5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
b'LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
2M80A 2H1BA 5DQYA 2KHPA 3G7YA 3GKMA 3HY2A 3UIWA 2GZPA 3TJKA 4JBBA 1EWXA 3DGQA 5ELAA 1GL8A 2C1YA 1T3BA 2K8VA 1KNGA 5DQSA 1NHOA 3RAZA 1GNWA 2YN1A 3LG6A 5HR3A 4MPGA 1J08A 1U3AA 10GSA 3LYPA 5JWQB 1YY7A 2B7JA 2AHEA 3GKNA 2DLXA 3BD2A 1DSBA 1F37A 1EGOA 4GRFA 4HOJA 5DAKA 2CVBA 1W4VA 3PH9A 2FD3A 3KTLA 2CVDA 3GKKA 3WT2A 2XPEA 3HYPA 4K9ZA 1EP8A 1WOUA 3TJJA 2X8CA 1GUHA 3IBHA 12GSA 6GSTA 3QCPA 3GRXA 2DJ1A 3H79A 2ON7A 2VLVA 3KMOA 2EIOA 1PGTA 2OBIA 2LRCA 3TCOA 2VIMA 2CX4A 4QL7A 3H8QA 4KGIA 1F3AA 5HFKA 4GQCA 1R5PA 2ZCTA 3C7MA 4IQ1A 5DCHA 3TKSE 4KA0A 1AQWA 1OVNA 3ZRDA 3GNJA 3TDGA 1QMVA 3KZQA 3MSZA 2NBSA 1PKWA 1ON4A 3FZAA 3TJGA 1YEPA 5DCGA 2VCWA 3WGXA 4MF5A 4RQRA 5ECQB 1GLPA 3FR3A 5AGYA 1FVJA 3ZVJA 2IFQA 3ERGA 3FR9A 3HZ4A 1V98A 5CP1A 2GT6A 2R4VA 5ECMB 1KBNA 4ISDA 1RW1A 2MBTA 5F06A 5AN1A 1HQOA 3Q6OA 1OKDA 3APOA 2H70A 1V40A 1JLVA 4HJ2A 2B1KA 1HD2A 2FY6A 2I81A 2IMDA 1YJ6A 3TKPA 3HCZA 4I8BA 4V2MA 3F8UA 2IIYA 3DYRA 4RI6A 5IMDA 1VF2A 1GSDA 4BPYA 2CZ3A 4NHZA 3KCMA 1RQMA 3F9UA 1FOVA 3J7Yb 3TKSA 2FA8A 4TR3A 4N0VA 4EUYA 1TRSA 1TU7A 4G2EA 2PU9C 2OADA 3HHVA 1SK1A 4FIWA 2WFCA 2YWMA 3VK9A 1GTAA 3TKQA 1XWBA 1AQXA 1AXDA 2JADA 2OA7A 4TR4A 3F3RA 3ZVJD 2Z9SA 4NAXA 2N5AA 3KP9A 6GSUA 1O73A 5ECIB 1AQVA 5AISA 5CRGA 3TUEA 4DSSB 5COHA 5C04A 1HYUA 5KN3A 1A8YA 5B6NA 3GX0A 3FZ4A 3E3EA 4IGJA 2RUFA 3GTUB 4JU5A 2A2RA 3TRQA 2RM5A 1XFLA 1EV4A 1U3IA 1A2LA 3W8JA 4ZBDA 4XRDA 3C1SA 2C3QA 2KOKA 4V2LA 4KW6A 3FY7A 2HZEA 4JZQA 2M72A 2HFDA 3D4TA 1GSYA 2MMZA 3WT1A 4KX4A 1UN2A 3VWVA 4K8MA 5KN0A 2CX3A 3UAPA 3US3A 5J41A 3UBKA 1EGRA 1UA5A 2H01A 2QC7A 1S3CA 4GLTA 4MDCA 4V1Ag 4OO4A 4WF5A 1B4QA 5IPGA 1SD9A 1WRYA 4N11A 5AIVA 4IP1A 3S9FA 2R37A 2YNXA 3GA4A 3FK8A 2XPDA 2C0DA 2DIYA 1ZYQB 1G7EA 4PQIA 1EZKA 16GSA 5J9BA 1THXA 3RDWA 1SJIA 3G9BA 5LNKe 4WR4A 3D21A 3QDNA 5DJLA 1XCCA 1XXUA 1JZOA 1K0CA 2WRTA 1TI1A 2GLRA 3KGKA 3QFBC 1U6TA 2I1UA 3CBUA 2A4VA 1OC9B 2LRNA 2L6CA 1SU9A 1M0UA 4EE0A 3HD5A 1PA3A 4P3YB 5G5FA 5CRWA 2NPBA 3M9KA 4X0XA 5DVBA 3ERWA 3RHCA 4MJAA 1T7PB 4FYCA 4E8HA 2VCVA 3GL3A 5DJMA 1GSSA 4BWQA 4EDZA 2GQLA 2GDRA 4TXOA 2B6MA 2GZZA 1F2EA 1GTUA 5C00A 2VCZA 3FHKA 3M0FA 4KSOA 1PKZA 2VCQA 1EV9A 5J3RA 3VPTA 1BX9A 4PQ1A 1H75A 1XIYA 4AJ8A 4K7NA 4TOPA 5CRDA 2OE3A 3MWHA 3L4NA 4POLA 1GH2A 1TXXA 2YWOA 3KH9A 1J9BA 4HUAA 1X9SB 1SJZA 1GNEA 4ZILA 5DAKB 4I5QA 3LEFA 3CSHA 2IY2A 4HU9A 4AGSA 5LD0A 3IE3A 2MBSA 2VLUA 4ECCA 2V2GA 2VM1A 4PQHA 4K2DA 5F0GA 4KNDA 1TOFA 2HSHA 4L5LA 4F9ZA 5ECKB 2DMLA 2O7KA 5IQYA 3H1NA 4MP4A 1V9WA 5ENUA 1K0DA 1S3DA 1TRWA 1LJRA 1F3BA 2OJLA 1Q98A 1ERTA 3IPZA 1WPIA 3APSA 2HT9A 1A8LA 3G7IA 3HJMA 2RLIA 1OC8A 2LS5A 4IELA 3C8EA 1AAZA 4MF6A 1MEKA 1XOAA 2H0IA 3F6DA 4ZL8A 3HVXA 3A2XA 2YWNA 4FYUA 2B5XA 4OFNA 1OKTA 2BTOT 3QR6A 4MABA 4N30A 4MPFA 5ID2A 3KM6A 3DWVA 4EC0A 4EF0A 1M7TA 2L6DA 1Q4JA 2B5EA 2GSRA 3SBCA 2IFQB 2CQ9A 1AC1A 2MYGA 4MA9A 1MD4A 2XBQA 5CREA 2XC2A 1I5GA 1K3LA 1Y6EA 5G31A 4OCEA 4KSMA 3WGDA 3CMIA 3M1GA 4XIHA 2C0GA 2R2JA 3UOMA 4WF4A 1QQ2A 2R3XA 1SYXA 4WKWA 2KUCA 1OC9A 4IJ3A 4LL1B 4D73A 4WEYA 4BA7A 3AY8A 1K3YA 3M8NA 2M46A 2H74A 4YQMA 2NVLA 4LA1A 2V1MA 2GT5A 2JZSA 1GUKA 5ECHB 1ERUA 3KXOA 4XS1A 2OKAA 1TK8B 1YF0A 5F05A 1M9BA 1SKWB 3F3QA 2RM6A 2V6KA 5G30A 4K6XA 4ZXGA 4KCEA 2VUPA 4XS6A 2ES7A 4MZBA 3QD9A 2B1LA 1PN9A 1OAZA 2D2ZA 3DEXA 1XVWA 3IAM2 2DBCA 1WMJA 2G0FA 2YV7A 2IN3A 4PGTA 1Z9HA 4NPBA 1NM3A 4HI7A 4IP6A 19GSA 4ML6A 3D4MA 1VF1A 4ID0A 4YAVA 3ED3A 1PSQA 5INYA 1A0RP 2JACA 1T8EB 4XRAA 3PGTA 2X64A 2H1AA 3ZFBA 1E6BA 4KDUA 1QFNA 2F8AA 3ZITA 1A24A 3D22A 2WZ9A 3FZ5A 3FR6A 3ZIVA 3MAKA 1O7UA 1PQNA 3EE2A 1GRXA 5IOWA 2IMFA 1UVZA 2LEGA 4TN8A 3QFAC 5A5KA 1R26A 4MZWA 4X1UA 1QUWA 3FW2A 4K0NA 2IL3A 17GSA 4ILFA 3IR4A 2JZTA 3BCKA 2HZEB 2VD1A 4QQ7A 2ZNMA 3P7XA 1Z6MA 3M9JA 1SENA 5D73A 2X8GA 3LXTA 3IDVA 4AF2A 3GMFA 4TRXA 4IVFA 2GQKA 2KLXA 1NW2A 4TVEA 1TTZA 3W8SA 3WD6A 2L59A 3FEUA 4BVXA 1ML6A 3F4SA 5E4WA 2C0FA 1Z6NA 2VCXA 1JZRA 3O76A 2LNSA 2WCIA 4G10A 3I69A 4ZL9A 11GSA 4HQZA 14GSA 1AIUA 5D8IA 1WWJA 4PUFC 1E2YA 5IPHA 3KMNA 5HR2A 4EO3A 2IMEA 3GL5A 4LLRA 5GZZB 1XW6A 3UL3A 4DEJA 1CQGA 3F6FA 1O8XA 4WR5A 1NHYA 1ERVA 4ZB6A 1XZOA 2RUEA 3GKXA 3M3MA 3ISOA 3UARA 3GSSA 4JR6A 2N5FA 1Z7PA 3GSTA 4IBPA 1JZWA 4PXOA 3KJYA 3TGZA 1JLWA 3GN3A 2MZCA 4MCUA 4MK3A 5H5RA 5GSSA 1KTEA 1K3OA 1EEMA 3VLNA 2L5LA 2B3SA 5ECOB 5B8BA 2LJKA 5EY6A 1ZGNA 3LXZA 18GSA 4TXOB 4OFMA 4GSTA 3UBLA 1T1VA 2QGVA 4FO5A 2YZUA 1Z7RA 2VL9A 1HNBA 4F82A 1HNCA 3TB2A 1TRVA 2I3YA 3QAVA 4WBJA 5HQPA 1JFUA 2HE3A 3W6GA 3I6AA 4OO5A 4O7HA 4F2IA 3ZREA 4I2TA 2VO4A 4NMUA 4KDYA 3CTGA 2CT6A 3FRCA 5IMAA 1X9WB 2HNLA 5AIXA 2VL2C 3EVIA 4HEA2 2H8LA 4XHMA 1TK5B 1GULA 3DVWA 1TK0B 3Q19A 1X0RA 2C4JA 3ZMLA 1X5DA 2K18A 3CSIA 3L9VA 2LNTA 2GTUA 4TW5A 3U5RE 3APQA 3GUSA 2X99A 3O3TA 2DSAA 3IAS2 5KN1A 1SL0B 4ULXA 2MMOA 2N5BA 5JWRB 2AYTA 3IV4A 4PUAA 2I4AA 4N10A 3IXRA 2A2SA 5FHIA 2HXKA 1WE0A 3IK9A 2NDOA 2X8HA 4OCFA 3VWXA 1PMTA 4X43A 2DJJA 1QGVA 1ZZYA 1U87A 4KB3A 2CVKA 5ID2B 1A0FA 3C71A 3BOAA 20GSA 3OR5A 1XW5A 1SL1B 1TKDB 2V32A 2WB9A 3HKRA 1XWGA 1BJXA 2OBKA 5GAND 3ME8A 2AB6A 1SD8A 1S3AA 3WGEA 4YQVA 3TJFA 5IO0A 4NV2A 5D93A 2KP2A 4IW9A 2JL4A 4OD7A 1BEDA 2LV3A 3EMPA 5JCUA 2LUSA 3ZFLA 3VI7A 4D73B 2PERA 2FNOA 4TXVA 4EKZA 4V2NA 1URMA 1EOHA 4HDEA 5F07A 3EMXA 2H1GA 5GAPD 3N5OA 3RBTA 4PX1A 4MJEA 2FUG2 2GQMA 5DBQA 2NTOA 2R6KA 3TKRA 4ML1A 1GUMA 1XWAA 4H86A 1A2JA 4KUNA 4F0BA 1O6JA 1MDIA 2YCDA 3VURA 4DSQA 1OE7A 2H19A 2IMKA 4Q5NA 4XTSA 1VRSD 4EXJA 4JR4A 2DJ0A 4MJCA 1YZXA 2PN8A 3CYNA 4HQSA 4GTUA 4TKYA 2XHFA 1FHEA 4OMVA 2LQQA 4GCIA 4JEDA 2HSYA 2WULA 3L9SA 3NIVA 3F4TA 4I2UA 4LMVA 1USBA 3TOTA 2YJHA 3VPQA 5CO3A 5A4WA 1NSWA 4Q5QA 3DKSA 3IHQA 1SK0A 3NOFA 4ECJA 4L5OA 1FVKA 4V1Ap 5D9VA 2LJAA 3IOSA 5IO2A 5KEJA 3UEMA 4O5RA 1X5CA 3KH7A 4NV5A 1YKCA 3O6TA 3ME7A 2H30A 1M9AA 1PRXA 1TRUA 1SL2B 3KEBA 2WJUA 4EDYA 3LGCA 4HU7A 3QOUA 1G0TA 3Q74A 1T00A 1U88A 3I9V2 1M2DA 5G2ZA 2H66A 2H75A 1K0MA 4K0GA 5FT3A 3IRAA 1TI3A 1YEXA 4MJBA 2K8SA 1JHBA 2GVPA 1Z3EA 2QKEA 3U6VA 4WETA 1FB0A 2DC5A 4XS4A 4NWYA 3C1RA 5J4UA 2C3NA 5B7CA 5DDLA 2K9FA 3DRNA 3FZ9A 5G1KA 4AJ6A 1K0AA 2LQOA 2H6ZA 1FW1A 5EPFA 1G6YA 4GWRA 2MMNA 1XWKA 2VL2A 2OE1A 3GFKA 3LWAA 1GSFA 2FWEA 4DVCA 3P2AA 3HVVA 3GIXA 1KEBA 2VOCA 4POMA 4ZBBA 1GTIA 2GSQA 3CRUA 5DALA 3E0UA 4MZCA 5F8BA 2YWIA 2PVOC 4GSSA 1VGLA 1MD3A 2IMIA 1V2AA 1J0FA 3GHAA 3GYKA 2K6VA 1BQ7A 1FO5A 4L0WA 1ZL9A 2WS2A 1YKAA 2L4QA 4MF7A 4OFTA 4L8EA 2GSTA 2P0GA 2WGRA 5B8AA 1B4PA 4ZB9A 2ON5A 3LYKA 3P8WA 5HR0A 1M99A 2HRFA 6GSSA 2JSYA 2HLSA 2H1DA 5EL8A 1N8JA 1I9DA 2LTKA 4MH3A 5HFGA 5J9CA 3Q18A 4TR1A 5ECPB 1T4YA 1YQ1A 1ZOFA 5H5SA 5A4UA 2B5YA 3HZ8A 2FWHA 5G5EA 2YOIA 1O85A 1THOA 1TDIA 1O81A 1DBYA 4YAPA 3L78A 3CRTA 1ABAA 4ACSA 1W89A 2IYJA 5D9XA 3HDCA 1MDKA 3EINA 2BMXA 1YDKA 3HJPA 2FWFA 2YPMA 4IHUA 1DE2A 1OYJA 3NZNA 2DJ2A 4Q5RA 4N0ZA 2HZFA 1TJDA 1OE8A 1UC7A 2FLSA 2TRXA 1R7HA 4WBRD 5IM9A 5IMFA 6GSYA 1QXHA 3UMAA 2PPTA 3FKFA 4LL4B 4DSRA 5JWOB 5HFIA 1B48A 3QAGA 1RK4A 5HR1A 4ZBAA 1XWCA 2E0QA 3PR8A 3GURA 2E2GA 2E2MA 1XBSA 3HA9A 2I9HA 1O8WA 1VF4A 2O85A 1YF1A 3ZL5A 1ZYEA 1Y25A 2IWTA 3QPMA 3EU3A 6GSWA 2L5OA 1IYIA 4IKHA 3HJOA 3I43A 1PD21 4RUVA 3D0ZA 2O89A 2VCTA 5GSTA 1ZCPA 2R5GA 3CSJA 3HXSA 4RI7A 4BVYA 2P5QA 3FYGA 2ALBA 4O32A 4ECIA 3E9JB 3EC3A 1F6MC 1MTCA 1OC3A 1XVQA 4NHWA 3VWUA 5ECSA 1B8XA 2O87A 1AW9A 4YQUA 1QK8A 4HZ4A 4KCAA 3EWLA 1GP1A 2H6XA 3G7JA 4G19A 4HJMA 1JZDA 5LCZA 4F03A 3D5JA 3F63A 3LJRA 1V58A 2JZRA 1VF3A 1A2MA 3DVXA 4QL9A 1GSUA 3F4RA 1LBKA 2DMMA 1HNAA 2GSSA 2V6OA 1X5EA 2P31A 3PINA 5B6MA 2H73A 2YP6A 4HS1A 2GS3A 2H0HA 1TW9A 4WXTA 9GSSA 1XOBA 4POBA 2F51A 22GSA 4PURA 2F9SA 1MDJA 1GWCA 2TIRA 5D9TA 1B9YC 5E59A 4PNGA 3DMLA 4J56E 3ZTLA 4GQFA 5IMCA 1B9XC 2CA8A 4FYBA 5ECNB 1GSEA 3N9JA 2VD0A 2PWJA 2LJRA 5A4VA 1T4ZA 2AV4A 4JRRA 4KAEA 3UJ1A 1BYEA 2MMAA 3SWLA 2L57A 3ZYWA 1ACVA 3TRXA 1PX6A 1M2BA 4EL1A 2F8FA 3ZLPA 2FWGA 3MNGA 4KDXA 3KTBA 3ERFA 3P90A 3D6IA 2VM2A 3EURA 4KE3A 4CDOA 4KH7A 2YV9A 4CW9A 2E7PA 3F0IA 3LQ7A 3CTFA 5ELGA 4CHSA 3H93A 2FGXA 2WDUA 2AUVA 1K0OA 2CZ2A 1ST9A 1PL1A 3RPNA 1R4WA 2PGTA 4FH8A 1M2AA 4IN0A 1LU4A 4HZ2A 5ECRB 3JCML 2ZUPA 3LSZA 4MMMA 5CRHA 2BJXA 1G7OA 4YH2A 4ECBA 4GSNA 1GLQA 1SK2A 4IS0A 4XS4B 1GTBA 4J57E 2REMA 1C72A 1AUCA 3EU4A 3QMXA 2VLTA 3C73A 5CNWA 3LORA 4JE1A 1V57A 3IC4A 5IMZA 4I6XA 4K7OA 3L0HA 2QSIA 2HRNA 3BJ5A 3DXBA 3TOUA 2C0EA 1GSQA 1FAAA 3WYWA 2GGTA 2EIRA 5DALB 3MDKA 6GSXA 2C8UA 5IMVA 3BCIA 1DE1A 4MH2A 3RHBA 1IYHA 1F9MA 2H71A 3J7Yk 4I97A 4BL7A 2VAFA 3GH9A 1WP0A 2J9HA 3A5WA 2RIIA 2G2QA 2JSZA 1X9MB 2GZYA 3ZIJA 6GSVA 2C3TA 1PX7A 2DJKA 3VFIA 1XPVA 4PNFA 4RQXA 1ZMAA 5IIZA 5ABRA 5D9WA 2YJ7A 4TR1B 5EVOA 2YZHA 3BBYA 5KN2A 3LFLA 2FA4A 5ECLB 1BG5A 4XCSA 1CQHA 2O8VB 1Z5YE 1WJKA 1N2AA 2LRTA 4L0UA 4ZL7A 2DJ3A 2FHEA 3UVTA 3GH6A 3A3TA 2CAIA 3KD0A 4ZB8A 3QAWA 2AAWA 1G6WA 4F0CA 2EC4A 4AJ7A 1EEJA 4Z7XA 4DSSA 1FG4A 3ZZXA 3DIEA 5JCGA 2CV4A 13GSA 3RPPA 2V41A 4BWSA 1A23A 4E8EA 3GTUA 1TU8A 2KP1A 3A2VA 4MLYA 3V1WA 2PBJA 2CAQA 2PVQA 7GSSA 1FB6A 1K0BA 2IJYA 2H72A 2F3MA 5IOXA 2PUKC 4K7IA 1WIKA 3GV1A 2EIQA 1R5AA 4TR0A 4ZIJA 3KP8A 4LMWA 3GX8A 2LKUA 1SYRA 4POKA 2B7KA 1TP9A 2HYXA 5G1LA 5L71A 3UVHA 4Q5FA 3L9UA 2PMTA 3HVSA 5H5QA 3CXGA 3ZMKA 2OE0A 1SKRB 3EYTA 4IJIA 4J2FA 2VL3A 2LSTA 5FWGA 1ERWA 1XW9A 3VWWA 2H76A 4K1FA 2HI7A 3R2QA 4EVMA 3H4KA 4GF0A 3IK7A 1K0NA 3K8NA 4G9HA 2FCHA 2C80A 3IA1A 3TJBA 5JCWA 3TRPA 3DD3A 1SJ6A 2IPAA 2H6YA 3KIJA 3A2WA 2P5RA 1EP7A 1DUGA 4O92A 1H4OA 5CAXA 1PL2A 8GSSA 4GXZA 3TKSC 2J23A 1EOGA 1BAYA 4NXIA 2JU5A 1ILOA 5D96A 4OWYA 2DIZA 2XBIA 5J5NA 2TRCP 2OACA 2H0GA 1SKSB 2YANA 5CYYA 2AJQB 3VI5A 2L4CA 4IQAA
chains in the Genus database with same CATH superfamily
2M80A 1GOVA 2H1BA 5DQYA 2KHPA 3G7YA 3GKMA 3HY2A 5LC7A 1SIHA 1JBSA 1JBTA 3UIWA 2GZPA 3V99A 1I3IA 3TJKA 4JBBA 2XFTA 1BNGA 2YFJB 1EWXA 3DGQA 5ELAA 1GL8A 2C1YA 5RNTA 1T3BA 2K8VA 1KNGA 5DQSA 1NHOA 2WGQA 2YFIB 3RAZA 1GNWA 2YN1A 1N9EA 3LG6A 2FGTA 5HR3A 4MPGA 3CCJ3 1J08A 2UZ8A 5EEOA 2R4IA 1TU5A 2HMMB 1K734 1KSIA 1U3AA 4PTSA 10GSA 1LQGC 3LTBA 3LYPA 4HSCX 1MGWA 3T0UA 5JWQB 1YY7A 4WFOA 2B7JA 1X1XA 2AHEA 3GKNA 2BT3A 1GMPA 3WA3A 2DLXA 3BD2A 1DSBA 1UI8A 4K90B 1F37A 1US1A 1EGOA 1EUIC 4GRFA 4HOJA 5DAKA 2CVBA 4KFDA 1JRQA 1W4VA 3PH9A 3SVAA 2FD3A 3KTLA 1GOYA 1TP6A 2CX0A 3NV0B 2CVDA 3GKKA 4BIRA 3WT2A 2XPEA 4MNNA 2I9WA 3HYPA 4K9ZA 1EP8A 1WOUA 1K8A4 4AKYA 2HRKA 3TJJA 2X8CA 1GUHA 2L4VA 3IBHA 12GSA 1UUGB 1IQXA 6GSTA 1YJN3 3QCPA 1NO3A 3GRXA 2DJ1A 1G96A 3K5TA 1KD14 3H79A 3DGOA 1M9GA 2Z6BA 2ON7A 2VLVA 3KMOA 1YGEA 3CCM3 2EIOA 1RJOA 1PGTA 3R3EA 2OBIA 2LRCA 3TCOA 2R0GA 2PNCA 1RGKA 2VIMA 2CX4A 4QL7A 3H8QA 2GBXB 4KGIA 1F3AA 5HFKA 4GQCA 1R5PA 2ZCTA 4Z2UA 3C7MA 2KF3A 4IQ1A 5DCHA 3TKSE 1D6ZA 3DGLA 4KA0A 2F99A 4BU4A 1AQWA 1JN5A 1OVNA 3GNJA 3TDGA 3ZRDA 2MF7A 2P38A 3URPA 1QMVA 3KZQA 4N6LA 3MSZA 2NBSA 1PKWA 2QA1A 1ON4A 3FZAA 3TJGA 1YEPA 5DCGA 2VCWA 7GSPA 3WGXA 2HOHA 4MF5A 2BU4A 1Q40A 3LT8A 4RQRA 1O7PB 5ECQB 1UCIA 1GLPA 3FR3A 4RNZA 5AGYA 1FVJA 3ZVJA 2IFQA 2AAEA 3ERGA 4LYLB 2CW9A 3S29A 3FR9A 3HZ4A 1V98A 4LEHA 1L5GB 5CP1A 3V98A 3PCRA 2GT6A 2R4VA 1UW1A 5IF6A 1KBNA 5ECMB 4ISDA 1Q864 4EBGA 2HMKB 1M3JA 1RW1A 1VQL3 2GEXA 2MBTA 2OOVA 5F06A 5AN1A 1HQOA 3Q6OA 1OKDA 2J8XB 3APOA 3CCR3 5M1AA 3U1WA 2H70A 1V40A 4BL7B 1JLVA 1IVWA 4HJ2A 2CFLA 2B1KA 1HD2A 1BNSA 4FMDA 2BO9B 4K5SA 2FY6A 2I81A 2XH9A 2IMDA 3ZG0A 1YJ6A 3TKPA 3HCZA 1BSCA 4HM8B 1BNRA 4I8BA 3UL5A 4V2MA 3B4OA 3F8UA 2KXGA 3MKIA 4AKZA 2IIYA 3DYRA 2Y73A 4RI6A 5IMDA 1VF2A 4O8SA 1GSDA 4BPYA 1QAKA 3CC23 2CZ3A 4NHZA 1Z1SA 1MNLA 3KCMA 2BMRB 1TTOA 1RQMA 2KF4A 3F9UA 3O8YA 1TFOA 1FOVA 3J7Yb 3STDA 4BL3A 5JPPA 1HYFA 1TUHA 2FA8A 4N0VA 4TR3A 3HOHA 3TKSA 4EUYA 1TRSA 2F5WA 1TU7A 4G2EA 2BNGA 1BANA 2HMJB 2QIYA 2PU9C 2OADA 3HHVA 1SK1A 3BB9A 1DETA 3WDGB 4FIWA 2WFCA 2F56A 2YWMA 3JVCA 3VK9A 1GTAA 3TKQA 2OQEC 4FQUA 2ZHXB 1XWBA 1AQXA 1AXDA 2JADA 2OA7A 4TR4A 3F7SA 3F3RA 2Z9SA 4NAXA 3ZVJD 1W2B2 2N5AA 3KP9A 6GSUA 1O73A 1CEWI 5ECIB 1AQVA 1PY3A 5AISA 5CRGA 3TUEA 4DSSB 5COHA 3WR2A 5C04A 1HYUA 4R9KA 3WOFB 1S723 5KN3A 1A8YA 5B6NA 3GX0A 3FZ4A 3E3EA 2JDIH 5G2GA 4IGJA 2RUFA 3GTUB 4JU5A 2A2RA 3TRQA 3OXAA 2RM5A 1XFLA 1EV4A 3CMA3 1U3IA 1A2LA 1GMRA 3W8JA 1W6GA 1B27A 4ZBDA 4XRDA 3C1SA 2C3QA 2KOKA 4V2LA 4KW6A 3FY7A 1I8VA 4BTXA 2HZEA 4JZQA 2M72A 2HFDA 3D4TA 1GSYA 2MMZA 3WT1A 4KX4A 1UN2A 3VWVA 2X49A 4K8MA 5KN0A 2OTL3 2CX3A 3UAPA 3US3A 5J41A 3UBKA 1EGRA 2LQVA 1UA5A 2H01A 2QC7A 1S3CA 4KZ1A 1B20A 4GLTA 4L8OA 4MDCA 4V1Ag 1YI23 1A67A 4OO4A 1W6CA 3LH4A 4WF5A 1B4QA 5IPGA 1SD9A 1WRYA 4N11A 5AIVA 4IP1A 3S9FA 4K2XA 2R37A 2YNXA 3GA4A 3FK8A 2XPDA 2C0DA 2DIYA 1ZYQB 3GZYB 1G7EA 3LYGA 4PQIA 3S67A 2GU3A 4N6NB 5AIHA 1EZKA 4XBTA 16GSA 5J9BA 3NBJA 3KCHA 1THXA 3RDWA 1AVLA 1SJIA 3G9BA 5LNKe 1FUWA 3D21A 4WR4A 3QDNA 5DJLA 1XCCA 1IQYA 1XXUA 4O3VA 2HRAA 1JZOA 4K1VA 1K0CA 2WRTA 1ULIB 3LT9A 1TI1A 2A15A 2GLRA 3KGKA 3QFBC 1U6TA 2I1UA 3CBUA 4EXRA 2A4VA 4Z2TA 1QMAA 3J7Yd 1OC9B 2LRNA 3X3XA 2L6CA 1SU9A 1M0UA 1FUSA 4EE0A 3HD5A 1PA3A 4P3YB 5G5FA 5CRWA 3EN1B 3U97A 1I0XA 1ROAA 2NPBA 3M9KA 7RNTA 4X0XA 5DVBA 3ERWA 3RHCA 4MJAA 1T7PB 3QRDA 3Q3FA 4FYCA 5CF1A 4E8HA 2VCVA 5IG4A 3GL3A 5DJMA 1GSSA 4BWQA 4EDZA 3CCV3 2E2TA 2GDRA 2GQLA 4TXOA 1GS3A 3G6E3 4R1KA 2B6MA 2GZZA 1CH0A 4HAAA 1F2EA 1NNVA 1GTUA 5C00A 2VCZA 3FHKA 4CJNA 3M0FA 1PKZA 1BNEA 4KSOA 1W4NA 3NX0A 2VCQA 1I2GA 1EV9A 5J3RA 4X2OA 2XFSA 1BX9A 4PQ1A 1H75A 1XIYA 3VPTA 1UUWB 1W01A 1VQ63 4K7NA 4AJ8A 1YNVX 4TOPA 5CRDA 2OE3A 3F9SA 3MWHA 2CFGA 3L4NA 4POLA 4ORLA 1GH2A 1TXXA 2YWOA 3NM2A 3DH2A 3KH9A 1J9BA 3BNDA 4HUAA 1VQ53 1X9SB 4EC6A 4ICYA 1IT8A 1N5HA 1IU7A 1SJZA 1GNEA 3VSYA 5M19A 4ZILA 1FGOA 2ZL8A 2E2UA 5DAKB 1XG8A 4I5QA 5KOWA 3LEFA 3CSHA 4K1UA 2IY2A 3NM7A 3VGNA 3UNLA 4HU9A 4AGSA 5DREA 5LD0A 3IE3A 2MBSA 2VLUA 4ECCA 4U13A 1UCLA 3WHOA 1JB5A 3ECFA 3NXJA 2V2GA 3GSPA 2VM1A 4PQHA 3CXC2 4K2DA 5F0GA 4KNDA 4MJDA 1BSBA 1TOFA 2HSHA 4L5LA 4F9ZA 3F8HA 5ECKB 1LQMB 2DMLA 2C11A 1B2UA 2O7KA 5IQYA 1A90A 3H1NA 4MP4A 1V9WA 5ENUA 1S3RA 1YVSA 1K0DA 1S3DA 1TRWA 1LJRA 3PPUA 1F3BA 2OJLA 4HM0B 5IW9A 3LZAA 3AMOA 1Q98A 4LMIA 1ERTA 2QEX3 3IPZA 5FW5A 1WPIA 2IMJA 1IYYA 3APSA 2HT9A 1A8LA 2OQEA 3MYDA 1BU4A 3MIXA 3DZLA 3G7IA 3HJMA 1FOHA 2RLIA 1OC8A 1JN5B 2PZVA 2LS5A 4IELA 3C8EA 1AAZA 4MF6A 3EBYA 1MEKA 1XOAA 2H0IA 3F6DA 4ZL8A 3HVXA 3A2XA 4R9LA 2YWNA 4FYUA 2B5XA 4OFNA 1K41A 4CPKA 1OKTA 2BTOT 3QR6A 4MABA 3FCSB 4N30A 4MPFA 5ID2A 3KM6A 1VQM3 3DWVA 4EC0A 2O9UX 4EF0A 1M7TA 2L6DA 1Q4JA 2B1XB 2B5EA 5EVHA 1EG9B 2GSRA 3AHWA 3SBCA 3FG3A 2IFQB 1B2ZA 4CDLA 2CQ9A 4GB5A 1AC1A 2MYGA 4MA9A 1MD4A 2XBQA 5CREA 4N6MA 2QA2A 2XC2A 2CWUA 4GHOA 1I5GA 1Q9EA 1K3LA 1Y6EA 5G31A 4OCEA 3HVNA 4KSMA 3WGDA 3CMIA 3M1GA 3HK4A 4XIHA 2C0GA 2R2JA 3UOMA 1F8NA 4WF4A 1QQ2A 2B24B 5IEPA 2W04A 2R3XA 2CWVA 1SYXA 4WKWA 2KUCA 1OC9A 4IJ3A 4OK0A 4LL1B 4D73A 1MOLA 1PFOA 2SARA 4WEYA 4BA7A 1RGCA 3AY8A 5JBSA 1K3YA 2OCTA 3M8NA 2M46A 4X2HA 3L0RA 2H74A 1ROVA 1T2HA 4J5KA 4YQMA 2R0PA 1BSAA 2NVLA 4LA1A 3SOYA 4USSA 4Q53A 2V1MA 4O2HA 2GT5A 2GU1A 3DMCA 4KT3B 1GUKA 2JZSA 5ECHB 1ERUA 3KXOA 3EB8A 4DKIA 5BU4A 4XS1A 2OKAA 1TK8B 1YF0A 5F05A 2GSPA 1M9BA 1RGEA 3H93A 1SKWB 1SQWA 2P0MA 3FLJA 3F3QA 2RM6A 1TFKA 2V6KA 3A5EA 5G30A 4K6XA 4ZXGA 4KCEA 4HBRA 2VUPA 4XS6A 1IQ8A 2ES7A 4MZBA 4X4JA 3IHGA 1BRHA 3QD9A 2B1LA 1IVUA 2CG1A 1PN9A 2AADA 1OAZA 5M18A 2D2ZA 3DEXA 2Z77A 1XVWA 3IAM2 2DBCA 3AGNA 1LVNA 5A0OB 2CX1A 1WMJA 2CG0A 2G0FA 3CNMA 5CF2A 3ZG5A 2YV7A 4R4KA 1UCJA 2IN3A 4PGTA 1Z9HA 4NPBA 1NM3A 1B2XA 4HI7A 4IP6A 1RRLA 19GSA 4ML6A 3D4MA 1VF1A 4ID0A 4YAVA 3ED3A 1PSQA 5INYA 1A0RP 4WWUC 4STDA 2JACA 1T8EB 4XRAA 3PGTA 2X64A 2H1AA 2C4BA 3ZFBA 1E6BA 4KDUA 1QFNA 3DGMA 4HM2B 2F8AA 3ZITA 1A24A 3FZWA 3SYUA 5ELJA 3D22A 1B3SA 2WZ9A 3FR6A 1N5PA 6GSPA 1RCLA 1DMQA 2XEPA 3FZ5A 3MAKA 3ZIVA 5AI1A 4OVMA 1Q814 1O7UA 3QK9A 1PQNA 3EE2A 3HIGA 1GRXA 4H3UA 5IOWA 1RN4A 3EHCA 2IMFA 2XSOB 1UVZA 2LEGA 4N6V0 4TN8A 3QFAC 1MWRA 3BIRA 3N54B 2P05A 1R26A 4MZWA 4X1UA 5A5KA 1QUWA 3FW2A 4K0NA 3F14A 2IL3A 17GSA 4ILFA 3IR4A 2JZTA 3BCKA 2HZEB 2VD1A 4QQ7A 3EJVA 2ZNMA 1YHQ3 3P7XA 1Z6MA 1QALA 3PS8A 3M9JA 1SENA 3BU4A 5D73A 2X8GA 2KF5A 3LXTA 3ER7A 3IDVA 4AF2A 4HM5B 3LMLA 3GMFA 4TRXA 3CCU3 4IVFA 1MWSA 3D79A 2GQKA 2KLXA 4HM3B 3PZWA 1NW2A 4TVEA 1TTZA 5GSPA 3W8SA 1W2ZA 1I2EA 3WD6A 2L59A 3OX9A 4IIAA 3FG1A 3FEUA 4BVXA 1ML6A 3F4SA 1JV2B 5E4WA 2XR8B 2WOHA 3UL6A 2KCDA 2C0FA 1Z6NA 2VCXA 1JZRA 3O76A 1RGLA 2LNSA 2WCIA 3BNEA 4KVHA 5IG0A 4G0IA 4G10A 3I69A 1JJ22 5D83A 4ZL9A 11GSA 1O7GB 4HQZA 14GSA 1AIUA 2YFLB 5D8IA 1WWJA 4PUFC 1E2YA 5IPHA 1W00A 3KMNA 5HR2A 4EO3A 4GL6A 2IMEA 5AIIA 1N9JA 1ZYNA 3GL5A 4HM6B 4LLRA 1OGZA 1LNHA 5GZZB 1XW6A 3FKAA 5KP3A 1IV7A 3UL3A 4DEJA 1CQGA 1O7HB 3NBRA 3F6FA 1O8XA 4LZIA 4WR5A 1NHYA 1ERVA 4ZB6A 1XZOA 2RUEA 3GKXA 3M3MA 1QAFA 4WYKA 3EQQB 3ISOA 3UARA 1U8CB 4MMXB 3GSSA 4JR6A 3EE1A 2N5FA 3CU3A 1Z7PA 3GSTA 4IBPA 1JZWA 4PXOA 3KJYA 3TGZA 1JLWA 3GN3A 2MZCA 4MCUA 1MGRA 5STDA 4MK3A 5H5RA 5GSSA 1AY7A 2W2CA 2KAAA 1KTEA 1RSNA 1K3OA 1EEMA 3VLNA 4CY6A 2L5LA 2B3SA 1WNHA 5ECOB 2UX0A 3WMDA 3N8BA 5B8BA 2LJKA 5EY6A 2W9PA 1ZGNA 3LXZA 1IV9A 1RHLA 18GSA 4TXOB 4JRFA 1OCVA 4OFMA 3RDEA 4GSTA 3UBLA 1T1VA 2QGVA 4FO5A 2YZUA 1Z7RA 1UCKA 2VL9A 5ELUA 1HNBA 3JUNA 4F82A 1HNCA 3TB2A 1SIIA 1TRVA 2I3YA 3QAVA 4WBJA 5HQPA 1M904 1O7WB 1FYSA 1JFUA 5FGOA 2CIUA 2HE3A 1SJWA 1BAOA 3W6GA 3I6AA 1LRAA 4OO5A 4O7HA 4F2IA 3ZREA 2INXA 4I2TA 1GD3A 3OW22 2VO4A 1M3IA 1AR0A 4NMUA 4KDYA 3CTGA 2CT6A 3MPHA 2CH9A 3FRCA 4I4KA 3D5IA 3BLZA 5IMAA 1X9WB 2HNLA 5AIXA 4RZMA 2VL2C 3EVIA 4HEA2 3OWSA 2H8LA 3IMAB 1RCKA 3F40A 4XHMA 1TK5B 1GULA 3DVWA 1G02A 1TK0B 3Q19A 1LOYA 1X0RA 2C4JA 5IENA 3ZMLA 1X5DA 2K18A 3CSIA 3L9VA 6RNTA 2LNTA 2GTUA 4TW5A 3U5RE 3APQA 3GUSA 2X99A 3O3TA 2DSAA 3IAS2 5KN1A 1SL0B 4ULXA 4G0KA 2BMQB 1ZX2A 3AMOB 1B2MA 2MMOA 2N5BA 1T5YA 5JWRB 2K54A 2AYTA 2DKHA 3IV4A 4PUAA 3WA2X 2HSMA 4FMCA 4R80A 2I4AA 3SEDA 4N10A 2KRTA 3IXRA 2A2SA 5FHIA 1JKGB 2HXKA 1NB3I 1WE0A 3FF2A 3IK9A 1C7HA 2OWPA 2NDOA 2X8HA 4OCFA 3VWXA 1PMTA 4X43A 1BSDA 1SARA 5IERA 2DJJA 2HMOB 1QGVA 1U87A 1ZZYA 3CQFA 3MHEA 4KB3A 2CVKA 5ID2B 1A0FA 4J8TA 2RNTA 4J9AA 3C71A 3BOAA 4L8PA 20GSA 3OR5A 3KSPA 1XW5A 3K0ZA 2BMOB 1NU3A 1SL1B 1TKDB 2V32A 2WB9A 3HKRA 5CLKA 1XWGA 2STDA 1BJXA 1R4YA 1RLSA 2OBKA 5GAND 3ME8A 1RDSA 2AB6A 1SD8A 3X42A 1S3AA 3WGEA 4YQVA 3CCQ3 3TJFA 5IO0A 4NV2A 5D93A 2KP2A 4IW9A 2JL4A 4OD7A 2GBWB 1W6YA 1BEDA 2LV3A 1OACA 4K5RA 3EMPA 5JCUA 4HOHA 1WMOA 1I70A 1IVXA 1TRQA 2LUSA 3ZFLA 1IDPA 3CNXA 3VI7A 2YX9A 4D73B 2PERA 4OUQA 2FNOA 2W6JH 4TXVA 2IA7A 2Z7AA 4EKZA 3NHXA 4V2NA 1URMA 2Q07A 4FCZA 1EOHA 4HDEA 5F07A 3DXOA 2C10A 3EMXA 2H1GA 5GAPD 3N5OA 4CY8A 3RBTA 3ALAA 4PX1A 4MJEA 2FUG2 3LW9A 3CPW2 1YJ93 1DMMA 2GQMA 5DBQA 2NTOA 2R6KA 3TKRA 4ML1A 1GUMA 1XWAA 4H86A 3SOAA 1A2JA 4KUNA 4F0BA 1O6JA 1MDIA 2YCDA 3VURA 1O7MB 4DSQA 1GYBA 3K7CA 1OE7A 2H19A 2IMKA 4Q5NA 4XTSA 1VQ93 3X41A 1VRSD 3IPTA 5I97A 1CQSA 3H51A 4EXJA 1RNTA 3JUMA 4JR4A 3KIIA 2DJ0A 4MJCA 1YZXA 2PN8A 3CYNA 4HQSA 4GTUA 3CCS3 4TKYA 2XHFA 1FHEA 1FGMA 4OMVA 2LQQA 4GCIA 4JEDA 2HSYA 2XSHB 3IJEB 2WULA 3L9SA 4N6TA 3B8LA 3NIVA 1KWIA 3F4TA 4I2UA 4LMVA 1USBA 3TOTA 2YJHA 4HZ9B 3VPQA 1BSEA 5AIFA 5CO3A 3D3LA 4YKGA 3G8ZA 1NSWA 5A4WA 4Q5QA 3DKSA 3IHQA 1SK0A 5AEUB 3NOFA 3OWUA 4ECJA 4L5OA 1FVKA 2OTJ3 4V1Ap 5D9VA 2LJAA 3IOSA 3BNBA 1VQ43 5IO2A 1C54A 2SBLA 1OPYA 5KEJA 3A76A 3UEMA 4O5RA 1A2PA 1X5CA 3KH7A 4NV5A 3FG4A 1YKCA 3O6TA 3ME7A 4PEJA 2H30A 3NQZA 1I0VA 1BNFA 1M9AA 1PRXA 3CME3 1TRUA 1SL2B 2UUGC 3G713 3KEBA 2WJUA 4EDYA 3LGCA 3MG3A 3QOUA 4HU7A 1RMSA 1A2KA 1G0TA 1D6YA 3I563 3Q74A 4BTWA 3LTCA 1T00A 1U88A 3I9V2 1M2DA 5G2ZA 4MEIA 3F7XA 1W5ZA 2H66A 4O02B 2RGQA 2BIRA 1TIJA 5HGRA 1K0MA 2H75A 4K0GA 3EN8A 1JKGA 5FT3A 2FNQA 1JB4A 3IRAA 1TI3A 1YEXA 4MJBA 2W56A 1BRJA 2K8SA 1JHBA 2GVPA 1Z3EA 4XBYA 2QKEA 3U6VA 4WETA 1FB0A 2DC5A 4XS4A 4NWYA 3C1RA 5J4UA 2C3NA 5B7CA 5DDLA 1ASKA 2K9FA 3LTAA 3DRNA 3FZ9A 5G1KA 4AJ6A 1K0AA 3X3ZA 2LQOA 1AV4A 2H6ZA 1OGXA 1FW1A 4BVXB 5EPFA 1IK3A 1N8R4 3G0KA 1PU4A 1G6YA 1O7NB 4GWRA 1SPUA 2MMNA 1XWKA 2VL2A 2OE1A 3GFKA 3LWAA 5AYSC 1M1K4 1CYVA 1ULJB 1KQS2 1GSFA 2FWEA 4DVCA 5AEWB 3P2AA 3HVVA 3GIXA 1T2IA 2W9QA 1KEBA 2VOCA 4POMA 1RN7A 3KN4A 3Q1CA 4ZBBA 3D5GA 3RNTA 1GTIA 2GSQA 3CRUA 5DALA 3E0UA 4MZCA 4BL2A 3PYJA 2F5MA 2LYXA 5F8BA 2YWIA 2PVOC 4GSSA 1VGLA 1MD3A 4FMAA 2IMIA 1V2AA 1J0FA 3GHAA 3GYKA 1E97A 3S28A 2K6VA 1BQ7A 1FO5A 4L0WA 1ZL9A 3Q2PA 2WS2A 1YKAA 4TX4A 2L4QA 4MF7A 4OFTA 4L8EA 2GSTA 2P0GA 2ML6A 4WYKB 2WGRA 5B8AA 1B4PA 3FF0A 4ZB9A 2ON5A 3LYKA 3P8WA 5HR0A 1M99A 1QVF2 1Q824 2HRFA 3JUQA 6GSSA 2R0CA 2JSYA 2HLSA 2KF6A 2H1DA 4A5PA 5EL8A 1N8JA 1I9DA 1LOXA 5BXQA 2LTKA 3OV4A 4QWTA 4MH3A 5HFGA 3KFQC 5J9CA 1HU9A 3CCL3 3Q18A 9RNTA 1FUTA 4TR1A 5ECPB 1T4YA 1YQ1A 1ZOFA 5BRTA 1MWTA 5H5SA 1OHPA 1FGTA 5A4UA 2B5YA 1FGRA 3HZ8A 2FWHA 2HMLB 3S27A 1OF5A 5G5EA 2YOIA 1O85A 4JF8A 1DVDA 1THOA 1TDIA 3X40A 1O81A 1DBYA 4YAPA 3L78A 2JQ5A 3N9HA 1W02A 3CRTA 1Q7Y4 2P0XA 1ABAA 4ACSA 1V74A 2IYJA 1W89A 3SXXA 3CPOA 5D9XA 3HDCA 1MDKA 1OUNA 3RGRA 3JUOA 3EINA 3F8XA 1GY6A 2BMXA 1STDA 2CHCA 4HM1B 2F4YA 1YDKA 3HJPA 2FXTA 2D1WA 1VQO3 2FWFA 4AEQA 2YPMA 4IHUA 1DE2A 3DUKA 1OYJA 3NZNA 2DJ2A 1VQN3 1JBRA 4Q5RA 4N0ZA 2MC8A 2CWTA 1RTUA 2HZFA 1TJDA 1OE8A 1UC7A 4KF9A 2FLSA 2TRXA 1R7HA 4WBRD 5IM9A 5IMFA 6GSYA 2GXFA 4WP5A 1QXHA 2RSXA 1PFPA 3UMAA 2XRXB 2PPTA 3FKFA 3T8UA 4LL4B 4DSRA 5JWOB 5HFIA 4KFEA 1B48A 3QAGA 1RK4A 5HR1A 5CXOA 1ZS7A 1RNBA 3GRDA 4ZBAA 1XWCA 2E0QA 3PR8A 3GURA 3PCSA 2E2GA 3HZPA 2E2MA 1XBSA 2X4AA 3HA9A 2I9HA 1O8WA 3FGYA 1VF4A 2O85A 2ZDJA 1YF1A 3KKGA 1S5AA 3ZL5A 1GOUA 1ZYEA 1Y25A 2IWTA 1X1UA 3QPMA 3EU3A 6GSWA 4XDWA 3A5IA 8CHOA 2L5OA 1IYIA 1UDII 4IKHA 1STFI 3HJOA 3I43A 2GEYA 3H3HA 2RBIA 1QJGA 1PD21 4RUVA 3D0ZA 2O89A 3DY5A 2VCTA 5GSTA 4RNYA 1ZCPA 2R5GA 3CSJA 3HXSA 4RI7A 4BVYA 2P5QA 1TRPA 3EPTA 3FYGA 2V1LA 5LC6A 3IC8A 2IUJA 2ALBA 1W7CA 4O32A 4ECIA 4LGQA 5AIGA 3E9JB 3EC3A 1F6MC 1MTCA 3M8CA 1UGHI 4WHAA 1OC3A 1XVQA 4NHWA 3VWUA 5ECSA 3UB1A 3KSED 3LOYA 1B8XA 1LXEA 5BMUA 2O87A 1AW9A 4YQUA 3NQYA 1WMPA 1QK8A 3MG2A 4HZ4A 3D4AA 1UGIA 7STDA 1LNIA 2WO0A 4N6UA 3CC73 1GMQA 3Q90A 4KCAA 4HVNA 3EWLA 1GP1A 2H6XA 3G7JA 4G19A 4FCMA 4HJMA 1JZDA 5LCZA 1RGGA 4F03A 3D5JA 3F63A 3LJRA 4XDVA 1BNIA 1V58A 1HKXA 2JZRA 2F86B 4NHFA 1A2MA 1VF3A 3DVXA 4QL9A 1JNQA 4N6OB 1GSUA 3F4RA 2Y74A 5D82A 1LBKA 2DMMA 1HNAA 2GSSA 2V6OA 1VZZA 1X5EA 4HJLB 2IUKA 2P31A 3PINA 3SX1A 5IG3A 5B6MA 2H73A 2F98A 3KE7A 3V92A 1BUJA 2YP6A 4HS1A 1EKMA 2GS3A 2H0HA 2XGLA 1TW9A 4WXTA 3G4S3 9GSSA 2L1SA 1XOBA 4POBA 2F51A 1GSPA 3I0YA 1EA2A 22GSA 1UUVB 5BVBA 4PURA 2F9SA 4O5QA 1MDJA 1GWCA 2TIRA 5D9TA 1JB2A 1B9YC 5E59A 4PNGA 1R4CA 3DMLA 4J56E 1U5OA 3B4PA 3ZTLA 1VQK3 4GQFA 3DGNA 3WOEB 4HYZA 2CFDA 5IMCA 1J2BA 1B9XC 2CA8A 4FYBA 5ECNB 1Y4KA 1GSEA 3N9JA 2VD0A 2PWJA 1VQ73 2LJRA 5A4VA 1T4ZA 2AV4A 1IT7A 4JRRA 3HI7A 4KAEA 3UJ1A 1BYEA 5KP1A 2MMAA 3T8NA 3SWLA 1EQKA 2L57A 3ZYWA 1ACVA 3TRXA 3CD63 3EC9A 1PX6A 1AQZA 3AGOA 3MSOA 4BTYA 3PGBA 1M2BA 4EL1A 1BOXA 2F8FA 3ZLPA 2CKFB 2FWGA 3NV0A 3MNGA 4KDXA 3KTBA 2K3DA 3ERFA 5JPUA 3FMWA 3P90A 3D6IA 3B7CA 4XM4A 2VM2A 5EQLA 4RBNA 3EURA 4KE3A 1B2SA 4CDOA 4KH7A 2YV9A 4G0LA 2E7PA 4CW9A 3F0IA 3LQ7A 3CTFA 5ELGA 3EBTA 3ZFZA 5BIRA 4CHSA 2WOFA 4EW5A 1GY7A 1BRIA 1Q7HA 5DRVA 2A2PA 1AVKA 2AUVA 2E2VA 2FGXA 2WDUA 4YKFA 2XF3A 1BRKA 1K0OA 1YIJ3 4MMYB 2CZ2A 1ST9A 1WMNA 1BUQA 1PL1A 3RPNA 1R4WA 1QVG2 2PGTA 4FH8A 1M2AA 4IN0A 1LU4A 4HZ2A 5ECRB 2CK3H 3JCML 2CFKA 2BHMA 1BIRA 2ZUPA 3LSZA 4MMMA 2W56B 5CRHA 5IEOA 2BJXA 1G7OA 4YH2A 4ECBA 4GSNA 1YJW3 1GLQA 1SK2A 4IS0A 4XS4B 1M1XB 3VF1A 1GTBA 4J57E 4N3VA 1C72A 2REMA 4LSOA 1NJI4 2ZA4A 1AUCA 5KP4A 3EU4A 3QMXA 2VLTA 2W0QA 5AYRB 1OHSA 3C73A 3LORA 5CNWA 4JE1A 1V57A 3IC4A 5IMZA 3K9MC 4I6XA 4K7OA 3L0HA 1N8QA 2QSIA 2HRNA 3BJ5A 3PXMA 3DXBA 1BRNL 1KC84 1BRGA 3TOUA 2XGNA 1VQQA 2C0EA 1GSQA 1FAAA 3WYWA 2GGTA 4EV2A 2EIRA 2P09A 2W03A 4KFFA 3MDKA 5DALB 3BNCA 2C8UA 6GSXA 5IMVA 3BCIA 1DE1A 3GZXB 4IPBA 4MH2A 3RHBA 1LOVA 1FA3A 1A2VA 1IYHA 3EX9A 4XBXA 1F9MA 2H71A 3J7Yk 4I97A 4BL7A 1ISKA 3HX8A 5CK6A 1BNJA 1IVVA 1K9M4 2VAFA 3LTDA 3UJMA 3GH9A 1WP0A 2J9HA 3RGAA 3A5WA 2RIIA 2G2QA 2JSZA 1X9MB 3DM8A 1PYLA 2GZYA 3ZIJA 6GSVA 2C3TA 5HOHA 1PX7A 2DJKA 1FGQA 1WTHA 3VFIA 4HZBB 1XPVA 5IG5A 4PNFA 4RQXA 1X1WA 1ZMAA 3OWYA 5IIZA 3GZRA 1RN1A 4CCVA 5ABRA 5D9WA 1I2FA 4L7KA 2YJ7A 1ZO2A 4TR1B 5EVOA 2RCDA 2YZHA 3BBYA 5KN2A 3NUVA 4EYCA 3LFLA 1RKYA 1E3VA 1OF5B 2FA4A 8RNTA 5ECLB 2K0MA 1VQ83 1BG5A 4XCSA 1CQHA 3LXUX 2O8VB 5TGNA 1Z5YE 1WJKA 1N2AA 1I3FA 2D42A 4FMBA 4EV5A 3CC43 1FZUA 2LRTA 4L0UA 2DJ3A 4ZL7A 2FHEA 3UVTA 3GAXA 3GH6A 3A3TA 1X1YA 3K63A 1YIT3 2CAIA 5KOXA 1PN0A 4O5UA 3KD0A 4ZB8A 3QAWA 2AAWA 1DVCA 4Z2RA 1G6WA 3S5CA 5D81A 2QGUA 3GZBA 3JUPA 2EC4A 4AJ7A 4F0CA 1EEJA 4Z7XA 4DSSA 3HIIA 1FG4A 3ZZXA 3DIEA 5JCGA 2CV4A 13GSA 4HKVB 3RPPA 1DYUA 4FCJA 2V41A 4HM7B 4BWSA 3MWZA 2HMNB 4J5GA 1A23A 4E8EA 3GTUA 4MMZB 4BIKA 3NBBA 1TU8A 1RGHA 2KP1A 2A4HA 2O3OA 1ZGXA 3A2VA 1BVIA 2WGOA 4EIPA 4MLYA 1OH0A 3V1WA 1UI7A 3E99A 2CAQA 2PBJA 2PVQA 7GSSA 1FB6A 1K0BA 2IJYA 2H72A 4FR9A 4G1MB 2F3MA 5IOXA 2RFRA 2PUKC 4NREA 1WIKA 1D6UA 4K7IA 1DMNA 4IT7A 4GSPA 3GV1A 2EIQA 1BRSA 1VQP3 1R5AA 4HM4B 4TR0A 4ZIJA 3KP8A 3DGYA 4LMWA 3GX8A 2LKUA 2CC3A 1RGFA 1SYRA 4POKA 2B7KA 2CFWA 1TP9A 1NWWA 4ZM8A 2HYXA 6STDA 4RNTA 1NDOB 2OOVC 5G1LA 5L71A 3UVHA 3MYTA 4Q5FA 1OHOA 3L9UA 2PMTA 3HVSA 3FH1A 5H5QA 3CXGA 3ZMKA 2M7OA 2OE0A 1SKRB 3EYTA 4IJIA 1RRHA 3G16A 4J2FA 2VL3A 2LSTA 5FWGA 1WQLB 1ERWA 3WODG 1XW9A 3VWWA 2H76A 4K1FA 2HI7A 3R2QA 4EVMA 3H4KA 4GF0A 3IK7A 1K0NA 3K8NA 4G9HA 2R41A 4BVYB 2FCHA 3X3YA 2C80A 3CCE3 4H61A 3IA1A 3TJBA 4EIQA 5JCWA 4K61A 3TRPA 3DD3A 1SJ6A 2IPAA 2H6YA 3KIJA 1Q40B 3A2WA 3FSDA 2P5RA 1EP7A 1LOWA 1DUGA 1E3RA 1NB5I 3AHSA 1B21A 4O92A 1H4OA 1BGSA 1HZ1A 3ROBA 5CAXA 3MG1A 1MWUA 1FW7A 1GD4A 1PL2A 8GSSA 3KZTA 3I553 4GXZA 1GY5A 3TKSC 2J23A 1EOGA 1K28A 2UGIA 1BAYA 3GWRA 4NXIA 4XB5A 2JU5A 5D96A 1ILOA 4OWYA 1Q42A 2DIZA 3EF8A 2QA43 3SLUA 2XBIA 5J5NA 2Z76A 2DKIA 1CYUA 1YGWA 2TRCP 2OACA 2H0GA 1SKSB 1RGAA 3D9RA 2YANA 5CYYA 1ZYPA 2ML5A 2AJQB 3VI5A 2L4CA 1YVBI 4IQAA 1DE3A
chains in the Genus database with same CATH topology
2M80A 2H1BA 5DQYA 2KHPA 3G7YA 3GKMA 3HY2A 3UIWA 2GZPA 3TJKA 4JBBA 1EWXA 3DGQA 5ELAA 1GL8A 2C1YA 1T3BA 2K8VA 1KNGA 5DQSA 1NHOA 3RAZA 1GNWA 2YN1A 3LG6A 5HR3A 4MPGA 2UZ8A 1J08A 1U3AA 4PTSA 10GSA 3LYPA 5JWQB 1YY7A 2B7JA 2AHEA 3GKNA 2DLXA 3BD2A 1DSBA 1F37A 1EGOA 4GRFA 4HOJA 5DAKA 2CVBA 1W4VA 3PH9A 2FD3A 3KTLA 2CVDA 3GKKA 3WT2A 2XPEA 4MNNA 3HYPA 4K9ZA 1EP8A 1WOUA 2HRKA 3TJJA 2X8CA 1GUHA 3IBHA 12GSA 6GSTA 3QCPA 3GRXA 2DJ1A 3H79A 2ON7A 2VLVA 3KMOA 2EIOA 1PGTA 3R3EA 2OBIA 2LRCA 3TCOA 2R0GA 2VIMA 2CX4A 4QL7A 3H8QA 4KGIA 1F3AA 5HFKA 4GQCA 1R5PA 2ZCTA 4Z2UA 3C7MA 4IQ1A 5DCHA 3TKSE 4KA0A 1AQWA 1OVNA 3ZRDA 3GNJA 3TDGA 1QMVA 3KZQA 3MSZA 2NBSA 1PKWA 2QA1A 1ON4A 3FZAA 3TJGA 1YEPA 5DCGA 2VCWA 3WGXA 4MF5A 4RQRA 5ECQB 1GLPA 3FR3A 5AGYA 1FVJA 3ZVJA 2IFQA 3ERGA 3FR9A 3HZ4A 1V98A 5CP1A 2GT6A 2R4VA 5ECMB 1KBNA 4ISDA 1RW1A 2MBTA 5F06A 5AN1A 1HQOA 3Q6OA 1OKDA 3APOA 2H70A 1V40A 4BL7B 1JLVA 4HJ2A 2B1KA 1HD2A 4K5SA 2FY6A 2I81A 2IMDA 1YJ6A 3TKPA 3HCZA 4I8BA 4V2MA 3F8UA 2IIYA 3DYRA 4RI6A 5IMDA 1VF2A 1GSDA 4BPYA 2CZ3A 4NHZA 3KCMA 1RQMA 3F9UA 1FOVA 3J7Yb 3TKSA 2FA8A 4TR3A 4N0VA 4EUYA 1TRSA 1TU7A 4G2EA 2PU9C 2OADA 3HHVA 1SK1A 4FIWA 2WFCA 2YWMA 3VK9A 1GTAA 3TKQA 4FQUA 1XWBA 1AQXA 1AXDA 2JADA 2OA7A 4TR4A 3F3RA 3ZVJD 2Z9SA 4NAXA 2N5AA 3KP9A 6GSUA 1O73A 5ECIB 1AQVA 5AISA 5CRGA 3TUEA 4DSSB 5COHA 5C04A 1HYUA 5KN3A 1A8YA 5B6NA 3GX0A 3FZ4A 3E3EA 4IGJA 2RUFA 3GTUB 4JU5A 2A2RA 3TRQA 2RM5A 1XFLA 1EV4A 1U3IA 1A2LA 3W8JA 4ZBDA 4XRDA 3C1SA 2C3QA 2KOKA 4V2LA 4KW6A 3FY7A 2HZEA 4JZQA 2M72A 2HFDA 3D4TA 1GSYA 2MMZA 3WT1A 4KX4A 1UN2A 3VWVA 2X49A 4K8MA 5KN0A 2CX3A 3UAPA 3US3A 5J41A 3UBKA 1EGRA 1UA5A 2H01A 2QC7A 1S3CA 4GLTA 4MDCA 4V1Ag 4OO4A 4WF5A 1B4QA 5IPGA 1SD9A 1WRYA 4N11A 5AIVA 4IP1A 3S9FA 4K2XA 2R37A 2YNXA 3GA4A 3FK8A 2XPDA 2C0DA 2DIYA 1ZYQB 1G7EA 4PQIA 1EZKA 16GSA 5J9BA 1THXA 3RDWA 1SJIA 3G9BA 5LNKe 4WR4A 3D21A 3QDNA 5DJLA 1XCCA 1XXUA 2HRAA 1JZOA 1K0CA 2WRTA 1TI1A 2GLRA 3KGKA 3QFBC 1U6TA 2I1UA 3CBUA 2A4VA 4Z2TA 1OC9B 2LRNA 2L6CA 1SU9A 1M0UA 4EE0A 3HD5A 1PA3A 4P3YB 5G5FA 5CRWA 2NPBA 3M9KA 4X0XA 5DVBA 3ERWA 3RHCA 4MJAA 1T7PB 4FYCA 4E8HA 2VCVA 3GL3A 5DJMA 1GSSA 4BWQA 4EDZA 2GQLA 2GDRA 4TXOA 2B6MA 2GZZA 1F2EA 1GTUA 5C00A 2VCZA 3FHKA 3M0FA 4KSOA 1PKZA 2VCQA 1EV9A 5J3RA 3VPTA 1BX9A 4PQ1A 1H75A 1XIYA 4AJ8A 4K7NA 4TOPA 5CRDA 2OE3A 3MWHA 3L4NA 4POLA 1GH2A 1TXXA 2YWOA 3KH9A 1J9BA 4HUAA 1X9SB 4ICYA 1SJZA 1GNEA 4ZILA 5DAKB 4I5QA 5KOWA 3LEFA 3CSHA 2IY2A 4HU9A 4AGSA 5LD0A 3IE3A 2MBSA 2VLUA 4ECCA 2V2GA 2VM1A 4PQHA 4K2DA 5F0GA 4KNDA 1TOFA 2HSHA 4L5LA 4F9ZA 5ECKB 2DMLA 2O7KA 5IQYA 3H1NA 4MP4A 1V9WA 5ENUA 1K0DA 1S3DA 1TRWA 1LJRA 3PPUA 1F3BA 2OJLA 1Q98A 1ERTA 3IPZA 1WPIA 3APSA 2HT9A 1A8LA 3MYDA 3MIXA 3G7IA 3HJMA 1FOHA 2RLIA 1OC8A 2LS5A 4IELA 3C8EA 1AAZA 4MF6A 1MEKA 1XOAA 2H0IA 3F6DA 4ZL8A 3HVXA 3A2XA 2YWNA 4FYUA 2B5XA 4OFNA 1OKTA 2BTOT 3QR6A 4MABA 4N30A 4MPFA 5ID2A 3KM6A 3DWVA 4EC0A 4EF0A 1M7TA 2L6DA 1Q4JA 2B5EA 2GSRA 3SBCA 2IFQB 2CQ9A 1AC1A 2MYGA 4MA9A 1MD4A 2XBQA 5CREA 2QA2A 2XC2A 1I5GA 1K3LA 1Y6EA 5G31A 4OCEA 4KSMA 3WGDA 3CMIA 3M1GA 4XIHA 2C0GA 2R2JA 3UOMA 4WF4A 1QQ2A 2R3XA 1SYXA 4WKWA 2KUCA 1OC9A 4IJ3A 4LL1B 4D73A 4WEYA 4BA7A 3AY8A 1K3YA 3M8NA 2M46A 2H74A 4YQMA 2R0PA 2NVLA 4LA1A 4USSA 2V1MA 2GT5A 2JZSA 1GUKA 5ECHB 1ERUA 3KXOA 4XS1A 2OKAA 1TK8B 1YF0A 5F05A 1M9BA 1SKWB 3F3QA 2RM6A 2V6KA 5G30A 4K6XA 4ZXGA 4KCEA 2VUPA 4XS6A 2ES7A 4MZBA 4X4JA 3IHGA 3QD9A 2B1LA 1PN9A 1OAZA 2D2ZA 3DEXA 1XVWA 3IAM2 2DBCA 1WMJA 2G0FA 2YV7A 2IN3A 4PGTA 1Z9HA 4NPBA 1NM3A 4HI7A 4IP6A 19GSA 4ML6A 3D4MA 1VF1A 4ID0A 4YAVA 3ED3A 1PSQA 5INYA 1A0RP 2JACA 1T8EB 4XRAA 3PGTA 2X64A 2H1AA 3ZFBA 1E6BA 4KDUA 1QFNA 2F8AA 3ZITA 1A24A 3D22A 2WZ9A 3FZ5A 3FR6A 3ZIVA 3MAKA 1O7UA 1PQNA 3EE2A 1GRXA 5IOWA 2IMFA 1UVZA 2LEGA 4TN8A 3QFAC 5A5KA 1R26A 4MZWA 4X1UA 1QUWA 3FW2A 4K0NA 2IL3A 17GSA 4ILFA 3IR4A 2JZTA 3BCKA 2HZEB 2VD1A 4QQ7A 2ZNMA 3P7XA 1Z6MA 3M9JA 1SENA 5D73A 2X8GA 3LXTA 3IDVA 4AF2A 3GMFA 4TRXA 4IVFA 2GQKA 2KLXA 1NW2A 4TVEA 1TTZA 3W8SA 3WD6A 2L59A 3FEUA 4BVXA 1ML6A 3F4SA 5E4WA 2C0FA 1Z6NA 2VCXA 1JZRA 3O76A 2LNSA 2WCIA 4G0IA 4G10A 3I69A 4ZL9A 11GSA 4HQZA 14GSA 1AIUA 5D8IA 1WWJA 4PUFC 1E2YA 5IPHA 3KMNA 5HR2A 4EO3A 2IMEA 1ZYNA 3GL5A 4LLRA 5GZZB 1XW6A 3UL3A 4DEJA 1CQGA 3F6FA 1O8XA 4WR5A 1NHYA 1ERVA 4ZB6A 1XZOA 2RUEA 3GKXA 3M3MA 3ISOA 3UARA 3GSSA 4JR6A 2N5FA 1Z7PA 3GSTA 4IBPA 1JZWA 4PXOA 3KJYA 3TGZA 1JLWA 3GN3A 2MZCA 4MCUA 4MK3A 5H5RA 5GSSA 1KTEA 1K3OA 1EEMA 3VLNA 4CY6A 2L5LA 2B3SA 5ECOB 5B8BA 2LJKA 5EY6A 1ZGNA 3LXZA 18GSA 4TXOB 4OFMA 4GSTA 3UBLA 1T1VA 2QGVA 4FO5A 2YZUA 1Z7RA 2VL9A 1HNBA 4F82A 1HNCA 3TB2A 1TRVA 2I3YA 3QAVA 4WBJA 5HQPA 1JFUA 2HE3A 3W6GA 3I6AA 4OO5A 4O7HA 4F2IA 3ZREA 4I2TA 2VO4A 4NMUA 4KDYA 3CTGA 2CT6A 3FRCA 5IMAA 1X9WB 2HNLA 5AIXA 2VL2C 3EVIA 4HEA2 2H8LA 4XHMA 1TK5B 1GULA 3DVWA 1TK0B 3Q19A 1X0RA 2C4JA 3ZMLA 1X5DA 2K18A 3CSIA 3L9VA 2LNTA 2GTUA 4TW5A 3U5RE 3APQA 3GUSA 2X99A 3O3TA 2DSAA 3IAS2 5KN1A 1SL0B 4ULXA 4G0KA 2MMOA 2N5BA 5JWRB 2AYTA 2DKHA 3IV4A 4PUAA 2HSMA 2I4AA 4N10A 3IXRA 2A2SA 5FHIA 2HXKA 1WE0A 3IK9A 2NDOA 2X8HA 4OCFA 3VWXA 1PMTA 4X43A 2DJJA 1QGVA 1ZZYA 1U87A 4KB3A 2CVKA 5ID2B 1A0FA 3C71A 3BOAA 20GSA 3OR5A 1XW5A 1SL1B 1TKDB 2V32A 2WB9A 3HKRA 1XWGA 1BJXA 2OBKA 5GAND 3ME8A 2AB6A 1SD8A 1S3AA 3WGEA 4YQVA 3TJFA 5IO0A 4NV2A 5D93A 2KP2A 4IW9A 2JL4A 4OD7A 1BEDA 2LV3A 4K5RA 3EMPA 5JCUA 2LUSA 3ZFLA 3VI7A 4D73B 2PERA 2FNOA 4TXVA 4EKZA 4V2NA 1URMA 1EOHA 4HDEA 5F07A 3EMXA 2H1GA 5GAPD 3N5OA 4CY8A 3RBTA 4PX1A 4MJEA 2FUG2 3LW9A 2GQMA 5DBQA 2NTOA 2R6KA 3TKRA 4ML1A 1GUMA 1XWAA 4H86A 1A2JA 4KUNA 4F0BA 1O6JA 1MDIA 2YCDA 3VURA 4DSQA 1OE7A 2H19A 2IMKA 4Q5NA 4XTSA 1VRSD 4EXJA 4JR4A 2DJ0A 4MJCA 1YZXA 2PN8A 3CYNA 4HQSA 4GTUA 4TKYA 2XHFA 1FHEA 4OMVA 2LQQA 4GCIA 4JEDA 2HSYA 2WULA 3L9SA 3NIVA 3F4TA 4I2UA 4LMVA 1USBA 3TOTA 2YJHA 3VPQA 5CO3A 4YKGA 5A4WA 1NSWA 4Q5QA 3DKSA 3IHQA 1SK0A 3NOFA 4ECJA 4L5OA 1FVKA 4V1Ap 5D9VA 2LJAA 3IOSA 5IO2A 5KEJA 3UEMA 4O5RA 1X5CA 3KH7A 4NV5A 1YKCA 3O6TA 3ME7A 2H30A 1M9AA 1PRXA 1TRUA 1SL2B 3KEBA 2WJUA 4EDYA 3LGCA 4HU7A 3QOUA 1G0TA 3Q74A 1T00A 1U88A 3I9V2 1M2DA 5G2ZA 2H66A 2H75A 1K0MA 4K0GA 5FT3A 3IRAA 1TI3A 1YEXA 4MJBA 2K8SA 1JHBA 2GVPA 1Z3EA 2QKEA 3U6VA 4WETA 1FB0A 2DC5A 4XS4A 4NWYA 3C1RA 5J4UA 2C3NA 5B7CA 5DDLA 2K9FA 3DRNA 3FZ9A 5G1KA 4AJ6A 1K0AA 2LQOA 2H6ZA 1FW1A 4BVXB 5EPFA 1G6YA 4GWRA 2MMNA 1XWKA 2VL2A 2OE1A 3GFKA 3LWAA 1GSFA 2FWEA 4DVCA 3P2AA 3HVVA 3GIXA 1KEBA 2VOCA 4POMA 4ZBBA 1GTIA 2GSQA 3CRUA 5DALA 3E0UA 4MZCA 5F8BA 2YWIA 2PVOC 4GSSA 1VGLA 1MD3A 2IMIA 1V2AA 1J0FA 3GHAA 3GYKA 2K6VA 1BQ7A 1FO5A 4L0WA 1ZL9A 2WS2A 1YKAA 2L4QA 4MF7A 4OFTA 4L8EA 2GSTA 2P0GA 2WGRA 5B8AA 1B4PA 4ZB9A 2ON5A 3LYKA 3P8WA 5HR0A 1M99A 2HRFA 6GSSA 2R0CA 2JSYA 2HLSA 2H1DA 4A5PA 5EL8A 1N8JA 1I9DA 2LTKA 4MH3A 5HFGA 5J9CA 3Q18A 4TR1A 5ECPB 1T4YA 1YQ1A 1ZOFA 5BRTA 5H5SA 5A4UA 2B5YA 3HZ8A 2FWHA 5G5EA 2YOIA 1O85A 1THOA 1TDIA 1O81A 1DBYA 4YAPA 3L78A 3CRTA 1ABAA 4ACSA 1W89A 2IYJA 5D9XA 3HDCA 1MDKA 3EINA 2BMXA 1YDKA 3HJPA 2FWFA 2YPMA 4IHUA 1DE2A 1OYJA 3NZNA 2DJ2A 4Q5RA 4N0ZA 2HZFA 1TJDA 1OE8A 1UC7A 4KF9A 2FLSA 2TRXA 1R7HA 4WBRD 5IM9A 5IMFA 6GSYA 1QXHA 3UMAA 2PPTA 3FKFA 4LL4B 4DSRA 5JWOB 5HFIA 1B48A 3QAGA 1RK4A 5HR1A 4ZBAA 1XWCA 2E0QA 3PR8A 3GURA 2E2GA 2E2MA 1XBSA 2X4AA 3HA9A 2I9HA 1O8WA 1VF4A 2O85A 1YF1A 3ZL5A 1ZYEA 1Y25A 2IWTA 3QPMA 3EU3A 6GSWA 3A5IA 2L5OA 1IYIA 4IKHA 3HJOA 3I43A 1PD21 4RUVA 3D0ZA 2O89A 2VCTA 5GSTA 1ZCPA 2R5GA 3CSJA 3HXSA 4RI7A 4BVYA 2P5QA 3EPTA 3FYGA 3IC8A 2ALBA 4O32A 4ECIA 3E9JB 3EC3A 1F6MC 1MTCA 1OC3A 1XVQA 4NHWA 3VWUA 5ECSA 1B8XA 5BMUA 2O87A 1AW9A 4YQUA 1QK8A 4HZ4A 4KCAA 3EWLA 1GP1A 2H6XA 3G7JA 4G19A 4HJMA 1JZDA 5LCZA 4F03A 3D5JA 3F63A 3LJRA 1V58A 2JZRA 1VF3A 1A2MA 3DVXA 4QL9A 1GSUA 3F4RA 1LBKA 2DMMA 1HNAA 2GSSA 2V6OA 1X5EA 2P31A 3PINA 5B6MA 2H73A 2YP6A 4HS1A 2GS3A 2H0HA 1TW9A 4WXTA 9GSSA 1XOBA 4POBA 2F51A 22GSA 4PURA 2F9SA 4O5QA 1MDJA 1GWCA 2TIRA 5D9TA 1B9YC 5E59A 4PNGA 3DMLA 4J56E 3ZTLA 4GQFA 5IMCA 1B9XC 2CA8A 4FYBA 5ECNB 1GSEA 3N9JA 2VD0A 2PWJA 2LJRA 5A4VA 1T4ZA 2AV4A 4JRRA 4KAEA 3UJ1A 1BYEA 2MMAA 3SWLA 2L57A 3ZYWA 1ACVA 3TRXA 1PX6A 1M2BA 4EL1A 2F8FA 3ZLPA 2FWGA 3MNGA 4KDXA 3KTBA 3ERFA 3FMWA 3P90A 3D6IA 2VM2A 3EURA 4KE3A 4CDOA 4KH7A 2YV9A 4G0LA 2E7PA 4CW9A 3F0IA 3LQ7A 3CTFA 5ELGA 4CHSA 3H93A 2A2PA 2FGXA 2WDUA 2AUVA 4YKFA 1K0OA 2CZ2A 1ST9A 1PL1A 3RPNA 1R4WA 2PGTA 4FH8A 1M2AA 4IN0A 1LU4A 4HZ2A 5ECRB 3JCML 2ZUPA 3LSZA 4MMMA 5CRHA 2BJXA 1G7OA 4YH2A 4ECBA 4GSNA 1GLQA 1SK2A 4IS0A 4XS4B 1GTBA 4J57E 2REMA 1C72A 1AUCA 3EU4A 3QMXA 2VLTA 3C73A 5CNWA 3LORA 4JE1A 1V57A 3IC4A 5IMZA 4I6XA 4K7OA 3L0HA 2QSIA 2HRNA 3BJ5A 3DXBA 3TOUA 2C0EA 1GSQA 1FAAA 3WYWA 2GGTA 2EIRA 5DALB 3MDKA 6GSXA 2C8UA 5IMVA 3BCIA 1DE1A 4MH2A 3RHBA 1IYHA 1F9MA 2H71A 3J7Yk 4I97A 4BL7A 2VAFA 3GH9A 1WP0A 2J9HA 3A5WA 2RIIA 2G2QA 2JSZA 1X9MB 2GZYA 3ZIJA 6GSVA 2C3TA 1PX7A 2DJKA 3VFIA 1XPVA 4PNFA 4RQXA 1ZMAA 5IIZA 5ABRA 5D9WA 2YJ7A 4TR1B 5EVOA 2YZHA 3BBYA 5KN2A 3LFLA 2FA4A 5ECLB 1BG5A 4XCSA 1CQHA 2O8VB 1Z5YE 1WJKA 1N2AA 2LRTA 4L0UA 4ZL7A 2DJ3A 2FHEA 3UVTA 3GH6A 3A3TA 2CAIA 5KOXA 1PN0A 4O5UA 3KD0A 4ZB8A 3QAWA 2AAWA 4Z2RA 1G6WA 4F0CA 2EC4A 4AJ7A 1EEJA 4Z7XA 4DSSA 1FG4A 3ZZXA 3DIEA 5JCGA 2CV4A 13GSA 3RPPA 2V41A 4BWSA 1A23A 4E8EA 3GTUA 1TU8A 2KP1A 2A4HA 3A2VA 4EIPA 4MLYA 3V1WA 2PBJA 2CAQA 2PVQA 7GSSA 1FB6A 1K0BA 2IJYA 2H72A 2F3MA 5IOXA 2PUKC 4K7IA 1WIKA 3GV1A 2EIQA 1R5AA 4TR0A 4ZIJA 3KP8A 4LMWA 3GX8A 2LKUA 1SYRA 4POKA 2B7KA 1TP9A 2HYXA 5G1LA 5L71A 3UVHA 4Q5FA 3L9UA 2PMTA 3HVSA 5H5QA 3CXGA 3ZMKA 2OE0A 1SKRB 3EYTA 4IJIA 4J2FA 2VL3A 2LSTA 5FWGA 1ERWA 1XW9A 3VWWA 2H76A 4K1FA 2HI7A 3R2QA 4EVMA 3H4KA 4GF0A 3IK7A 1K0NA 3K8NA 4G9HA 4BVYB 2FCHA 2C80A 3IA1A 3TJBA 4EIQA 5JCWA 3TRPA 3DD3A 1SJ6A 2IPAA 2H6YA 3KIJA 3A2WA 2P5RA 1EP7A 1DUGA 4O92A 1H4OA 5CAXA 1PL2A 8GSSA 4GXZA 3TKSC 2J23A 1EOGA 1BAYA 4NXIA 2JU5A 1ILOA 5D96A 4OWYA 2DIZA 2XBIA 5J5NA 2DKIA 2TRCP 2OACA 2H0GA 1SKSB 2YANA 5CYYA 1ZYPA 2AJQB 3VI5A 2L4CA 4IQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M80 A;  2H1B A;  5DQY A;  2KHP A;  3G7Y A;  3GKM A;  3HY2 A;  3UIW A;  2GZP A;  3TJK A;  4JBB A;  1EWX A;  3DGQ A;  5ELA A;  1GL8 A;  2C1Y A;  1T3B A;  2K8V A;  1KNG A;  5DQS A;  1NHO A;  3RAZ A;  1GNW A;  2YN1 A;  3LG6 A;  5HR3 A;  4MPG A;  1J08 A;  1U3A A;  10GS A;  3LYP A;  5JWQ B;  1YY7 A;  2B7J A;  2AHE A;  3GKN A;  2DLX A;  3BD2 A;  1DSB A;  1F37 A;  1EGO A;  4GRF A;  4HOJ A;  5DAK A;  2CVB A;  1W4V A;  3PH9 A;  2FD3 A;  3KTL A;  2CVD A;  3GKK A;  3WT2 A;  2XPE A;  3HYP A;  4K9Z A;  1EP8 A;  1WOU A;  3TJJ A;  2X8C A;  1GUH A;  3IBH A;  12GS A;  6GST A;  3QCP A;  3GRX A;  2DJ1 A;  3H79 A;  2ON7 A;  2VLV A;  3KMO A;  2EIO A;  1PGT A;  2OBI A;  2LRC A;  3TCO A;  2VIM A;  2CX4 A;  4QL7 A;  3H8Q A;  4KGI A;  1F3A A;  5HFK A;  4GQC A;  1R5P A;  2ZCT A;  3C7M A;  4IQ1 A;  5DCH A;  3TKS E;  4KA0 A;  1AQW A;  1OVN A;  3ZRD A;  3GNJ A;  3TDG A;  1QMV A;  3KZQ A;  3MSZ A;  2NBS A;  1PKW A;  1ON4 A;  3FZA A;  3TJG A;  1YEP A;  5DCG A;  2VCW A;  3WGX A;  4MF5 A;  4RQR A;  5ECQ B;  1GLP A;  3FR3 A;  5AGY A;  1FVJ A;  3ZVJ A;  2IFQ A;  3ERG A;  3FR9 A;  3HZ4 A;  1V98 A;  5CP1 A;  2GT6 A;  2R4V A;  5ECM B;  1KBN A;  4ISD A;  1RW1 A;  2MBT A;  5F06 A;  5AN1 A;  1HQO A;  3Q6O A;  1OKD A;  3APO A;  2H70 A;  1V40 A;  1JLV A;  4HJ2 A;  2B1K A;  1HD2 A;  2FY6 A;  2I81 A;  2IMD A;  1YJ6 A;  3TKP A;  3HCZ A;  4I8B A;  4V2M A;  3F8U A;  2IIY A;  3DYR A;  4RI6 A;  5IMD A;  1VF2 A;  1GSD A;  4BPY A;  2CZ3 A;  4NHZ A;  3KCM A;  1RQM A;  3F9U A;  1FOV A;  3J7Y b;  3TKS A;  2FA8 A;  4TR3 A;  4N0V A;  4EUY A;  1TRS A;  1TU7 A;  4G2E A;  2PU9 C;  2OAD A;  3HHV A;  1SK1 A;  4FIW A;  2WFC A;  2YWM A;  3VK9 A;  1GTA A;  3TKQ A;  1XWB A;  1AQX A;  1AXD A;  2JAD A;  2OA7 A;  4TR4 A;  3F3R A;  3ZVJ D;  2Z9S A;  4NAX A;  2N5A A;  3KP9 A;  6GSU A;  1O73 A;  5ECI B;  1AQV A;  5AIS A;  5CRG A;  3TUE A;  4DSS B;  5COH A;  5C04 A;  1HYU A;  5KN3 A;  1A8Y A;  5B6N A;  3GX0 A;  3FZ4 A;  3E3E A;  4IGJ A;  2RUF A;  3GTU B;  4JU5 A;  2A2R A;  3TRQ A;  2RM5 A;  1XFL A;  1EV4 A;  1U3I A;  1A2L A;  3W8J A;  4ZBD A;  4XRD A;  3C1S A;  2C3Q A;  2KOK A;  4V2L A;  4KW6 A;  3FY7 A;  2HZE A;  4JZQ A;  2M72 A;  2HFD A;  3D4T A;  1GSY A;  2MMZ A;  3WT1 A;  4KX4 A;  1UN2 A;  3VWV A;  4K8M A;  5KN0 A;  2CX3 A;  3UAP A;  3US3 A;  5J41 A;  3UBK A;  1EGR A;  1UA5 A;  2H01 A;  2QC7 A;  1S3C A;  4GLT A;  4MDC A;  4V1A g;  4OO4 A;  4WF5 A;  1B4Q A;  5IPG A;  1SD9 A;  1WRY A;  4N11 A;  5AIV A;  4IP1 A;  3S9F A;  2R37 A;  2YNX A;  3GA4 A;  3FK8 A;  2XPD A;  2C0D A;  2DIY A;  1ZYQ B;  1G7E A;  4PQI A;  1EZK A;  16GS A;  5J9B A;  1THX A;  3RDW A;  1SJI A;  3G9B A;  5LNK e;  4WR4 A;  3D21 A;  3QDN A;  5DJL A;  1XCC A;  1XXU A;  1JZO A;  1K0C A;  2WRT A;  1TI1 A;  2GLR A;  3KGK A;  3QFB C;  1U6T A;  2I1U A;  3CBU A;  2A4V A;  1OC9 B;  2LRN A;  2L6C A;  1SU9 A;  1M0U A;  4EE0 A;  3HD5 A;  1PA3 A;  4P3Y B;  5G5F A;  5CRW A;  2NPB A;  3M9K A;  4X0X A;  5DVB A;  3ERW A;  3RHC A;  4MJA A;  1T7P B;  4FYC A;  4E8H A;  2VCV A;  3GL3 A;  5DJM A;  1GSS A;  4BWQ A;  4EDZ A;  2GQL A;  2GDR A;  4TXO A;  2B6M A;  2GZZ A;  1F2E A;  1GTU A;  5C00 A;  2VCZ A;  3FHK A;  3M0F A;  4KSO A;  1PKZ A;  2VCQ A;  1EV9 A;  5J3R A;  3VPT A;  1BX9 A;  4PQ1 A;  1H75 A;  1XIY A;  4AJ8 A;  4K7N A;  4TOP A;  5CRD A;  2OE3 A;  3MWH A;  3L4N A;  4POL A;  1GH2 A;  1TXX A;  2YWO A;  3KH9 A;  1J9B A;  4HUA A;  1X9S B;  1SJZ A;  1GNE A;  4ZIL A;  5DAK B;  4I5Q A;  3LEF A;  3CSH A;  2IY2 A;  4HU9 A;  4AGS A;  5LD0 A;  3IE3 A;  2MBS A;  2VLU A;  4ECC A;  2V2G A;  2VM1 A;  4PQH A;  4K2D A;  5F0G A;  4KND A;  1TOF A;  2HSH A;  4L5L A;  4F9Z A;  5ECK B;  2DML A;  2O7K A;  5IQY A;  3H1N A;  4MP4 A;  1V9W A;  5ENU A;  1K0D A;  1S3D A;  1TRW A;  1LJR A;  1F3B A;  2OJL A;  1Q98 A;  1ERT A;  3IPZ A;  1WPI A;  3APS A;  2HT9 A;  1A8L A;  3G7I A;  3HJM A;  2RLI A;  1OC8 A;  2LS5 A;  4IEL A;  3C8E A;  1AAZ A;  4MF6 A;  1MEK A;  1XOA A;  2H0I A;  3F6D A;  4ZL8 A;  3HVX A;  3A2X A;  2YWN A;  4FYU A;  2B5X A;  4OFN A;  1OKT A;  2BTO T;  3QR6 A;  4MAB A;  4N30 A;  4MPF A;  5ID2 A;  3KM6 A;  3DWV A;  4EC0 A;  4EF0 A;  1M7T A;  2L6D A;  1Q4J A;  2B5E A;  2GSR A;  3SBC A;  2IFQ B;  2CQ9 A;  1AC1 A;  2MYG A;  4MA9 A;  1MD4 A;  2XBQ A;  5CRE A;  2XC2 A;  1I5G A;  1K3L A;  1Y6E A;  5G31 A;  4OCE A;  4KSM A;  3WGD A;  3CMI A;  3M1G A;  4XIH A;  2C0G A;  2R2J A;  3UOM A;  4WF4 A;  1QQ2 A;  2R3X A;  1SYX A;  4WKW A;  2KUC A;  1OC9 A;  4IJ3 A;  4LL1 B;  4D73 A;  4WEY A;  4BA7 A;  3AY8 A;  1K3Y A;  3M8N A;  2M46 A;  2H74 A;  4YQM A;  2NVL A;  4LA1 A;  2V1M A;  2GT5 A;  2JZS A;  1GUK A;  5ECH B;  1ERU A;  3KXO A;  4XS1 A;  2OKA A;  1TK8 B;  1YF0 A;  5F05 A;  1M9B A;  1SKW B;  3F3Q A;  2RM6 A;  2V6K A;  5G30 A;  4K6X A;  4ZXG A;  4KCE A;  2VUP A;  4XS6 A;  2ES7 A;  4MZB A;  3QD9 A;  2B1L A;  1PN9 A;  1OAZ A;  2D2Z A;  3DEX A;  1XVW A;  3IAM 2;  2DBC A;  1WMJ A;  2G0F A;  2YV7 A;  2IN3 A;  4PGT A;  1Z9H A;  4NPB A;  1NM3 A;  4HI7 A;  4IP6 A;  19GS A;  4ML6 A;  3D4M A;  1VF1 A;  4ID0 A;  4YAV A;  3ED3 A;  1PSQ A;  5INY A;  1A0R P;  2JAC A;  1T8E B;  4XRA A;  3PGT A;  2X64 A;  2H1A A;  3ZFB A;  1E6B A;  4KDU A;  1QFN A;  2F8A A;  3ZIT A;  1A24 A;  3D22 A;  2WZ9 A;  3FZ5 A;  3FR6 A;  3ZIV A;  3MAK A;  1O7U A;  1PQN A;  3EE2 A;  1GRX A;  5IOW A;  2IMF A;  1UVZ A;  2LEG A;  4TN8 A;  3QFA C;  5A5K A;  1R26 A;  4MZW A;  4X1U A;  1QUW A;  3FW2 A;  4K0N A;  2IL3 A;  17GS A;  4ILF A;  3IR4 A;  2JZT A;  3BCK A;  2HZE B;  2VD1 A;  4QQ7 A;  2ZNM A;  3P7X A;  1Z6M A;  3M9J A;  1SEN A;  5D73 A;  2X8G A;  3LXT A;  3IDV A;  4AF2 A;  3GMF A;  4TRX A;  4IVF A;  2GQK A;  2KLX A;  1NW2 A;  4TVE A;  1TTZ A;  3W8S A;  3WD6 A;  2L59 A;  3FEU A;  4BVX A;  1ML6 A;  3F4S A;  5E4W A;  2C0F A;  1Z6N A;  2VCX A;  1JZR A;  3O76 A;  2LNS A;  2WCI A;  4G10 A;  3I69 A;  4ZL9 A;  11GS A;  4HQZ A;  14GS A;  1AIU A;  5D8I A;  1WWJ A;  4PUF C;  1E2Y A;  5IPH A;  3KMN A;  5HR2 A;  4EO3 A;  2IME A;  3GL5 A;  4LLR A;  5GZZ B;  1XW6 A;  3UL3 A;  4DEJ A;  1CQG A;  3F6F A;  1O8X A;  4WR5 A;  1NHY A;  1ERV A;  4ZB6 A;  1XZO A;  2RUE A;  3GKX A;  3M3M A;  3ISO A;  3UAR A;  3GSS A;  4JR6 A;  2N5F A;  1Z7P A;  3GST A;  4IBP A;  1JZW A;  4PXO A;  3KJY A;  3TGZ A;  1JLW A;  3GN3 A;  2MZC A;  4MCU A;  4MK3 A;  5H5R A;  5GSS A;  1KTE A;  1K3O A;  1EEM A;  3VLN A;  2L5L A;  2B3S A;  5ECO B;  5B8B A;  2LJK A;  5EY6 A;  1ZGN A;  3LXZ A;  18GS A;  4TXO B;  4OFM A;  4GST A;  3UBL A;  1T1V A;  2QGV A;  4FO5 A;  2YZU A;  1Z7R A;  2VL9 A;  1HNB A;  4F82 A;  1HNC A;  3TB2 A;  1TRV A;  2I3Y A;  3QAV A;  4WBJ A;  5HQP A;  1JFU A;  2HE3 A;  3W6G A;  3I6A A;  4OO5 A;  4O7H A;  4F2I A;  3ZRE A;  4I2T A;  2VO4 A;  4NMU A;  4KDY A;  3CTG A;  2CT6 A;  3FRC A;  5IMA A;  1X9W B;  2HNL A;  5AIX A;  2VL2 C;  3EVI A;  4HEA 2;  2H8L A;  4XHM A;  1TK5 B;  1GUL A;  3DVW A;  1TK0 B;  3Q19 A;  1X0R A;  2C4J A;  3ZML A;  1X5D A;  2K18 A;  3CSI A;  3L9V A;  2LNT A;  2GTU A;  4TW5 A;  3U5R E;  3APQ A;  3GUS A;  2X99 A;  3O3T A;  2DSA A;  3IAS 2;  5KN1 A;  1SL0 B;  4ULX A;  2MMO A;  2N5B A;  5JWR B;  2AYT A;  3IV4 A;  4PUA A;  2I4A A;  4N10 A;  3IXR A;  2A2S A;  5FHI A;  2HXK A;  1WE0 A;  3IK9 A;  2NDO A;  2X8H A;  4OCF A;  3VWX A;  1PMT A;  4X43 A;  2DJJ A;  1QGV A;  1ZZY A;  1U87 A;  4KB3 A;  2CVK A;  5ID2 B;  1A0F A;  3C71 A;  3BOA A;  20GS A;  3OR5 A;  1XW5 A;  1SL1 B;  1TKD B;  2V32 A;  2WB9 A;  3HKR A;  1XWG A;  1BJX A;  2OBK A;  5GAN D;  3ME8 A;  2AB6 A;  1SD8 A;  1S3A A;  3WGE A;  4YQV A;  3TJF A;  5IO0 A;  4NV2 A;  5D93 A;  2KP2 A;  4IW9 A;  2JL4 A;  4OD7 A;  1BED A;  2LV3 A;  3EMP A;  5JCU A;  2LUS A;  3ZFL A;  3VI7 A;  4D73 B;  2PER A;  2FNO A;  4TXV A;  4EKZ A;  4V2N A;  1URM A;  1EOH A;  4HDE A;  5F07 A;  3EMX A;  2H1G A;  5GAP D;  3N5O A;  3RBT A;  4PX1 A;  4MJE A;  2FUG 2;  2GQM A;  5DBQ A;  2NTO A;  2R6K A;  3TKR A;  4ML1 A;  1GUM A;  1XWA A;  4H86 A;  1A2J A;  4KUN A;  4F0B A;  1O6J A;  1MDI A;  2YCD A;  3VUR A;  4DSQ A;  1OE7 A;  2H19 A;  2IMK A;  4Q5N A;  4XTS A;  1VRS D;  4EXJ A;  4JR4 A;  2DJ0 A;  4MJC A;  1YZX A;  2PN8 A;  3CYN A;  4HQS A;  4GTU A;  4TKY A;  2XHF A;  1FHE A;  4OMV A;  2LQQ A;  4GCI A;  4JED A;  2HSY A;  2WUL A;  3L9S A;  3NIV A;  3F4T A;  4I2U A;  4LMV A;  1USB A;  3TOT A;  2YJH A;  3VPQ A;  5CO3 A;  5A4W A;  1NSW A;  4Q5Q A;  3DKS A;  3IHQ A;  1SK0 A;  3NOF A;  4ECJ A;  4L5O A;  1FVK A;  4V1A p;  5D9V A;  2LJA A;  3IOS A;  5IO2 A;  5KEJ A;  3UEM A;  4O5R A;  1X5C A;  3KH7 A;  4NV5 A;  1YKC A;  3O6T A;  3ME7 A;  2H30 A;  1M9A A;  1PRX A;  1TRU A;  1SL2 B;  3KEB A;  2WJU A;  4EDY A;  3LGC A;  4HU7 A;  3QOU A;  1G0T A;  3Q74 A;  1T00 A;  1U88 A;  3I9V 2;  1M2D A;  5G2Z A;  2H66 A;  2H75 A;  1K0M A;  4K0G A;  5FT3 A;  3IRA A;  1TI3 A;  1YEX A;  4MJB A;  2K8S A;  1JHB A;  2GVP A;  1Z3E A;  2QKE A;  3U6V A;  4WET A;  1FB0 A;  2DC5 A;  4XS4 A;  4NWY A;  3C1R A;  5J4U A;  2C3N A;  5B7C A;  5DDL A;  2K9F A;  3DRN A;  3FZ9 A;  5G1K A;  4AJ6 A;  1K0A A;  2LQO A;  2H6Z A;  1FW1 A;  5EPF A;  1G6Y A;  4GWR A;  2MMN A;  1XWK A;  2VL2 A;  2OE1 A;  3GFK A;  3LWA A;  1GSF A;  2FWE A;  4DVC A;  3P2A A;  3HVV A;  3GIX A;  1KEB A;  2VOC A;  4POM A;  4ZBB A;  1GTI A;  2GSQ A;  3CRU A;  5DAL A;  3E0U A;  4MZC A;  5F8B A;  2YWI A;  2PVO C;  4GSS A;  1VGL A;  1MD3 A;  2IMI A;  1V2A A;  1J0F A;  3GHA A;  3GYK A;  2K6V A;  1BQ7 A;  1FO5 A;  4L0W A;  1ZL9 A;  2WS2 A;  1YKA A;  2L4Q A;  4MF7 A;  4OFT A;  4L8E A;  2GST A;  2P0G A;  2WGR A;  5B8A A;  1B4P A;  4ZB9 A;  2ON5 A;  3LYK A;  3P8W A;  5HR0 A;  1M99 A;  2HRF A;  6GSS A;  2JSY A;  2HLS A;  2H1D A;  5EL8 A;  1N8J A;  1I9D A;  2LTK A;  4MH3 A;  5HFG A;  5J9C A;  3Q18 A;  4TR1 A;  5ECP B;  1T4Y A;  1YQ1 A;  1ZOF A;  5H5S A;  5A4U A;  2B5Y A;  3HZ8 A;  2FWH A;  5G5E A;  2YOI A;  1O85 A;  1THO A;  1TDI A;  1O81 A;  1DBY A;  4YAP A;  3L78 A;  3CRT A;  1ABA A;  4ACS A;  1W89 A;  2IYJ A;  5D9X A;  3HDC A;  1MDK A;  3EIN A;  2BMX A;  1YDK A;  3HJP A;  2FWF A;  2YPM A;  4IHU A;  1DE2 A;  1OYJ A;  3NZN A;  2DJ2 A;  4Q5R A;  4N0Z A;  2HZF A;  1TJD A;  1OE8 A;  1UC7 A;  2FLS A;  2TRX A;  1R7H A;  4WBR D;  5IM9 A;  5IMF A;  6GSY A;  1QXH A;  3UMA A;  2PPT A;  3FKF A;  4LL4 B;  4DSR A;  5JWO B;  5HFI A;  1B48 A;  3QAG A;  1RK4 A;  5HR1 A;  4ZBA A;  1XWC A;  2E0Q A;  3PR8 A;  3GUR A;  2E2G A;  2E2M A;  1XBS A;  3HA9 A;  2I9H A;  1O8W A;  1VF4 A;  2O85 A;  1YF1 A;  3ZL5 A;  1ZYE A;  1Y25 A;  2IWT A;  3QPM A;  3EU3 A;  6GSW A;  2L5O A;  1IYI A;  4IKH A;  3HJO A;  3I43 A;  1PD2 1;  4RUV A;  3D0Z A;  2O89 A;  2VCT A;  5GST A;  1ZCP A;  2R5G A;  3CSJ A;  3HXS A;  4RI7 A;  4BVY A;  2P5Q A;  3FYG A;  2ALB A;  4O32 A;  4ECI A;  3E9J B;  3EC3 A;  1F6M C;  1MTC A;  1OC3 A;  1XVQ A;  4NHW A;  3VWU A;  5ECS A;  1B8X A;  2O87 A;  1AW9 A;  4YQU A;  1QK8 A;  4HZ4 A;  4KCA A;  3EWL A;  1GP1 A;  2H6X A;  3G7J A;  4G19 A;  4HJM A;  1JZD A;  5LCZ A;  4F03 A;  3D5J A;  3F63 A;  3LJR A;  1V58 A;  2JZR A;  1VF3 A;  1A2M A;  3DVX A;  4QL9 A;  1GSU A;  3F4R A;  1LBK A;  2DMM A;  1HNA A;  2GSS A;  2V6O A;  1X5E A;  2P31 A;  3PIN A;  5B6M A;  2H73 A;  2YP6 A;  4HS1 A;  2GS3 A;  2H0H A;  1TW9 A;  4WXT A;  9GSS A;  1XOB A;  4POB A;  2F51 A;  22GS A;  4PUR A;  2F9S A;  1MDJ A;  1GWC A;  2TIR A;  5D9T A;  1B9Y C;  5E59 A;  4PNG A;  3DML A;  4J56 E;  3ZTL A;  4GQF A;  5IMC A;  1B9X C;  2CA8 A;  4FYB A;  5ECN B;  1GSE A;  3N9J A;  2VD0 A;  2PWJ A;  2LJR A;  5A4V A;  1T4Z A;  2AV4 A;  4JRR A;  4KAE A;  3UJ1 A;  1BYE A;  2MMA A;  3SWL A;  2L57 A;  3ZYW A;  1ACV A;  3TRX A;  1PX6 A;  1M2B A;  4EL1 A;  2F8F A;  3ZLP A;  2FWG A;  3MNG A;  4KDX A;  3KTB A;  3ERF A;  3P90 A;  3D6I A;  2VM2 A;  3EUR A;  4KE3 A;  4CDO A;  4KH7 A;  2YV9 A;  4CW9 A;  2E7P A;  3F0I A;  3LQ7 A;  3CTF A;  5ELG A;  4CHS A;  3H93 A;  2FGX A;  2WDU A;  2AUV A;  1K0O A;  2CZ2 A;  1ST9 A;  1PL1 A;  3RPN A;  1R4W A;  2PGT A;  4FH8 A;  1M2A A;  4IN0 A;  1LU4 A;  4HZ2 A;  5ECR B;  3JCM L;  2ZUP A;  3LSZ A;  4MMM A;  5CRH A;  2BJX A;  1G7O A;  4YH2 A;  4ECB A;  4GSN A;  1GLQ A;  1SK2 A;  4IS0 A;  4XS4 B;  1GTB A;  4J57 E;  2REM A;  1C72 A;  1AUC A;  3EU4 A;  3QMX A;  2VLT A;  3C73 A;  5CNW A;  3LOR A;  4JE1 A;  1V57 A;  3IC4 A;  5IMZ A;  4I6X A;  4K7O A;  3L0H A;  2QSI A;  2HRN A;  3BJ5 A;  3DXB A;  3TOU A;  2C0E A;  1GSQ A;  1FAA A;  3WYW A;  2GGT A;  2EIR A;  5DAL B;  3MDK A;  6GSX A;  2C8U A;  5IMV A;  3BCI A;  1DE1 A;  4MH2 A;  3RHB A;  1IYH A;  1F9M A;  2H71 A;  3J7Y k;  4I97 A;  4BL7 A;  2VAF A;  3GH9 A;  1WP0 A;  2J9H A;  3A5W A;  2RII A;  2G2Q A;  2JSZ A;  1X9M B;  2GZY A;  3ZIJ A;  6GSV A;  2C3T A;  1PX7 A;  2DJK A;  3VFI A;  1XPV A;  4PNF A;  4RQX A;  1ZMA A;  5IIZ A;  5ABR A;  5D9W A;  2YJ7 A;  4TR1 B;  5EVO A;  2YZH A;  3BBY A;  5KN2 A;  3LFL A;  2FA4 A;  5ECL B;  1BG5 A;  4XCS A;  1CQH A;  2O8V B;  1Z5Y E;  1WJK A;  1N2A A;  2LRT A;  4L0U A;  4ZL7 A;  2DJ3 A;  2FHE A;  3UVT A;  3GH6 A;  3A3T A;  2CAI A;  3KD0 A;  4ZB8 A;  3QAW A;  2AAW A;  1G6W A;  4F0C A;  2EC4 A;  4AJ7 A;  1EEJ A;  4Z7X A;  4DSS A;  1FG4 A;  3ZZX A;  3DIE A;  5JCG A;  2CV4 A;  13GS A;  3RPP A;  2V41 A;  4BWS A;  1A23 A;  4E8E A;  3GTU A;  1TU8 A;  2KP1 A;  3A2V A;  4MLY A;  3V1W A;  2PBJ A;  2CAQ A;  2PVQ A;  7GSS A;  1FB6 A;  1K0B A;  2IJY A;  2H72 A;  2F3M A;  5IOX A;  2PUK C;  4K7I A;  1WIK A;  3GV1 A;  2EIQ A;  1R5A A;  4TR0 A;  4ZIJ A;  3KP8 A;  4LMW A;  3GX8 A;  2LKU A;  1SYR A;  4POK A;  2B7K A;  1TP9 A;  2HYX A;  5G1L A;  5L71 A;  3UVH A;  4Q5F A;  3L9U A;  2PMT A;  3HVS A;  5H5Q A;  3CXG A;  3ZMK A;  2OE0 A;  1SKR B;  3EYT A;  4IJI A;  4J2F A;  2VL3 A;  2LST A;  5FWG A;  1ERW A;  1XW9 A;  3VWW A;  2H76 A;  4K1F A;  2HI7 A;  3R2Q A;  4EVM A;  3H4K A;  4GF0 A;  3IK7 A;  1K0N A;  3K8N A;  4G9H A;  2FCH A;  2C80 A;  3IA1 A;  3TJB A;  5JCW A;  3TRP A;  3DD3 A;  1SJ6 A;  2IPA A;  2H6Y A;  3KIJ A;  3A2W A;  2P5R A;  1EP7 A;  1DUG A;  4O92 A;  1H4O A;  5CAX A;  1PL2 A;  8GSS A;  4GXZ A;  3TKS C;  2J23 A;  1EOG A;  1BAY A;  4NXI A;  2JU5 A;  1ILO A;  5D96 A;  4OWY A;  2DIZ A;  2XBI A;  5J5N A;  2TRC P;  2OAC A;  2H0G A;  1SKS B;  2YAN A;  5CYY A;  2AJQ B;  3VI5 A;  2L4C A;  4IQA A; 
#chains in the Genus database with same CATH topology
 2M80 A;  1GOV A;  2H1B A;  5DQY A;  2KHP A;  3G7Y A;  3GKM A;  3HY2 A;  5LC7 A;  1SIH A;  1JBS A;  1JBT A;  3UIW A;  2GZP A;  3V99 A;  1I3I A;  3TJK A;  4JBB A;  2XFT A;  1BNG A;  2YFJ B;  1EWX A;  3DGQ A;  5ELA A;  1GL8 A;  2C1Y A;  5RNT A;  1T3B A;  2K8V A;  1KNG A;  5DQS A;  1NHO A;  2WGQ A;  2YFI B;  3RAZ A;  1GNW A;  2YN1 A;  1N9E A;  3LG6 A;  2FGT A;  5HR3 A;  4MPG A;  3CCJ 3;  1J08 A;  2UZ8 A;  5EEO A;  2R4I A;  1TU5 A;  2HMM B;  1K73 4;  1KSI A;  1U3A A;  4PTS A;  10GS A;  1LQG C;  3LTB A;  3LYP A;  4HSC X;  1MGW A;  3T0U A;  5JWQ B;  1YY7 A;  4WFO A;  2B7J A;  1X1X A;  2AHE A;  3GKN A;  2BT3 A;  1GMP A;  3WA3 A;  2DLX A;  3BD2 A;  1DSB A;  1UI8 A;  4K90 B;  1F37 A;  1US1 A;  1EGO A;  1EUI C;  4GRF A;  4HOJ A;  5DAK A;  2CVB A;  4KFD A;  1JRQ A;  1W4V A;  3PH9 A;  3SVA A;  2FD3 A;  3KTL A;  1GOY A;  1TP6 A;  2CX0 A;  3NV0 B;  2CVD A;  3GKK A;  4BIR A;  3WT2 A;  2XPE A;  4MNN A;  2I9W A;  3HYP A;  4K9Z A;  1EP8 A;  1WOU A;  1K8A 4;  4AKY A;  2HRK A;  3TJJ A;  2X8C A;  1GUH A;  2L4V A;  3IBH A;  12GS A;  1UUG B;  1IQX A;  6GST A;  1YJN 3;  3QCP A;  1NO3 A;  3GRX A;  2DJ1 A;  1G96 A;  3K5T A;  1KD1 4;  3H79 A;  3DGO A;  1M9G A;  2Z6B A;  2ON7 A;  2VLV A;  3KMO A;  1YGE A;  3CCM 3;  2EIO A;  1RJO A;  1PGT A;  3R3E A;  2OBI A;  2LRC A;  3TCO A;  2R0G A;  2PNC A;  1RGK A;  2VIM A;  2CX4 A;  4QL7 A;  3H8Q A;  2GBX B;  4KGI A;  1F3A A;  5HFK A;  4GQC A;  1R5P A;  2ZCT A;  4Z2U A;  3C7M A;  2KF3 A;  4IQ1 A;  5DCH A;  3TKS E;  1D6Z A;  3DGL A;  4KA0 A;  2F99 A;  4BU4 A;  1AQW A;  1JN5 A;  1OVN A;  3GNJ A;  3TDG A;  3ZRD A;  2MF7 A;  2P38 A;  3URP A;  1QMV A;  3KZQ A;  4N6L A;  3MSZ A;  2NBS A;  1PKW A;  2QA1 A;  1ON4 A;  3FZA A;  3TJG A;  1YEP A;  5DCG A;  2VCW A;  7GSP A;  3WGX A;  2HOH A;  4MF5 A;  2BU4 A;  1Q40 A;  3LT8 A;  4RQR A;  1O7P B;  5ECQ B;  1UCI A;  1GLP A;  3FR3 A;  4RNZ A;  5AGY A;  1FVJ A;  3ZVJ A;  2IFQ A;  2AAE A;  3ERG A;  4LYL B;  2CW9 A;  3S29 A;  3FR9 A;  3HZ4 A;  1V98 A;  4LEH A;  1L5G B;  5CP1 A;  3V98 A;  3PCR A;  2GT6 A;  2R4V A;  1UW1 A;  5IF6 A;  1KBN A;  5ECM B;  4ISD A;  1Q86 4;  4EBG A;  2HMK B;  1M3J A;  1RW1 A;  1VQL 3;  2GEX A;  2MBT A;  2OOV A;  5F06 A;  5AN1 A;  1HQO A;  3Q6O A;  1OKD A;  2J8X B;  3APO A;  3CCR 3;  5M1A A;  3U1W A;  2H70 A;  1V40 A;  4BL7 B;  1JLV A;  1IVW A;  4HJ2 A;  2CFL A;  2B1K A;  1HD2 A;  1BNS A;  4FMD A;  2BO9 B;  4K5S A;  2FY6 A;  2I81 A;  2XH9 A;  2IMD A;  3ZG0 A;  1YJ6 A;  3TKP A;  3HCZ A;  1BSC A;  4HM8 B;  1BNR A;  4I8B A;  3UL5 A;  4V2M A;  3B4O A;  3F8U A;  2KXG A;  3MKI A;  4AKZ A;  2IIY A;  3DYR A;  2Y73 A;  4RI6 A;  5IMD A;  1VF2 A;  4O8S A;  1GSD A;  4BPY A;  1QAK A;  3CC2 3;  2CZ3 A;  4NHZ A;  1Z1S A;  1MNL A;  3KCM A;  2BMR B;  1TTO A;  1RQM A;  2KF4 A;  3F9U A;  3O8Y A;  1TFO A;  1FOV A;  3J7Y b;  3STD A;  4BL3 A;  5JPP A;  1HYF A;  1TUH A;  2FA8 A;  4N0V A;  4TR3 A;  3HOH A;  3TKS A;  4EUY A;  1TRS A;  2F5W A;  1TU7 A;  4G2E A;  2BNG A;  1BAN A;  2HMJ B;  2QIY A;  2PU9 C;  2OAD A;  3HHV A;  1SK1 A;  3BB9 A;  1DET A;  3WDG B;  4FIW A;  2WFC A;  2F56 A;  2YWM A;  3JVC A;  3VK9 A;  1GTA A;  3TKQ A;  2OQE C;  4FQU A;  2ZHX B;  1XWB A;  1AQX A;  1AXD A;  2JAD A;  2OA7 A;  4TR4 A;  3F7S A;  3F3R A;  2Z9S A;  4NAX A;  3ZVJ D;  1W2B 2;  2N5A A;  3KP9 A;  6GSU A;  1O73 A;  1CEW I;  5ECI B;  1AQV A;  1PY3 A;  5AIS A;  5CRG A;  3TUE A;  4DSS B;  5COH A;  3WR2 A;  5C04 A;  1HYU A;  4R9K A;  3WOF B;  1S72 3;  5KN3 A;  1A8Y A;  5B6N A;  3GX0 A;  3FZ4 A;  3E3E A;  2JDI H;  5G2G A;  4IGJ A;  2RUF A;  3GTU B;  4JU5 A;  2A2R A;  3TRQ A;  3OXA A;  2RM5 A;  1XFL A;  1EV4 A;  3CMA 3;  1U3I A;  1A2L A;  1GMR A;  3W8J A;  1W6G A;  1B27 A;  4ZBD A;  4XRD A;  3C1S A;  2C3Q A;  2KOK A;  4V2L A;  4KW6 A;  3FY7 A;  1I8V A;  4BTX A;  2HZE A;  4JZQ A;  2M72 A;  2HFD A;  3D4T A;  1GSY A;  2MMZ A;  3WT1 A;  4KX4 A;  1UN2 A;  3VWV A;  2X49 A;  4K8M A;  5KN0 A;  2OTL 3;  2CX3 A;  3UAP A;  3US3 A;  5J41 A;  3UBK A;  1EGR A;  2LQV A;  1UA5 A;  2H01 A;  2QC7 A;  1S3C A;  4KZ1 A;  1B20 A;  4GLT A;  4L8O A;  4MDC A;  4V1A g;  1YI2 3;  1A67 A;  4OO4 A;  1W6C A;  3LH4 A;  4WF5 A;  1B4Q A;  5IPG A;  1SD9 A;  1WRY A;  4N11 A;  5AIV A;  4IP1 A;  3S9F A;  4K2X A;  2R37 A;  2YNX A;  3GA4 A;  3FK8 A;  2XPD A;  2C0D A;  2DIY A;  1ZYQ B;  3GZY B;  1G7E A;  3LYG A;  4PQI A;  3S67 A;  2GU3 A;  4N6N B;  5AIH A;  1EZK A;  4XBT A;  16GS A;  5J9B A;  3NBJ A;  3KCH A;  1THX A;  3RDW A;  1AVL A;  1SJI A;  3G9B A;  5LNK e;  1FUW A;  3D21 A;  4WR4 A;  3QDN A;  5DJL A;  1XCC A;  1IQY A;  1XXU A;  4O3V A;  2HRA A;  1JZO A;  4K1V A;  1K0C A;  2WRT A;  1ULI B;  3LT9 A;  1TI1 A;  2A15 A;  2GLR A;  3KGK A;  3QFB C;  1U6T A;  2I1U A;  3CBU A;  4EXR A;  2A4V A;  4Z2T A;  1QMA A;  3J7Y d;  1OC9 B;  2LRN A;  3X3X A;  2L6C A;  1SU9 A;  1M0U A;  1FUS A;  4EE0 A;  3HD5 A;  1PA3 A;  4P3Y B;  5G5F A;  5CRW A;  3EN1 B;  3U97 A;  1I0X A;  1ROA A;  2NPB A;  3M9K A;  7RNT A;  4X0X A;  5DVB A;  3ERW A;  3RHC A;  4MJA A;  1T7P B;  3QRD A;  3Q3F A;  4FYC A;  5CF1 A;  4E8H A;  2VCV A;  5IG4 A;  3GL3 A;  5DJM A;  1GSS A;  4BWQ A;  4EDZ A;  3CCV 3;  2E2T A;  2GDR A;  2GQL A;  4TXO A;  1GS3 A;  3G6E 3;  4R1K A;  2B6M A;  2GZZ A;  1CH0 A;  4HAA A;  1F2E A;  1NNV A;  1GTU A;  5C00 A;  2VCZ A;  3FHK A;  4CJN A;  3M0F A;  1PKZ A;  1BNE A;  4KSO A;  1W4N A;  3NX0 A;  2VCQ A;  1I2G A;  1EV9 A;  5J3R A;  4X2O A;  2XFS A;  1BX9 A;  4PQ1 A;  1H75 A;  1XIY A;  3VPT A;  1UUW B;  1W01 A;  1VQ6 3;  4K7N A;  4AJ8 A;  1YNV X;  4TOP A;  5CRD A;  2OE3 A;  3F9S A;  3MWH A;  2CFG A;  3L4N A;  4POL A;  4ORL A;  1GH2 A;  1TXX A;  2YWO A;  3NM2 A;  3DH2 A;  3KH9 A;  1J9B A;  3BND A;  4HUA A;  1VQ5 3;  1X9S B;  4EC6 A;  4ICY A;  1IT8 A;  1N5H A;  1IU7 A;  1SJZ A;  1GNE A;  3VSY A;  5M19 A;  4ZIL A;  1FGO A;  2ZL8 A;  2E2U A;  5DAK B;  1XG8 A;  4I5Q A;  5KOW A;  3LEF A;  3CSH A;  4K1U A;  2IY2 A;  3NM7 A;  3VGN A;  3UNL A;  4HU9 A;  4AGS A;  5DRE A;  5LD0 A;  3IE3 A;  2MBS A;  2VLU A;  4ECC A;  4U13 A;  1UCL A;  3WHO A;  1JB5 A;  3ECF A;  3NXJ A;  2V2G A;  3GSP A;  2VM1 A;  4PQH A;  3CXC 2;  4K2D A;  5F0G A;  4KND A;  4MJD A;  1BSB A;  1TOF A;  2HSH A;  4L5L A;  4F9Z A;  3F8H A;  5ECK B;  1LQM B;  2DML A;  2C11 A;  1B2U A;  2O7K A;  5IQY A;  1A90 A;  3H1N A;  4MP4 A;  1V9W A;  5ENU A;  1S3R A;  1YVS A;  1K0D A;  1S3D A;  1TRW A;  1LJR A;  3PPU A;  1F3B A;  2OJL A;  4HM0 B;  5IW9 A;  3LZA A;  3AMO A;  1Q98 A;  4LMI A;  1ERT A;  2QEX 3;  3IPZ A;  5FW5 A;  1WPI A;  2IMJ A;  1IYY A;  3APS A;  2HT9 A;  1A8L A;  2OQE A;  3MYD A;  1BU4 A;  3MIX A;  3DZL A;  3G7I A;  3HJM A;  1FOH A;  2RLI A;  1OC8 A;  1JN5 B;  2PZV A;  2LS5 A;  4IEL A;  3C8E A;  1AAZ A;  4MF6 A;  3EBY A;  1MEK A;  1XOA A;  2H0I A;  3F6D A;  4ZL8 A;  3HVX A;  3A2X A;  4R9L A;  2YWN A;  4FYU A;  2B5X A;  4OFN A;  1K41 A;  4CPK A;  1OKT A;  2BTO T;  3QR6 A;  4MAB A;  3FCS B;  4N30 A;  4MPF A;  5ID2 A;  3KM6 A;  1VQM 3;  3DWV A;  4EC0 A;  2O9U X;  4EF0 A;  1M7T A;  2L6D A;  1Q4J A;  2B1X B;  2B5E A;  5EVH A;  1EG9 B;  2GSR A;  3AHW A;  3SBC A;  3FG3 A;  2IFQ B;  1B2Z A;  4CDL A;  2CQ9 A;  4GB5 A;  1AC1 A;  2MYG A;  4MA9 A;  1MD4 A;  2XBQ A;  5CRE A;  4N6M A;  2QA2 A;  2XC2 A;  2CWU A;  4GHO A;  1I5G A;  1Q9E A;  1K3L A;  1Y6E A;  5G31 A;  4OCE A;  3HVN A;  4KSM A;  3WGD A;  3CMI A;  3M1G A;  3HK4 A;  4XIH A;  2C0G A;  2R2J A;  3UOM A;  1F8N A;  4WF4 A;  1QQ2 A;  2B24 B;  5IEP A;  2W04 A;  2R3X A;  2CWV A;  1SYX A;  4WKW A;  2KUC A;  1OC9 A;  4IJ3 A;  4OK0 A;  4LL1 B;  4D73 A;  1MOL A;  1PFO A;  2SAR A;  4WEY A;  4BA7 A;  1RGC A;  3AY8 A;  5JBS A;  1K3Y A;  2OCT A;  3M8N A;  2M46 A;  4X2H A;  3L0R A;  2H74 A;  1ROV A;  1T2H A;  4J5K A;  4YQM A;  2R0P A;  1BSA A;  2NVL A;  4LA1 A;  3SOY A;  4USS A;  4Q53 A;  2V1M A;  4O2H A;  2GT5 A;  2GU1 A;  3DMC A;  4KT3 B;  1GUK A;  2JZS A;  5ECH B;  1ERU A;  3KXO A;  3EB8 A;  4DKI A;  5BU4 A;  4XS1 A;  2OKA A;  1TK8 B;  1YF0 A;  5F05 A;  2GSP A;  1M9B A;  1RGE A;  3H93 A;  1SKW B;  1SQW A;  2P0M A;  3FLJ A;  3F3Q A;  2RM6 A;  1TFK A;  2V6K A;  3A5E A;  5G30 A;  4K6X A;  4ZXG A;  4KCE A;  4HBR A;  2VUP A;  4XS6 A;  1IQ8 A;  2ES7 A;  4MZB A;  4X4J A;  3IHG A;  1BRH A;  3QD9 A;  2B1L A;  1IVU A;  2CG1 A;  1PN9 A;  2AAD A;  1OAZ A;  5M18 A;  2D2Z A;  3DEX A;  2Z77 A;  1XVW A;  3IAM 2;  2DBC A;  3AGN A;  1LVN A;  5A0O B;  2CX1 A;  1WMJ A;  2CG0 A;  2G0F A;  3CNM A;  5CF2 A;  3ZG5 A;  2YV7 A;  4R4K A;  1UCJ A;  2IN3 A;  4PGT A;  1Z9H A;  4NPB A;  1NM3 A;  1B2X A;  4HI7 A;  4IP6 A;  1RRL A;  19GS A;  4ML6 A;  3D4M A;  1VF1 A;  4ID0 A;  4YAV A;  3ED3 A;  1PSQ A;  5INY A;  1A0R P;  4WWU C;  4STD A;  2JAC A;  1T8E B;  4XRA A;  3PGT A;  2X64 A;  2H1A A;  2C4B A;  3ZFB A;  1E6B A;  4KDU A;  1QFN A;  3DGM A;  4HM2 B;  2F8A A;  3ZIT A;  1A24 A;  3FZW A;  3SYU A;  5ELJ A;  3D22 A;  1B3S A;  2WZ9 A;  3FR6 A;  1N5P A;  6GSP A;  1RCL A;  1DMQ A;  2XEP A;  3FZ5 A;  3MAK A;  3ZIV A;  5AI1 A;  4OVM A;  1Q81 4;  1O7U A;  3QK9 A;  1PQN A;  3EE2 A;  3HIG A;  1GRX A;  4H3U A;  5IOW A;  1RN4 A;  3EHC A;  2IMF A;  2XSO B;  1UVZ A;  2LEG A;  4N6V 0;  4TN8 A;  3QFA C;  1MWR A;  3BIR A;  3N54 B;  2P05 A;  1R26 A;  4MZW A;  4X1U A;  5A5K A;  1QUW A;  3FW2 A;  4K0N A;  3F14 A;  2IL3 A;  17GS A;  4ILF A;  3IR4 A;  2JZT A;  3BCK A;  2HZE B;  2VD1 A;  4QQ7 A;  3EJV A;  2ZNM A;  1YHQ 3;  3P7X A;  1Z6M A;  1QAL A;  3PS8 A;  3M9J A;  1SEN A;  3BU4 A;  5D73 A;  2X8G A;  2KF5 A;  3LXT A;  3ER7 A;  3IDV A;  4AF2 A;  4HM5 B;  3LML A;  3GMF A;  4TRX A;  3CCU 3;  4IVF A;  1MWS A;  3D79 A;  2GQK A;  2KLX A;  4HM3 B;  3PZW A;  1NW2 A;  4TVE A;  1TTZ A;  5GSP A;  3W8S A;  1W2Z A;  1I2E A;  3WD6 A;  2L59 A;  3OX9 A;  4IIA A;  3FG1 A;  3FEU A;  4BVX A;  1ML6 A;  3F4S A;  1JV2 B;  5E4W A;  2XR8 B;  2WOH A;  3UL6 A;  2KCD A;  2C0F A;  1Z6N A;  2VCX A;  1JZR A;  3O76 A;  1RGL A;  2LNS A;  2WCI A;  3BNE A;  4KVH A;  5IG0 A;  4G0I A;  4G10 A;  3I69 A;  1JJ2 2;  5D83 A;  4ZL9 A;  11GS A;  1O7G B;  4HQZ A;  14GS A;  1AIU A;  2YFL B;  5D8I A;  1WWJ A;  4PUF C;  1E2Y A;  5IPH A;  1W00 A;  3KMN A;  5HR2 A;  4EO3 A;  4GL6 A;  2IME A;  5AII A;  1N9J A;  1ZYN A;  3GL5 A;  4HM6 B;  4LLR A;  1OGZ A;  1LNH A;  5GZZ B;  1XW6 A;  3FKA A;  5KP3 A;  1IV7 A;  3UL3 A;  4DEJ A;  1CQG A;  1O7H B;  3NBR A;  3F6F A;  1O8X A;  4LZI A;  4WR5 A;  1NHY A;  1ERV A;  4ZB6 A;  1XZO A;  2RUE A;  3GKX A;  3M3M A;  1QAF A;  4WYK A;  3EQQ B;  3ISO A;  3UAR A;  1U8C B;  4MMX B;  3GSS A;  4JR6 A;  3EE1 A;  2N5F A;  3CU3 A;  1Z7P A;  3GST A;  4IBP A;  1JZW A;  4PXO A;  3KJY A;  3TGZ A;  1JLW A;  3GN3 A;  2MZC A;  4MCU A;  1MGR A;  5STD A;  4MK3 A;  5H5R A;  5GSS A;  1AY7 A;  2W2C A;  2KAA A;  1KTE A;  1RSN A;  1K3O A;  1EEM A;  3VLN A;  4CY6 A;  2L5L A;  2B3S A;  1WNH A;  5ECO B;  2UX0 A;  3WMD A;  3N8B A;  5B8B A;  2LJK A;  5EY6 A;  2W9P A;  1ZGN A;  3LXZ A;  1IV9 A;  1RHL A;  18GS A;  4TXO B;  4JRF A;  1OCV A;  4OFM A;  3RDE A;  4GST A;  3UBL A;  1T1V A;  2QGV A;  4FO5 A;  2YZU A;  1Z7R A;  1UCK A;  2VL9 A;  5ELU A;  1HNB A;  3JUN A;  4F82 A;  1HNC A;  3TB2 A;  1SII A;  1TRV A;  2I3Y A;  3QAV A;  4WBJ A;  5HQP A;  1M90 4;  1O7W B;  1FYS A;  1JFU A;  5FGO A;  2CIU A;  2HE3 A;  1SJW A;  1BAO A;  3W6G A;  3I6A A;  1LRA A;  4OO5 A;  4O7H A;  4F2I A;  3ZRE A;  2INX A;  4I2T A;  1GD3 A;  3OW2 2;  2VO4 A;  1M3I A;  1AR0 A;  4NMU A;  4KDY A;  3CTG A;  2CT6 A;  3MPH A;  2CH9 A;  3FRC A;  4I4K A;  3D5I A;  3BLZ A;  5IMA A;  1X9W B;  2HNL A;  5AIX A;  4RZM A;  2VL2 C;  3EVI A;  4HEA 2;  3OWS A;  2H8L A;  3IMA B;  1RCK A;  3F40 A;  4XHM A;  1TK5 B;  1GUL A;  3DVW A;  1G02 A;  1TK0 B;  3Q19 A;  1LOY A;  1X0R A;  2C4J A;  5IEN A;  3ZML A;  1X5D A;  2K18 A;  3CSI A;  3L9V A;  6RNT A;  2LNT A;  2GTU A;  4TW5 A;  3U5R E;  3APQ A;  3GUS A;  2X99 A;  3O3T A;  2DSA A;  3IAS 2;  5KN1 A;  1SL0 B;  4ULX A;  4G0K A;  2BMQ B;  1ZX2 A;  3AMO B;  1B2M A;  2MMO A;  2N5B A;  1T5Y A;  5JWR B;  2K54 A;  2AYT A;  2DKH A;  3IV4 A;  4PUA A;  3WA2 X;  2HSM A;  4FMC A;  4R80 A;  2I4A A;  3SED A;  4N10 A;  2KRT A;  3IXR A;  2A2S A;  5FHI A;  1JKG B;  2HXK A;  1NB3 I;  1WE0 A;  3FF2 A;  3IK9 A;  1C7H A;  2OWP A;  2NDO A;  2X8H A;  4OCF A;  3VWX A;  1PMT A;  4X43 A;  1BSD A;  1SAR A;  5IER A;  2DJJ A;  2HMO B;  1QGV A;  1U87 A;  1ZZY A;  3CQF A;  3MHE A;  4KB3 A;  2CVK A;  5ID2 B;  1A0F A;  4J8T A;  2RNT A;  4J9A A;  3C71 A;  3BOA A;  4L8P A;  20GS A;  3OR5 A;  3KSP A;  1XW5 A;  3K0Z A;  2BMO B;  1NU3 A;  1SL1 B;  1TKD B;  2V32 A;  2WB9 A;  3HKR A;  5CLK A;  1XWG A;  2STD A;  1BJX A;  1R4Y A;  1RLS A;  2OBK A;  5GAN D;  3ME8 A;  1RDS A;  2AB6 A;  1SD8 A;  3X42 A;  1S3A A;  3WGE A;  4YQV A;  3CCQ 3;  3TJF A;  5IO0 A;  4NV2 A;  5D93 A;  2KP2 A;  4IW9 A;  2JL4 A;  4OD7 A;  2GBW B;  1W6Y A;  1BED A;  2LV3 A;  1OAC A;  4K5R A;  3EMP A;  5JCU A;  4HOH A;  1WMO A;  1I70 A;  1IVX A;  1TRQ A;  2LUS A;  3ZFL A;  1IDP A;  3CNX A;  3VI7 A;  2YX9 A;  4D73 B;  2PER A;  4OUQ A;  2FNO A;  2W6J H;  4TXV A;  2IA7 A;  2Z7A A;  4EKZ A;  3NHX A;  4V2N A;  1URM A;  2Q07 A;  4FCZ A;  1EOH A;  4HDE A;  5F07 A;  3DXO A;  2C10 A;  3EMX A;  2H1G A;  5GAP D;  3N5O A;  4CY8 A;  3RBT A;  3ALA A;  4PX1 A;  4MJE A;  2FUG 2;  3LW9 A;  3CPW 2;  1YJ9 3;  1DMM A;  2GQM A;  5DBQ A;  2NTO A;  2R6K A;  3TKR A;  4ML1 A;  1GUM A;  1XWA A;  4H86 A;  3SOA A;  1A2J A;  4KUN A;  4F0B A;  1O6J A;  1MDI A;  2YCD A;  3VUR A;  1O7M B;  4DSQ A;  1GYB A;  3K7C A;  1OE7 A;  2H19 A;  2IMK A;  4Q5N A;  4XTS A;  1VQ9 3;  3X41 A;  1VRS D;  3IPT A;  5I97 A;  1CQS A;  3H51 A;  4EXJ A;  1RNT A;  3JUM A;  4JR4 A;  3KII A;  2DJ0 A;  4MJC A;  1YZX A;  2PN8 A;  3CYN A;  4HQS A;  4GTU A;  3CCS 3;  4TKY A;  2XHF A;  1FHE A;  1FGM A;  4OMV A;  2LQQ A;  4GCI A;  4JED A;  2HSY A;  2XSH B;  3IJE B;  2WUL A;  3L9S A;  4N6T A;  3B8L A;  3NIV A;  1KWI A;  3F4T A;  4I2U A;  4LMV A;  1USB A;  3TOT A;  2YJH A;  4HZ9 B;  3VPQ A;  1BSE A;  5AIF A;  5CO3 A;  3D3L A;  4YKG A;  3G8Z A;  1NSW A;  5A4W A;  4Q5Q A;  3DKS A;  3IHQ A;  1SK0 A;  5AEU B;  3NOF A;  3OWU A;  4ECJ A;  4L5O A;  1FVK A;  2OTJ 3;  4V1A p;  5D9V A;  2LJA A;  3IOS A;  3BNB A;  1VQ4 3;  5IO2 A;  1C54 A;  2SBL A;  1OPY A;  5KEJ A;  3A76 A;  3UEM A;  4O5R A;  1A2P A;  1X5C A;  3KH7 A;  4NV5 A;  3FG4 A;  1YKC A;  3O6T A;  3ME7 A;  4PEJ A;  2H30 A;  3NQZ A;  1I0V A;  1BNF A;  1M9A A;  1PRX A;  3CME 3;  1TRU A;  1SL2 B;  2UUG C;  3G71 3;  3KEB A;  2WJU A;  4EDY A;  3LGC A;  3MG3 A;  3QOU A;  4HU7 A;  1RMS A;  1A2K A;  1G0T A;  1D6Y A;  3I56 3;  3Q74 A;  4BTW A;  3LTC A;  1T00 A;  1U88 A;  3I9V 2;  1M2D A;  5G2Z A;  4MEI A;  3F7X A;  1W5Z A;  2H66 A;  4O02 B;  2RGQ A;  2BIR A;  1TIJ A;  5HGR A;  1K0M A;  2H75 A;  4K0G A;  3EN8 A;  1JKG A;  5FT3 A;  2FNQ A;  1JB4 A;  3IRA A;  1TI3 A;  1YEX A;  4MJB A;  2W56 A;  1BRJ A;  2K8S A;  1JHB A;  2GVP A;  1Z3E A;  4XBY A;  2QKE A;  3U6V A;  4WET A;  1FB0 A;  2DC5 A;  4XS4 A;  4NWY A;  3C1R A;  5J4U A;  2C3N A;  5B7C A;  5DDL A;  1ASK A;  2K9F A;  3LTA A;  3DRN A;  3FZ9 A;  5G1K A;  4AJ6 A;  1K0A A;  3X3Z A;  2LQO A;  1AV4 A;  2H6Z A;  1OGX A;  1FW1 A;  4BVX B;  5EPF A;  1IK3 A;  1N8R 4;  3G0K A;  1PU4 A;  1G6Y A;  1O7N B;  4GWR A;  1SPU A;  2MMN A;  1XWK A;  2VL2 A;  2OE1 A;  3GFK A;  3LWA A;  5AYS C;  1M1K 4;  1CYV A;  1ULJ B;  1KQS 2;  1GSF A;  2FWE A;  4DVC A;  5AEW B;  3P2A A;  3HVV A;  3GIX A;  1T2I A;  2W9Q A;  1KEB A;  2VOC A;  4POM A;  1RN7 A;  3KN4 A;  3Q1C A;  4ZBB A;  3D5G A;  3RNT A;  1GTI A;  2GSQ A;  3CRU A;  5DAL A;  3E0U A;  4MZC A;  4BL2 A;  3PYJ A;  2F5M A;  2LYX A;  5F8B A;  2YWI A;  2PVO C;  4GSS A;  1VGL A;  1MD3 A;  4FMA A;  2IMI A;  1V2A A;  1J0F A;  3GHA A;  3GYK A;  1E97 A;  3S28 A;  2K6V A;  1BQ7 A;  1FO5 A;  4L0W A;  1ZL9 A;  3Q2P A;  2WS2 A;  1YKA A;  4TX4 A;  2L4Q A;  4MF7 A;  4OFT A;  4L8E A;  2GST A;  2P0G A;  2ML6 A;  4WYK B;  2WGR A;  5B8A A;  1B4P A;  3FF0 A;  4ZB9 A;  2ON5 A;  3LYK A;  3P8W A;  5HR0 A;  1M99 A;  1QVF 2;  1Q82 4;  2HRF A;  3JUQ A;  6GSS A;  2R0C A;  2JSY A;  2HLS A;  2KF6 A;  2H1D A;  4A5P A;  5EL8 A;  1N8J A;  1I9D A;  1LOX A;  5BXQ A;  2LTK A;  3OV4 A;  4QWT A;  4MH3 A;  5HFG A;  3KFQ C;  5J9C A;  1HU9 A;  3CCL 3;  3Q18 A;  9RNT A;  1FUT A;  4TR1 A;  5ECP B;  1T4Y A;  1YQ1 A;  1ZOF A;  5BRT A;  1MWT A;  5H5S A;  1OHP A;  1FGT A;  5A4U A;  2B5Y A;  1FGR A;  3HZ8 A;  2FWH A;  2HML B;  3S27 A;  1OF5 A;  5G5E A;  2YOI A;  1O85 A;  4JF8 A;  1DVD A;  1THO A;  1TDI A;  3X40 A;  1O81 A;  1DBY A;  4YAP A;  3L78 A;  2JQ5 A;  3N9H A;  1W02 A;  3CRT A;  1Q7Y 4;  2P0X A;  1ABA A;  4ACS A;  1V74 A;  2IYJ A;  1W89 A;  3SXX A;  3CPO A;  5D9X A;  3HDC A;  1MDK A;  1OUN A;  3RGR A;  3JUO A;  3EIN A;  3F8X A;  1GY6 A;  2BMX A;  1STD A;  2CHC A;  4HM1 B;  2F4Y A;  1YDK A;  3HJP A;  2FXT A;  2D1W A;  1VQO 3;  2FWF A;  4AEQ A;  2YPM A;  4IHU A;  1DE2 A;  3DUK A;  1OYJ A;  3NZN A;  2DJ2 A;  1VQN 3;  1JBR A;  4Q5R A;  4N0Z A;  2MC8 A;  2CWT A;  1RTU A;  2HZF A;  1TJD A;  1OE8 A;  1UC7 A;  4KF9 A;  2FLS A;  2TRX A;  1R7H A;  4WBR D;  5IM9 A;  5IMF A;  6GSY A;  2GXF A;  4WP5 A;  1QXH A;  2RSX A;  1PFP A;  3UMA A;  2XRX B;  2PPT A;  3FKF A;  3T8U A;  4LL4 B;  4DSR A;  5JWO B;  5HFI A;  4KFE A;  1B48 A;  3QAG A;  1RK4 A;  5HR1 A;  5CXO A;  1ZS7 A;  1RNB A;  3GRD A;  4ZBA A;  1XWC A;  2E0Q A;  3PR8 A;  3GUR A;  3PCS A;  2E2G A;  3HZP A;  2E2M A;  1XBS A;  2X4A A;  3HA9 A;  2I9H A;  1O8W A;  3FGY A;  1VF4 A;  2O85 A;  2ZDJ A;  1YF1 A;  3KKG A;  1S5A A;  3ZL5 A;  1GOU A;  1ZYE A;  1Y25 A;  2IWT A;  1X1U A;  3QPM A;  3EU3 A;  6GSW A;  4XDW A;  3A5I A;  8CHO A;  2L5O A;  1IYI A;  1UDI I;  4IKH A;  1STF I;  3HJO A;  3I43 A;  2GEY A;  3H3H A;  2RBI A;  1QJG A;  1PD2 1;  4RUV A;  3D0Z A;  2O89 A;  3DY5 A;  2VCT A;  5GST A;  4RNY A;  1ZCP A;  2R5G A;  3CSJ A;  3HXS A;  4RI7 A;  4BVY A;  2P5Q A;  1TRP A;  3EPT A;  3FYG A;  2V1L A;  5LC6 A;  3IC8 A;  2IUJ A;  2ALB A;  1W7C A;  4O32 A;  4ECI A;  4LGQ A;  5AIG A;  3E9J B;  3EC3 A;  1F6M C;  1MTC A;  3M8C A;  1UGH I;  4WHA A;  1OC3 A;  1XVQ A;  4NHW A;  3VWU A;  5ECS A;  3UB1 A;  3KSE D;  3LOY A;  1B8X A;  1LXE A;  5BMU A;  2O87 A;  1AW9 A;  4YQU A;  3NQY A;  1WMP A;  1QK8 A;  3MG2 A;  4HZ4 A;  3D4A A;  1UGI A;  7STD A;  1LNI A;  2WO0 A;  4N6U A;  3CC7 3;  1GMQ A;  3Q90 A;  4KCA A;  4HVN A;  3EWL A;  1GP1 A;  2H6X A;  3G7J A;  4G19 A;  4FCM A;  4HJM A;  1JZD A;  5LCZ A;  1RGG A;  4F03 A;  3D5J A;  3F63 A;  3LJR A;  4XDV A;  1BNI A;  1V58 A;  1HKX A;  2JZR A;  2F86 B;  4NHF A;  1A2M A;  1VF3 A;  3DVX A;  4QL9 A;  1JNQ A;  4N6O B;  1GSU A;  3F4R A;  2Y74 A;  5D82 A;  1LBK A;  2DMM A;  1HNA A;  2GSS A;  2V6O A;  1VZZ A;  1X5E A;  4HJL B;  2IUK A;  2P31 A;  3PIN A;  3SX1 A;  5IG3 A;  5B6M A;  2H73 A;  2F98 A;  3KE7 A;  3V92 A;  1BUJ A;  2YP6 A;  4HS1 A;  1EKM A;  2GS3 A;  2H0H A;  2XGL A;  1TW9 A;  4WXT A;  3G4S 3;  9GSS A;  2L1S A;  1XOB A;  4POB A;  2F51 A;  1GSP A;  3I0Y A;  1EA2 A;  22GS A;  1UUV B;  5BVB A;  4PUR A;  2F9S A;  4O5Q A;  1MDJ A;  1GWC A;  2TIR A;  5D9T A;  1JB2 A;  1B9Y C;  5E59 A;  4PNG A;  1R4C A;  3DML A;  4J56 E;  1U5O A;  3B4P A;  3ZTL A;  1VQK 3;  4GQF A;  3DGN A;  3WOE B;  4HYZ A;  2CFD A;  5IMC A;  1J2B A;  1B9X C;  2CA8 A;  4FYB A;  5ECN B;  1Y4K A;  1GSE A;  3N9J A;  2VD0 A;  2PWJ A;  1VQ7 3;  2LJR A;  5A4V A;  1T4Z A;  2AV4 A;  1IT7 A;  4JRR A;  3HI7 A;  4KAE A;  3UJ1 A;  1BYE A;  5KP1 A;  2MMA A;  3T8N A;  3SWL A;  1EQK A;  2L57 A;  3ZYW A;  1ACV A;  3TRX A;  3CD6 3;  3EC9 A;  1PX6 A;  1AQZ A;  3AGO A;  3MSO A;  4BTY A;  3PGB A;  1M2B A;  4EL1 A;  1BOX A;  2F8F A;  3ZLP A;  2CKF B;  2FWG A;  3NV0 A;  3MNG A;  4KDX A;  3KTB A;  2K3D A;  3ERF A;  5JPU A;  3FMW A;  3P90 A;  3D6I A;  3B7C A;  4XM4 A;  2VM2 A;  5EQL A;  4RBN A;  3EUR A;  4KE3 A;  1B2S A;  4CDO A;  4KH7 A;  2YV9 A;  4G0L A;  2E7P A;  4CW9 A;  3F0I A;  3LQ7 A;  3CTF A;  5ELG A;  3EBT A;  3ZFZ A;  5BIR A;  4CHS A;  2WOF A;  4EW5 A;  1GY7 A;  1BRI A;  1Q7H A;  5DRV A;  2A2P A;  1AVK A;  2AUV A;  2E2V A;  2FGX A;  2WDU A;  4YKF A;  2XF3 A;  1BRK A;  1K0O A;  1YIJ 3;  4MMY B;  2CZ2 A;  1ST9 A;  1WMN A;  1BUQ A;  1PL1 A;  3RPN A;  1R4W A;  1QVG 2;  2PGT A;  4FH8 A;  1M2A A;  4IN0 A;  1LU4 A;  4HZ2 A;  5ECR B;  2CK3 H;  3JCM L;  2CFK A;  2BHM A;  1BIR A;  2ZUP A;  3LSZ A;  4MMM A;  2W56 B;  5CRH A;  5IEO A;  2BJX A;  1G7O A;  4YH2 A;  4ECB A;  4GSN A;  1YJW 3;  1GLQ A;  1SK2 A;  4IS0 A;  4XS4 B;  1M1X B;  3VF1 A;  1GTB A;  4J57 E;  4N3V A;  1C72 A;  2REM A;  4LSO A;  1NJI 4;  2ZA4 A;  1AUC A;  5KP4 A;  3EU4 A;  3QMX A;  2VLT A;  2W0Q A;  5AYR B;  1OHS A;  3C73 A;  3LOR A;  5CNW A;  4JE1 A;  1V57 A;  3IC4 A;  5IMZ A;  3K9M C;  4I6X A;  4K7O A;  3L0H A;  1N8Q A;  2QSI A;  2HRN A;  3BJ5 A;  3PXM A;  3DXB A;  1BRN L;  1KC8 4;  1BRG A;  3TOU A;  2XGN A;  1VQQ A;  2C0E A;  1GSQ A;  1FAA A;  3WYW A;  2GGT A;  4EV2 A;  2EIR A;  2P09 A;  2W03 A;  4KFF A;  3MDK A;  5DAL B;  3BNC A;  2C8U A;  6GSX A;  5IMV A;  3BCI A;  1DE1 A;  3GZX B;  4IPB A;  4MH2 A;  3RHB A;  1LOV A;  1FA3 A;  1A2V A;  1IYH A;  3EX9 A;  4XBX A;  1F9M A;  2H71 A;  3J7Y k;  4I97 A;  4BL7 A;  1ISK A;  3HX8 A;  5CK6 A;  1BNJ A;  1IVV A;  1K9M 4;  2VAF A;  3LTD A;  3UJM A;  3GH9 A;  1WP0 A;  2J9H A;  3RGA A;  3A5W A;  2RII A;  2G2Q A;  2JSZ A;  1X9M B;  3DM8 A;  1PYL A;  2GZY A;  3ZIJ A;  6GSV A;  2C3T A;  5HOH A;  1PX7 A;  2DJK A;  1FGQ A;  1WTH A;  3VFI A;  4HZB B;  1XPV A;  5IG5 A;  4PNF A;  4RQX A;  1X1W A;  1ZMA A;  3OWY A;  5IIZ A;  3GZR A;  1RN1 A;  4CCV A;  5ABR A;  5D9W A;  1I2F A;  4L7K A;  2YJ7 A;  1ZO2 A;  4TR1 B;  5EVO A;  2RCD A;  2YZH A;  3BBY A;  5KN2 A;  3NUV A;  4EYC A;  3LFL A;  1RKY A;  1E3V A;  1OF5 B;  2FA4 A;  8RNT A;  5ECL B;  2K0M A;  1VQ8 3;  1BG5 A;  4XCS A;  1CQH A;  3LXU X;  2O8V B;  5TGN A;  1Z5Y E;  1WJK A;  1N2A A;  1I3F A;  2D42 A;  4FMB A;  4EV5 A;  3CC4 3;  1FZU A;  2LRT A;  4L0U A;  2DJ3 A;  4ZL7 A;  2FHE A;  3UVT A;  3GAX A;  3GH6 A;  3A3T A;  1X1Y A;  3K63 A;  1YIT 3;  2CAI A;  5KOX A;  1PN0 A;  4O5U A;  3KD0 A;  4ZB8 A;  3QAW A;  2AAW A;  1DVC A;  4Z2R A;  1G6W A;  3S5C A;  5D81 A;  2QGU A;  3GZB A;  3JUP A;  2EC4 A;  4AJ7 A;  4F0C A;  1EEJ A;  4Z7X A;  4DSS A;  3HII A;  1FG4 A;  3ZZX A;  3DIE A;  5JCG A;  2CV4 A;  13GS A;  4HKV B;  3RPP A;  1DYU A;  4FCJ A;  2V41 A;  4HM7 B;  4BWS A;  3MWZ A;  2HMN B;  4J5G A;  1A23 A;  4E8E A;  3GTU A;  4MMZ B;  4BIK A;  3NBB A;  1TU8 A;  1RGH A;  2KP1 A;  2A4H A;  2O3O A;  1ZGX A;  3A2V A;  1BVI A;  2WGO A;  4EIP A;  4MLY A;  1OH0 A;  3V1W A;  1UI7 A;  3E99 A;  2CAQ A;  2PBJ A;  2PVQ A;  7GSS A;  1FB6 A;  1K0B A;  2IJY A;  2H72 A;  4FR9 A;  4G1M B;  2F3M A;  5IOX A;  2RFR A;  2PUK C;  4NRE A;  1WIK A;  1D6U A;  4K7I A;  1DMN A;  4IT7 A;  4GSP A;  3GV1 A;  2EIQ A;  1BRS A;  1VQP 3;  1R5A A;  4HM4 B;  4TR0 A;  4ZIJ A;  3KP8 A;  3DGY A;  4LMW A;  3GX8 A;  2LKU A;  2CC3 A;  1RGF A;  1SYR A;  4POK A;  2B7K A;  2CFW A;  1TP9 A;  1NWW A;  4ZM8 A;  2HYX A;  6STD A;  4RNT A;  1NDO B;  2OOV C;  5G1L A;  5L71 A;  3UVH A;  3MYT A;  4Q5F A;  1OHO A;  3L9U A;  2PMT A;  3HVS A;  3FH1 A;  5H5Q A;  3CXG A;  3ZMK A;  2M7O A;  2OE0 A;  1SKR B;  3EYT A;  4IJI A;  1RRH A;  3G16 A;  4J2F A;  2VL3 A;  2LST A;  5FWG A;  1WQL B;  1ERW A;  3WOD G;  1XW9 A;  3VWW A;  2H76 A;  4K1F A;  2HI7 A;  3R2Q A;  4EVM A;  3H4K A;  4GF0 A;  3IK7 A;  1K0N A;  3K8N A;  4G9H A;  2R41 A;  4BVY B;  2FCH A;  3X3Y A;  2C80 A;  3CCE 3;  4H61 A;  3IA1 A;  3TJB A;  4EIQ A;  5JCW A;  4K61 A;  3TRP A;  3DD3 A;  1SJ6 A;  2IPA A;  2H6Y A;  3KIJ A;  1Q40 B;  3A2W A;  3FSD A;  2P5R A;  1EP7 A;  1LOW A;  1DUG A;  1E3R A;  1NB5 I;  3AHS A;  1B21 A;  4O92 A;  1H4O A;  1BGS A;  1HZ1 A;  3ROB A;  5CAX A;  3MG1 A;  1MWU A;  1FW7 A;  1GD4 A;  1PL2 A;  8GSS A;  3KZT A;  3I55 3;  4GXZ A;  1GY5 A;  3TKS C;  2J23 A;  1EOG A;  1K28 A;  2UGI A;  1BAY A;  3GWR A;  4NXI A;  4XB5 A;  2JU5 A;  5D96 A;  1ILO A;  4OWY A;  1Q42 A;  2DIZ A;  3EF8 A;  2QA4 3;  3SLU A;  2XBI A;  5J5N A;  2Z76 A;  2DKI A;  1CYU A;  1YGW A;  2TRC P;  2OAC A;  2H0G A;  1SKS B;  1RGA A;  3D9R A;  2YAN A;  5CYY A;  1ZYP A;  2ML5 A;  2AJQ B;  3VI5 A;  2L4C A;  1YVB I;  4IQA A;  1DE3 A; 
#chains in the Genus database with same CATH homology
 2M80 A;  2H1B A;  5DQY A;  2KHP A;  3G7Y A;  3GKM A;  3HY2 A;  3UIW A;  2GZP A;  3TJK A;  4JBB A;  1EWX A;  3DGQ A;  5ELA A;  1GL8 A;  2C1Y A;  1T3B A;  2K8V A;  1KNG A;  5DQS A;  1NHO A;  3RAZ A;  1GNW A;  2YN1 A;  3LG6 A;  5HR3 A;  4MPG A;  2UZ8 A;  1J08 A;  1U3A A;  4PTS A;  10GS A;  3LYP A;  5JWQ B;  1YY7 A;  2B7J A;  2AHE A;  3GKN A;  2DLX A;  3BD2 A;  1DSB A;  1F37 A;  1EGO A;  4GRF A;  4HOJ A;  5DAK A;  2CVB A;  1W4V A;  3PH9 A;  2FD3 A;  3KTL A;  2CVD A;  3GKK A;  3WT2 A;  2XPE A;  4MNN A;  3HYP A;  4K9Z A;  1EP8 A;  1WOU A;  2HRK A;  3TJJ A;  2X8C A;  1GUH A;  3IBH A;  12GS A;  6GST A;  3QCP A;  3GRX A;  2DJ1 A;  3H79 A;  2ON7 A;  2VLV A;  3KMO A;  2EIO A;  1PGT A;  3R3E A;  2OBI A;  2LRC A;  3TCO A;  2R0G A;  2VIM A;  2CX4 A;  4QL7 A;  3H8Q A;  4KGI A;  1F3A A;  5HFK A;  4GQC A;  1R5P A;  2ZCT A;  4Z2U A;  3C7M A;  4IQ1 A;  5DCH A;  3TKS E;  4KA0 A;  1AQW A;  1OVN A;  3ZRD A;  3GNJ A;  3TDG A;  1QMV A;  3KZQ A;  3MSZ A;  2NBS A;  1PKW A;  2QA1 A;  1ON4 A;  3FZA A;  3TJG A;  1YEP A;  5DCG A;  2VCW A;  3WGX A;  4MF5 A;  4RQR A;  5ECQ B;  1GLP A;  3FR3 A;  5AGY A;  1FVJ A;  3ZVJ A;  2IFQ A;  3ERG A;  3FR9 A;  3HZ4 A;  1V98 A;  5CP1 A;  2GT6 A;  2R4V A;  5ECM B;  1KBN A;  4ISD A;  1RW1 A;  2MBT A;  5F06 A;  5AN1 A;  1HQO A;  3Q6O A;  1OKD A;  3APO A;  2H70 A;  1V40 A;  4BL7 B;  1JLV A;  4HJ2 A;  2B1K A;  1HD2 A;  4K5S A;  2FY6 A;  2I81 A;  2IMD A;  1YJ6 A;  3TKP A;  3HCZ A;  4I8B A;  4V2M A;  3F8U A;  2IIY A;  3DYR A;  4RI6 A;  5IMD A;  1VF2 A;  1GSD A;  4BPY A;  2CZ3 A;  4NHZ A;  3KCM A;  1RQM A;  3F9U A;  1FOV A;  3J7Y b;  3TKS A;  2FA8 A;  4TR3 A;  4N0V A;  4EUY A;  1TRS A;  1TU7 A;  4G2E A;  2PU9 C;  2OAD A;  3HHV A;  1SK1 A;  4FIW A;  2WFC A;  2YWM A;  3VK9 A;  1GTA A;  3TKQ A;  4FQU A;  1XWB A;  1AQX A;  1AXD A;  2JAD A;  2OA7 A;  4TR4 A;  3F3R A;  3ZVJ D;  2Z9S A;  4NAX A;  2N5A A;  3KP9 A;  6GSU A;  1O73 A;  5ECI B;  1AQV A;  5AIS A;  5CRG A;  3TUE A;  4DSS B;  5COH A;  5C04 A;  1HYU A;  5KN3 A;  1A8Y A;  5B6N A;  3GX0 A;  3FZ4 A;  3E3E A;  4IGJ A;  2RUF A;  3GTU B;  4JU5 A;  2A2R A;  3TRQ A;  2RM5 A;  1XFL A;  1EV4 A;  1U3I A;  1A2L A;  3W8J A;  4ZBD A;  4XRD A;  3C1S A;  2C3Q A;  2KOK A;  4V2L A;  4KW6 A;  3FY7 A;  2HZE A;  4JZQ A;  2M72 A;  2HFD A;  3D4T A;  1GSY A;  2MMZ A;  3WT1 A;  4KX4 A;  1UN2 A;  3VWV A;  2X49 A;  4K8M A;  5KN0 A;  2CX3 A;  3UAP A;  3US3 A;  5J41 A;  3UBK A;  1EGR A;  1UA5 A;  2H01 A;  2QC7 A;  1S3C A;  4GLT A;  4MDC A;  4V1A g;  4OO4 A;  4WF5 A;  1B4Q A;  5IPG A;  1SD9 A;  1WRY A;  4N11 A;  5AIV A;  4IP1 A;  3S9F A;  4K2X A;  2R37 A;  2YNX A;  3GA4 A;  3FK8 A;  2XPD A;  2C0D A;  2DIY A;  1ZYQ B;  1G7E A;  4PQI A;  1EZK A;  16GS A;  5J9B A;  1THX A;  3RDW A;  1SJI A;  3G9B A;  5LNK e;  4WR4 A;  3D21 A;  3QDN A;  5DJL A;  1XCC A;  1XXU A;  2HRA A;  1JZO A;  1K0C A;  2WRT A;  1TI1 A;  2GLR A;  3KGK A;  3QFB C;  1U6T A;  2I1U A;  3CBU A;  2A4V A;  4Z2T A;  1OC9 B;  2LRN A;  2L6C A;  1SU9 A;  1M0U A;  4EE0 A;  3HD5 A;  1PA3 A;  4P3Y B;  5G5F A;  5CRW A;  2NPB A;  3M9K A;  4X0X A;  5DVB A;  3ERW A;  3RHC A;  4MJA A;  1T7P B;  4FYC A;  4E8H A;  2VCV A;  3GL3 A;  5DJM A;  1GSS A;  4BWQ A;  4EDZ A;  2GQL A;  2GDR A;  4TXO A;  2B6M A;  2GZZ A;  1F2E A;  1GTU A;  5C00 A;  2VCZ A;  3FHK A;  3M0F A;  4KSO A;  1PKZ A;  2VCQ A;  1EV9 A;  5J3R A;  3VPT A;  1BX9 A;  4PQ1 A;  1H75 A;  1XIY A;  4AJ8 A;  4K7N A;  4TOP A;  5CRD A;  2OE3 A;  3MWH A;  3L4N A;  4POL A;  1GH2 A;  1TXX A;  2YWO A;  3KH9 A;  1J9B A;  4HUA A;  1X9S B;  4ICY A;  1SJZ A;  1GNE A;  4ZIL A;  5DAK B;  4I5Q A;  5KOW A;  3LEF A;  3CSH A;  2IY2 A;  4HU9 A;  4AGS A;  5LD0 A;  3IE3 A;  2MBS A;  2VLU A;  4ECC A;  2V2G A;  2VM1 A;  4PQH A;  4K2D A;  5F0G A;  4KND A;  1TOF A;  2HSH A;  4L5L A;  4F9Z A;  5ECK B;  2DML A;  2O7K A;  5IQY A;  3H1N A;  4MP4 A;  1V9W A;  5ENU A;  1K0D A;  1S3D A;  1TRW A;  1LJR A;  3PPU A;  1F3B A;  2OJL A;  1Q98 A;  1ERT A;  3IPZ A;  1WPI A;  3APS A;  2HT9 A;  1A8L A;  3MYD A;  3MIX A;  3G7I A;  3HJM A;  1FOH A;  2RLI A;  1OC8 A;  2LS5 A;  4IEL A;  3C8E A;  1AAZ A;  4MF6 A;  1MEK A;  1XOA A;  2H0I A;  3F6D A;  4ZL8 A;  3HVX A;  3A2X A;  2YWN A;  4FYU A;  2B5X A;  4OFN A;  1OKT A;  2BTO T;  3QR6 A;  4MAB A;  4N30 A;  4MPF A;  5ID2 A;  3KM6 A;  3DWV A;  4EC0 A;  4EF0 A;  1M7T A;  2L6D A;  1Q4J A;  2B5E A;  2GSR A;  3SBC A;  2IFQ B;  2CQ9 A;  1AC1 A;  2MYG A;  4MA9 A;  1MD4 A;  2XBQ A;  5CRE A;  2QA2 A;  2XC2 A;  1I5G A;  1K3L A;  1Y6E A;  5G31 A;  4OCE A;  4KSM A;  3WGD A;  3CMI A;  3M1G A;  4XIH A;  2C0G A;  2R2J A;  3UOM A;  4WF4 A;  1QQ2 A;  2R3X A;  1SYX A;  4WKW A;  2KUC A;  1OC9 A;  4IJ3 A;  4LL1 B;  4D73 A;  4WEY A;  4BA7 A;  3AY8 A;  1K3Y A;  3M8N A;  2M46 A;  2H74 A;  4YQM A;  2R0P A;  2NVL A;  4LA1 A;  4USS A;  2V1M A;  2GT5 A;  2JZS A;  1GUK A;  5ECH B;  1ERU A;  3KXO A;  4XS1 A;  2OKA A;  1TK8 B;  1YF0 A;  5F05 A;  1M9B A;  1SKW B;  3F3Q A;  2RM6 A;  2V6K A;  5G30 A;  4K6X A;  4ZXG A;  4KCE A;  2VUP A;  4XS6 A;  2ES7 A;  4MZB A;  4X4J A;  3IHG A;  3QD9 A;  2B1L A;  1PN9 A;  1OAZ A;  2D2Z A;  3DEX A;  1XVW A;  3IAM 2;  2DBC A;  1WMJ A;  2G0F A;  2YV7 A;  2IN3 A;  4PGT A;  1Z9H A;  4NPB A;  1NM3 A;  4HI7 A;  4IP6 A;  19GS A;  4ML6 A;  3D4M A;  1VF1 A;  4ID0 A;  4YAV A;  3ED3 A;  1PSQ A;  5INY A;  1A0R P;  2JAC A;  1T8E B;  4XRA A;  3PGT A;  2X64 A;  2H1A A;  3ZFB A;  1E6B A;  4KDU A;  1QFN A;  2F8A A;  3ZIT A;  1A24 A;  3D22 A;  2WZ9 A;  3FZ5 A;  3FR6 A;  3ZIV A;  3MAK A;  1O7U A;  1PQN A;  3EE2 A;  1GRX A;  5IOW A;  2IMF A;  1UVZ A;  2LEG A;  4TN8 A;  3QFA C;  5A5K A;  1R26 A;  4MZW A;  4X1U A;  1QUW A;  3FW2 A;  4K0N A;  2IL3 A;  17GS A;  4ILF A;  3IR4 A;  2JZT A;  3BCK A;  2HZE B;  2VD1 A;  4QQ7 A;  2ZNM A;  3P7X A;  1Z6M A;  3M9J A;  1SEN A;  5D73 A;  2X8G A;  3LXT A;  3IDV A;  4AF2 A;  3GMF A;  4TRX A;  4IVF A;  2GQK A;  2KLX A;  1NW2 A;  4TVE A;  1TTZ A;  3W8S A;  3WD6 A;  2L59 A;  3FEU A;  4BVX A;  1ML6 A;  3F4S A;  5E4W A;  2C0F A;  1Z6N A;  2VCX A;  1JZR A;  3O76 A;  2LNS A;  2WCI A;  4G0I A;  4G10 A;  3I69 A;  4ZL9 A;  11GS A;  4HQZ A;  14GS A;  1AIU A;  5D8I A;  1WWJ A;  4PUF C;  1E2Y A;  5IPH A;  3KMN A;  5HR2 A;  4EO3 A;  2IME A;  1ZYN A;  3GL5 A;  4LLR A;  5GZZ B;  1XW6 A;  3UL3 A;  4DEJ A;  1CQG A;  3F6F A;  1O8X A;  4WR5 A;  1NHY A;  1ERV A;  4ZB6 A;  1XZO A;  2RUE A;  3GKX A;  3M3M A;  3ISO A;  3UAR A;  3GSS A;  4JR6 A;  2N5F A;  1Z7P A;  3GST A;  4IBP A;  1JZW A;  4PXO A;  3KJY A;  3TGZ A;  1JLW A;  3GN3 A;  2MZC A;  4MCU A;  4MK3 A;  5H5R A;  5GSS A;  1KTE A;  1K3O A;  1EEM A;  3VLN A;  4CY6 A;  2L5L A;  2B3S A;  5ECO B;  5B8B A;  2LJK A;  5EY6 A;  1ZGN A;  3LXZ A;  18GS A;  4TXO B;  4OFM A;  4GST A;  3UBL A;  1T1V A;  2QGV A;  4FO5 A;  2YZU A;  1Z7R A;  2VL9 A;  1HNB A;  4F82 A;  1HNC A;  3TB2 A;  1TRV A;  2I3Y A;  3QAV A;  4WBJ A;  5HQP A;  1JFU A;  2HE3 A;  3W6G A;  3I6A A;  4OO5 A;  4O7H A;  4F2I A;  3ZRE A;  4I2T A;  2VO4 A;  4NMU A;  4KDY A;  3CTG A;  2CT6 A;  3FRC A;  5IMA A;  1X9W B;  2HNL A;  5AIX A;  2VL2 C;  3EVI A;  4HEA 2;  2H8L A;  4XHM A;  1TK5 B;  1GUL A;  3DVW A;  1TK0 B;  3Q19 A;  1X0R A;  2C4J A;  3ZML A;  1X5D A;  2K18 A;  3CSI A;  3L9V A;  2LNT A;  2GTU A;  4TW5 A;  3U5R E;  3APQ A;  3GUS A;  2X99 A;  3O3T A;  2DSA A;  3IAS 2;  5KN1 A;  1SL0 B;  4ULX A;  4G0K A;  2MMO A;  2N5B A;  5JWR B;  2AYT A;  2DKH A;  3IV4 A;  4PUA A;  2HSM A;  2I4A A;  4N10 A;  3IXR A;  2A2S A;  5FHI A;  2HXK A;  1WE0 A;  3IK9 A;  2NDO A;  2X8H A;  4OCF A;  3VWX A;  1PMT A;  4X43 A;  2DJJ A;  1QGV A;  1ZZY A;  1U87 A;  4KB3 A;  2CVK A;  5ID2 B;  1A0F A;  3C71 A;  3BOA A;  20GS A;  3OR5 A;  1XW5 A;  1SL1 B;  1TKD B;  2V32 A;  2WB9 A;  3HKR A;  1XWG A;  1BJX A;  2OBK A;  5GAN D;  3ME8 A;  2AB6 A;  1SD8 A;  1S3A A;  3WGE A;  4YQV A;  3TJF A;  5IO0 A;  4NV2 A;  5D93 A;  2KP2 A;  4IW9 A;  2JL4 A;  4OD7 A;  1BED A;  2LV3 A;  4K5R A;  3EMP A;  5JCU A;  2LUS A;  3ZFL A;  3VI7 A;  4D73 B;  2PER A;  2FNO A;  4TXV A;  4EKZ A;  4V2N A;  1URM A;  1EOH A;  4HDE A;  5F07 A;  3EMX A;  2H1G A;  5GAP D;  3N5O A;  4CY8 A;  3RBT A;  4PX1 A;  4MJE A;  2FUG 2;  3LW9 A;  2GQM A;  5DBQ A;  2NTO A;  2R6K A;  3TKR A;  4ML1 A;  1GUM A;  1XWA A;  4H86 A;  1A2J A;  4KUN A;  4F0B A;  1O6J A;  1MDI A;  2YCD A;  3VUR A;  4DSQ A;  1OE7 A;  2H19 A;  2IMK A;  4Q5N A;  4XTS A;  1VRS D;  4EXJ A;  4JR4 A;  2DJ0 A;  4MJC A;  1YZX A;  2PN8 A;  3CYN A;  4HQS A;  4GTU A;  4TKY A;  2XHF A;  1FHE A;  4OMV A;  2LQQ A;  4GCI A;  4JED A;  2HSY A;  2WUL A;  3L9S A;  3NIV A;  3F4T A;  4I2U A;  4LMV A;  1USB A;  3TOT A;  2YJH A;  3VPQ A;  5CO3 A;  4YKG A;  5A4W A;  1NSW A;  4Q5Q A;  3DKS A;  3IHQ A;  1SK0 A;  3NOF A;  4ECJ A;  4L5O A;  1FVK A;  4V1A p;  5D9V A;  2LJA A;  3IOS A;  5IO2 A;  5KEJ A;  3UEM A;  4O5R A;  1X5C A;  3KH7 A;  4NV5 A;  1YKC A;  3O6T A;  3ME7 A;  2H30 A;  1M9A A;  1PRX A;  1TRU A;  1SL2 B;  3KEB A;  2WJU A;  4EDY A;  3LGC A;  4HU7 A;  3QOU A;  1G0T A;  3Q74 A;  1T00 A;  1U88 A;  3I9V 2;  1M2D A;  5G2Z A;  2H66 A;  2H75 A;  1K0M A;  4K0G A;  5FT3 A;  3IRA A;  1TI3 A;  1YEX A;  4MJB A;  2K8S A;  1JHB A;  2GVP A;  1Z3E A;  2QKE A;  3U6V A;  4WET A;  1FB0 A;  2DC5 A;  4XS4 A;  4NWY A;  3C1R A;  5J4U A;  2C3N A;  5B7C A;  5DDL A;  2K9F A;  3DRN A;  3FZ9 A;  5G1K A;  4AJ6 A;  1K0A A;  2LQO A;  2H6Z A;  1FW1 A;  4BVX B;  5EPF A;  1G6Y A;  4GWR A;  2MMN A;  1XWK A;  2VL2 A;  2OE1 A;  3GFK A;  3LWA A;  1GSF A;  2FWE A;  4DVC A;  3P2A A;  3HVV A;  3GIX A;  1KEB A;  2VOC A;  4POM A;  4ZBB A;  1GTI A;  2GSQ A;  3CRU A;  5DAL A;  3E0U A;  4MZC A;  5F8B A;  2YWI A;  2PVO C;  4GSS A;  1VGL A;  1MD3 A;  2IMI A;  1V2A A;  1J0F A;  3GHA A;  3GYK A;  2K6V A;  1BQ7 A;  1FO5 A;  4L0W A;  1ZL9 A;  2WS2 A;  1YKA A;  2L4Q A;  4MF7 A;  4OFT A;  4L8E A;  2GST A;  2P0G A;  2WGR A;  5B8A A;  1B4P A;  4ZB9 A;  2ON5 A;  3LYK A;  3P8W A;  5HR0 A;  1M99 A;  2HRF A;  6GSS A;  2R0C A;  2JSY A;  2HLS A;  2H1D A;  4A5P A;  5EL8 A;  1N8J A;  1I9D A;  2LTK A;  4MH3 A;  5HFG A;  5J9C A;  3Q18 A;  4TR1 A;  5ECP B;  1T4Y A;  1YQ1 A;  1ZOF A;  5BRT A;  5H5S A;  5A4U A;  2B5Y A;  3HZ8 A;  2FWH A;  5G5E A;  2YOI A;  1O85 A;  1THO A;  1TDI A;  1O81 A;  1DBY A;  4YAP A;  3L78 A;  3CRT A;  1ABA A;  4ACS A;  1W89 A;  2IYJ A;  5D9X A;  3HDC A;  1MDK A;  3EIN A;  2BMX A;  1YDK A;  3HJP A;  2FWF A;  2YPM A;  4IHU A;  1DE2 A;  1OYJ A;  3NZN A;  2DJ2 A;  4Q5R A;  4N0Z A;  2HZF A;  1TJD A;  1OE8 A;  1UC7 A;  4KF9 A;  2FLS A;  2TRX A;  1R7H A;  4WBR D;  5IM9 A;  5IMF A;  6GSY A;  1QXH A;  3UMA A;  2PPT A;  3FKF A;  4LL4 B;  4DSR A;  5JWO B;  5HFI A;  1B48 A;  3QAG A;  1RK4 A;  5HR1 A;  4ZBA A;  1XWC A;  2E0Q A;  3PR8 A;  3GUR A;  2E2G A;  2E2M A;  1XBS A;  2X4A A;  3HA9 A;  2I9H A;  1O8W A;  1VF4 A;  2O85 A;  1YF1 A;  3ZL5 A;  1ZYE A;  1Y25 A;  2IWT A;  3QPM A;  3EU3 A;  6GSW A;  3A5I A;  2L5O A;  1IYI A;  4IKH A;  3HJO A;  3I43 A;  1PD2 1;  4RUV A;  3D0Z A;  2O89 A;  2VCT A;  5GST A;  1ZCP A;  2R5G A;  3CSJ A;  3HXS A;  4RI7 A;  4BVY A;  2P5Q A;  3EPT A;  3FYG A;  3IC8 A;  2ALB A;  4O32 A;  4ECI A;  3E9J B;  3EC3 A;  1F6M C;  1MTC A;  1OC3 A;  1XVQ A;  4NHW A;  3VWU A;  5ECS A;  1B8X A;  5BMU A;  2O87 A;  1AW9 A;  4YQU A;  1QK8 A;  4HZ4 A;  4KCA A;  3EWL A;  1GP1 A;  2H6X A;  3G7J A;  4G19 A;  4HJM A;  1JZD A;  5LCZ A;  4F03 A;  3D5J A;  3F63 A;  3LJR A;  1V58 A;  2JZR A;  1VF3 A;  1A2M A;  3DVX A;  4QL9 A;  1GSU A;  3F4R A;  1LBK A;  2DMM A;  1HNA A;  2GSS A;  2V6O A;  1X5E A;  2P31 A;  3PIN A;  5B6M A;  2H73 A;  2YP6 A;  4HS1 A;  2GS3 A;  2H0H A;  1TW9 A;  4WXT A;  9GSS A;  1XOB A;  4POB A;  2F51 A;  22GS A;  4PUR A;  2F9S A;  4O5Q A;  1MDJ A;  1GWC A;  2TIR A;  5D9T A;  1B9Y C;  5E59 A;  4PNG A;  3DML A;  4J56 E;  3ZTL A;  4GQF A;  5IMC A;  1B9X C;  2CA8 A;  4FYB A;  5ECN B;  1GSE A;  3N9J A;  2VD0 A;  2PWJ A;  2LJR A;  5A4V A;  1T4Z A;  2AV4 A;  4JRR A;  4KAE A;  3UJ1 A;  1BYE A;  2MMA A;  3SWL A;  2L57 A;  3ZYW A;  1ACV A;  3TRX A;  1PX6 A;  1M2B A;  4EL1 A;  2F8F A;  3ZLP A;  2FWG A;  3MNG A;  4KDX A;  3KTB A;  3ERF A;  3FMW A;  3P90 A;  3D6I A;  2VM2 A;  3EUR A;  4KE3 A;  4CDO A;  4KH7 A;  2YV9 A;  4G0L A;  2E7P A;  4CW9 A;  3F0I A;  3LQ7 A;  3CTF A;  5ELG A;  4CHS A;  3H93 A;  2A2P A;  2FGX A;  2WDU A;  2AUV A;  4YKF A;  1K0O A;  2CZ2 A;  1ST9 A;  1PL1 A;  3RPN A;  1R4W A;  2PGT A;  4FH8 A;  1M2A A;  4IN0 A;  1LU4 A;  4HZ2 A;  5ECR B;  3JCM L;  2ZUP A;  3LSZ A;  4MMM A;  5CRH A;  2BJX A;  1G7O A;  4YH2 A;  4ECB A;  4GSN A;  1GLQ A;  1SK2 A;  4IS0 A;  4XS4 B;  1GTB A;  4J57 E;  2REM A;  1C72 A;  1AUC A;  3EU4 A;  3QMX A;  2VLT A;  3C73 A;  5CNW A;  3LOR A;  4JE1 A;  1V57 A;  3IC4 A;  5IMZ A;  4I6X A;  4K7O A;  3L0H A;  2QSI A;  2HRN A;  3BJ5 A;  3DXB A;  3TOU A;  2C0E A;  1GSQ A;  1FAA A;  3WYW A;  2GGT A;  2EIR A;  5DAL B;  3MDK A;  6GSX A;  2C8U A;  5IMV A;  3BCI A;  1DE1 A;  4MH2 A;  3RHB A;  1IYH A;  1F9M A;  2H71 A;  3J7Y k;  4I97 A;  4BL7 A;  2VAF A;  3GH9 A;  1WP0 A;  2J9H A;  3A5W A;  2RII A;  2G2Q A;  2JSZ A;  1X9M B;  2GZY A;  3ZIJ A;  6GSV A;  2C3T A;  1PX7 A;  2DJK A;  3VFI A;  1XPV A;  4PNF A;  4RQX A;  1ZMA A;  5IIZ A;  5ABR A;  5D9W A;  2YJ7 A;  4TR1 B;  5EVO A;  2YZH A;  3BBY A;  5KN2 A;  3LFL A;  2FA4 A;  5ECL B;  1BG5 A;  4XCS A;  1CQH A;  2O8V B;  1Z5Y E;  1WJK A;  1N2A A;  2LRT A;  4L0U A;  4ZL7 A;  2DJ3 A;  2FHE A;  3UVT A;  3GH6 A;  3A3T A;  2CAI A;  5KOX A;  1PN0 A;  4O5U A;  3KD0 A;  4ZB8 A;  3QAW A;  2AAW A;  4Z2R A;  1G6W A;  4F0C A;  2EC4 A;  4AJ7 A;  1EEJ A;  4Z7X A;  4DSS A;  1FG4 A;  3ZZX A;  3DIE A;  5JCG A;  2CV4 A;  13GS A;  3RPP A;  2V41 A;  4BWS A;  1A23 A;  4E8E A;  3GTU A;  1TU8 A;  2KP1 A;  2A4H A;  3A2V A;  4EIP A;  4MLY A;  3V1W A;  2PBJ A;  2CAQ A;  2PVQ A;  7GSS A;  1FB6 A;  1K0B A;  2IJY A;  2H72 A;  2F3M A;  5IOX A;  2PUK C;  4K7I A;  1WIK A;  3GV1 A;  2EIQ A;  1R5A A;  4TR0 A;  4ZIJ A;  3KP8 A;  4LMW A;  3GX8 A;  2LKU A;  1SYR A;  4POK A;  2B7K A;  1TP9 A;  2HYX A;  5G1L A;  5L71 A;  3UVH A;  4Q5F A;  3L9U A;  2PMT A;  3HVS A;  5H5Q A;  3CXG A;  3ZMK A;  2OE0 A;  1SKR B;  3EYT A;  4IJI A;  4J2F A;  2VL3 A;  2LST A;  5FWG A;  1ERW A;  1XW9 A;  3VWW A;  2H76 A;  4K1F A;  2HI7 A;  3R2Q A;  4EVM A;  3H4K A;  4GF0 A;  3IK7 A;  1K0N A;  3K8N A;  4G9H A;  4BVY B;  2FCH A;  2C80 A;  3IA1 A;  3TJB A;  4EIQ A;  5JCW A;  3TRP A;  3DD3 A;  1SJ6 A;  2IPA A;  2H6Y A;  3KIJ A;  3A2W A;  2P5R A;  1EP7 A;  1DUG A;  4O92 A;  1H4O A;  5CAX A;  1PL2 A;  8GSS A;  4GXZ A;  3TKS C;  2J23 A;  1EOG A;  1BAY A;  4NXI A;  2JU5 A;  1ILO A;  5D96 A;  4OWY A;  2DIZ A;  2XBI A;  5J5N A;  2DKI A;  2TRC P;  2OAC A;  2H0G A;  1SKS B;  2YAN A;  5CYY A;  1ZYP A;  2AJQ B;  3VI5 A;  2L4C A;  4IQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...