  3LT9 A;  3QAG A;  4QL9 A;  3FLJ A;  4F0C A;  2D1W A;  2XHF A;  3K7C A;  2MMO A;  4DSS A;  5B7C A;  2QEX 3;  1WNH A;  3J7Y k;  4NV2 A;  1R26 A;  3SYU A;  2MC8 A;  2FY6 A;  3TKS E;  2HRA A;  4X1U A;  3UNL A;  1DVD A;  6GSX A;  2OBK A;  5HFK A;  1W6C A;  4K5S A;  3UBL A;  4JR6 A;  1U8C B;  3FG1 A;  4KND A;  1ZYE A;  5DJM A;  1KD1 4;  5HR2 A;  4G9H A;  4ML6 A;  3F4R A;  3WDG B;  3GZY B;  4MZW A;  5G30 A;  1YEX A;  3ER7 A;  2KAA A;  4K9Z A;  2KF4 A;  4ID0 A;  4L5L A;  3WOE B;  1XZO A;  2ZUP A;  3MNG A;  4WF5 A;  1M9A A;  4YH2 A;  2GZZ A;  5EEO A;  3A2W A;  1MD4 A;  3D79 A;  2QKE A;  3ZVJ D;  1AR0 A;  4XS1 A;  1GL8 A;  1IV9 A;  1ERU A;  3EB8 A;  3T0U A;  1XWG A;  3FW2 A;  5CRG A;  1BSC A;  1YGW A;  1IVU A;  1JB2 A;  3LT8 A;  3PR8 A;  1T5Y A;  4XBX A;  1QUW A;  3FKF A;  3SVA A;  5CLK A;  5AIH A;  4HSC X;  1YGE A;  1LNI A;  4O8S A;  2HOH A;  3FF2 A;  1GTA A;  3TCO A;  3GUS A;  1IT8 A;  3MWZ A;  3CC4 3;  4PX1 A;  5ID2 B;  5KEJ A;  3KH7 A;  2OCT A;  1W89 A;  3ZZX A;  3UB1 A;  4YKF A;  2CG1 A;  3IHG A;  2WGO A;  3KD0 A;  1DUG A;  5HOH A;  2BMO B;  1Q7Y 4;  3DY5 A;  8CHO A;  3I0Y A;  1EV4 A;  4TRX A;  2C0F A;  1OC9 A;  4CDO A;  1V40 A;  2BMR B;  2F99 A;  1ZO2 A;  1WMP A;  1MGR A;  2R4I A;  1VF1 A;  3BOA A;  4JBB A;  4L5O A;  3K0Z A;  3V1W A;  3GMF A;  4I97 A;  1OHO A;  1PL2 A;  1UI8 A;  3EU4 A;  5FGO A;  3LTA A;  4LL1 B;  2R41 A;  1XXU A;  1M2D A;  4GSN A;  2L57 A;  4KW6 A;  1BRN L;  1KTE A;  2EIR A;  3BNE A;  5DAK A;  4CY8 A;  5JWO B;  4I2T A;  2XGL A;  5G2G A;  1W4N A;  1F2E A;  2GZY A;  2LNS A;  5ECH B;  4IJI A;  2P31 A;  4JF8 A;  1HYF A;  2CA8 A;  3HHV A;  3CU3 A;  5HFI A;  5J41 A;  3WMD A;  3GX0 A;  2W56 B;  2I81 A;  5LNK e;  2F9S A;  5HR0 A;  1R5A A;  4PQI A;  2VLV A;  4IKH A;  3ERG A;  2VL2 C;  1PSQ A;  1C72 A;  3TKP A;  1AVL A;  3RDE A;  3BND A;  3G16 A;  2H1G A;  2FWE A;  1UCI A;  3C71 A;  3Q2P A;  4MLY A;  3DZL A;  1RGA A;  4EV5 A;  1GOV A;  3OWY A;  2IMI A;  2DMM A;  2C3N A;  3QRD A;  2ML5 A;  4LEH A;  1N8Q A;  2YJ7 A;  4HZ9 B;  5FWG A;  1LJR A;  3KCM A;  1QVF 2;  2OE3 A;  3I43 A;  2CIU A;  1HNB A;  2XC2 A;  1SJW A;  3LTB A;  3DYR A;  1XOA A;  2EIQ A;  3KSP A;  4WBR D;  3LEF A;  2VL2 A;  4BWS A;  3MDK A;  4G1M B;  3IK7 A;  4EKZ A;  2KP2 A;  4ZBB A;  2IYJ A;  2CT6 A;  3OW2 2;  4RZM A;  1K28 A;  3L78 A;  5CRE A;  3KKG A;  4I8B A;  1GD4 A;  2F8F A;  4Q5Q A;  1GSP A;  2BIR A;  4YQM A;  2JU5 A;  2V1M A;  4RQX A;  1K0B A;  5ABR A;  3O3T A;  1M1K 4;  1YF1 A;  4EDY A;  4OFN A;  1DE2 A;  1TFK A;  2N5F A;  2D2Z A;  3LZA A;  1YZX A;  2E2V A;  1SAR A;  2XEP A;  3HXS A;  3UIW A;  4MMZ B;  1EQK A;  4K1F A;  1SKW B;  2E2M A;  2V6K A;  3F7S A;  2IMD A;  3PPU A;  3SED A;  3FRC A;  2CX1 A;  2F56 A;  5GAP D;  1BRJ A;  1GTB A;  1A2M A;  3P2A A;  1T2H A;  2LV3 A;  1A2J A;  3LQ7 A;  4HZ2 A;  1K0N A;  4MF7 A;  5DCG A;  1GNW A;  3CRT A;  2LQO A;  1IQ8 A;  5CF1 A;  5IPH A;  2B5E A;  1LOV A;  2RM5 A;  1JJ2 2;  1GSS A;  1ZYP A;  4IP1 A;  4ISD A;  4MP4 A;  3HIG A;  3CCJ 3;  4R80 A;  2WS2 A;  1YIT 3;  3B4O A;  5D96 A;  1XW5 A;  5ECQ B;  1Q82 4;  4IHU A;  3ERF A;  1M9B A;  1RKY A;  1AIU A;  1BRK A;  2F86 B;  2RSX A;  4FYB A;  3C7M A;  5EVH A;  3I56 3;  2PGT A;  5CRW A;  2F8A A;  4PTS A;  4WFO A;  1PFO A;  4K7N A;  2H0G A;  3WYW A;  1Z5Y E;  1F37 A;  1KQS 2;  1JZR A;  3CYN A;  1UC7 A;  3HJM A;  1S3A A;  2C4J A;  3DEX A;  1XBS A;  4EUY A;  5M19 A;  1DYU A;  1NU3 A;  2TRC P;  5CP1 A;  3Q90 A;  1GMQ A;  2LJR A;  1TKD B;  1YQ1 A;  4MZB A;  4KDX A;  3MSZ A;  1WJK A;  3RPN A;  5CRD A;  3JVC A;  5H5S A;  1STF I;  1PFP A;  1B4P A;  3GV1 A;  2JSZ A;  2LS5 A;  1B27 A;  3L0H A;  2W9Q A;  4OMV A;  3FF0 A;  3NOF A;  2FWF A;  2HZE B;  3CC2 3;  1NW2 A;  1VGL A;  2EIO A;  2AUV A;  1EOG A;  3GIX A;  3PH9 A;  4F2I A;  4TR1 B;  3N9H A;  4F0B A;  2WUL A;  2X8H A;  2C3Q A;  3DRN A;  2DKH A;  4OUQ A;  1O7N B;  3URP A;  4IN0 A;  4H86 A;  1I3F A;  3EHC A;  2OJL A;  5ID2 A;  4YAP A;  1LVN A;  3FK8 A;  4PUR A;  1I70 A;  4U13 A;  3CTF A;  2HT9 A;  3EWL A;  1TOF A;  1MEK A;  4BTX A;  2WB9 A;  3MG3 A;  4Z2U A;  4BU4 A;  4LSO A;  2CHC A;  1V2A A;  1B3S A;  1RCL A;  1U87 A;  4HEA 2;  2X8G A;  4EO3 A;  3B8L A;  3MIX A;  1H4O A;  3CCS 3;  2OAD A;  5GSP A;  4MF5 A;  2BT3 A;  3WGD A;  3H1N A;  4DVC A;  4FCM A;  3K8N A;  5AGY A;  2K3D A;  1TTO A;  1TXX A;  2MF7 A;  3MAK A;  1I9D A;  4TVE A;  3ZFB A;  4K0N A;  3KCH A;  1E3R A;  1SU9 A;  4N3V A;  2IMJ A;  2SAR A;  1K3L A;  4HJ2 A;  3X3X A;  1QK8 A;  2W56 A;  4L0U A;  3ZIT A;  5LCZ A;  5M18 A;  4TKY A;  4FCZ A;  1YVS A;  5ECR B;  1N8J A;  2GS3 A;  2FGT A;  3VWV A;  3ZTL A;  2BMQ B;  4K90 B;  4PQH A;  1RRL A;  1QAL A;  2IIY A;  3S67 A;  5AYS C;  1JNQ A;  3HK4 A;  3H3H A;  4XS6 A;  1MWS A;  3ME8 A;  3F7X A;  3GSP A;  4D73 B;  2QIY A;  1UGI A;  2NPB A;  2H1A A;  1O8W A;  1TK0 B;  3IC4 A;  1IVV A;  2YZU A;  4WXT A;  2IA7 A;  2JZT A;  4IQA A;  1X1Y A;  1M0U A;  2WFC A;  3UOM A;  1FUW A;  3EU3 A;  1B48 A;  5H5R A;  4BVX B;  1GLP A;  1ZL9 A;  3FHK A;  1FGR A;  1IQX A;  2DJ0 A;  3TOU A;  1TRQ A;  2H66 A;  1O7M B;  4EYC A;  4LMV A;  3GNJ A;  2AJQ B;  2LNT A;  1MDI A;  2VIM A;  1IDP A;  4N6N B;  5J9C A;  2H01 A;  4MDC A;  2VOC A;  3E99 A;  1IT7 A;  1JBT A;  4J56 E;  4AJ8 A;  1THO A;  4OWY A;  4WYK B;  2V6O A;  5G31 A;  5J5N A;  3X41 A;  1BED A;  4K1V A;  1RN4 A;  4MH3 A;  3BCI A;  4XS4 B;  1THX A;  4BIK A;  1K0A A;  3HA9 A;  1QMV A;  2FCH A;  3I55 3;  3DGQ A;  2OWP A;  2DJ3 A;  1FYS A;  2C0E A;  5COH A;  2RFR A;  2QC7 A;  1KSI A;  1BX9 A;  5D73 A;  3HZP A;  4POL A;  4HS1 A;  4KUN A;  4O3V A;  1VQ8 3;  1SK0 A;  2K0M A;  1FB6 A;  4AJ6 A;  1OVN A;  3AGO A;  3FCS B;  2P5R A;  3TJF A;  4ECJ A;  1RMS A;  2F5M A;  3JUQ A;  4R9K A;  2WO0 A;  2K6V A;  3NBB A;  2YNX A;  4IS0 A;  1BRH A;  2O3O A;  2LJA A;  1HD2 A;  2ZHX B;  2A4V A;  1CYU A;  1GLQ A;  3VWU A;  1GRX A;  3FR9 A;  3ZML A;  1E2Y A;  3K9M C;  1SYR A;  3FZA A;  1A24 A;  1WP0 A;  3EUR A;  3TKS C;  2H0I A;  1BNJ A;  2WCI A;  5AIG A;  5BIR A;  5F07 A;  4EL1 A;  3QPM A;  1MD3 A;  2VCT A;  3SLU A;  1JB5 A;  3AMO B;  2B24 B;  3AGN A;  1W6G A;  3VF1 A;  1W2B 2;  2GST A;  1J2B A;  3D4T A;  5A0O B;  2C10 A;  1UUV B;  1WMJ A;  1BGS A;  1V57 A;  3LXZ A;  3UVT A;  4ZL9 A;  1VQL 3;  4PNG A;  2VM1 A;  3GWR A;  4POM A;  1ZGX A;  3CCV 3;  3PS8 A;  4RBN A;  2HZE A;  5A4V A;  2K8V A;  5JPU A;  2C80 A;  3Q1C A;  1I3I A;  5KP1 A;  2R3X A;  1A0R P;  5BRT A;  2V32 A;  4LMI A;  4Q5N A;  1NHO A;  1CEW I;  1VZZ A;  2QA4 3;  3TRX A;  3F8H A;  4O5Q A;  3RHC A;  3EIN A;  4ZB8 A;  3HKR A;  4BL2 A;  2H71 A;  4MH2 A;  5CAX A;  3GFK A;  4EC6 A;  4RNT A;  1A8L A;  2CQ9 A;  3HVX A;  3EN1 B;  4G0I A;  3KM6 A;  4HM5 B;  7RNT A;  4ZIL A;  3VK9 A;  3VWW A;  2J8X B;  3TJG A;  3VI7 A;  3JUN A;  3M8N A;  3MG2 A;  1GOY A;  1UN2 A;  4V2M A;  2IL3 A;  4JRR A;  3JUM A;  1AQV A;  1U88 A;  2CC3 A;  2PVO C;  4HQZ A;  3UVH A;  4L7K A;  3GHA A;  4ZB6 A;  2GLR A;  2ZNM A;  1BVI A;  4MJB A;  1RGE A;  3GST A;  1ZYQ B;  3TOT A;  3GRD A;  1VF3 A;  4XM4 A;  2KXG A;  3X42 A;  1BRS A;  4KDY A;  5IO2 A;  6RNT A;  3IOS A;  1SJ6 A;  2W9P A;  14GS A;  1M1X B;  2CAI A;  1N2A A;  2ON5 A;  1SQW A;  3IPZ A;  2AV4 A;  4N0Z A;  3ERW A;  2GZP A;  3PCR A;  5D9W A;  3N54 B;  2C3T A;  4R4K A;  1OF5 B;  2L4V A;  1O7W B;  1RK4 A;  3D5G A;  2GVP A;  3J7Y d;  2NDO A;  2O89 A;  2ZCT A;  4NRE A;  3WGE A;  4X4J A;  2MYG A;  1OPY A;  2GU1 A;  2LKU A;  3TRP A;  4D73 A;  2W03 A;  13GS A;  4OFT A;  3LTC A;  1I0X A;  5ELU A;  1TI3 A;  2GU3 A;  3S9F A;  3LW9 A;  3TUE A;  4XCS A;  4HM4 B;  1XVW A;  3OWS A;  1PY3 A;  3KFQ C;  1Q4J A;  3LGC A;  5B8A A;  4KFE A;  4DSR A;  1I8V A;  5GZZ B;  3L4N A;  3DKS A;  1NB5 I;  4NMU A;  4XRD A;  4OFM A;  2XR8 B;  3FG4 A;  4MJE A;  4WET A;  2DJK A;  1SII A;  2M72 A;  2CG0 A;  1PX6 A;  1FW1 A;  3BLZ A;  4O5R A;  5D9X A;  1BUJ A;  3IV4 A;  4IVF A;  1VQK 3;  4GHO A;  1TDI A;  2FD3 A;  3NBJ A;  1QFN A;  5HQP A;  2YWN A;  3G71 3;  3WHO A;  1OH0 A;  1I2G A;  1T7P B;  1Z6M A;  1B2X A;  4KVH A;  2TIR A;  2OTL 3;  3F8U A;  3LG6 A;  2QSI A;  1K3O A;  1VQQ A;  4XS4 A;  4LYL B;  2CFG A;  1XPV A;  2O7K A;  1MGW A;  4N0V A;  5G1K A;  3DH2 A;  4LMW A;  3G9B A;  2IWT A;  1TI1 A;  2B7K A;  1GY6 A;  1QAF A;  3GKX A;  3TDG A;  2LST A;  3CBU A;  4HI7 A;  4MMM A;  4J5K A;  3QFB C;  4K2D A;  1G6Y A;  5IEP A;  1JBS A;  1SD9 A;  2H19 A;  1VQ6 3;  1CQH A;  4KSO A;  2MMN A;  1RGH A;  4HM3 B;  2H0H A;  3D4M A;  1T00 A;  4TXO B;  5IG4 A;  4PUA A;  1B4Q A;  1Q42 A;  1QGV A;  4EVM A;  2DJ1 A;  3W8J A;  1GNE A;  3L0R A;  4OCF A;  2GQL A;  3CSI A;  1LOX A;  4HM0 B;  3HCZ A;  2R0P A;  3C73 A;  2WOF A;  3GSS A;  2LRT A;  1FGQ A;  2FA8 A;  2H75 A;  3DXB A;  2R6K A;  1E3V A;  1X0R A;  2BNG A;  2ES7 A;  2ON7 A;  2I9W A;  4N6V 0;  2GEX A;  4G0L A;  3U97 A;  2L6D A;  3APS A;  4HJL B;  3EMP A;  4BWQ A;  4E8E A;  5IEN A;  1LXE A;  2L6C A;  2HMJ B;  2JAC A;  4MJA A;  4O5U A;  2VM2 A;  5STD A;  5ECS A;  4PGT A;  1URM A;  2FHE A;  2XF3 A;  3AMO A;  1BIR A;  2LJK A;  4KCE A;  5F0G A;  2AYT A;  3RPP A;  2P0X A;  3WGX A;  4MAB A;  1JFU A;  4V1A p;  1OYJ A;  1Q40 B;  1X5E A;  1XIY A;  5DJL A;  3DXO A;  4K0G A;  3F8X A;  3RDW A;  3G7I A;  1TTZ A;  1VQ5 3;  1BNG A;  2H1B A;  4V1A g;  1OGX A;  2IFQ B;  1TFO A;  3A5I A;  3H4K A;  3F9U A;  5C04 A;  1RW1 A;  3P90 A;  2MZC A;  3MYT A;  2JQ5 A;  1B9X C;  4GSP A;  3V92 A;  3FG3 A;  4EW5 A;  3WOD G;  1SIH A;  4KH7 A;  1TJD A;  5IM9 A;  5A4U A;  2Z6B A;  1FGO A;  3HVV A;  1Q98 A;  4FMD A;  3L9V A;  3DGO A;  1IK3 A;  4L8P A;  1O6J A;  1WE0 A;  1NSW A;  1RQM A;  4O02 B;  4N6L A;  5IF6 A;  5RNT A;  1FB0 A;  1DBY A;  5CYY A;  4X2O A;  1ZS7 A;  17GS A;  4MPG A;  1RGC A;  1W5Z A;  2DLX A;  1UDI I;  3F9S A;  3IAM 2;  5DCH A;  4NAX A;  3F4S A;  8RNT A;  3FZ5 A;  5G5E A;  4J5G A;  1SJZ A;  1VQM 3;  1YI2 3;  3VLN A;  3CCQ 3;  1RN1 A;  1RSN A;  3EBY A;  1EZK A;  3KMO A;  1GUM A;  4MJD A;  2M80 A;  5ECM B;  1ABA A;  3J7Y b;  3MG1 A;  5F06 A;  3C1S A;  4KDU A;  2GGT A;  4ML1 A;  9GSS A;  3LYG A;  1RN7 A;  3IRA A;  2RUF A;  3NIV A;  2B3S A;  2NBS A;  1VQ9 3;  1F8N A;  1OF5 A;  3CSJ A;  1JKG B;  1TRP A;  4FYU A;  4N11 A;  1PA3 A;  3CRU A;  2BMX A;  2CFL A;  5IG0 A;  1USB A;  4NXI A;  5J9B A;  4MZC A;  4Z2T A;  2HLS A;  1A90 A;  4HUA A;  1WQL B;  3DGY A;  4YQV A;  4FYC A;  2G0F A;  3I6A A;  1HZ1 A;  3CMA 3;  1RLS A;  4CY6 A;  5F05 A;  2XSH B;  1NJI 4;  4KCA A;  5TGN A;  3GTU A;  2YFL B;  1EOH A;  1PU4 A;  3LYK A;  4TX4 A;  4MNN A;  4FH8 A;  3DML A;  3NM7 A;  4R1K A;  1L5G B;  3ZYW A;  2FNO A;  2I9H A;  1RGF A;  1W4V A;  3IXR A;  3KIJ A;  5LD0 A;  3CCL 3;  5LC6 A;  2BJX A;  2L4Q A;  3TKR A;  1JLW A;  4BTY A;  3KH9 A;  3RBT A;  3LOR A;  1ISK A;  1S3C A;  5IG5 A;  3CCU 3;  4CW9 A;  3LH4 A;  2WDU A;  2XH9 A;  1ST9 A;  1DE1 A;  1TK5 B;  1TRU A;  5D82 A;  1LNH A;  2C8U A;  2OQE C;  5JPP A;  1JZD A;  3DVW A;  1Q7H A;  4GTU A;  5IOX A;  2W04 A;  1WTH A;  3VFI A;  1T1V A;  4Q5R A;  1V9W A;  2O85 A;  5GST A;  1Q81 4;  4JED A;  2KRT A;  5DRV A;  2R2J A;  4TR3 A;  1ZZY A;  4OCE A;  3DGM A;  3N8B A;  4FQU A;  3UAR A;  1YNV X;  4HOJ A;  3CMI A;  5ECO B;  1UGH I;  1LOW A;  5JCG A;  3ZLP A;  2DC5 A;  2GXF A;  4TXO A;  3ED3 A;  2OQE A;  3ECF A;  4HM1 B;  1B2S A;  3HJO A;  16GS A;  1N9E A;  2GBX B;  1BNE A;  1K73 4;  4G19 A;  1Z1S A;  3IC8 A;  5IMZ A;  5KP4 A;  1TU7 A;  1N5P A;  3FEU A;  4JZQ A;  4USS A;  3P8W A;  2F4Y A;  4KF9 A;  3TJJ A;  1K0O A;  5IO0 A;  4IIA A;  1M2B A;  4OO5 A;  3Q19 A;  3MYD A;  1FG4 A;  2V1L A;  2JDI H;  1FOH A;  5I97 A;  4OO4 A;  3VSY A;  4PXO A;  3CNM A;  3APO A;  1FOV A;  2Y74 A;  5D81 A;  3PZW A;  3DWV A;  1RGL A;  1Q40 A;  1K0C A;  5IOW A;  1FUT A;  5IW9 A;  2HMO B;  2UX0 A;  1PN0 A;  1RRH A;  2YPM A;  1OC8 A;  2IFQ A;  4EC0 A;  1RGK A;  3GA4 A;  4ULX A;  2GSQ A;  3MPH A;  3L9U A;  4ECI A;  2Q07 A;  2YJH A;  1S5A A;  3S27 A;  1A23 A;  4J2F A;  1U3I A;  4GWR A;  3DMC A;  2DSA A;  3I69 A;  1CYV A;  2VD0 A;  3O76 A;  2PU9 C;  1YJW 3;  3TJB A;  3KZQ A;  3JCM L;  1QQ2 A;  4FCJ A;  3FZ9 A;  1O85 A;  4K7I A;  2YZH A;  3HJP A;  2OBI A;  4MMY B;  1OCV A;  3LWA A;  1E6B A;  1F9M A;  1KEB A;  4ORL A;  3HZ8 A;  2DIY A;  3CCM 3;  1ROV A;  2VLT A;  1Q86 4;  3EYT A;  1IV7 A;  1DMN A;  3LSZ A;  1EA2 A;  2KUC A;  1US1 A;  1BSB A;  5DRE A;  2CX3 A;  2PBJ A;  3D5J A;  4WR4 A;  2YWM A;  1R4C A;  4I4K A;  2R0G A;  3F6F A;  3M3M A;  2HSH A;  1MDK A;  3W6G A;  3OR5 A;  4HQS A;  3A3T A;  3S28 A;  2CK3 H;  3KXO A;  4OD7 A;  2KF5 A;  2H73 A;  3SX1 A;  1ULI B;  3EC3 A;  3VPT A;  1X9S B;  3D4A A;  3NX0 A;  1HQO A;  3ZIJ A;  4IQ1 A;  4TR0 A;  5B6N A;  1B2Z A;  2LTK A;  1WWJ A;  3BB9 A;  1NDO B;  2DJ2 A;  1RJO A;  2H8L A;  3PGB A;  3IE3 A;  4AGS A;  2H6Y A;  1G96 A;  2V2G A;  4F03 A;  2Z77 A;  1NO3 A;  1JKG A;  2N5B A;  4O92 A;  1GSQ A;  1SJI A;  1PD2 1;  1RNT A;  1MWU A;  1XWC A;  5IMV A;  4HZB B;  2K54 A;  2ZA4 A;  3M1G A;  1RTU A;  1OAZ A;  5IMA A;  1LQG C;  3D3L A;  3CCE 3;  3P7X A;  1OKD A;  4PEJ A;  2A4H A;  2VCQ A;  2XFT A;  2V41 A;  1FUS A;  3X3Y A;  2DBC A;  4J57 E;  5G2Z A;  1O7H B;  1MWR A;  2YFI B;  5CO3 A;  2RII A;  5AIF A;  4ZL8 A;  3RGR A;  3EBT A;  1FW7 A;  5D83 A;  1PRX A;  3KGK A;  2HML B;  3IAS 2;  3F6D A;  2NVL A;  4EXR A;  3CPW 2;  1ZOF A;  2Z7A A;  4XDW A;  3ZRE A;  1FGT A;  4JE1 A;  2X64 A;  3FR3 A;  3TGZ A;  3SXX A;  3OV4 A;  3X40 A;  1GSE A;  3SOY A;  3EC9 A;  1K3Y A;  2C11 A;  3W8S A;  2F98 A;  4G10 A;  4IW9 A;  1S3D A;  3FR6 A;  2YN1 A;  3G8Z A;  5DAL B;  1BNI A;  3F63 A;  1YJ6 A;  3C1R A;  2AAD A;  2CWV A;  1X1U A;  3BCK A;  4J8T A;  1GH2 A;  2IUJ A;  1JZW A;  2TRX A;  1R4Y A;  1XW9 A;  1GYB A;  4BVY B;  4HDE A;  5F8B A;  1A8Y A;  2Z9S A;  1N8R 4;  4GQF A;  3ISO A;  2KP1 A;  4ECB A;  3HX8 A;  3O8Y A;  4NV5 A;  3E0U A;  4IGJ A;  2FXT A;  1UUG B;  3NXJ A;  1FA3 A;  2JL4 A;  1F3A A;  2KLX A;  2VL3 A;  3UEM A;  2QGV A;  1AW9 A;  5IMC A;  1OC3 A;  2KHP A;  2ALB A;  1YIJ 3;  3BU4 A;  4A5P A;  1J08 A;  1WMO A;  1VQP 3;  3RNT A;  2E2U A;  3GUR A;  3A5W A;  4QWT A;  3WT1 A;  2FGX A;  3R2Q A;  2L1S A;  2N5A A;  3D9R A;  5ECK B;  1BNS A;  1SK1 A;  3NBR A;  4NHF A;  4RUV A;  5EL8 A;  2OOV C;  5KN0 A;  2YWI A;  2YX9 A;  3RAZ A;  6GSS A;  1PQN A;  4YAV A;  4TR1 A;  1JHB A;  1XW6 A;  2R4V A;  2O8V B;  3IPT A;  10GS A;  2W6J H;  3MSO A;  2ZL8 A;  1U6T A;  2OKA A;  3TKS A;  2HI7 A;  3MKI A;  2LEG A;  3TB2 A;  3WA2 X;  1DET A;  2AAE A;  4FR9 A;  2K9F A;  3H93 A;  5D9T A;  3FSD A;  1GY7 A;  3ZG5 A;  2FWG A;  3AHS A;  2LRN A;  1B2M A;  3CD6 3;  5IQY A;  2HMK B;  5DAK B;  2E2T A;  4WWU C;  1MNL A;  4GL6 A;  2P09 A;  1EWX A;  1PMT A;  3DVX A;  6GSU A;  1SK2 A;  2OOV A;  2XBI A;  3N9J A;  3IMA B;  4EE0 A;  4EIP A;  2CW9 A;  3DM8 A;  4FMB A;  1UVZ A;  6GSV A;  1LRA A;  5JCW A;  5ENU A;  3LYP A;  3M9J A;  5CRH A;  2B6M A;  3ZL5 A;  2P5Q A;  2GDR A;  1IYH A;  1EUI C;  3ZFZ A;  1SL1 B;  4K6X A;  2WOH A;  4I5Q A;  3NUV A;  4RNY A;  1QMA A;  1HNA A;  4EV2 A;  3GKM A;  5ECL B;  1CQG A;  3EVI A;  1A2K A;  1W00 A;  2UUG C;  3OXA A;  4X2H A;  3QD9 A;  1UCL A;  1LOY A;  3PYJ A;  2LQQ A;  4EF0 A;  4H61 A;  3V98 A;  2WRT A;  4WF4 A;  3TKQ A;  3NHX A;  2NTO A;  1FZU A;  2GT5 A;  1W6Y A;  5KN3 A;  2QA2 A;  4N30 A;  1DMM A;  4IBP A;  4RI7 A;  1E97 A;  3X3Z A;  2XSO B;  3A2X A;  1AC1 A;  1EGO A;  4N6U A;  3E3E A;  2JAD A;  5H5Q A;  2IME A;  2BTO T;  4TOP A;  4N6M A;  1AAZ A;  4G0K A;  3UJM A;  1BAN A;  5BVB A;  6GSW A;  2X99 A;  1GMR A;  2VCX A;  1FHE A;  3MWH A;  3LML A;  1G6W A;  2H72 A;  2J23 A;  6STD A;  3ZVJ A;  1BSD A;  1CQS A;  3U1W A;  1JBR A;  1WIK A;  3CXG A;  3EJV A;  4BVX A;  1X9M B;  2QGU A;  3F14 A;  2R5G A;  2Z76 A;  3IK9 A;  1C54 A;  2C0D A;  4IEL A;  7STD A;  5D93 A;  2BO9 B;  2INX A;  3UBK A;  1UUW B;  1D6Z A;  3KTL A;  2O87 A;  5DQS A;  2B1X B;  7GSP A;  3BIR A;  3T8U A;  2ML6 A;  4N6O B;  4FMC A;  4I2U A;  2CWU A;  1GUL A;  3CNX A;  3EQQ B;  3SBC A;  4WYK A;  4HM6 B;  4MK3 A;  3S29 A;  3V99 A;  3CXC 2;  2O9U X;  1A2L A;  3GYK A;  3WA3 A;  1A2P A;  4GCI A;  1FVK A;  2R0C A;  2VD1 A;  3NM2 A;  1ERW A;  1A2V A;  4KT3 B;  2FUG 2;  5EVO A;  4ZIJ A;  3GN3 A;  1JRQ A;  2GT6 A;  4O2H A;  2YP6 A;  3OX9 A;  5AII A;  2W0Q A;  5DVB A;  2P0G A;  1Z3E A;  2VUP A;  1T4Z A;  3WR2 A;  2GBW B;  4K61 A;  2YWO A;  5E59 A;  1BSA A;  5AIX A;  3IBH A;  4LL4 B;  5DAL A;  3RGA A;  2Y73 A;  3APQ A;  2K8S A;  3E9J B;  2OE1 A;  2IUK A;  1S72 3;  3H79 A;  4JR4 A;  2H74 A;  2F51 A;  4AKZ A;  3R3E A;  3QFA C;  1N5H A;  2CVD A;  4DSQ A;  4BVY A;  2KCD A;  3M8C A;  2JSY A;  1EEJ A;  2CFK A;  3FH1 A;  1O7G B;  2WGR A;  1GD3 A;  5IMF A;  3SWL A;  2PZV A;  2GSP A;  22GS A;  4PQ1 A;  3LOY A;  8GSS A;  4IPB A;  1G7E A;  1O81 A;  4GXZ A;  1HKX A;  1ACV A;  4J9A A;  1DSB A;  4GST A;  2PMT A;  1X9W B;  4L0W A;  3WD6 A;  1O7P B; 
#chains in the Genus database with same CATH homology
 5HR3 A;  4XHM A;  3LJR A;  3LXT A;  1FVJ A;  1SKR B;  2FWH A;  5JWR B;  3EMX A;  2K18 A;  2L5L A;  4NHZ A;  2L5O A;  1GWC A;  2HXK A;  3IHQ A;  3ZMK A;  5HFG A;  4GF0 A;  3TRQ A;  2IMK A;  4O7H A;  1T4Y A;  3G7Y A;  4QL7 A;  1G7O A;  4GSS A;  1V58 A;  1VF2 A;  2RUE A;  1EP8 A;  2HZF A;  3AY8 A;  3IA1 A;  2OAC A;  3D22 A;  1IYI A;  4ZL7 A;  2RM6 A;  4YQU A;  3PGT A;  1PKW A;  2JZS A;  2GSS A;  3FMW A;  1BG5 A;  3Q18 A;  1AXD A;  3VWX A;  3FZ4 A;  1GSY A;  2GSR A;  2I3Y A;  4TR4 A;  4HJM A;  4ZBD A;  1ZCP A;  2XBQ A;  2OE0 A;  4Q5F A;  1GUK A;  4LA1 A;  1MDJ A;  1ML6 A;  1BAY A;  1TK8 B;  1G0T A;  1SL0 B;  3QMX A;  1SEN A;  4Z7X A;  2CZ2 A;  5HR1 A;  1BQ7 A;  1ERV A;  5ECI B;  2DML A;  3A2V A;  5B8B A;  1B9Y C;  1Y6E A;  2I4A A;  3WT2 A;  2YV9 A;  1ON4 A;  5FHI A;  1M99 A;  4G2E A;  4V2N A;  3DIE A;  4WKW A;  4IP6 A;  5EY6 A;  2CX4 A;  2H1D A;  2LUS A;  1OE7 A;  1O73 A;  2XPD A;  1GSF A;  1AQX A;  2YOI A;  5J3R A;  3F3R A;  4V2L A;  4NWY A;  1YKC A;  2L59 A;  6GST A;  2A2S A;  1TRW A;  4Z2R A;  1SKS B;  2AAW A;  4QQ7 A;  2B7J A;  4X43 A;  4K5R A;  4EXJ A;  1BYE A;  1AQW A;  3C8E A;  3GX8 A;  4I6X A;  1TU8 A;  5INY A;  2HYX A;  2B1L A;  1SD8 A;  1JZO A;  2X4A A;  5DDL A;  2PN8 A;  3EPT A;  1JLV A;  1Z9H A;  3HVS A;  5CNW A;  1WOU A;  2RLI A;  2E2G A;  1V98 A;  3M9K A;  4POB A;  3FYG A;  2B5Y A;  2PVQ A;  3HYP A;  1OKT A;  4TW5 A;  2OA7 A;  3KP9 A;  2IY2 A;  2X8C A;  3Q74 A;  1XWK A;  4FO5 A;  4KSM A;  3UJ1 A;  1EV9 A;  1XCC A;  4PNF A;  1GTU A;  1K0D A;  5IMD A;  1YF0 A;  2IMF A;  4POK A;  4F9Z A;  1Z7P A;  5JCU A;  4JU5 A;  3UMA A;  1YKA A;  2XPE A;  1LBK A;  4MA9 A;  3HY2 A;  1U3A A;  2HSY A;  1LU4 A;  3U6V A;  1GSD A;  2PUK C;  1SYX A;  1XWB A;  1YDK A;  1KNG A;  3GL5 A;  3EE2 A;  2I1U A;  4CHS A;  4ZBA A;  5KOX A;  3QAW A;  1PX7 A;  1EP7 A;  2DKI A;  3L9S A;  11GS A;  4L8E A;  5E4W A;  2AHE A;  1TRV A;  3F3Q A;  5ECN B;  4KA0 A;  3CTG A;  1J9B A;  1ILO A;  1ZMA A;  4ACS A;  4AJ7 A;  3KP8 A;  5IIZ A;  4ZB9 A;  4XTS A;  1O7U A;  4MPF A;  3ZIV A;  7GSS A;  3VI5 A;  2J9H A;  1NHY A;  5B6M A;  5ELA A;  1XWA A;  4HU9 A;  1AUC A;  1X5C A;  3GH6 A;  4K7O A;  18GS A;  1UA5 A;  3N5O A;  2HE3 A;  3D21 A;  2MMZ A;  3IR4 A;  1VF4 A;  3BD2 A;  3DD3 A;  3ZRD A;  1FAA A;  1B8X A;  2M46 A;  4HZ4 A;  1YY7 A;  3H8Q A;  2C1Y A;  12GS A;  3GRX A;  5DBQ A;  5GAN D;  4BL7 B;  2VO4 A;  5A4W A;  4WEY A;  4LLR A;  4GRF A;  5C00 A;  2CVK A;  6GSY A;  5KOW A;  4FIW A;  3BJ5 A;  2L4C A;  3UL3 A;  2IPA A;  4PUF C;  3US3 A;  4XRA A;  2HNL A;  5AN1 A;  1PKZ A;  1GSU A;  1R5P A;  2H70 A;  3G7J A;  2YV7 A;  1T3B A;  4EIQ A;  5L71 A;  1PGT A;  2CVB A;  4GLT A;  4TN8 A;  2VL9 A;  1YEP A;  1O8X A;  2UZ8 A;  4RQR A;  1WPI A;  2LRC A;  2MMA A;  4KX4 A;  2VCZ A;  4ICY A;  2CV4 A;  2GQK A;  3GL3 A;  4N10 A;  3I9V 2;  1R7H A;  2GQM A;  5AIS A;  4DSS B;  1H75 A;  1A0F A;  2IN3 A;  2KOK A;  5ELG A;  1QXH A;  5J4U A;  3NZN A;  2FLS A;  1BJX A;  2HFD A;  19GS A;  4P3Y B;  2VAF A;  4YKG A;  1EGR A;  3D0Z A;  2QA1 A;  1KBN A;  3QAV A;  1F3B A;  3U5R E;  4HU7 A;  2G2Q A;  1XOB A;  3HD5 A;  2MBT A;  2H6Z A;  3D6I A;  3QDN A;  1TW9 A;  2AB6 A;  2F3M A;  2VCW A;  2DIZ A;  2EC4 A;  3IDV A;  4NPB A;  3QR6 A;  1VRS D;  4GQC A;  4ILF A;  2DJJ A;  5AIV A;  1ZGN A;  2H76 A;  2MBS A;  2B1K A;  2R37 A;  3GKK A;  1I5G A;  1Z6N A;  4BA7 A;  1OE8 A;  1OC9 B;  1HYU A;  3O6T A;  3ZFL A;  3KMN A;  2PPT A;  4EDZ A;  4NHW A;  3KJY A;  4E8H A;  5ECP B;  4KE3 A;  3M0F A;  1PL1 A;  4X0X A;  1GP1 A;  3FY7 A;  2A2R A;  4IJ3 A;  3QOU A;  3HZ4 A;  1WRY A;  1T8E B;  1GTI A;  2YAN A;  2E7P A;  2GTU A;  4ECC A;  4AF2 A;  1Y25 A;  3QCP A;  1ZYN A;  3KEB A;  2C0G A;  5D8I A;  2VLU A;  1GUH A;  5IPG A;  5DQY A;  4TXV A;  2H30 A;  1ERT A;  3KTB A;  2JZR A;  5GSS A;  1Z7R A;  1F6M C;  2WZ9 A;  4F82 A;  3UAP A;  3VPQ A;  1J0F A;  5EPF A;  3GH9 A;  2FA4 A;  4KAE A;  2X49 A;  4ZXG A;  2REM A;  4KB3 A;  3TJK A;  1XVQ A;  20GS A;  5KN1 A;  2A2P A;  3ME7 A;  1NM3 A;  4BPY A;  2HSM A;  3HDC A;  5G1L A;  3PIN A;  2H6X A;  4K8M A;  5BMU A;  4BL7 A;  5D9V A;  2HRF A;  2PER A;  2IJY A;  2YCD A;  5A5K A;  4WBJ A;  2HRK A;  2CZ3 A;  3LFL A;  5FT3 A;  1HNC A;  4MJC A;  3GTU B;  4MF6 A;  3VUR A;  5G5F A;  1TRS A;  3F0I A;  4KGI A;  1SL2 B;  1K0M A;  1PN9 A;  3RHB A;  4MCU A;  1M2A A;  1EEM A;  1TP9 A;  2CAQ A;  4O32 A;  1R4W A;  4RI6 A;  4XIH A;  1FO5 A;  5JWQ B;  1XFL A;  3Q6O A;  4DEJ A;  1M7T A;  3CSH A;  4WR5 A;  3F4T A;  1X5D A;  4K2X A;  2B5X A;  3GKN A;  2E0Q A;  2HRN A;  2VCV A;  3BBY A;  5KN2 A;  2WJU A;  1MTC A;  2PWJ A;  3QAG A;  4QL9 A;  4F0C A;  2XHF A;  2MMO A;  4DSS A;  5B7C A;  3J7Y k;  4NV2 A;  1R26 A;  2FY6 A;  3TKS E;  2HRA A;  4X1U A;  6GSX A;  2OBK A;  5HFK A;  4K5S A;  3UBL A;  4JR6 A;  4KND A;  1ZYE A;  5DJM A;  5HR2 A;  4G9H A;  4ML6 A;  3F4R A;  4MZW A;  5G30 A;  1YEX A;  4K9Z A;  4ID0 A;  4L5L A;  1XZO A;  2ZUP A;  3MNG A;  4WF5 A;  1M9A A;  4YH2 A;  2GZZ A;  3A2W A;  1MD4 A;  2QKE A;  3ZVJ D;  1GL8 A;  4XS1 A;  1ERU A;  1XWG A;  5CRG A;  3FW2 A;  3PR8 A;  3FKF A;  1QUW A;  1GTA A;  3TCO A;  3GUS A;  4PX1 A;  5ID2 B;  5KEJ A;  3KH7 A;  1W89 A;  3ZZX A;  4YKF A;  3IHG A;  3KD0 A;  1DUG A;  1EV4 A;  4TRX A;  2C0F A;  1OC9 A;  4CDO A;  1V40 A;  3BOA A;  1VF1 A;  4JBB A;  4L5O A;  3V1W A;  3GMF A;  4I97 A;  1PL2 A;  3EU4 A;  4LL1 B;  1XXU A;  1M2D A;  4GSN A;  2L57 A;  4KW6 A;  1KTE A;  2EIR A;  5DAK A;  4CY8 A;  5JWO B;  4I2T A;  1F2E A;  2GZY A;  2LNS A;  5ECH B;  4IJI A;  2P31 A;  2CA8 A;  3HHV A;  5HFI A;  5J41 A;  3GX0 A;  2I81 A;  5LNK e;  2F9S A;  5HR0 A;  1R5A A;  4PQI A;  2VLV A;  4IKH A;  3ERG A;  2VL2 C;  1PSQ A;  1C72 A;  3TKP A;  2H1G A;  2FWE A;  3C71 A;  4MLY A;  2IMI A;  2DMM A;  2C3N A;  2YJ7 A;  5FWG A;  1LJR A;  3KCM A;  2OE3 A;  3I43 A;  1HNB A;  2XC2 A;  3DYR A;  1XOA A;  2EIQ A;  4WBR D;  3LEF A;  2VL2 A;  4BWS A;  3MDK A;  3IK7 A;  4EKZ A;  2KP2 A;  4ZBB A;  2IYJ A;  2CT6 A;  3L78 A;  5CRE A;  4I8B A;  2F8F A;  4Q5Q A;  4YQM A;  2JU5 A;  2V1M A;  4RQX A;  1K0B A;  5ABR A;  3O3T A;  1YF1 A;  4EDY A;  4OFN A;  1DE2 A;  2N5F A;  2D2Z A;  1YZX A;  3HXS A;  3UIW A;  1SKW B;  4K1F A;  2E2M A;  2V6K A;  2IMD A;  3PPU A;  3FRC A;  5GAP D;  1GTB A;  1A2M A;  3P2A A;  2LV3 A;  1A2J A;  3LQ7 A;  4HZ2 A;  1K0N A;  4MF7 A;  5DCG A;  1GNW A;  3CRT A;  2LQO A;  5IPH A;  2B5E A;  2RM5 A;  1GSS A;  1ZYP A;  4IP1 A;  4ISD A;  4MP4 A;  2WS2 A;  5D96 A;  5ECQ B;  1XW5 A;  4IHU A;  3ERF A;  1M9B A;  1AIU A;  4FYB A;  3C7M A;  2PGT A;  5CRW A;  2F8A A;  4PTS A;  4K7N A;  2H0G A;  3WYW A;  1Z5Y E;  1F37 A;  1JZR A;  3CYN A;  1UC7 A;  3HJM A;  1S3A A;  2C4J A;  3DEX A;  1XBS A;  4EUY A;  2TRC P;  5CP1 A;  2LJR A;  1TKD B;  1YQ1 A;  4MZB A;  4KDX A;  3MSZ A;  1WJK A;  3RPN A;  5CRD A;  5H5S A;  1B4P A;  3GV1 A;  2JSZ A;  2LS5 A;  3L0H A;  4OMV A;  3NOF A;  2FWF A;  2HZE B;  1NW2 A;  1VGL A;  2EIO A;  2AUV A;  1EOG A;  3GIX A;  3PH9 A;  4F2I A;  4TR1 B;  4F0B A;  2WUL A;  2X8H A;  2C3Q A;  3DRN A;  2DKH A;  4IN0 A;  4H86 A;  2OJL A;  5ID2 A;  4YAP A;  3FK8 A;  4PUR A;  3CTF A;  2HT9 A;  3EWL A;  1TOF A;  1MEK A;  2WB9 A;  4Z2U A;  1V2A A;  1U87 A;  4HEA 2;  2X8G A;  4EO3 A;  3MIX A;  1H4O A;  2OAD A;  4MF5 A;  3WGD A;  3H1N A;  4DVC A;  3K8N A;  5AGY A;  1TXX A;  3MAK A;  1I9D A;  4TVE A;  3ZFB A;  4K0N A;  1SU9 A;  1K3L A;  4HJ2 A;  1QK8 A;  4L0U A;  3ZIT A;  5LCZ A;  4TKY A;  5ECR B;  1N8J A;  2GS3 A;  3VWV A;  3ZTL A;  4PQH A;  2IIY A;  4XS6 A;  3ME8 A;  4D73 B;  2NPB A;  2H1A A;  1O8W A;  1TK0 B;  3IC4 A;  2YZU A;  4WXT A;  2JZT A;  4IQA A;  1M0U A;  2WFC A;  3UOM A;  3EU3 A;  1B48 A;  5H5R A;  4BVX B;  1GLP A;  1ZL9 A;  3FHK A;  2DJ0 A;  3TOU A;  2H66 A;  4LMV A;  3GNJ A;  2AJQ B;  2LNT A;  1MDI A;  2VIM A;  5J9C A;  2H01 A;  4MDC A;  2VOC A;  4J56 E;  4AJ8 A;  1THO A;  4OWY A;  2V6O A;  5G31 A;  5J5N A;  1BED A;  4MH3 A;  3BCI A;  4XS4 B;  1THX A;  1K0A A;  3HA9 A;  1QMV A;  2FCH A;  3DGQ A;  2DJ3 A;  2C0E A;  5COH A;  2QC7 A;  1BX9 A;  5D73 A;  4POL A;  4HS1 A;  4KUN A;  1SK0 A;  1FB6 A;  4AJ6 A;  1OVN A;  2P5R A;  3TJF A;  4ECJ A;  2K6V A;  2YNX A;  4IS0 A;  2LJA A;  1HD2 A;  2A4V A;  1GLQ A;  3VWU A;  1GRX A;  3FR9 A;  3ZML A;  1E2Y A;  1SYR A;  3FZA A;  1A24 A;  1WP0 A;  3EUR A;  3TKS C;  2H0I A;  2WCI A;  5F07 A;  4EL1 A;  3QPM A;  1MD3 A;  2VCT A;  2GST A;  3D4T A;  1WMJ A;  1V57 A;  3LXZ A;  3UVT A;  4ZL9 A;  4PNG A;  2VM1 A;  4POM A;  2HZE A;  5A4V A;  2K8V A;  2C80 A;  2R3X A;  1A0R P;  5BRT A;  2V32 A;  4Q5N A;  1NHO A;  3TRX A;  4O5Q A;  3RHC A;  3EIN A;  4ZB8 A;  3HKR A;  2H71 A;  4MH2 A;  5CAX A;  3GFK A;  1A8L A;  2CQ9 A;  3HVX A;  4G0I A;  3KM6 A;  4ZIL A;  3VK9 A;  3VWW A;  3TJG A;  3VI7 A;  3M8N A;  1UN2 A;  4V2M A;  2IL3 A;  4JRR A;  1AQV A;  1U88 A;  2PVO C;  4HQZ A;  3UVH A;  4ZB6 A;  3GHA A;  2GLR A;  2ZNM A;  4MJB A;  3GST A;  1ZYQ B;  3TOT A;  1VF3 A;  4KDY A;  5IO2 A;  3IOS A;  1SJ6 A;  14GS A;  2CAI A;  1N2A A;  2ON5 A;  3IPZ A;  2AV4 A;  4N0Z A;  3ERW A;  2GZP A;  5D9W A;  2C3T A;  1RK4 A;  2GVP A;  2NDO A;  2O89 A;  2ZCT A;  3WGE A;  4X4J A;  2MYG A;  2LKU A;  3TRP A;  4D73 A;  13GS A;  4OFT A;  1TI3 A;  3S9F A;  3LW9 A;  3TUE A;  4XCS A;  1XVW A;  1Q4J A;  3LGC A;  5B8A A;  4DSR A;  5GZZ B;  3L4N A;  3DKS A;  4NMU A;  4XRD A;  4OFM A;  4MJE A;  4WET A;  2DJK A;  2M72 A;  1PX6 A;  1FW1 A;  4O5R A;  5D9X A;  3IV4 A;  4IVF A;  1TDI A;  2FD3 A;  1QFN A;  5HQP A;  2YWN A;  1T7P B;  1Z6M A;  2TIR A;  3F8U A;  3LG6 A;  2QSI A;  1K3O A;  4XS4 A;  1XPV A;  2O7K A;  4N0V A;  5G1K A;  4LMW A;  3G9B A;  2IWT A;  1TI1 A;  2B7K A;  3GKX A;  2LST A;  3TDG A;  3CBU A;  4HI7 A;  4MMM A;  3QFB C;  4K2D A;  1G6Y A;  1SD9 A;  2H19 A;  1CQH A;  4KSO A;  2MMN A;  2H0H A;  3D4M A;  1T00 A;  4TXO B;  4PUA A;  1B4Q A;  1QGV A;  4EVM A;  2DJ1 A;  3W8J A;  1GNE A;  4OCF A;  2GQL A;  3CSI A;  3HCZ A;  2R0P A;  3C73 A;  3GSS A;  2LRT A;  2FA8 A;  2H75 A;  3DXB A;  2R6K A;  1X0R A;  2ES7 A;  2ON7 A;  4G0L A;  2L6D A;  3APS A;  4BWQ A;  3EMP A;  4E8E A;  2L6C A;  2JAC A;  4MJA A;  4O5U A;  2VM2 A;  5ECS A;  4PGT A;  1URM A;  2FHE A;  2LJK A;  4KCE A;  5F0G A;  2AYT A;  3RPP A;  3WGX A;  4MAB A;  1JFU A;  4V1A p;  1OYJ A;  1X5E A;  1XIY A;  5DJL A;  4K0G A;  3RDW A;  3G7I A;  1TTZ A;  2H1B A;  4V1A g;  3H4K A;  2IFQ B;  3A5I A;  3F9U A;  5C04 A;  1RW1 A;  3P90 A;  2MZC A;  1B9X C;  4KH7 A;  1TJD A;  5IM9 A;  5A4U A;  3HVV A;  1Q98 A;  3L9V A;  1WE0 A;  1O6J A;  1NSW A;  1RQM A;  1FB0 A;  1DBY A;  5CYY A;  17GS A;  4MPG A;  2DLX A;  3IAM 2;  5DCH A;  4NAX A;  3F4S A;  5G5E A;  3FZ5 A;  1SJZ A;  3VLN A;  1EZK A;  3KMO A;  1GUM A;  2M80 A;  5ECM B;  1ABA A;  3J7Y b;  5F06 A;  3C1S A;  4KDU A;  2GGT A;  4ML1 A;  9GSS A;  3IRA A;  2RUF A;  3NIV A;  2B3S A;  2NBS A;  3CSJ A;  4FYU A;  4N11 A;  1PA3 A;  3CRU A;  2BMX A;  1USB A;  4NXI A;  5J9B A;  4MZC A;  4Z2T A;  2HLS A;  4HUA A;  4YQV A;  4FYC A;  2G0F A;  3I6A A;  4CY6 A;  5F05 A;  4KCA A;  3GTU A;  1EOH A;  3LYK A;  4MNN A;  4FH8 A;  3DML A;  3ZYW A;  2FNO A;  2I9H A;  1W4V A;  3IXR A;  3KIJ A;  5LD0 A;  2BJX A;  2L4Q A;  3TKR A;  1JLW A;  3KH9 A;  3RBT A;  3LOR A;  1S3C A;  4CW9 A;  2WDU A;  1ST9 A;  1DE1 A;  1TK5 B;  1TRU A;  2C8U A;  1JZD A;  3DVW A;  4GTU A;  5IOX A;  3VFI A;  1T1V A;  4Q5R A;  1V9W A;  2O85 A;  5GST A;  4JED A;  2R2J A;  4TR3 A;  1ZZY A;  4OCE A;  3UAR A;  4FQU A;  4HOJ A;  3CMI A;  5ECO B;  5JCG A;  3ZLP A;  2DC5 A;  4TXO A;  3ED3 A;  3HJO A;  16GS A;  4G19 A;  5IMZ A;  3IC8 A;  1TU7 A;  3FEU A;  4JZQ A;  4USS A;  3P8W A;  4KF9 A;  3TJJ A;  1K0O A;  5IO0 A;  1M2B A;  4OO5 A;  3Q19 A;  3MYD A;  1FG4 A;  1FOH A;  4OO4 A;  4PXO A;  3APO A;  1FOV A;  3DWV A;  1K0C A;  5IOW A;  1PN0 A;  2YPM A;  1OC8 A;  2IFQ A;  4EC0 A;  3GA4 A;  4ULX A;  2GSQ A;  3L9U A;  4ECI A;  2YJH A;  1A23 A;  4J2F A;  1U3I A;  4GWR A;  2DSA A;  3I69 A;  2VD0 A;  3O76 A;  2PU9 C;  3TJB A;  3KZQ A;  3JCM L;  1QQ2 A;  3FZ9 A;  1O85 A;  4K7I A;  2YZH A;  3HJP A;  2OBI A;  3LWA A;  1E6B A;  1F9M A;  1KEB A;  3HZ8 A;  2DIY A;  2VLT A;  3EYT A;  3LSZ A;  2KUC A;  2CX3 A;  2PBJ A;  3D5J A;  4WR4 A;  2YWM A;  2R0G A;  3F6F A;  3M3M A;  2HSH A;  1MDK A;  3W6G A;  3OR5 A;  4HQS A;  3A3T A;  3KXO A;  4OD7 A;  3EC3 A;  2H73 A;  3VPT A;  1X9S B;  1HQO A;  3ZIJ A;  4IQ1 A;  4TR0 A;  5B6N A;  2LTK A;  1WWJ A;  2DJ2 A;  2H8L A;  4AGS A;  3IE3 A;  2H6Y A;  2V2G A;  4F03 A;  2N5B A;  4O92 A;  1GSQ A;  1SJI A;  1PD2 1;  1XWC A;  5IMV A;  3M1G A;  1OAZ A;  5IMA A;  3P7X A;  1OKD A;  2A4H A;  2VCQ A;  2V41 A;  2DBC A;  4J57 E;  5G2Z A;  5CO3 A;  2RII A;  4ZL8 A;  1PRX A;  3KGK A;  3IAS 2;  3F6D A;  2NVL A;  1ZOF A;  3ZRE A;  4JE1 A;  2X64 A;  3FR3 A;  3TGZ A;  1GSE A;  1K3Y A;  3W8S A;  4G10 A;  4IW9 A;  1S3D A;  3FR6 A;  2YN1 A;  5DAL B;  3F63 A;  1YJ6 A;  3C1R A;  3BCK A;  1GH2 A;  1JZW A;  2TRX A;  1XW9 A;  4BVY B;  4HDE A;  5F8B A;  1A8Y A;  2Z9S A;  4GQF A;  3ISO A;  2KP1 A;  4ECB A;  4NV5 A;  3E0U A;  4IGJ A;  2KLX A;  2JL4 A;  1F3A A;  2VL3 A;  3UEM A;  2QGV A;  1AW9 A;  5IMC A;  1OC3 A;  2KHP A;  2ALB A;  4A5P A;  1J08 A;  3GUR A;  3A5W A;  3WT1 A;  2FGX A;  3R2Q A;  2N5A A;  5ECK B;  1SK1 A;  4RUV A;  5EL8 A;  5KN0 A;  2YWI A;  3RAZ A;  6GSS A;  1PQN A;  4YAV A;  4TR1 A;  1JHB A;  1XW6 A;  2R4V A;  2O8V B;  10GS A;  2OKA A;  3TKS A;  1U6T A;  2HI7 A;  2LEG A;  3TB2 A;  2K9F A;  3H93 A;  5D9T A;  2FWG A;  2LRN A;  5IQY A;  5DAK B;  1EWX A;  1PMT A;  3DVX A;  6GSU A;  1SK2 A;  2XBI A;  3N9J A;  4EE0 A;  4EIP A;  1UVZ A;  6GSV A;  5JCW A;  5ENU A;  3LYP A;  3M9J A;  5CRH A;  2B6M A;  3ZL5 A;  2P5Q A;  2GDR A;  1IYH A;  1SL1 B;  4K6X A;  4I5Q A;  1HNA A;  3GKM A;  5ECL B;  1CQG A;  3EVI A;  3QD9 A;  2LQQ A;  4EF0 A;  2WRT A;  4WF4 A;  3TKQ A;  2NTO A;  2GT5 A;  5KN3 A;  2QA2 A;  4N30 A;  4IBP A;  4RI7 A;  3A2X A;  1AC1 A;  1EGO A;  3E3E A;  2JAD A;  5H5Q A;  2IME A;  2BTO T;  4TOP A;  1AAZ A;  4G0K A;  6GSW A;  2X99 A;  2VCX A;  1FHE A;  3MWH A;  1G6W A;  2H72 A;  2J23 A;  3ZVJ A;  1WIK A;  3CXG A;  4BVX A;  1X9M B;  2R5G A;  3IK9 A;  2C0D A;  4IEL A;  5D93 A;  3UBK A;  3KTL A;  2O87 A;  5DQS A;  4I2U A;  1GUL A;  3SBC A;  4MK3 A;  1A2L A;  3GYK A;  4GCI A;  1FVK A;  2R0C A;  2VD1 A;  1ERW A;  2FUG 2;  5EVO A;  4ZIJ A;  3GN3 A;  2GT6 A;  2YP6 A;  5DVB A;  2P0G A;  1Z3E A;  2VUP A;  1T4Z A;  2YWO A;  5E59 A;  5AIX A;  3IBH A;  4LL4 B;  5DAL A;  3APQ A;  2K8S A;  3E9J B;  2OE1 A;  3H79 A;  4JR4 A;  2H74 A;  2F51 A;  3R3E A;  3QFA C;  2CVD A;  4DSQ A;  4BVY A;  2JSY A;  1EEJ A;  2WGR A;  5IMF A;  3SWL A;  22GS A;  4PQ1 A;  8GSS A;  1G7E A;  1O81 A;  4GXZ A;  1ACV A;  1DSB A;  4GST A;  2PMT A;  1X9W B;  4L0W A;  3WD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...