5G1KA

A triple mutant of dsbg engineered for denitrosylation
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
228
structure length
228
Chain Sequence
LPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCGPCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVMPAIYYMSKENTLQQAVGLPDQKTLNIIMGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOL DISULFIDE INTERCHANGE PROTEIN DSBG
publication title Sulfur Denitrosylation by an Engineered Trx-Like Dsbg Enzyme Identifies Nucleophilic Cysteine Hydrogen Bonds as Key Functional Determinant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 67
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13098 Thioredoxin_2 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.70 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Disulphide bond isomerase, DsbC/G, N-terminal 5g1kA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5g1kA02
2I3YA 1BG5A 4I2TA 2R3XA 4MP4A 3IC4A 1S3CA 3HXSA 4D73A 1VGLA 3GH6A 1YF1A 3O6TA 3ZIJA 2L6DA 2AV4A 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 5F0GA 2KHPA 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 2HZEB 3EMXA 1T3BA 1T4ZA 1ACVA 6GSWA 3FZ9A 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1B9XC 3O3TA 5IO2A 1PN9A 4LL1B 2FNOA 3GL5A 5G5EA 2L5LA 1G6WA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 4POMA 4QQ7A 3DKSA 4WETA 2A4VA 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 2VAFA 1WOUA 3CXGA 2PU9C 3BD2A 4JR6A 2H1AA 4KAEA 4PNGA 4YH2A 2C3QA 1FAAA 1G7OA 5GAND 3H8QA 3IAM2 2OE0A 4EUYA 2O85A 3QMXA 2DLXA 1MDKA 2OJLA 4POBA 1FVJA 1VF2A 1YY7A 4TN8A 2IFQA 4JEDA 3QAVA 4HS1A 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 4J56E 1HYUA 5KN0A 19GSA 3BCKA 3L0HA 3WGXA 2H75A 4N10A 1BAYA 4FYUA 5COHA 1SL2B 4GQFA 1XWGA 1N8JA 3P90A 3I69A 5D9WA 1TP9A 5KN2A 1VRSD 4QL9A 3GHAA 2QKEA 5ABRA 1M9AA 3MNGA 3ME7A 2LRTA 3DVWA 4ZXGA 4EC0A 1GSUA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 1ON4A 2CQ9A 3ZL5A 4F2IA 4IQAA 4EF0A 4ZB6A 4G9HA 3UL3A 1X5CA 3L9SA 4V2MA 1EGRA 2G0FA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 1IYIA 3UVHA 6GSVA 2LNTA 10GSA 2FGXA 4MF5A 20GSA 1GTAA 3TJGA 4XS1A 2GZZA 4MDCA 3EYTA 5G31A 2FUG2 5A4UA 3D0ZA 1PA3A 3PINA 3UBKA 3I43A 4EDZA 1M7TA 4F0CA 3KTBA 4GTUA 4IELA 2F9SA 2DMLA 5CRHA 4PUAA 4NAXA 1G7EA 2IPAA 3VI5A 1U88A 1GTIA 1XBSA 5H5SA 2F51A 2ALBA 2VL3A 1OC9A 1AW9A 2C0GA 3VWXA 3L4NA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 3LJRA 5DAKB 3HKRA 1F6MC 2CAIA 5GSTA 1YEXA 2PERA 3LXZA 2M46A 4DSSB 3ISOA 3HY2A 2LQQA 4FYBA 2AJQB 2HLSA 1MD4A 3I9V2 3VWVA 4GXZA 4O32A 2V32A 1MD3A 2IMDA 1YQ1A 2NDOA 2OADA 4MZCA 3M9KA 2OBIA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 3ZIVA 5E4WA 1R26A 3TJJA 1XW5A 1XXUA 2VCXA 2XBQA 2PN8A 1C72A 2J23A 3IXRA 1KBNA 2TRCP 4XS4B 1M2BA 3KD0A 1SKRB 3APOA 2PPTA 4G19A 4OWYA 4WEYA 2YV7A 3DIEA 3EC3A 4IW9A 3DVXA 5IPHA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 1F3AA 3G7JA 5H5QA 2IL3A 5A4WA 1XWKA 5CRDA 1HNAA 1YEPA 4MH3A 4HDEA 2FA4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3F9UA 3G7YA 4TXOB 5HR3A 1O81A 2VL9A 3IPZA 2YWOA 2CAQA 3DMLA 2VO4A 2VIMA 1O85A 2CZ2A 1B8XA 5CAXA 5KN1A 3F4TA 1XZOA 2X99A 1GLQA 2VCVA 4NMUA 3WYWA 4LMWA 5IMDA 2P31A 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 4GWRA 4N30A 2K18A 1BX9A 1FHEA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 5LNKe 2XC2A 5IO0A 1WJKA 1KTEA 1GH2A 1SK2A 4OCFA 1O8WA 2H30A 4BA7A 1A8LA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 5B6NA 5G1KA 1TU7A 2QSIA 3MAKA 5HFIA 4PNFA 4HJMA 1H75A 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 2YPMA 1YZXA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 2C1YA 3DEXA 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 2EC4A 1O73A 4ACSA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 1XVWA 1KEBA 1O6JA 5FT3A 5AISA 5DJMA 1SK1A 1BYEA 4PUFC 5FWGA 5CP1A 1S3DA 5F8BA 5EY6A 1Q4JA 2MMOA 1XFLA 1V98A 1K0DA 4DVCA 2L59A 5G30A 2H1GA 3HVXA 1QMVA 3IK9A 3SWLA 3D5JA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 2EIRA 3RAZA 1GSEA 4GRFA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1GTBA 5L71A 1XIYA 2IY2A 4H86A 4V2NA 1A2JA 3UMAA 3TOUA 5JWQB 1ERWA 4ML1A 8GSSA 3ZTLA 1SK0A 3WD6A 4XIHA 1A8YA 2IMEA 2VCTA 1Z6NA 2VD0A 2WRTA 2MZCA 1WRYA 2HFDA 3LEFA 3GKXA 3Q74A 3UOMA 1T4YA 3PR8A 3ZZXA 5ECQB 3F3QA 3S9FA 1V9WA 2JZRA 4GSTA 5HFGA 3FYGA 5AN1A 2HXKA 2B5EA 2WB9A 4EXJA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 2F8FA 1EP7A 3APSA 3ED3A 2CX3A 12GSA 4WBRD 1ZCPA 3KZQA 3VWWA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 5CYYA 22GSA 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 2EIOA 4L5OA 4GSNA 5F05A 1O8XA 2BJXA 2H66A 5LD0A 5DBQA 1UVZA 1HNCA 1FB6A 1Z7PA 5KN3A 3DWVA 4I2UA 4KE3A 4K0GA 1Z7RA 3J7Yk 5C00A 4IN0A 4X0XA 2C4JA 2V2GA 1M99A 2B5YA 3QPMA 5E59A 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 4KUNA 1X9WB 3WGDA 1RK4A 1SJ6A 3A2WA 1TKDB 2E2MA 4KGIA 4JR4A 1LJRA 2OE1A 2CVBA 3L9UA 4ZL8A 1AQWA 1GLPA 3GH9A 2HZEA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 4OFNA 1GNEA 1YF0A 3EVIA 4ZB9A 1XWBA 2TRXA 4TR3A 3F6DA 5DALB 5D9XA 1T8EB 3TDGA 5HR2A 2L4CA 3SBCA 2H70A 2GSRA 4YAPA 11GSA 4ECCA 2IWTA 4JBBA 4GF0A 4DEJA 2VUPA 4POKA 3M0FA 3RHBA 1O7UA 1AIUA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 3EE2A 5J5NA 1ZL9A 1WIKA 2L5OA 2CX4A 4TR1B 2X8CA 1YDKA 3NZNA 4P3YB 2REMA 1QQ2A 2NBSA 4F03A 3HJOA 4TKYA 4MCUA 4IGJA 4X43A 1CQHA 2MBTA 4BL7A 1SKWB 2FWEA 3TKSE 2WS2A 2VM1A 4FIWA 1M9BA 4OD7A 2PVOC 1I5GA 3NIVA 3DRNA 2ON7A 1XCCA 1TOFA 3C8EA 1WWJA 2R37A 14GSA 2OA7A 2KOKA 2GT6A 2I1UA 1THOA 3FZ4A 5G1LA 4KB3A 4RQRA 3N5OA 2WULA 2P5QA 4KA0A 1TI1A 4PURA 1GTUA 2WFCA 5IMCA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 2BTOT 2K8SA 2N5FA 4IP6A 5G2ZA 2WZ9A 4ZBDA 2H8LA 2B7JA 3FR3A 4KDUA 4LLRA 1SD9A 2GZPA 2HRNA 5ECSA 3Q19A 2H6XA 3GX0A 1PX6A 2AYTA 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 2C0EA 2JSYA 3BOAA 1A2LA 2C80A 1MDIA 3LYKA 3ZFBA 1GRXA 2H1DA 1DBYA 4HZ4A 4HI7A 2DIZA 3L78A 4E8HA 1R7HA 5JWRB 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3NOFA 3D4MA 5DVBA 4Q5NA 4K7IA 3QOUA 4KSMA 4PQHA 2XPEA 4YQMA 2YJ7A 2K9FA 2FA8A 3BBYA 3HJMA 17GSA 3AY8A 1Y25A 4I5QA 1WMJA 3KP8A 3DD3A 1SU9A 1PD21 2GTUA 3IA1A 1Z3EA 2JL4A 5ID2B 2B5XA 1K0OA 4MJAA 4YAVA 5GZZB 4MA9A 5DAKA 4JZQA 1Z5YE 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 3TCOA 4MJBA 1K3LA 2JADA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 2WJUA 4ECJA 4XCSA 2DJ1A 4YQUA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 1BEDA 3ZVJA 1ABAA 1VF1A 4EO3A 3LXTA 3HCZA 4K7NA 4MH2A 3W8SA 2IN3A 3ZITA 1R4WA 1E6BA 3V1WA 4XS4A 4O5RA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 1EGOA 4NXIA 1FOVA 1NW2A 3HHVA 2R5GA 2RIIA 4V1Ag 4F9ZA 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 3ZYWA 5FHIA 2GSQA 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 5ECIB 2PGTA 1DE1A 4L8EA 2YZHA 2WCIA 3IDVA 2HSYA 6GSSA 4TXOA 1V40A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 1NHYA 2I9HA 4ZL9A 5IMFA 4Q5FA 4X1UA 5B8AA 1SYXA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 2L4QA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 2LJRA 4TR4A 1PSQA 1EEJA 4E8EA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3KH9A 1M2DA 3VI7A 1PMTA 3TB2A 4BVYA 1GP1A 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 3IR4A 2YP6A 1J9BA 2HNLA 3GIXA 3EWLA 3K8NA 2C0FA 1HQOA 2P5RA 3ERWA 2VLVA 2ES7A 4NPBA 2BMXA 2Z9SA 4KCEA 4RI7A 1THXA 2N5AA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 2NPBA 1TRWA 2YOIA 1A2MA 2DMMA 5A5KA 3TGZA 4ZILA 5EPFA 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3PH9A 4MF7A 1ML6A 2VL2C 4O7HA 2GQLA 6GSYA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 2H73A 1V58A 1A0RP 2VOCA 4RI6A 2FCHA 4PQ1A 1TK5B 2J9HA 3RPNA 3EINA 2NTOA 3MWHA 1TU8A 4OO4A 4AJ6A 3GURA 1AUCA 3A2XA 1T7PB 3E3EA 2HSHA 3F4SA 2IIYA 2O8VB 3M1GA 1GL8A 1J0FA 3KP9A 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 4GSSA 4JU5A 4DSQA 2V41A 4N0ZA 1DUGA 3IBHA 3LWAA 3FK8A 4XHMA 2LV3A 3FR6A 2MYGA 1OC8A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 5G5FA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 2YN1A 2IMFA 1GSQA 1JZRA 2VLTA 1AC1A 3EU4A 3HD5A 2VM2A 1MDJA 1JFUA 5IPGA 5ECMB 4AGSA 2MBSA 5D8IA 2I4AA 3LQ7A 2H71A 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 3CTGA 2HRFA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 1ZGNA 1S3AA 1U87A 3ZMKA 1GNWA 4HQSA 5IOXA 2A2SA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 2O7KA 4HU7A 2ON5A 5IQYA 2GT5A 5HR1A 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 3HA9A 5IM9A 4ZIJA 3FW2A 3ZREA 4I97A 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 3FR9A 3VK9A 3D4TA 2LRCA 3M3MA 3GKMA 3UAPA 4OO5A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3IRAA 1B48A 1ZZYA 2GLRA 4PQIA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 2LEGA 4MK3A 2PMTA 2FWFA 2K8VA 5DQYA 7GSSA 5B7CA 2H74A 3M8NA 1U6TA 3TKQA 1B9YC 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 3C73A 2QGVA 3W6GA 3PGTA 3D6IA 1K3OA 4HZ2A 3UVTA 4I8BA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 4MJCA 4IBPA 1XW6A 4Q5QA 3US3A 2H0HA 2C8UA 4QL7A 5ECNB 3IE3A 5CRGA 1WPIA 1VF3A 1RQMA 2FWGA 3CSHA 5DALA 3GUSA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 3C1RA 5JWOB 1B4PA 3A3TA 3KIJA 2GQMA 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 1E2YA 4OMVA 3RPPA 4XRAA 2AB6A 2JZTA 3I6AA 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 4JE1A 1SD8A 1OE8A 1UN2A 3LSZA 4RQXA 3UBLA 2CVDA 1AQVA 3GRXA 1JZOA 4GQCA 3G7IA 1PQNA 3WT2A 2D2ZA 5H5RA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 2CZ3A 5J9CA 3HDCA 4DSRA 2YNXA 4LMVA 2G2QA 4O92A 16GSA 2YCDA 1FO5A 5DDLA 2RM5A 3VURA 1F9MA 3GFKA 3BCIA 3FEUA 4HUAA 4ISDA 2F8AA 3DGQA 3KM6A 4EVMA 1F3BA 2N5BA 1OKDA 3H4KA 4TRXA 3TKPA 1JZDA 4KW6A 4KDYA 3APQA 5IIZA 1Z6MA 2IMKA 1YJ6A 3GTUB 5ECHB 2RLIA 2CVKA 2H1BA 2MMNA 4WF5A 1JLVA 3CRUA 4ZB8A 3VWUA 4N11A 3GNJA 4GLTA 2FWHA 3KMNA 4MZWA 4ZBAA 2P0GA 2FY6A 3DXBA 5DJLA 1A24A 5GAPD 4MZBA 1V2AA 2VL2A 3KGKA 3FY7A 4ECIA 1K0BA 3GKNA 3KEBA 13GSA 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 4PXOA 1Q98A 4Q5RA 2LKUA 5EVOA 3EMPA 1VF4A 3QDNA 3DYRA 2GS3A 2E2GA 2H19A 9GSSA 3HVSA 1CQGA 3TOTA 5J3RA 3WGEA 1EOHA 1EOGA 2ZCTA 5EL8A 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 2KLXA 4TR0A 2LJAA 3KMOA 3KCMA 2YV9A 3GSTA 3W8JA 3KJYA 2X64A 4MABA 3FZ5A 1A0FA 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 5ID2A 4XTSA 1SL1B 3P2AA 2ZUPA 5CREA 1PKWA 1URMA 2VCQA 3RHCA 1JZWA 1BQ7A 1J08A 1MTCA 4G10A 1K0MA 3FRCA 4MPGA 5DQSA 1GUHA 4CHSA 2IYJA 1EV4A 2E7PA 3MSZA 3L9VA 4IJIA 1NM3A 2HZFA 1TRVA 5ELGA 3H93A 1R5AA 4J2FA 1ZMAA 3TKSC 5AIXA 2OE3A 3Q18A 3TJFA 3JCML 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1GSSA 3E9JB 5ECKB 2HE3A 5J41A 1EEMA 5GSSA 1U3IA 3GN3A 2VD1A 1FG4A 2PWJA 2DJJA 4IS0A 1NHOA 1ZYEA 1K0AA 1QFNA 3WT1A 2GSTA 5HR0A 1WE0A 2YWIA 4NWYA 2KP2A 1XOBA 5JCUA 1GULA
chains in the Genus database with same CATH superfamily
1ZS7A 1OPYA 2I3YA 3HZPA 1BG5A 4I2TA 2R3XA 4MP4A 3JUOA 1WNHA 3QK9A 2CG1A 4L8PA 1VQK3 3IC4A 1S3CA 3HXSA 4L7KA 4D73A 4HM4B 4CJNA 1VGLA 3NV0A 1NB5I 3GH6A 2P05A 2GEXA 2MC8A 1YF1A 3O6TA 3ZIJA 4EV2A 2L6DA 2AV4A 2WGOA 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 1E3VA 1RGHA 5F0GA 2KHPA 2C11A 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 3PYJA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 4OK0A 3CXC2 1N5PA 3CPOA 2HZEB 3EMXA 1FZUA 1T3BA 1QAKA 1T4ZA 1QALA 2B1XB 1EQKA 1ACVA 6GSWA 3FZ9A 3PCRA 3CCE3 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 3F7XA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1W6GA 3EBTA 1B9XC 3O3TA 5IO2A 1PN9A 3LTAA 4LL1B 2FNOA 3OV4A 3GL5A 1N9EA 1A2KA 1B2XA 4KFDA 5G5EA 4FR9A 2BHMA 1G6WA 2L5LA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 1LOWA 4POMA 3DKSA 4QQ7A 4WETA 4FCJA 2A4VA 3ER7A 3MYDA 2BMQB 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 1VQQA 2VAFA 1WOUA 4R9LA 3CXGA 2PU9C 3BD2A 4JR6A 1U5OA 4IT7A 3IC8A 1RLSA 1PU4A 1QVF2 1Z1SA 2H1AA 3Q3FA 3T8NA 4KAEA 4PNGA 4YH2A 2WO0A 1M904 1UUWB 2C3QA 1GYBA 1FAAA 3E99A 1G7OA 4HYZA 5GAND 3H8QA 3IAM2 1QVG2 1UCIA 1YVSA 2OE0A 3CU3A 4LMIA 3B4PA 3GRDA 4EUYA 2O85A 2DKIA 3V99A 3QMXA 2SARA 2DLXA 4BL7B 2Z76A 3FKAA 2XR8B 1MDKA 2OJLA 4POBA 2YFIB 1FVJA 2OQEA 1VF2A 1YY7A 4TN8A 1SQWA 1BRKA 2CC3A 2IFQA 2XFSA 4JEDA 3QAVA 3MYTA 4HM5B 3EN1B 1SIIA 4NREA 1TRPA 4WHAA 4HS1A 1AY7A 1JBRA 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 3FLJA 4J56E 1RN4A 1HYUA 1LQGC 3D5GA 5KN0A 1AR0A 19GSA 3H3HA 3BCKA 3L0HA 3WGXA 3GZBA 2H75A 1BAYA 4N10A 4FYUA 1A2VA 5COHA 1ZYPA 1SL2B 2F99A 4GQFA 1ZO2A 1YJN3 5I97A 2MF7A 3OXAA 1TTOA 3MWZA 1XWGA 2L4VA 1N8JA 2W04A 4CY6A 5EEOA 2IMJA 3P90A 3I69A 5D9WA 1IVXA 1TP9A 3BNEA 4O5QA 5KN2A 1VRSD 4QL9A 4CPKA 3GHAA 5KP1A 3G0KA 2QKEA 5ABRA 1M9AA 3MNGA 4EYCA 1GMQA 3ME7A 2LRTA 5CK6A 1W01A 3DVWA 4ZXGA 4EC0A 1N8QA 1GSUA 1B20A 1D6ZA 1S5AA 5BIRA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 3PXMA 2RFRA 1ON4A 4HM2B 3D79A 3WODG 2CQ9A 3ZL5A 4F2IA 2P0XA 3BNCA 4IQAA 4FMDA 4EF0A 1UGIA 4ZB6A 2ZDJA 4G9HA 1C7HA 3UL3A 1X5CA 1WQLB 3L9SA 4V2MA 1EGRA 2G0FA 1DETA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 4BVXB 1IYIA 4K90B 3UVHA 6GSVA 3KCHA 2LNTA 2JDIH 10GSA 2FGXA 4MF5A 20GSA 1GTAA 1ULIB 3TJGA 1N9JA 4XS1A 2GZZA 4MDCA 3EYTA 3SVAA 5G31A 2FUG2 1DVDA 3EE1A 3B8LA 1JB5A 5CF2A 3G4S3 5A4UA 3D0ZA 3FSDA 4R9KA 1PA3A 3PINA 3UBKA 3KN4A 3I43A 4EDZA 1M7TA 1LOVA 4MMZB 5ELUA 3WMDA 1UI7A 1X1YA 4F0CA 5DRVA 3KTBA 4GTUA 3CC23 4IELA 1VQ53 2F9SA 5D81A 3KFQC 9RNTA 2DMLA 4HM7B 5CRHA 4PUAA 1MWTA 4NAXA 1G7EA 2IPAA 1M1XB 4HM8B 3VI5A 1U88A 2OWPA 3A76A 1I0XA 2CG0A 1GTIA 1XBSA 5H5SA 1DVCA 1PFPA 2INXA 4WYKB 2ALBA 2F51A 2VL3A 1OC9A 1AW9A 3HOHA 5JPUA 2C0GA 2BO9B 3VWXA 3L4NA 3MIXA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 1BUQA 3LJRA 5DAKB 3HKRA 2P09A 3X41A 3F40A 1F6MC 2CAIA 5CXOA 5GSTA 1YEXA 2PERA 1WMOA 2M46A 3LXZA 4DSSB 1VQ83 1NJI4 2F86B 4GSPA 3ISOA 1ROVA 3HY2A 2LQQA 4FYBA 2AJQB 4WFOA 2HLSA 1MD4A 1YNVX 3I9V2 3VWVA 3CD63 3JUQA 4GXZA 1JKGA 2W9QA 5KOWA 4O32A 2QEX3 2V32A 4N6UA 3CCV3 1MD3A 2IMDA 2QGUA 1YQ1A 2NDOA 2OADA 4STDA 4MZCA 4LSOA 3M9KA 2W0QA 1O7MB 2OBIA 2FGTA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 1JBSA 3ZIVA 5E4WA 4KFEA 1R26A 3TJJA 2GBXB 1XW5A 4AKZA 1XXUA 2VCXA 3DGMA 2XBQA 2PN8A 1C72A 2J23A 1Q9EA 3IXRA 1KBNA 1V74A 1BRSA 4GHOA 2TRCP 4XS4B 1M2BA 4JRFA 4BTXA 2DKHA 3KD0A 1SKRB 3APOA 1D6UA 1W4NA 3EF8A 2PPTA 1HZ1A 4G19A 4OWYA 1TU5A 1WTHA 4WEYA 2YV7A 1CYVA 8CHOA 3DIEA 3EC3A 4IW9A 3DVXA 3KSPA 1EG9B 5BVBA 3QRDA 5IPHA 3RGRA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 3PZWA 1YGEA 1M1K4 4MEIA 1F3AA 3G7JA 5H5QA 4OUQA 2AADA 2IL3A 3S27A 1XWKA 5A4WA 1JN5A 5CRDA 3S28A 1HNAA 1YEPA 1RNBA 3KE7A 4MH3A 1BNIA 4HDEA 2CFLA 2FA4A 1GD4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3SYUA 4N6OB 3F9UA 4Q53A 3G7YA 4TXOB 5HR3A 1Y4KA 1S723 1O81A 2W56B 2VL9A 3IPZA 1FGRA 1BIRA 2YWOA 2CAQA 1LOXA 3DMLA 1TRQA 2VO4A 4FMBA 2VIMA 1O85A 2CZ2A 1BNFA 3LXUX 3SLUA 2A2PA 1B8XA 5CAXA 4DKIA 1X1WA 1FGOA 5KN1A 1FUWA 3F4TA 3EC9A 1XZOA 3FF2A 4N6V0 2X99A 1K734 3X3YA 4HKVB 1GLQA 3MHEA 2IUJA 1C54A 1MGRA 1QMAA 5IG5A 2VCVA 4NMUA 3J7Yd 3WYWA 2W6JH 4LMWA 3PGBA 1DYUA 3T8UA 3CCJ3 4BVYB 3F8XA 5IEPA 5IMDA 2P31A 1MNLA 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 1WMPA 4GWRA 4N30A 1W2ZA 3BLZA 2K18A 1TIJA 1BX9A 1FHEA 1FUTA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 4NHFA 5LNKe 3X42A 2XC2A 1XG8A 5IO0A 1WJKA 1LQMB 1KTEA 1GH2A 1SK2A 5JBSA 4OCFA 1O8WA 2H30A 1UGHI 3IJEB 4FCMA 4BA7A 1A8LA 4R4KA 3R3EA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 1OF5B 3CCL3 4BL3A 1IQ8A 5B6NA 5G1KA 4XBXA 1TU7A 2QSIA 4KF9A 3MAKA 5HFIA 1BVIA 4PNFA 4HJMA 3CME3 3DXOA 4ORLA 1H75A 1RMSA 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 3H51A 1GMRA 2YPMA 1YZXA 4MNNA 5KP4A 3IPTA 1HU9A 3LT8A 1LXEA 3CMA3 1OHPA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 1VQM3 1TFKA 2C1YA 3DEXA 4XB5A 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 4HAAA 2EC4A 1O73A 4ACSA 4L8OA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 3CCU3 3G6E3 1XVWA 1KEBA 1O6JA 2HMKB 3EPTA 1FGQA 2KAAA 5FT3A 2E2UA 5AISA 3DGNA 3NBJA 1KWIA 1RN1A 1M3JA 5DJMA 1SK1A 3VF1A 1BYEA 4PUFC 5FWGA 3I563 5CP1A 1S3DA 5F8BA 5EY6A 2BU4A 2HMLB 4K5SA 1Q4JA 1A67A 2MMOA 1XFLA 1V98A 1K0DA 4HVNA 4DVCA 2L59A 1B3SA 5G30A 2H1GA 1DMMA 2XSOB 3HVXA 1OACA 1QMVA 3IK9A 2LYXA 3SWLA 3D5JA 1I70A 3K0ZA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 1IYYA 5KP3A 2EIRA 3RAZA 3V98A 1GSEA 4GRFA 3A5EA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1IQXA 1CQSA 5IW9A 1GTBA 5L71A 1XIYA 1AVLA 1U8CB 2IY2A 4H86A 4V2NA 1A2JA 3JUPA 3UMAA 3TOUA 5JWQB 1ERWA 1Q40B 1W5ZA 4ML1A 1O7WB 1UCJA 2XH9A 3ZTLA 1SK0A 3WD6A 4XIHA 8GSSA 2F5WA 4J5GA 1X1XA 5EQLA 1A8YA 3K9MC 3DGYA 2IMEA 3KIIA 2VCTA 1Z6NA 1T5YA 3RGAA 2VD0A 1FW7A 2MZCA 3RDEA 2WRTA 1TFOA 1BSBA 1WRYA 2HFDA 3GKXA 3LEFA 3Q74A 4PTSA 3UOMA 3D3LA 1T4YA 3PR8A 3ZZXA 1Q814 5ECQB 3F3QA 3S9FA 1V9WA 5DREA 2JZRA 4GSTA 5HFGA 1RKYA 3FYGA 6STDA 5AN1A 2HXKA 1RGCA 2B5EA 2WB9A 4EXJA 3ALAA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 1B2SA 2F8FA 1EP7A 2RGQA 3APSA 3ED3A 2CX3A 12GSA 4XDVA 4WBRD 1ZCPA 3KZQA 4LGQA 2R0PA 3VWWA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 3CNXA 5CYYA 3URPA 22GSA 1O7NB 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 3OX9A 2EIOA 3I553 2V1LA 4L5OA 3DY5A 3SOYA 4GSNA 3BNDA 5F05A 4PEJA 3CPW2 5STDA 1O8XA 5M19A 3GWRA 1GMPA 3JUMA 2BJXA 2H66A 5LD0A 3STDA 5DBQA 2RCDA 1HKXA 4MMYB 1UVZA 1HNCA 1FB6A 1GS3A 2OCTA 1YHQ3 1Z7PA 5KN3A 3DWVA 4I2UA 3B4OA 4KZ1A 4XM4A 2GSPA 4KE3A 4K0GA 1Z7RA 1K9M4 3J7Yk 3D9RA 5C00A 4IN0A 4X0XA 2C4JA 1RN7A 2V2GA 1YJW3 4I4KA 1M99A 2B5YA 3QPMA 5E59A 4OVMA 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 3HI7A 4KUNA 2HMOB 2O3OA 3AMOB 1X9WB 3WGDA 1UUGB 1RK4A 1SJ6A 3A2WA 1TKDB 3NX0A 2E2MA 4HSCX 4KGIA 4JR4A 1Q7HA 3FG4A 1BRHA 1LJRA 2OE1A 1BRIA 2CVBA 3L9UA 4ZL8A 1UDII 3M8CA 1AQWA 1GLPA 1B21A 3GH9A 2K0MA 2HZEA 3CCQ3 1BNGA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 1IVUA 1MWSA 4OFNA 1VQO3 1A90A 1GNEA 1YF0A 4FQUA 3EVIA 4ZB9A 1XWBA 2TRXA 1OUNA 3EB8A 4TR3A 3F6DA 5DALB 5D9XA 1IQYA 1T8EB 3TDGA 5HR2A 1Q7Y4 3SEDA 2L4CA 1RHLA 3SBCA 2HMNB 2H70A 2GSRA 4YAPA 1RSNA 11GSA 3UL5A 4ECCA 1KC84 2IWTA 3GZXB 4JBBA 4GF0A 3NM7A 4HM6B 4DEJA 3MG1A 4N6NB 2VUPA 4POKA 3M0FA 2PZVA 1O7UA 1AIUA 3RHBA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 1FGMA 1VQP3 3FZWA 3EE2A 5J5NA 2HRAA 4X2OA 3X3ZA 1ZL9A 1WIKA 5IF6A 2L5OA 2GBWB 2CX4A 4BIKA 4TR1B 2X8CA 2A4HA 1YDKA 4K61A 2ZL8A 3N8BA 3NBRA 3NZNA 5CLKA 4P3YB 3OWYA 1EKMA 1I8VA 2REMA 3F9SA 1QQ2A 2NBSA 4F03A 2CH9A 3HJOA 4TKYA 2BMRB 4MCUA 3CNMA 4IGJA 4X43A 1CQHA 1VQ43 2MBTA 1RRLA 4BL7A 1SKWB 2FWEA 3TKSE 2UGIA 3Q90A 2WS2A 3PCSA 3SXXA 1VZZA 2VM1A 4FIWA 1M9BA 4OD7A 3PPUA 2PVOC 1I5GA 3MSOA 2XGNA 3NIVA 3DRNA 2ON7A 1X1UA 3HX8A 1XCCA 1GY5A 1TOFA 2RSXA 3C8EA 3F8HA 1WWJA 1OH0A 4XBTA 3FGYA 2R37A 14GSA 2OA7A 2KOKA 1OGXA 2YX9A 1RCKA 2GT6A 2I1UA 1THOA 1E97A 5G1LA 3FZ4A 5AIHA 1US1A 4KB3A 1RGAA 4RQRA 3N5OA 3CCR3 2WULA 1RTUA 2XGLA 4WP5A 1G02A 2P5QA 1TI1A 4KA0A 4PURA 4G0KA 2XF3A 3LTDA 4J5KA 4XBYA 1GTUA 2WFCA 3HIIA 5IMCA 2HSMA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 4ZM8A 2BTOT 2K8SA 1NO3A 2N5FA 3NXJA 4IP6A 5G2ZA 2WZ9A 2GXFA 4ZBDA 1VQ73 3G8ZA 2H8LA 1BANA 2B7JA 3FR3A 3EN8A 4KDUA 3FG3A 4LLRA 3CCM3 1SD9A 2GZPA 2C10A 2HRNA 5ECSA 3GZYB 3Q19A 5AIIA 5IG0A 2H6XA 5AEWB 3GX0A 1T2IA 3HK4A 1PX6A 2ZA4A 1I3FA 5EVHA 2AYTA 1Q824 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 4N6LA 1I0VA 3WA3A 2C0EA 3BB9A 3DMCA 2JSYA 3BOAA 1QAFA 2O9UX 1A2LA 3UNLA 2C80A 1MDIA 1BNJA 1S3RA 2CFGA 1FA3A 2IA7A 3LYKA 3ZFBA 1GRXA 5FW5A 2W9PA 2H1DA 2CK3H 5HGRA 4XDWA 4HZ4A 1DBYA 3X40A 2A15A 4HI7A 2DIZA 3L78A 2BMOB 4E8HA 1GSPA 2F98A 1R7HA 1RGGA 4GB5A 5JWRB 1AQZA 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3MKIA 3NOFA 2HMMB 2WGQA 3D4MA 5DVBA 4Q5NA 2WOFA 4K7IA 3QOUA 4KSMA 4PQHA 1BU4A 2XPEA 5AYSC 4YQMA 2IUKA 3Q1CA 2YJ7A 4HM3B 2K9FA 2FA8A 1I3IA 3BBYA 17GSA 2YFJB 1M9GA 1PY3A 3AY8A 3HJMA 1I2GA 4Z2TA 4AEQA 3DH2A 1Y25A 4I5QA 1IT7A 1WMJA 3KP8A 3DD3A 4WYKA 1SU9A 1PD21 2GTUA 3UB1A 1Z3EA 3IA1A 2JL4A 2OTJ3 5ID2B 2B5XA 2QA43 1B2MA 1K0OA 4Z2UA 2QA1A 2BIRA 5KOXA 1NWWA 1NDOB 2CX1A 4MJAA 4YAVA 2KF4A 2KF3A 1W02A 3RNTA 2L1SA 5GZZB 3OWSA 4MA9A 2CW9A 4EXRA 5DAKA 1AVKA 1JB2A 4JZQA 3GAXA 1Z5YE 2Y73A 1BNEA 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 2RBIA 1BNRA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 3U97A 4X4JA 3SX1A 3TCOA 4MJBA 2KXGA 3KSED 1K3LA 3T0UA 2JADA 1E3RA 3OWUA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 1ZYNA 3A5IA 1YJ93 1M3IA 2WJUA 4YKGA 4ECJA 1N8R4 4XCSA 3B7CA 2DJ1A 4YQUA 4Z2RA 1MWRA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 5ELJA 1BEDA 4N3VA 5G2GA 2F4YA 3ZVJA 1ABAA 2E2VA 4HM0B 2CIUA 1VF1A 5JPPA 4EO3A 3LXTA 3K5TA 2QIYA 2Z77A 1DMNA 3HCZA 4K7NA 1JJ22 1D6YA 4MH2A 3W8SA 5IERA 1YIT3 3DM8A 2IN3A 3ZITA 1R4WA 5AIFA 1J2BA 1E6BA 1K28A 3V1WA 4XS4A 3GZRA 3DUKA 4RNYA 4O5RA 5M1AA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 2OOVC 2CFDA 1EGOA 4NXIA 3AGOA 1FOVA 1LVNA 1TP6A 2F56A 1NW2A 1JV2B 1PN0A 3HHVA 2R5GA 2CWVA 2RIIA 4V1Ag 4F9ZA 1B27A 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 1JB4A 3ZYWA 5FHIA 2GSQA 2RNTA 2ML6A 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 3NV0B 5ECIB 2PGTA 1DE1A 4L8EA 4WWUC 2YZHA 2WCIA 1JBTA 3IDVA 2Z6BA 3N9HA 3D4AA 3WDGB 2HSYA 4TXOA 6GSSA 1V40A 1KSIA 2W56A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 3KKGA 1NHYA 2I9HA 4ZL9A 5IMFA 3Q2PA 4Q5FA 4X1UA 5B8AA 1G96A 4CY8A 1SYXA 3LYGA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 1FYSA 2L4QA 1IDPA 1LNHA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 3CCS3 2LJRA 4TR4A 1PSQA 1YIJ3 1EUIC 1EEJA 4E8EA 3DZLA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3EHCA 3KH9A 1M2DA 4CCVA 3VI7A 1MOLA 1PMTA 3TB2A 4BVYA 4LZIA 3LT9A 1GP1A 3FCSB 4KFFA 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 2W03A 3IR4A 1PYLA 2YP6A 1J9BA 2HNLA 3GIXA 5IEOA 3EWLA 3K8NA 2C0FA 1HQOA 3WHOA 2P5RA 2W2CA 3JVCA 4QWTA 3ERWA 2VLVA 3NBBA 2ES7A 4NPBA 2BMXA 2Z9SA 2YFLB 4KCEA 4RI7A 1THXA 2N5AA 2CKFB 3S5CA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 4BIRA 2NPBA 1TRWA 3WOFB 2YOIA 1A2MA 4HM1B 3MPHA 2DMMA 4HJLB 1UUVB 5A5KA 3TGZA 4ZILA 5EPFA 1OF5A 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4HOHA 1JNQA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3V92A 3PH9A 4MF7A 1ML6A 1RGEA 1W7CA 2VL2C 4O7HA 2GQLA 4U13A 6GSYA 1HYFA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 5BMUA 1EA2A 1WMNA 2H73A 1V58A 1A0RP 3NUVA 1KQS2 2VOCA 1RCLA 4RI6A 1W6YA 2FCHA 4PQ1A 2J9HA 1TK5B 3RPNA 3EINA 2NTOA 4AKYA 2I9WA 1TU8A 3MWHA 4OO4A 4AJ6A 4EIPA 5CF1A 3GURA 1AUCA 3A2XA 1T7PB 3LTCA 3E3EA 2HSHA 3F4SA 3VGNA 2IIYA 1UI8A 2O8VB 3M1GA 1GL8A 3KZTA 1J0FA 3KP9A 3LH4A 4N6TA 3FMWA 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 3MG3A 5LC6A 3BIRA 4GSSA 3F7SA 4O2HA 1L5GB 7STDA 1W2B2 4JU5A 3FF0A 4ICYA 1IV9A 4DSQA 2UX0A 2V41A 4N0ZA 1DUGA 3IBHA 4O3VA 2X49A 3LWAA 3FK8A 1O7PB 1Q864 4XHMA 3CQFA 2K54A 2LV3A 3G16A 4GL6A 3FR6A 3HVNA 2MYGA 1OC8A 1OCVA 4TX4A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 1GOYA 3EJVA 5G5FA 3LZAA 5IENA 4KT3B 2CWUA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 4HZ9B 2YN1A 2IMFA 1GSQA 1JZRA 1VQ93 2VLTA 1AC1A 1VQ63 3EU4A 3ECFA 2QA2A 3HD5A 2VM2A 2XFTA 1MDJA 1JFUA 1GD3A 5IPGA 5ECMB 4AGSA 2MBSA 2CX0A 5D8IA 2I4AA 5AI1A 1Q40A 3LQ7A 1BOXA 4J9AA 2H71A 4K1VA 2WOHA 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 4USSA 3AHSA 3CTGA 2HRFA 1I2EA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 4A5PA 1ZGNA 4BTWA 1S3AA 1U87A 3K63A 1GNWA 3ZMKA 4HQSA 5IOXA 2A2SA 1FUSA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 1RRHA 2O7KA 4HU7A 2ON5A 4BL2A 5IQYA 1W6CA 3WOEB 3SOAA 2GT5A 5HR1A 5LC7A 1BUJA 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 5FGOA 1RGLA 3WR2A 3HA9A 5IM9A 4ZIJA 2R0CA 3FW2A 3ROBA 2R0GA 3F14A 3ZREA 1IK3A 8RNTA 1RGFA 3DGLA 1GOVA 4I97A 1ROAA 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2FNQA 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 1B2UA 3FR9A 3VK9A 3D4TA 1GOUA 2LRCA 3M3MA 4O5UA 4K1UA 3GKMA 4HZBB 4OO5A 3UAPA 3S29A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1SJWA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3G713 4O8SA 1BGSA 3IRAA 3UJMA 1B48A 1ZZYA 2JQ5A 2GLRA 4PQIA 3HIGA 6RNTA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 1TUHA 2LEGA 4RZMA 4EBGA 4MK3A 2PMTA 4EIQA 1JKGB 5D82A 2FWFA 2K8VA 2D42A 5DQYA 7GSSA 5B7CA 5TGNA 1GY7A 2H74A 2P38A 3AHWA 2HOHA 3AMOA 3M8NA 2HRKA 1RGKA 3FH1A 1U6TA 3TKQA 1B9YC 1LNIA 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 2KF5A 2FXTA 3U1WA 3C73A 2QGVA 3W6GA 4RNTA 3PGTA 1IVVA 3D6IA 3WA2X 1K3OA 4HZ2A 3UVTA 3X3XA 4I8BA 1F8NA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 2BT3A 4IBPA 1XW6A 4MJCA 4Q5QA 3US3A 2H0HA 2C8UA 1RNTA 4QL7A 5ECNB 3IE3A 5CRGA 1BSCA 3FG1A 2P0MA 1VF3A 1WPIA 1RQMA 2FWGA 3CSHA 3IHGA 5DALA 3GUSA 4FMCA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 1Q42A 1BSDA 6GSPA 2HMJB 3C1RA 5JWOB 1B4PA 3A3TA 2GEYA 3KIJA 4R1KA 4R80A 2OOVA 2KRTA 1YVBI 1BSAA 2GQMA 1JN5B 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 4MJDA 1E2YA 4OMVA 5AIGA 3RPPA 1BSEA 4XRAA 2AB6A 4RBNA 1NNVA 1YGWA 2JZTA 3I6AA 2Q07A 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 2ML5A 2PNCA 2OTL3 1MWUA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 2GU1A 4JE1A 1SD8A 4HBRA 1OE8A 1UN2A 3LSZA 2XRXB 4RQXA 4YKFA 3UBLA 3LW9A 4J8TA 3BU4A 2CVDA 1AQVA 3GRXA 2OQEC 1JZOA 2XSHB 4GQCA 3G7IA 1BRJA 2M7OA 1PQNA 3WT2A 1R4YA 3ZG0A 1I2FA 1FOHA 2D2ZA 1CYUA 5H5RA 1LOYA 4EC6A 2ZHXB 4G0IA 2LQVA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 5AYRB 4X2HA 3K7CA 2CZ3A 3NM2A 5J9CA 3HDCA 4DSRA 2YNXA 1CEWI 4LMVA 2G2QA 4O92A 16GSA 2R4IA 2YCDA 1FO5A 5DDLA 2RM5A 1UCLA 3VURA 1F9MA 2E2TA 3BCIA 3FEUA 3GFKA 4HUAA 4ISDA 2F8AA 4K2XA 3DGQA 3KM6A 1IU7A 4EVMA 1R4CA 1F3BA 2N5BA 1KD14 1OHSA 1UW1A 3NHXA 1OKDA 3H4KA 4O02B 4TRXA 1SPUA 3TKPA 1JZDA 4KW6A 4KDYA 1K41A 3APQA 5IIZA 1CH0A 1Z6MA 2IMKA 1SIHA 4H3UA 4MMXB 1YJ6A 2B24B 1FGTA 3GTUB 3MG2A 3NQZA 2RLIA 5ECHB 2CVKA 2H1BA 2K3DA 2MMNA 3CC73 1B2ZA 4WF5A 1JLVA 3CRUA 4ZB8A 1O7GB 2D1WA 3VWUA 4N11A 3GNJA 2CHCA 3O8YA 4CDLA 2BNGA 3UL6A 1RDSA 4GLTA 2FWHA 3KMNA 1ZX2A 4MZWA 4ZBAA 4KVHA 2P0GA 2Z7AA 2FY6A 3DXBA 5DJLA 1A24A 4G0LA 5GAPD 2F5MA 4MZBA 1N5HA 1V2AA 2VL2A 3KGKA 3FY7A 5A0OB 4G1MB 5BXQA 4ECIA 1O7HB 5RNTA 1K0BA 5GSPA 7RNTA 1BRGA 3GKNA 3KEBA 4LYLB 13GSA 2SBLA 1SARA 4JF8A 4LEHA 1VQL3 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 1PFOA 1GY6A 4PXOA 1Q98A 4Q5RA 1ISKA 4N6MA 2LKUA 5EVOA 3ZG5A 3EMPA 1QJGA 1NU3A 2C4BA 1VF4A 3QDNA 3NQYA 4FCZA 1K8A4 2E2GA 2GS3A 3DYRA 2H19A 7GSPA 9GSSA 3IMAB 2X4AA 1T2HA 3HVSA 3LTBA 5IG3A 1CQGA 3TOTA 5J3RA 4EW5A 3OW22 3WGEA 1EOHA 1EOGA 2R41A 2ZCTA 5EL8A 4BTYA 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 1DE3A 2KLXA 4TR0A 2LJAA 1STFI 5D83A 3KMOA 3KCMA 1MGWA 2YV9A 1DMQA 3EQQB 3GSTA 5BRTA 1RJOA 3KJYA 2X64A 4MABA 3W8JA 3FZ5A 1BNSA 3N54B 1A0FA 1IV7A 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 4EV5A 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 1IT8A 5ID2A 4K5RA 4XTSA 1SL1B 3CC43 1ASKA 3P2AA 2ZUPA 1PKWA 1URMA 2VCQA 5CREA 1OGZA 3RHCA 3JUNA 2J8XB 3EBYA 1ULJB 2CWTA 1JZWA 1BQ7A 2AAEA 1J08A 1MTCA 4G10A 3PS8A 1K0MA 3FRCA 1IVWA 3I0YA 4MPGA 5DQSA 1GUHA 4CHSA 2CFWA 2IYJA 1EV4A 2E7PA 3MSZA 2CFKA 3LMLA 3L9VA 4IJIA 1NM3A 2XEPA 1BRNL 2HZFA 1TRVA 5ELGA 3H93A 1BAOA 1W00A 1R5AA 3VSYA 4J2FA 1ZMAA 3TKSC 5AIXA 5AEUB 2Y74A 2OE3A 1LRAA 1OHOA 3Q18A 4FMAA 5HOHA 3LOYA 1VQN3 1YI23 2STDA 2KF6A 3TJFA 3JCML 3D5IA 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1STDA 1GSSA 3S67A 3E9JB 4H61A 2UUGC 5ECKB 3DGOA 3BNBA 2HE3A 5J41A 1AV4A 1EEMA 5IG4A 5GSSA 1U3IA 2KCDA 3GN3A 2VD1A 1FG4A 2PWJA 3ZFZA 4IIAA 3GSPA 1NB3I 1ZGXA 2DJJA 2UZ8A 4IS0A 1A2PA 1NHOA 1ZYEA 5M18A 1K0AA 1UCKA 1QFNA 3WT1A 4BU4A 2GSTA 5HR0A 1JRQA 1WE0A 2GU3A 3L0RA 3EX9A 2YWIA 4RNZA 4NWYA 2KP2A 1XOBA 3AGNA 5BU4A 5JCUA 4IPBA 1GULA
chains in the Genus database with same CATH topology
2I3YA 1BG5A 4I2TA 2R3XA 4MP4A 3IC4A 1S3CA 3HXSA 4D73A 1VGLA 3GH6A 1YF1A 3O6TA 3ZIJA 2L6DA 2AV4A 4MLYA 5D9VA 2B6MA 3LFLA 1XPVA 3F6FA 5F0GA 2KHPA 3HZ4A 4ZL7A 5IOWA 4HOJA 5KEJA 2KUCA 1TDIA 4TVEA 2IFQB 5IMAA 1EP8A 4KDXA 3ERFA 2HZEB 3EMXA 1T3BA 1T4ZA 1ACVA 6GSWA 3FZ9A 2A2RA 4K9ZA 3H1NA 4K7OA 1SENA 2GQKA 1X5EA 2RUFA 1KNGA 3RBTA 4J57E 4XRDA 1B9XC 3O3TA 5IO2A 1PN9A 4LL1B 2FNOA 3GL5A 5G5EA 2L5LA 1G6WA 4CW9A 2LQOA 3ZVJD 4PX1A 4JRRA 2C0DA 1TXXA 2I81A 2MMZA 1ZYQB 4POMA 4QQ7A 3DKSA 4WETA 2A4VA 3MYDA 1GUKA 2L6CA 3ME8A 1T1VA 3CSIA 1GSYA 2VAFA 1WOUA 3CXGA 2PU9C 3BD2A 4JR6A 3IC8A 2H1AA 4KAEA 4PNGA 4YH2A 2C3QA 1FAAA 1G7OA 5GAND 3H8QA 3IAM2 2OE0A 4EUYA 2O85A 2DKIA 3QMXA 2DLXA 4BL7B 1MDKA 2OJLA 4POBA 1FVJA 1VF2A 1YY7A 4TN8A 2IFQA 4JEDA 3QAVA 4HS1A 2DIYA 1G0TA 2OBKA 2QC7A 2B1LA 4J56E 1HYUA 5KN0A 19GSA 3BCKA 3L0HA 3WGXA 2H75A 4N10A 1BAYA 4FYUA 5COHA 1ZYPA 1SL2B 4GQFA 1XWGA 1N8JA 4CY6A 3P90A 3I69A 5D9WA 1TP9A 4O5QA 5KN2A 1VRSD 4QL9A 3GHAA 2QKEA 5ABRA 1M9AA 3MNGA 3ME7A 2LRTA 3DVWA 4ZXGA 4EC0A 1GSUA 1QGVA 3ZRDA 1USBA 2FD3A 4XS6A 1ON4A 2CQ9A 3ZL5A 4F2IA 4IQAA 4EF0A 4ZB6A 4G9HA 3UL3A 1X5CA 3L9SA 4V2MA 1EGRA 2G0FA 4IVFA 2WDUA 3A5WA 1W89A 3CSJA 4BVXB 1IYIA 3UVHA 6GSVA 2LNTA 10GSA 2FGXA 4MF5A 20GSA 1GTAA 3TJGA 4XS1A 2GZZA 4MDCA 3EYTA 5G31A 2FUG2 5A4UA 3D0ZA 1PA3A 3PINA 3UBKA 3I43A 4EDZA 1M7TA 4F0CA 3KTBA 4GTUA 4IELA 2F9SA 2DMLA 5CRHA 4PUAA 4NAXA 1G7EA 2IPAA 3VI5A 1U88A 1GTIA 1XBSA 5H5SA 2F51A 2ALBA 2VL3A 1OC9A 1AW9A 2C0GA 3VWXA 3L4NA 3MIXA 1A23A 5HFKA 4ML6A 2AHEA 2LUSA 3LJRA 5DAKB 3HKRA 1F6MC 2CAIA 5GSTA 1YEXA 2PERA 3LXZA 2M46A 4DSSB 3ISOA 3HY2A 2LQQA 4FYBA 2AJQB 2HLSA 1MD4A 3I9V2 3VWVA 4GXZA 5KOWA 4O32A 2V32A 1MD3A 2IMDA 1YQ1A 2NDOA 2OADA 4MZCA 3M9KA 2OBIA 4ID0A 1G6YA 2YJHA 3TKSA 4BVXA 3ZIVA 5E4WA 1R26A 3TJJA 1XW5A 1XXUA 2VCXA 2XBQA 2PN8A 1C72A 2J23A 3IXRA 1KBNA 2TRCP 4XS4B 1M2BA 2DKHA 3KD0A 1SKRB 3APOA 2PPTA 4G19A 4OWYA 4WEYA 2YV7A 3DIEA 3EC3A 4IW9A 3DVXA 5IPHA 2PUKC 1HD2A 1ERUA 5B6MA 3CBUA 1F3AA 3G7JA 5H5QA 2IL3A 5A4WA 1XWKA 5CRDA 1HNAA 1YEPA 4MH3A 4HDEA 2FA4A 3P7XA 5ECOB 1PGTA 1LU4A 2DJKA 4K6XA 3F9UA 3G7YA 4TXOB 5HR3A 1O81A 2VL9A 3IPZA 2YWOA 2CAQA 3DMLA 2VO4A 2VIMA 1O85A 2CZ2A 2A2PA 1B8XA 5CAXA 5KN1A 3F4TA 1XZOA 2X99A 1GLQA 2VCVA 4NMUA 3WYWA 4LMWA 4BVYB 5IMDA 2P31A 2RUEA 2GVPA 4FYCA 3UIWA 2R6KA 4GWRA 4N30A 2K18A 1BX9A 1FHEA 3UEMA 1EWXA 2MMAA 2AAWA 1R5PA 1UC7A 4K2DA 2XHFA 3F0IA 4OCEA 5LNKe 2XC2A 5IO0A 1WJKA 1KTEA 1GH2A 1SK2A 4OCFA 1O8WA 2H30A 4BA7A 1A8LA 3R3EA 3GYKA 1NSWA 6GSUA 3GTUA 4F0BA 2V1MA 5B6NA 5G1KA 1TU7A 2QSIA 4KF9A 3MAKA 5HFIA 4PNFA 4HJMA 1H75A 1AXDA 3IHQA 2GSSA 4AJ7A 2YWNA 2YPMA 1YZXA 4MNNA 1EV9A 2V6KA 1F2EA 2VCWA 2B3SA 6GSTA 2C1YA 3DEXA 2CT6A 3TKRA 2DJ2A 3TJBA 4OFMA 2EC4A 1O73A 4ACSA 4LA1A 3QAWA 5JCGA 3KTLA 3HZ8A 4L0WA 1XVWA 1KEBA 1O6JA 3EPTA 5FT3A 5AISA 5DJMA 1SK1A 1BYEA 4PUFC 5FWGA 5CP1A 1S3DA 5F8BA 5EY6A 4K5SA 1Q4JA 2MMOA 1XFLA 1V98A 1K0DA 4DVCA 2L59A 5G30A 2H1GA 3HVXA 1QMVA 3IK9A 3SWLA 3D5JA 4BWQA 1SJZA 2M80A 2C3TA 1TTZA 2EIRA 3RAZA 1GSEA 4GRFA 1XWAA 2LNSA 3GV1A 3H79A 4PGTA 1TI3A 4L0UA 1GTBA 5L71A 1XIYA 2IY2A 4H86A 4V2NA 1A2JA 3UMAA 3TOUA 5JWQB 1ERWA 4ML1A 8GSSA 3ZTLA 1SK0A 3WD6A 4XIHA 1A8YA 2IMEA 2VCTA 1Z6NA 2VD0A 2WRTA 2MZCA 1WRYA 2HFDA 3LEFA 3GKXA 3Q74A 4PTSA 3UOMA 1T4YA 3PR8A 3ZZXA 5ECQB 3F3QA 3S9FA 1V9WA 2JZRA 4GSTA 5HFGA 3FYGA 5AN1A 2HXKA 2B5EA 2WB9A 4EXJA 2WGRA 4ZBBA 1TRUA 4OFTA 2M72A 1GUMA 3VFIA 2F8FA 1EP7A 3APSA 3ED3A 2CX3A 12GSA 4WBRD 1ZCPA 3KZQA 3VWWA 2R0PA 4EL1A 2V6OA 2H72A 2PBJA 3GKKA 5CYYA 22GSA 1QUWA 4NV5A 4EDYA 1DSBA 4WF4A 2HYXA 2EIOA 4L5OA 4GSNA 5F05A 1O8XA 2BJXA 2H66A 5LD0A 5DBQA 1UVZA 1HNCA 1FB6A 1Z7PA 5KN3A 3DWVA 4I2UA 4KE3A 4K0GA 1Z7RA 3J7Yk 5C00A 4IN0A 4X0XA 2C4JA 2V2GA 1M99A 2B5YA 3QPMA 5E59A 2DC5A 2XBIA 2R4VA 1BJXA 1Y6EA 3GMFA 4POLA 4KUNA 1X9WB 3WGDA 1RK4A 1SJ6A 3A2WA 1TKDB 2E2MA 4KGIA 4JR4A 1LJRA 2OE1A 2CVBA 3L9UA 4ZL8A 1AQWA 1GLPA 3GH9A 2HZEA 2X8GA 2TIRA 1X5DA 2K6VA 4ILFA 5D96A 4OFNA 1GNEA 1YF0A 4FQUA 3EVIA 4ZB9A 1XWBA 2TRXA 4TR3A 3F6DA 5DALB 5D9XA 1T8EB 3TDGA 5HR2A 2L4CA 3SBCA 2H70A 2GSRA 4YAPA 11GSA 4ECCA 2IWTA 4JBBA 4GF0A 4DEJA 2VUPA 4POKA 3M0FA 3RHBA 1O7UA 1AIUA 1W4VA 3D22A 2XPDA 3QR6A 3F8UA 3EE2A 5J5NA 2HRAA 1ZL9A 1WIKA 2L5OA 2CX4A 4TR1B 2X8CA 2A4HA 1YDKA 3NZNA 4P3YB 2REMA 1QQ2A 2NBSA 4F03A 3HJOA 4TKYA 4MCUA 4IGJA 4X43A 1CQHA 2MBTA 4BL7A 1SKWB 2FWEA 3TKSE 2WS2A 2VM1A 4FIWA 1M9BA 4OD7A 3PPUA 2PVOC 1I5GA 3NIVA 3DRNA 2ON7A 1XCCA 1TOFA 3C8EA 1WWJA 2R37A 14GSA 2OA7A 2KOKA 2GT6A 2I1UA 1THOA 3FZ4A 5G1LA 4KB3A 4RQRA 3N5OA 2WULA 2P5QA 4KA0A 1TI1A 4PURA 4G0KA 1GTUA 2WFCA 5IMCA 2HSMA 1YKAA 1X9SB 4IQ1A 3O76A 4WKWA 1PX7A 1X0RA 5J4UA 4LL4B 1XW9A 4KH7A 1H4OA 2BTOT 2K8SA 2N5FA 4IP6A 5G2ZA 2WZ9A 4ZBDA 2H8LA 2B7JA 3FR3A 4KDUA 4LLRA 1SD9A 2GZPA 2HRNA 5ECSA 3Q19A 2H6XA 3GX0A 1PX6A 2AYTA 3QD9A 5JCWA 1FW1A 4BPYA 3TRPA 1SL0B 4G2EA 3QAGA 1TW9A 1UA5A 3CTFA 2C0EA 2JSYA 3BOAA 1A2LA 2C80A 1MDIA 3LYKA 3ZFBA 1GRXA 2H1DA 1DBYA 4HZ4A 4HI7A 2DIZA 3L78A 4E8HA 1R7HA 5JWRB 1LBKA 3F63A 3HVVA 2FHEA 2JU5A 3NOFA 3D4MA 5DVBA 4Q5NA 4K7IA 3QOUA 4KSMA 4PQHA 2XPEA 4YQMA 2YJ7A 2K9FA 2FA8A 3BBYA 3HJMA 17GSA 3AY8A 4Z2TA 1Y25A 4I5QA 1WMJA 3KP8A 3DD3A 1SU9A 1PD21 2GTUA 3IA1A 1Z3EA 2JL4A 5ID2B 2B5XA 1K0OA 4Z2UA 2QA1A 5KOXA 4MJAA 4YAVA 5GZZB 4MA9A 5DAKA 4JZQA 1Z5YE 3C7MA 1OAZA 1PKZA 2RM6A 1ERTA 4HEA2 4DSSA 3EURA 2LRNA 1OVNA 4X4JA 3TCOA 4MJBA 1K3LA 2JADA 3C1SA 1PRXA 3LG6A 3R2QA 4V1Ap 3C71A 1ZYNA 3A5IA 2WJUA 4YKGA 4ECJA 4XCSA 4Z2RA 2DJ1A 4YQUA 4I6XA 1HNBA 2H0IA 3FZAA 5D9TA 1BEDA 3ZVJA 1ABAA 1VF1A 4EO3A 3LXTA 3HCZA 4K7NA 4MH2A 3W8SA 2IN3A 3ZITA 1R4WA 1E6BA 3V1WA 4XS4A 4O5RA 4WR4A 1IYHA 3E0UA 3MDKA 3TRXA 3LYPA 2YANA 1DE2A 1EGOA 4NXIA 1FOVA 1NW2A 1PN0A 3HHVA 2R5GA 2RIIA 4V1Ag 4F9ZA 5D93A 5INYA 2B7KA 4BWSA 2GDRA 4EKZA 3ZYWA 5FHIA 2GSQA 5J9BA 4D73B 2YWMA 5AGYA 2F3MA 4GCIA 5ECIB 2PGTA 1DE1A 4L8EA 2YZHA 2WCIA 3IDVA 2HSYA 6GSSA 4TXOA 1V40A 1OYJA 5D73A 1U3AA 2IJYA 5C04A 5A4VA 1OC3A 1NHYA 2I9HA 4ZL9A 5IMFA 4Q5FA 4X1UA 5B8AA 4CY8A 1SYXA 1WP0A 5ENUA 3GL3A 18GSA 1QXHA 3IOSA 2L4QA 2HI7A 3QFBC 6GSXA 1XOAA 4MPFA 2GZYA 1ERVA 2H76A 2LJRA 4TR4A 1PSQA 1EEJA 4E8EA 4CDOA 2DJ0A 1EZKA 3ZFLA 1TK8B 5B8BA 3KH9A 1M2DA 3VI7A 1PMTA 3TB2A 4BVYA 1GP1A 1GWCA 4MF6A 2NVLA 3UJ1A 2E0QA 3IR4A 2YP6A 1J9BA 2HNLA 3GIXA 3EWLA 3K8NA 2C0FA 1HQOA 2P5RA 3ERWA 2VLVA 2ES7A 4NPBA 2BMXA 2Z9SA 4KCEA 4RI7A 1THXA 2N5AA 1SKSB 1V57A 1AQXA 3D21A 4KSOA 2NPBA 1TRWA 2YOIA 1A2MA 2DMMA 5A5KA 3TGZA 4ZILA 5EPFA 2X8HA 2CA8A 4ECBA 3F4RA 2DJ3A 3GSSA 4V2LA 2IMIA 2OACA 1K0NA 4TXVA 4WXTA 1XWCA 1OKTA 2C3NA 3PH9A 4MF7A 1ML6A 2VL2C 4O7HA 2GQLA 6GSYA 3FKFA 1MEKA 1I9DA 2JSZA 4HJ2A 1JLWA 4NV2A 4KCAA 5BMUA 2H73A 1V58A 1A0RP 2VOCA 4RI6A 2FCHA 4PQ1A 1TK5B 2J9HA 3RPNA 3EINA 2NTOA 3MWHA 1TU8A 4OO4A 4AJ6A 4EIPA 3GURA 1AUCA 3A2XA 1T7PB 3E3EA 2HSHA 3F4SA 2IIYA 2O8VB 3M1GA 1GL8A 1J0FA 3KP9A 3FMWA 2PVQA 4WR5A 2LS5A 5ECLB 3VLNA 5F06A 3RDWA 4GSSA 4JU5A 4ICYA 4DSQA 2V41A 4N0ZA 1DUGA 3IBHA 2X49A 3LWAA 3FK8A 4XHMA 2LV3A 3FR6A 2MYGA 1OC8A 2LTKA 1F37A 1GSDA 1GSFA 3G9BA 5DCGA 5G5FA 1RW1A 1T00A 3HYPA 3GX8A 3IV4A 5DCHA 2KP1A 4KX4A 2YN1A 2IMFA 1GSQA 1JZRA 2VLTA 1AC1A 3EU4A 2QA2A 3HD5A 2VM2A 1MDJA 1JFUA 5IPGA 5ECMB 4AGSA 2MBSA 5D8IA 2I4AA 3LQ7A 2H71A 4FH8A 3U6VA 4AF2A 3ERGA 3N9JA 5ECPB 4USSA 3CTGA 2HRFA 1B4QA 1OE7A 3HJPA 4F82A 2DBCA 3U5RE 3OR5A 4A5PA 1ZGNA 1S3AA 1U87A 3ZMKA 1GNWA 4HQSA 5IOXA 2A2SA 2H0GA 2LSTA 4NHWA 4N0VA 3TUEA 2O7KA 4HU7A 2ON5A 5IQYA 2GT5A 5HR1A 2HT9A 3ZMLA 3TJKA 1FVKA 3EU3A 3HA9A 5IM9A 4ZIJA 2R0CA 3FW2A 2R0GA 3ZREA 4I97A 2JACA 2CV4A 2ZNMA 3ZLPA 1X9MB 3IAS2 2EIQA 5ELAA 5LCZA 1ILOA 2LJKA 4WBJA 3FR9A 3VK9A 3D4TA 2LRCA 3M3MA 4O5UA 3GKMA 3UAPA 4OO5A 1ST9A 3LGCA 4AJ8A 1PL1A 4L5LA 5HQPA 3P8WA 1AAZA 1OC9B 3CMIA 1N2AA 2O89A 2FLSA 3GA4A 3IRAA 1B48A 1ZZYA 2GLRA 4PQIA 5IMVA 2VLUA 3F3RA 3J7Yb 5F07A 1K0CA 3KH7A 4K0NA 2H01A 1JHBA 2LEGA 4MK3A 2PMTA 4EIQA 2FWFA 2K8VA 5DQYA 7GSSA 5B7CA 2H74A 3M8NA 2HRKA 1U6TA 3TKQA 1B9YC 2L57A 3LORA 1M2AA 4K8MA 4RUVA 5CRWA 3C73A 2QGVA 3W6GA 3PGTA 3D6IA 1K3OA 4HZ2A 3UVTA 4I8BA 2OKAA 5CNWA 1TK0B 4ULXA 4K1FA 4KNDA 4MJCA 4IBPA 1XW6A 4Q5QA 3US3A 2H0HA 2C8UA 4QL7A 5ECNB 3IE3A 5CRGA 1WPIA 1VF3A 1RQMA 2FWGA 3CSHA 3IHGA 5DALA 3GUSA 1YKCA 2VCZA 4MJEA 3Q6OA 3VPQA 1ZOFA 4NHZA 3C1RA 5JWOB 1B4PA 3A3TA 3KIJA 2GQMA 3KXOA 1Z9HA 3VPTA 3QCPA 1M0UA 1E2YA 4OMVA 3RPPA 4XRAA 2AB6A 2JZTA 3I6AA 2JZSA 4IJ3A 4MMMA 2H6ZA 4YQVA 3FHKA 3QFAC 5AIVA 5IMZA 1K3YA 1TJDA 3CRTA 3A2VA 4TR1A 4JE1A 1SD8A 1OE8A 1UN2A 3LSZA 4RQXA 4YKFA 3UBLA 3LW9A 2CVDA 1AQVA 3GRXA 1JZOA 4GQCA 3G7IA 1PQNA 3WT2A 1FOHA 2D2ZA 5H5RA 4G0IA 3TRQA 2DSAA 3IK7A 4HU9A 2R2JA 4EE0A 2H6YA 2CZ3A 5J9CA 3HDCA 4DSRA 2YNXA 4LMVA 2G2QA 4O92A 16GSA 2YCDA 1FO5A 5DDLA 2RM5A 3VURA 1F9MA 3GFKA 3BCIA 3FEUA 4HUAA 4ISDA 2F8AA 4K2XA 3DGQA 3KM6A 4EVMA 1F3BA 2N5BA 1OKDA 3H4KA 4TRXA 3TKPA 1JZDA 4KW6A 4KDYA 3APQA 5IIZA 1Z6MA 2IMKA 1YJ6A 3GTUB 5ECHB 2RLIA 2CVKA 2H1BA 2MMNA 4WF5A 1JLVA 3CRUA 4ZB8A 3VWUA 4N11A 3GNJA 4GLTA 2FWHA 3KMNA 4MZWA 4ZBAA 2P0GA 2FY6A 3DXBA 5DJLA 1A24A 4G0LA 5GAPD 4MZBA 1V2AA 2VL2A 3KGKA 3FY7A 4ECIA 1K0BA 3GKNA 3KEBA 13GSA 2YZUA 5CO3A 1SYRA 4Z7XA 3BJ5A 4PXOA 1Q98A 4Q5RA 2LKUA 5EVOA 3EMPA 1VF4A 3QDNA 3DYRA 2GS3A 2E2GA 2H19A 9GSSA 2X4AA 3HVSA 1CQGA 3TOTA 5J3RA 3WGEA 1EOHA 1EOGA 2ZCTA 5EL8A 4IP1A 1XVQA 3CYNA 1TRSA 2AUVA 2KLXA 4TR0A 2LJAA 3KMOA 3KCMA 2YV9A 3GSTA 5BRTA 3W8JA 3KJYA 2X64A 4MABA 3FZ5A 1A0FA 2O87A 1PL2A 5ECRB 4FO5A 4HQZA 4IKHA 1FB0A 2GGTA 3M9JA 3UARA 4TOPA 5ID2A 4K5RA 4XTSA 1SL1B 3P2AA 2ZUPA 5CREA 1PKWA 1URMA 2VCQA 3RHCA 1JZWA 1BQ7A 1J08A 1MTCA 4G10A 1K0MA 3FRCA 4MPGA 5DQSA 1GUHA 4CHSA 2IYJA 1EV4A 2E7PA 3MSZA 3L9VA 4IJIA 1NM3A 2HZFA 1TRVA 5ELGA 3H93A 1R5AA 4J2FA 1ZMAA 3TKSC 5AIXA 2OE3A 3Q18A 3TJFA 3JCML 1SJIA 4TW5A 2B1KA 4IHUA 1QK8A 1GSSA 3E9JB 5ECKB 2HE3A 5J41A 1EEMA 5GSSA 1U3IA 3GN3A 2VD1A 1FG4A 2PWJA 2DJJA 2UZ8A 4IS0A 1NHOA 1ZYEA 1K0AA 1QFNA 3WT1A 2GSTA 5HR0A 1WE0A 2YWIA 4NWYA 2KP2A 1XOBA 5JCUA 1GULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3Y A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3IC4 A;  1S3C A;  3HXS A;  4D73 A;  1VGL A;  3GH6 A;  1YF1 A;  3O6T A;  3ZIJ A;  2L6D A;  2AV4 A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  5F0G A;  2KHP A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  2HZE B;  3EMX A;  1T3B A;  1T4Z A;  1ACV A;  6GSW A;  3FZ9 A;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  4LL1 B;  2FNO A;  3GL5 A;  5G5E A;  2L5L A;  1G6W A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  4POM A;  4QQ7 A;  3DKS A;  4WET A;  2A4V A;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  2VAF A;  1WOU A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  2H1A A;  4KAE A;  4PNG A;  4YH2 A;  2C3Q A;  1FAA A;  1G7O A;  5GAN D;  3H8Q A;  3IAM 2;  2OE0 A;  4EUY A;  2O85 A;  3QMX A;  2DLX A;  1MDK A;  2OJL A;  4POB A;  1FVJ A;  1VF2 A;  1YY7 A;  4TN8 A;  2IFQ A;  4JED A;  3QAV A;  4HS1 A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  4J56 E;  1HYU A;  5KN0 A;  19GS A;  3BCK A;  3L0H A;  3WGX A;  2H75 A;  4N10 A;  1BAY A;  4FYU A;  5COH A;  1SL2 B;  4GQF A;  1XWG A;  1N8J A;  3P90 A;  3I69 A;  5D9W A;  1TP9 A;  5KN2 A;  1VRS D;  4QL9 A;  3GHA A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  3ME7 A;  2LRT A;  3DVW A;  4ZXG A;  4EC0 A;  1GSU A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  1ON4 A;  2CQ9 A;  3ZL5 A;  4F2I A;  4IQA A;  4EF0 A;  4ZB6 A;  4G9H A;  3UL3 A;  1X5C A;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  1IYI A;  3UVH A;  6GSV A;  2LNT A;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  3TJG A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  5G31 A;  2FUG 2;  5A4U A;  3D0Z A;  1PA3 A;  3PIN A;  3UBK A;  3I43 A;  4EDZ A;  1M7T A;  4F0C A;  3KTB A;  4GTU A;  4IEL A;  2F9S A;  2DML A;  5CRH A;  4PUA A;  4NAX A;  1G7E A;  2IPA A;  3VI5 A;  1U88 A;  1GTI A;  1XBS A;  5H5S A;  2F51 A;  2ALB A;  2VL3 A;  1OC9 A;  1AW9 A;  2C0G A;  3VWX A;  3L4N A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  3LJR A;  5DAK B;  3HKR A;  1F6M C;  2CAI A;  5GST A;  1YEX A;  2PER A;  3LXZ A;  2M46 A;  4DSS B;  3ISO A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  2HLS A;  1MD4 A;  3I9V 2;  3VWV A;  4GXZ A;  4O32 A;  2V32 A;  1MD3 A;  2IMD A;  1YQ1 A;  2NDO A;  2OAD A;  4MZC A;  3M9K A;  2OBI A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  3ZIV A;  5E4W A;  1R26 A;  3TJJ A;  1XW5 A;  1XXU A;  2VCX A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  3IXR A;  1KBN A;  2TRC P;  4XS4 B;  1M2B A;  3KD0 A;  1SKR B;  3APO A;  2PPT A;  4G19 A;  4OWY A;  4WEY A;  2YV7 A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  5IPH A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  1F3A A;  3G7J A;  5H5Q A;  2IL3 A;  5A4W A;  1XWK A;  5CRD A;  1HNA A;  1YEP A;  4MH3 A;  4HDE A;  2FA4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3F9U A;  3G7Y A;  4TXO B;  5HR3 A;  1O81 A;  2VL9 A;  3IPZ A;  2YWO A;  2CAQ A;  3DML A;  2VO4 A;  2VIM A;  1O85 A;  2CZ2 A;  1B8X A;  5CAX A;  5KN1 A;  3F4T A;  1XZO A;  2X99 A;  1GLQ A;  2VCV A;  4NMU A;  3WYW A;  4LMW A;  5IMD A;  2P31 A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  4GWR A;  4N30 A;  2K18 A;  1BX9 A;  1FHE A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  5LNK e;  2XC2 A;  5IO0 A;  1WJK A;  1KTE A;  1GH2 A;  1SK2 A;  4OCF A;  1O8W A;  2H30 A;  4BA7 A;  1A8L A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  5B6N A;  5G1K A;  1TU7 A;  2QSI A;  3MAK A;  5HFI A;  4PNF A;  4HJM A;  1H75 A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  2YPM A;  1YZX A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  2C1Y A;  3DEX A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  2EC4 A;  1O73 A;  4ACS A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  1XVW A;  1KEB A;  1O6J A;  5FT3 A;  5AIS A;  5DJM A;  1SK1 A;  1BYE A;  4PUF C;  5FWG A;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  1Q4J A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4DVC A;  2L59 A;  5G30 A;  2H1G A;  3HVX A;  1QMV A;  3IK9 A;  3SWL A;  3D5J A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  2EIR A;  3RAZ A;  1GSE A;  4GRF A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1GTB A;  5L71 A;  1XIY A;  2IY2 A;  4H86 A;  4V2N A;  1A2J A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  4ML1 A;  8GSS A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  1A8Y A;  2IME A;  2VCT A;  1Z6N A;  2VD0 A;  2WRT A;  2MZC A;  1WRY A;  2HFD A;  3LEF A;  3GKX A;  3Q74 A;  3UOM A;  1T4Y A;  3PR8 A;  3ZZX A;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  2JZR A;  4GST A;  5HFG A;  3FYG A;  5AN1 A;  2HXK A;  2B5E A;  2WB9 A;  4EXJ A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  2F8F A;  1EP7 A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4WBR D;  1ZCP A;  3KZQ A;  3VWW A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  5CYY A;  22GS A;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  2EIO A;  4L5O A;  4GSN A;  5F05 A;  1O8X A;  2BJX A;  2H66 A;  5LD0 A;  5DBQ A;  1UVZ A;  1HNC A;  1FB6 A;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  4KE3 A;  4K0G A;  1Z7R A;  3J7Y k;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  2V2G A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  4KUN A;  1X9W B;  3WGD A;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  2E2M A;  4KGI A;  4JR4 A;  1LJR A;  2OE1 A;  2CVB A;  3L9U A;  4ZL8 A;  1AQW A;  1GLP A;  3GH9 A;  2HZE A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  4OFN A;  1GNE A;  1YF0 A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1T8E B;  3TDG A;  5HR2 A;  2L4C A;  3SBC A;  2H70 A;  2GSR A;  4YAP A;  11GS A;  4ECC A;  2IWT A;  4JBB A;  4GF0 A;  4DEJ A;  2VUP A;  4POK A;  3M0F A;  3RHB A;  1O7U A;  1AIU A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  3EE2 A;  5J5N A;  1ZL9 A;  1WIK A;  2L5O A;  2CX4 A;  4TR1 B;  2X8C A;  1YDK A;  3NZN A;  4P3Y B;  2REM A;  1QQ2 A;  2NBS A;  4F03 A;  3HJO A;  4TKY A;  4MCU A;  4IGJ A;  4X43 A;  1CQH A;  2MBT A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2WS2 A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  2PVO C;  1I5G A;  3NIV A;  3DRN A;  2ON7 A;  1XCC A;  1TOF A;  3C8E A;  1WWJ A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  2GT6 A;  2I1U A;  1THO A;  3FZ4 A;  5G1L A;  4KB3 A;  4RQR A;  3N5O A;  2WUL A;  2P5Q A;  4KA0 A;  1TI1 A;  4PUR A;  1GTU A;  2WFC A;  5IMC A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  2BTO T;  2K8S A;  2N5F A;  4IP6 A;  5G2Z A;  2WZ9 A;  4ZBD A;  2H8L A;  2B7J A;  3FR3 A;  4KDU A;  4LLR A;  1SD9 A;  2GZP A;  2HRN A;  5ECS A;  3Q19 A;  2H6X A;  3GX0 A;  1PX6 A;  2AYT A;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  2C0E A;  2JSY A;  3BOA A;  1A2L A;  2C80 A;  1MDI A;  3LYK A;  3ZFB A;  1GRX A;  2H1D A;  1DBY A;  4HZ4 A;  4HI7 A;  2DIZ A;  3L78 A;  4E8H A;  1R7H A;  5JWR B;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3NOF A;  3D4M A;  5DVB A;  4Q5N A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  2XPE A;  4YQM A;  2YJ7 A;  2K9F A;  2FA8 A;  3BBY A;  3HJM A;  17GS A;  3AY8 A;  1Y25 A;  4I5Q A;  1WMJ A;  3KP8 A;  3DD3 A;  1SU9 A;  1PD2 1;  2GTU A;  3IA1 A;  1Z3E A;  2JL4 A;  5ID2 B;  2B5X A;  1K0O A;  4MJA A;  4YAV A;  5GZZ B;  4MA9 A;  5DAK A;  4JZQ A;  1Z5Y E;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  3TCO A;  4MJB A;  1K3L A;  2JAD A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  2WJU A;  4ECJ A;  4XCS A;  2DJ1 A;  4YQU A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  1BED A;  3ZVJ A;  1ABA A;  1VF1 A;  4EO3 A;  3LXT A;  3HCZ A;  4K7N A;  4MH2 A;  3W8S A;  2IN3 A;  3ZIT A;  1R4W A;  1E6B A;  3V1W A;  4XS4 A;  4O5R A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  1EGO A;  4NXI A;  1FOV A;  1NW2 A;  3HHV A;  2R5G A;  2RII A;  4V1A g;  4F9Z A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  3ZYW A;  5FHI A;  2GSQ A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  2YZH A;  2WCI A;  3IDV A;  2HSY A;  6GSS A;  4TXO A;  1V40 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  4Q5F A;  4X1U A;  5B8A A;  1SYX A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  2L4Q A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  2LJR A;  4TR4 A;  1PSQ A;  1EEJ A;  4E8E A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3KH9 A;  1M2D A;  3VI7 A;  1PMT A;  3TB2 A;  4BVY A;  1GP1 A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  3IR4 A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  2P5R A;  3ERW A;  2VLV A;  2ES7 A;  4NPB A;  2BMX A;  2Z9S A;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  2NPB A;  1TRW A;  2YOI A;  1A2M A;  2DMM A;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3PH9 A;  4MF7 A;  1ML6 A;  2VL2 C;  4O7H A;  2GQL A;  6GSY A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  2H73 A;  1V58 A;  1A0R P;  2VOC A;  4RI6 A;  2FCH A;  4PQ1 A;  1TK5 B;  2J9H A;  3RPN A;  3EIN A;  2NTO A;  3MWH A;  1TU8 A;  4OO4 A;  4AJ6 A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3E3E A;  2HSH A;  3F4S A;  2IIY A;  2O8V B;  3M1G A;  1GL8 A;  1J0F A;  3KP9 A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  4GSS A;  4JU5 A;  4DSQ A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  3LWA A;  3FK8 A;  4XHM A;  2LV3 A;  3FR6 A;  2MYG A;  1OC8 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  5G5F A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  2VLT A;  1AC1 A;  3EU4 A;  3HD5 A;  2VM2 A;  1MDJ A;  1JFU A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  5D8I A;  2I4A A;  3LQ7 A;  2H71 A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  3CTG A;  2HRF A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  1ZGN A;  1S3A A;  1U87 A;  3ZMK A;  1GNW A;  4HQS A;  5IOX A;  2A2S A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  2O7K A;  4HU7 A;  2ON5 A;  5IQY A;  2GT5 A;  5HR1 A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  3HA9 A;  5IM9 A;  4ZIJ A;  3FW2 A;  3ZRE A;  4I97 A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  3FR9 A;  3VK9 A;  3D4T A;  2LRC A;  3M3M A;  3GKM A;  3UAP A;  4OO5 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3IRA A;  1B48 A;  1ZZY A;  2GLR A;  4PQI A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  2LEG A;  4MK3 A;  2PMT A;  2FWF A;  2K8V A;  5DQY A;  7GSS A;  5B7C A;  2H74 A;  3M8N A;  1U6T A;  3TKQ A;  1B9Y C;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  3C73 A;  2QGV A;  3W6G A;  3PGT A;  3D6I A;  1K3O A;  4HZ2 A;  3UVT A;  4I8B A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  4MJC A;  4IBP A;  1XW6 A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1WPI A;  1VF3 A;  1RQM A;  2FWG A;  3CSH A;  5DAL A;  3GUS A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  3KIJ A;  2GQM A;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  1E2Y A;  4OMV A;  3RPP A;  4XRA A;  2AB6 A;  2JZT A;  3I6A A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  4JE1 A;  1SD8 A;  1OE8 A;  1UN2 A;  3LSZ A;  4RQX A;  3UBL A;  2CVD A;  1AQV A;  3GRX A;  1JZO A;  4GQC A;  3G7I A;  1PQN A;  3WT2 A;  2D2Z A;  5H5R A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  2CZ3 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  3VUR A;  1F9M A;  3GFK A;  3BCI A;  3FEU A;  4HUA A;  4ISD A;  2F8A A;  3DGQ A;  3KM6 A;  4EVM A;  1F3B A;  2N5B A;  1OKD A;  3H4K A;  4TRX A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  3APQ A;  5IIZ A;  1Z6M A;  2IMK A;  1YJ6 A;  3GTU B;  5ECH B;  2RLI A;  2CVK A;  2H1B A;  2MMN A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  3VWU A;  4N11 A;  3GNJ A;  4GLT A;  2FWH A;  3KMN A;  4MZW A;  4ZBA A;  2P0G A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  5GAP D;  4MZB A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  4ECI A;  1K0B A;  3GKN A;  3KEB A;  13GS A;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  4PXO A;  1Q98 A;  4Q5R A;  2LKU A;  5EVO A;  3EMP A;  1VF4 A;  3QDN A;  3DYR A;  2GS3 A;  2E2G A;  2H19 A;  9GSS A;  3HVS A;  1CQG A;  3TOT A;  5J3R A;  3WGE A;  1EOH A;  1EOG A;  2ZCT A;  5EL8 A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  2KLX A;  4TR0 A;  2LJA A;  3KMO A;  3KCM A;  2YV9 A;  3GST A;  3W8J A;  3KJY A;  2X64 A;  4MAB A;  3FZ5 A;  1A0F A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  5ID2 A;  4XTS A;  1SL1 B;  3P2A A;  2ZUP A;  5CRE A;  1PKW A;  1URM A;  2VCQ A;  3RHC A;  1JZW A;  1BQ7 A;  1J08 A;  1MTC A;  4G10 A;  1K0M A;  3FRC A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2IYJ A;  1EV4 A;  2E7P A;  3MSZ A;  3L9V A;  4IJI A;  1NM3 A;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1R5A A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  2OE3 A;  3Q18 A;  3TJF A;  3JCM L;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1GSS A;  3E9J B;  5ECK B;  2HE3 A;  5J41 A;  1EEM A;  5GSS A;  1U3I A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  2DJJ A;  4IS0 A;  1NHO A;  1ZYE A;  1K0A A;  1QFN A;  3WT1 A;  2GST A;  5HR0 A;  1WE0 A;  2YWI A;  4NWY A;  2KP2 A;  1XOB A;  5JCU A;  1GUL A; 
#chains in the Genus database with same CATH topology
 1ZS7 A;  1OPY A;  2I3Y A;  3HZP A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3JUO A;  1WNH A;  3QK9 A;  2CG1 A;  4L8P A;  1VQK 3;  3IC4 A;  1S3C A;  3HXS A;  4L7K A;  4D73 A;  4HM4 B;  4CJN A;  1VGL A;  3NV0 A;  1NB5 I;  3GH6 A;  2P05 A;  2GEX A;  2MC8 A;  1YF1 A;  3O6T A;  3ZIJ A;  4EV2 A;  2L6D A;  2AV4 A;  2WGO A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  1E3V A;  1RGH A;  5F0G A;  2KHP A;  2C11 A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  3PYJ A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  4OK0 A;  3CXC 2;  1N5P A;  3CPO A;  2HZE B;  3EMX A;  1FZU A;  1T3B A;  1QAK A;  1T4Z A;  1QAL A;  2B1X B;  1EQK A;  1ACV A;  6GSW A;  3FZ9 A;  3PCR A;  3CCE 3;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  3F7X A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1W6G A;  3EBT A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  3LTA A;  4LL1 B;  2FNO A;  3OV4 A;  3GL5 A;  1N9E A;  1A2K A;  1B2X A;  4KFD A;  5G5E A;  4FR9 A;  2BHM A;  1G6W A;  2L5L A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  1LOW A;  4POM A;  3DKS A;  4QQ7 A;  4WET A;  4FCJ A;  2A4V A;  3ER7 A;  3MYD A;  2BMQ B;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  1VQQ A;  2VAF A;  1WOU A;  4R9L A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  1U5O A;  4IT7 A;  3IC8 A;  1RLS A;  1PU4 A;  1QVF 2;  1Z1S A;  2H1A A;  3Q3F A;  3T8N A;  4KAE A;  4PNG A;  4YH2 A;  2WO0 A;  1M90 4;  1UUW B;  2C3Q A;  1GYB A;  1FAA A;  3E99 A;  1G7O A;  4HYZ A;  5GAN D;  3H8Q A;  3IAM 2;  1QVG 2;  1UCI A;  1YVS A;  2OE0 A;  3CU3 A;  4LMI A;  3B4P A;  3GRD A;  4EUY A;  2O85 A;  2DKI A;  3V99 A;  3QMX A;  2SAR A;  2DLX A;  4BL7 B;  2Z76 A;  3FKA A;  2XR8 B;  1MDK A;  2OJL A;  4POB A;  2YFI B;  1FVJ A;  2OQE A;  1VF2 A;  1YY7 A;  4TN8 A;  1SQW A;  1BRK A;  2CC3 A;  2IFQ A;  2XFS A;  4JED A;  3QAV A;  3MYT A;  4HM5 B;  3EN1 B;  1SII A;  4NRE A;  1TRP A;  4WHA A;  4HS1 A;  1AY7 A;  1JBR A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  3FLJ A;  4J56 E;  1RN4 A;  1HYU A;  1LQG C;  3D5G A;  5KN0 A;  1AR0 A;  19GS A;  3H3H A;  3BCK A;  3L0H A;  3WGX A;  3GZB A;  2H75 A;  1BAY A;  4N10 A;  4FYU A;  1A2V A;  5COH A;  1ZYP A;  1SL2 B;  2F99 A;  4GQF A;  1ZO2 A;  1YJN 3;  5I97 A;  2MF7 A;  3OXA A;  1TTO A;  3MWZ A;  1XWG A;  2L4V A;  1N8J A;  2W04 A;  4CY6 A;  5EEO A;  2IMJ A;  3P90 A;  3I69 A;  5D9W A;  1IVX A;  1TP9 A;  3BNE A;  4O5Q A;  5KN2 A;  1VRS D;  4QL9 A;  4CPK A;  3GHA A;  5KP1 A;  3G0K A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  4EYC A;  1GMQ A;  3ME7 A;  2LRT A;  5CK6 A;  1W01 A;  3DVW A;  4ZXG A;  4EC0 A;  1N8Q A;  1GSU A;  1B20 A;  1D6Z A;  1S5A A;  5BIR A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  3PXM A;  2RFR A;  1ON4 A;  4HM2 B;  3D79 A;  3WOD G;  2CQ9 A;  3ZL5 A;  4F2I A;  2P0X A;  3BNC A;  4IQA A;  4FMD A;  4EF0 A;  1UGI A;  4ZB6 A;  2ZDJ A;  4G9H A;  1C7H A;  3UL3 A;  1X5C A;  1WQL B;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  1DET A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  4BVX B;  1IYI A;  4K90 B;  3UVH A;  6GSV A;  3KCH A;  2LNT A;  2JDI H;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  1ULI B;  3TJG A;  1N9J A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  3SVA A;  5G31 A;  2FUG 2;  1DVD A;  3EE1 A;  3B8L A;  1JB5 A;  5CF2 A;  3G4S 3;  5A4U A;  3D0Z A;  3FSD A;  4R9K A;  1PA3 A;  3PIN A;  3UBK A;  3KN4 A;  3I43 A;  4EDZ A;  1M7T A;  1LOV A;  4MMZ B;  5ELU A;  3WMD A;  1UI7 A;  1X1Y A;  4F0C A;  5DRV A;  3KTB A;  4GTU A;  3CC2 3;  4IEL A;  1VQ5 3;  2F9S A;  5D81 A;  3KFQ C;  9RNT A;  2DML A;  4HM7 B;  5CRH A;  4PUA A;  1MWT A;  4NAX A;  1G7E A;  2IPA A;  1M1X B;  4HM8 B;  3VI5 A;  1U88 A;  2OWP A;  3A76 A;  1I0X A;  2CG0 A;  1GTI A;  1XBS A;  5H5S A;  1DVC A;  1PFP A;  2INX A;  4WYK B;  2ALB A;  2F51 A;  2VL3 A;  1OC9 A;  1AW9 A;  3HOH A;  5JPU A;  2C0G A;  2BO9 B;  3VWX A;  3L4N A;  3MIX A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  1BUQ A;  3LJR A;  5DAK B;  3HKR A;  2P09 A;  3X41 A;  3F40 A;  1F6M C;  2CAI A;  5CXO A;  5GST A;  1YEX A;  2PER A;  1WMO A;  2M46 A;  3LXZ A;  4DSS B;  1VQ8 3;  1NJI 4;  2F86 B;  4GSP A;  3ISO A;  1ROV A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  4WFO A;  2HLS A;  1MD4 A;  1YNV X;  3I9V 2;  3VWV A;  3CD6 3;  3JUQ A;  4GXZ A;  1JKG A;  2W9Q A;  5KOW A;  4O32 A;  2QEX 3;  2V32 A;  4N6U A;  3CCV 3;  1MD3 A;  2IMD A;  2QGU A;  1YQ1 A;  2NDO A;  2OAD A;  4STD A;  4MZC A;  4LSO A;  3M9K A;  2W0Q A;  1O7M B;  2OBI A;  2FGT A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  1JBS A;  3ZIV A;  5E4W A;  4KFE A;  1R26 A;  3TJJ A;  2GBX B;  1XW5 A;  4AKZ A;  1XXU A;  2VCX A;  3DGM A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  1Q9E A;  3IXR A;  1KBN A;  1V74 A;  1BRS A;  4GHO A;  2TRC P;  4XS4 B;  1M2B A;  4JRF A;  4BTX A;  2DKH A;  3KD0 A;  1SKR B;  3APO A;  1D6U A;  1W4N A;  3EF8 A;  2PPT A;  1HZ1 A;  4G19 A;  4OWY A;  1TU5 A;  1WTH A;  4WEY A;  2YV7 A;  1CYV A;  8CHO A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  3KSP A;  1EG9 B;  5BVB A;  3QRD A;  5IPH A;  3RGR A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  3PZW A;  1YGE A;  1M1K 4;  4MEI A;  1F3A A;  3G7J A;  5H5Q A;  4OUQ A;  2AAD A;  2IL3 A;  3S27 A;  1XWK A;  5A4W A;  1JN5 A;  5CRD A;  3S28 A;  1HNA A;  1YEP A;  1RNB A;  3KE7 A;  4MH3 A;  1BNI A;  4HDE A;  2CFL A;  2FA4 A;  1GD4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3SYU A;  4N6O B;  3F9U A;  4Q53 A;  3G7Y A;  4TXO B;  5HR3 A;  1Y4K A;  1S72 3;  1O81 A;  2W56 B;  2VL9 A;  3IPZ A;  1FGR A;  1BIR A;  2YWO A;  2CAQ A;  1LOX A;  3DML A;  1TRQ A;  2VO4 A;  4FMB A;  2VIM A;  1O85 A;  2CZ2 A;  1BNF A;  3LXU X;  3SLU A;  2A2P A;  1B8X A;  5CAX A;  4DKI A;  1X1W A;  1FGO A;  5KN1 A;  1FUW A;  3F4T A;  3EC9 A;  1XZO A;  3FF2 A;  4N6V 0;  2X99 A;  1K73 4;  3X3Y A;  4HKV B;  1GLQ A;  3MHE A;  2IUJ A;  1C54 A;  1MGR A;  1QMA A;  5IG5 A;  2VCV A;  4NMU A;  3J7Y d;  3WYW A;  2W6J H;  4LMW A;  3PGB A;  1DYU A;  3T8U A;  3CCJ 3;  4BVY B;  3F8X A;  5IEP A;  5IMD A;  2P31 A;  1MNL A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  1WMP A;  4GWR A;  4N30 A;  1W2Z A;  3BLZ A;  2K18 A;  1TIJ A;  1BX9 A;  1FHE A;  1FUT A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  4NHF A;  5LNK e;  3X42 A;  2XC2 A;  1XG8 A;  5IO0 A;  1WJK A;  1LQM B;  1KTE A;  1GH2 A;  1SK2 A;  5JBS A;  4OCF A;  1O8W A;  2H30 A;  1UGH I;  3IJE B;  4FCM A;  4BA7 A;  1A8L A;  4R4K A;  3R3E A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  1OF5 B;  3CCL 3;  4BL3 A;  1IQ8 A;  5B6N A;  5G1K A;  4XBX A;  1TU7 A;  2QSI A;  4KF9 A;  3MAK A;  5HFI A;  1BVI A;  4PNF A;  4HJM A;  3CME 3;  3DXO A;  4ORL A;  1H75 A;  1RMS A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  3H51 A;  1GMR A;  2YPM A;  1YZX A;  4MNN A;  5KP4 A;  3IPT A;  1HU9 A;  3LT8 A;  1LXE A;  3CMA 3;  1OHP A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  1VQM 3;  1TFK A;  2C1Y A;  3DEX A;  4XB5 A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  4HAA A;  2EC4 A;  1O73 A;  4ACS A;  4L8O A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  3CCU 3;  3G6E 3;  1XVW A;  1KEB A;  1O6J A;  2HMK B;  3EPT A;  1FGQ A;  2KAA A;  5FT3 A;  2E2U A;  5AIS A;  3DGN A;  3NBJ A;  1KWI A;  1RN1 A;  1M3J A;  5DJM A;  1SK1 A;  3VF1 A;  1BYE A;  4PUF C;  5FWG A;  3I56 3;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  2BU4 A;  2HML B;  4K5S A;  1Q4J A;  1A67 A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4HVN A;  4DVC A;  2L59 A;  1B3S A;  5G30 A;  2H1G A;  1DMM A;  2XSO B;  3HVX A;  1OAC A;  1QMV A;  3IK9 A;  2LYX A;  3SWL A;  3D5J A;  1I70 A;  3K0Z A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  1IYY A;  5KP3 A;  2EIR A;  3RAZ A;  3V98 A;  1GSE A;  4GRF A;  3A5E A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1IQX A;  1CQS A;  5IW9 A;  1GTB A;  5L71 A;  1XIY A;  1AVL A;  1U8C B;  2IY2 A;  4H86 A;  4V2N A;  1A2J A;  3JUP A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  1Q40 B;  1W5Z A;  4ML1 A;  1O7W B;  1UCJ A;  2XH9 A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  8GSS A;  2F5W A;  4J5G A;  1X1X A;  5EQL A;  1A8Y A;  3K9M C;  3DGY A;  2IME A;  3KII A;  2VCT A;  1Z6N A;  1T5Y A;  3RGA A;  2VD0 A;  1FW7 A;  2MZC A;  3RDE A;  2WRT A;  1TFO A;  1BSB A;  1WRY A;  2HFD A;  3GKX A;  3LEF A;  3Q74 A;  4PTS A;  3UOM A;  3D3L A;  1T4Y A;  3PR8 A;  3ZZX A;  1Q81 4;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  5DRE A;  2JZR A;  4GST A;  5HFG A;  1RKY A;  3FYG A;  6STD A;  5AN1 A;  2HXK A;  1RGC A;  2B5E A;  2WB9 A;  4EXJ A;  3ALA A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  1B2S A;  2F8F A;  1EP7 A;  2RGQ A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4XDV A;  4WBR D;  1ZCP A;  3KZQ A;  4LGQ A;  2R0P A;  3VWW A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  3CNX A;  5CYY A;  3URP A;  22GS A;  1O7N B;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  3OX9 A;  2EIO A;  3I55 3;  2V1L A;  4L5O A;  3DY5 A;  3SOY A;  4GSN A;  3BND A;  5F05 A;  4PEJ A;  3CPW 2;  5STD A;  1O8X A;  5M19 A;  3GWR A;  1GMP A;  3JUM A;  2BJX A;  2H66 A;  5LD0 A;  3STD A;  5DBQ A;  2RCD A;  1HKX A;  4MMY B;  1UVZ A;  1HNC A;  1FB6 A;  1GS3 A;  2OCT A;  1YHQ 3;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  3B4O A;  4KZ1 A;  4XM4 A;  2GSP A;  4KE3 A;  4K0G A;  1Z7R A;  1K9M 4;  3J7Y k;  3D9R A;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  1RN7 A;  2V2G A;  1YJW 3;  4I4K A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  4OVM A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  3HI7 A;  4KUN A;  2HMO B;  2O3O A;  3AMO B;  1X9W B;  3WGD A;  1UUG B;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  3NX0 A;  2E2M A;  4HSC X;  4KGI A;  4JR4 A;  1Q7H A;  3FG4 A;  1BRH A;  1LJR A;  2OE1 A;  1BRI A;  2CVB A;  3L9U A;  4ZL8 A;  1UDI I;  3M8C A;  1AQW A;  1GLP A;  1B21 A;  3GH9 A;  2K0M A;  2HZE A;  3CCQ 3;  1BNG A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  1IVU A;  1MWS A;  4OFN A;  1VQO 3;  1A90 A;  1GNE A;  1YF0 A;  4FQU A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  1OUN A;  3EB8 A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1IQY A;  1T8E B;  3TDG A;  5HR2 A;  1Q7Y 4;  3SED A;  2L4C A;  1RHL A;  3SBC A;  2HMN B;  2H70 A;  2GSR A;  4YAP A;  1RSN A;  11GS A;  3UL5 A;  4ECC A;  1KC8 4;  2IWT A;  3GZX B;  4JBB A;  4GF0 A;  3NM7 A;  4HM6 B;  4DEJ A;  3MG1 A;  4N6N B;  2VUP A;  4POK A;  3M0F A;  2PZV A;  1O7U A;  1AIU A;  3RHB A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  1FGM A;  1VQP 3;  3FZW A;  3EE2 A;  5J5N A;  2HRA A;  4X2O A;  3X3Z A;  1ZL9 A;  1WIK A;  5IF6 A;  2L5O A;  2GBW B;  2CX4 A;  4BIK A;  4TR1 B;  2X8C A;  2A4H A;  1YDK A;  4K61 A;  2ZL8 A;  3N8B A;  3NBR A;  3NZN A;  5CLK A;  4P3Y B;  3OWY A;  1EKM A;  1I8V A;  2REM A;  3F9S A;  1QQ2 A;  2NBS A;  4F03 A;  2CH9 A;  3HJO A;  4TKY A;  2BMR B;  4MCU A;  3CNM A;  4IGJ A;  4X43 A;  1CQH A;  1VQ4 3;  2MBT A;  1RRL A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2UGI A;  3Q90 A;  2WS2 A;  3PCS A;  3SXX A;  1VZZ A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  3PPU A;  2PVO C;  1I5G A;  3MSO A;  2XGN A;  3NIV A;  3DRN A;  2ON7 A;  1X1U A;  3HX8 A;  1XCC A;  1GY5 A;  1TOF A;  2RSX A;  3C8E A;  3F8H A;  1WWJ A;  1OH0 A;  4XBT A;  3FGY A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  1OGX A;  2YX9 A;  1RCK A;  2GT6 A;  2I1U A;  1THO A;  1E97 A;  5G1L A;  3FZ4 A;  5AIH A;  1US1 A;  4KB3 A;  1RGA A;  4RQR A;  3N5O A;  3CCR 3;  2WUL A;  1RTU A;  2XGL A;  4WP5 A;  1G02 A;  2P5Q A;  1TI1 A;  4KA0 A;  4PUR A;  4G0K A;  2XF3 A;  3LTD A;  4J5K A;  4XBY A;  1GTU A;  2WFC A;  3HII A;  5IMC A;  2HSM A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  4ZM8 A;  2BTO T;  2K8S A;  1NO3 A;  2N5F A;  3NXJ A;  4IP6 A;  5G2Z A;  2WZ9 A;  2GXF A;  4ZBD A;  1VQ7 3;  3G8Z A;  2H8L A;  1BAN A;  2B7J A;  3FR3 A;  3EN8 A;  4KDU A;  3FG3 A;  4LLR A;  3CCM 3;  1SD9 A;  2GZP A;  2C10 A;  2HRN A;  5ECS A;  3GZY B;  3Q19 A;  5AII A;  5IG0 A;  2H6X A;  5AEW B;  3GX0 A;  1T2I A;  3HK4 A;  1PX6 A;  2ZA4 A;  1I3F A;  5EVH A;  2AYT A;  1Q82 4;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  4N6L A;  1I0V A;  3WA3 A;  2C0E A;  3BB9 A;  3DMC A;  2JSY A;  3BOA A;  1QAF A;  2O9U X;  1A2L A;  3UNL A;  2C80 A;  1MDI A;  1BNJ A;  1S3R A;  2CFG A;  1FA3 A;  2IA7 A;  3LYK A;  3ZFB A;  1GRX A;  5FW5 A;  2W9P A;  2H1D A;  2CK3 H;  5HGR A;  4XDW A;  4HZ4 A;  1DBY A;  3X40 A;  2A15 A;  4HI7 A;  2DIZ A;  3L78 A;  2BMO B;  4E8H A;  1GSP A;  2F98 A;  1R7H A;  1RGG A;  4GB5 A;  5JWR B;  1AQZ A;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3MKI A;  3NOF A;  2HMM B;  2WGQ A;  3D4M A;  5DVB A;  4Q5N A;  2WOF A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  1BU4 A;  2XPE A;  5AYS C;  4YQM A;  2IUK A;  3Q1C A;  2YJ7 A;  4HM3 B;  2K9F A;  2FA8 A;  1I3I A;  3BBY A;  17GS A;  2YFJ B;  1M9G A;  1PY3 A;  3AY8 A;  3HJM A;  1I2G A;  4Z2T A;  4AEQ A;  3DH2 A;  1Y25 A;  4I5Q A;  1IT7 A;  1WMJ A;  3KP8 A;  3DD3 A;  4WYK A;  1SU9 A;  1PD2 1;  2GTU A;  3UB1 A;  1Z3E A;  3IA1 A;  2JL4 A;  2OTJ 3;  5ID2 B;  2B5X A;  2QA4 3;  1B2M A;  1K0O A;  4Z2U A;  2QA1 A;  2BIR A;  5KOX A;  1NWW A;  1NDO B;  2CX1 A;  4MJA A;  4YAV A;  2KF4 A;  2KF3 A;  1W02 A;  3RNT A;  2L1S A;  5GZZ B;  3OWS A;  4MA9 A;  2CW9 A;  4EXR A;  5DAK A;  1AVK A;  1JB2 A;  4JZQ A;  3GAX A;  1Z5Y E;  2Y73 A;  1BNE A;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  2RBI A;  1BNR A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  3U97 A;  4X4J A;  3SX1 A;  3TCO A;  4MJB A;  2KXG A;  3KSE D;  1K3L A;  3T0U A;  2JAD A;  1E3R A;  3OWU A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  1ZYN A;  3A5I A;  1YJ9 3;  1M3I A;  2WJU A;  4YKG A;  4ECJ A;  1N8R 4;  4XCS A;  3B7C A;  2DJ1 A;  4YQU A;  4Z2R A;  1MWR A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  5ELJ A;  1BED A;  4N3V A;  5G2G A;  2F4Y A;  3ZVJ A;  1ABA A;  2E2V A;  4HM0 B;  2CIU A;  1VF1 A;  5JPP A;  4EO3 A;  3LXT A;  3K5T A;  2QIY A;  2Z77 A;  1DMN A;  3HCZ A;  4K7N A;  1JJ2 2;  1D6Y A;  4MH2 A;  3W8S A;  5IER A;  1YIT 3;  3DM8 A;  2IN3 A;  3ZIT A;  1R4W A;  5AIF A;  1J2B A;  1E6B A;  1K28 A;  3V1W A;  4XS4 A;  3GZR A;  3DUK A;  4RNY A;  4O5R A;  5M1A A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  2OOV C;  2CFD A;  1EGO A;  4NXI A;  3AGO A;  1FOV A;  1LVN A;  1TP6 A;  2F56 A;  1NW2 A;  1JV2 B;  1PN0 A;  3HHV A;  2R5G A;  2CWV A;  2RII A;  4V1A g;  4F9Z A;  1B27 A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  1JB4 A;  3ZYW A;  5FHI A;  2GSQ A;  2RNT A;  2ML6 A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  3NV0 B;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  4WWU C;  2YZH A;  2WCI A;  1JBT A;  3IDV A;  2Z6B A;  3N9H A;  3D4A A;  3WDG B;  2HSY A;  4TXO A;  6GSS A;  1V40 A;  1KSI A;  2W56 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  3KKG A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  3Q2P A;  4Q5F A;  4X1U A;  5B8A A;  1G96 A;  4CY8 A;  1SYX A;  3LYG A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  1FYS A;  2L4Q A;  1IDP A;  1LNH A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  3CCS 3;  2LJR A;  4TR4 A;  1PSQ A;  1YIJ 3;  1EUI C;  1EEJ A;  4E8E A;  3DZL A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3EHC A;  3KH9 A;  1M2D A;  4CCV A;  3VI7 A;  1MOL A;  1PMT A;  3TB2 A;  4BVY A;  4LZI A;  3LT9 A;  1GP1 A;  3FCS B;  4KFF A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  2W03 A;  3IR4 A;  1PYL A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  5IEO A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  3WHO A;  2P5R A;  2W2C A;  3JVC A;  4QWT A;  3ERW A;  2VLV A;  3NBB A;  2ES7 A;  4NPB A;  2BMX A;  2Z9S A;  2YFL B;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  2CKF B;  3S5C A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  4BIR A;  2NPB A;  1TRW A;  3WOF B;  2YOI A;  1A2M A;  4HM1 B;  3MPH A;  2DMM A;  4HJL B;  1UUV B;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  1OF5 A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4HOH A;  1JNQ A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3V92 A;  3PH9 A;  4MF7 A;  1ML6 A;  1RGE A;  1W7C A;  2VL2 C;  4O7H A;  2GQL A;  4U13 A;  6GSY A;  1HYF A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  5BMU A;  1EA2 A;  1WMN A;  2H73 A;  1V58 A;  1A0R P;  3NUV A;  1KQS 2;  2VOC A;  1RCL A;  4RI6 A;  1W6Y A;  2FCH A;  4PQ1 A;  2J9H A;  1TK5 B;  3RPN A;  3EIN A;  2NTO A;  4AKY A;  2I9W A;  1TU8 A;  3MWH A;  4OO4 A;  4AJ6 A;  4EIP A;  5CF1 A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3LTC A;  3E3E A;  2HSH A;  3F4S A;  3VGN A;  2IIY A;  1UI8 A;  2O8V B;  3M1G A;  1GL8 A;  3KZT A;  1J0F A;  3KP9 A;  3LH4 A;  4N6T A;  3FMW A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  3MG3 A;  5LC6 A;  3BIR A;  4GSS A;  3F7S A;  4O2H A;  1L5G B;  7STD A;  1W2B 2;  4JU5 A;  3FF0 A;  4ICY A;  1IV9 A;  4DSQ A;  2UX0 A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  4O3V A;  2X49 A;  3LWA A;  3FK8 A;  1O7P B;  1Q86 4;  4XHM A;  3CQF A;  2K54 A;  2LV3 A;  3G16 A;  4GL6 A;  3FR6 A;  3HVN A;  2MYG A;  1OC8 A;  1OCV A;  4TX4 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  1GOY A;  3EJV A;  5G5F A;  3LZA A;  5IEN A;  4KT3 B;  2CWU A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  4HZ9 B;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  1VQ9 3;  2VLT A;  1AC1 A;  1VQ6 3;  3EU4 A;  3ECF A;  2QA2 A;  3HD5 A;  2VM2 A;  2XFT A;  1MDJ A;  1JFU A;  1GD3 A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  2CX0 A;  5D8I A;  2I4A A;  5AI1 A;  1Q40 A;  3LQ7 A;  1BOX A;  4J9A A;  2H71 A;  4K1V A;  2WOH A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  4USS A;  3AHS A;  3CTG A;  2HRF A;  1I2E A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  4A5P A;  1ZGN A;  4BTW A;  1S3A A;  1U87 A;  3K63 A;  1GNW A;  3ZMK A;  4HQS A;  5IOX A;  2A2S A;  1FUS A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  1RRH A;  2O7K A;  4HU7 A;  2ON5 A;  4BL2 A;  5IQY A;  1W6C A;  3WOE B;  3SOA A;  2GT5 A;  5HR1 A;  5LC7 A;  1BUJ A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  5FGO A;  1RGL A;  3WR2 A;  3HA9 A;  5IM9 A;  4ZIJ A;  2R0C A;  3FW2 A;  3ROB A;  2R0G A;  3F14 A;  3ZRE A;  1IK3 A;  8RNT A;  1RGF A;  3DGL A;  1GOV A;  4I97 A;  1ROA A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2FNQ A;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  1B2U A;  3FR9 A;  3VK9 A;  3D4T A;  1GOU A;  2LRC A;  3M3M A;  4O5U A;  4K1U A;  3GKM A;  4HZB B;  4OO5 A;  3UAP A;  3S29 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1SJW A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3G71 3;  4O8S A;  1BGS A;  3IRA A;  3UJM A;  1B48 A;  1ZZY A;  2JQ5 A;  2GLR A;  4PQI A;  3HIG A;  6RNT A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  1TUH A;  2LEG A;  4RZM A;  4EBG A;  4MK3 A;  2PMT A;  4EIQ A;  1JKG B;  5D82 A;  2FWF A;  2K8V A;  2D42 A;  5DQY A;  7GSS A;  5B7C A;  5TGN A;  1GY7 A;  2H74 A;  2P38 A;  3AHW A;  2HOH A;  3AMO A;  3M8N A;  2HRK A;  1RGK A;  3FH1 A;  1U6T A;  3TKQ A;  1B9Y C;  1LNI A;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  2KF5 A;  2FXT A;  3U1W A;  3C73 A;  2QGV A;  3W6G A;  4RNT A;  3PGT A;  1IVV A;  3D6I A;  3WA2 X;  1K3O A;  4HZ2 A;  3UVT A;  3X3X A;  4I8B A;  1F8N A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  2BT3 A;  4IBP A;  1XW6 A;  4MJC A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  1RNT A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1BSC A;  3FG1 A;  2P0M A;  1VF3 A;  1WPI A;  1RQM A;  2FWG A;  3CSH A;  3IHG A;  5DAL A;  3GUS A;  4FMC A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  1Q42 A;  1BSD A;  6GSP A;  2HMJ B;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  2GEY A;  3KIJ A;  4R1K A;  4R80 A;  2OOV A;  2KRT A;  1YVB I;  1BSA A;  2GQM A;  1JN5 B;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  4MJD A;  1E2Y A;  4OMV A;  5AIG A;  3RPP A;  1BSE A;  4XRA A;  2AB6 A;  4RBN A;  1NNV A;  1YGW A;  2JZT A;  3I6A A;  2Q07 A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  2ML5 A;  2PNC A;  2OTL 3;  1MWU A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  2GU1 A;  4JE1 A;  1SD8 A;  4HBR A;  1OE8 A;  1UN2 A;  3LSZ A;  2XRX B;  4RQX A;  4YKF A;  3UBL A;  3LW9 A;  4J8T A;  3BU4 A;  2CVD A;  1AQV A;  3GRX A;  2OQE C;  1JZO A;  2XSH B;  4GQC A;  3G7I A;  1BRJ A;  2M7O A;  1PQN A;  3WT2 A;  1R4Y A;  3ZG0 A;  1I2F A;  1FOH A;  2D2Z A;  1CYU A;  5H5R A;  1LOY A;  4EC6 A;  2ZHX B;  4G0I A;  2LQV A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  5AYR B;  4X2H A;  3K7C A;  2CZ3 A;  3NM2 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  1CEW I;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2R4I A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  1UCL A;  3VUR A;  1F9M A;  2E2T A;  3BCI A;  3FEU A;  3GFK A;  4HUA A;  4ISD A;  2F8A A;  4K2X A;  3DGQ A;  3KM6 A;  1IU7 A;  4EVM A;  1R4C A;  1F3B A;  2N5B A;  1KD1 4;  1OHS A;  1UW1 A;  3NHX A;  1OKD A;  3H4K A;  4O02 B;  4TRX A;  1SPU A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  1K41 A;  3APQ A;  5IIZ A;  1CH0 A;  1Z6M A;  2IMK A;  1SIH A;  4H3U A;  4MMX B;  1YJ6 A;  2B24 B;  1FGT A;  3GTU B;  3MG2 A;  3NQZ A;  2RLI A;  5ECH B;  2CVK A;  2H1B A;  2K3D A;  2MMN A;  3CC7 3;  1B2Z A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  1O7G B;  2D1W A;  3VWU A;  4N11 A;  3GNJ A;  2CHC A;  3O8Y A;  4CDL A;  2BNG A;  3UL6 A;  1RDS A;  4GLT A;  2FWH A;  3KMN A;  1ZX2 A;  4MZW A;  4ZBA A;  4KVH A;  2P0G A;  2Z7A A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  4G0L A;  5GAP D;  2F5M A;  4MZB A;  1N5H A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  5A0O B;  4G1M B;  5BXQ A;  4ECI A;  1O7H B;  5RNT A;  1K0B A;  5GSP A;  7RNT A;  1BRG A;  3GKN A;  3KEB A;  4LYL B;  13GS A;  2SBL A;  1SAR A;  4JF8 A;  4LEH A;  1VQL 3;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  1PFO A;  1GY6 A;  4PXO A;  1Q98 A;  4Q5R A;  1ISK A;  4N6M A;  2LKU A;  5EVO A;  3ZG5 A;  3EMP A;  1QJG A;  1NU3 A;  2C4B A;  1VF4 A;  3QDN A;  3NQY A;  4FCZ A;  1K8A 4;  2E2G A;  2GS3 A;  3DYR A;  2H19 A;  7GSP A;  9GSS A;  3IMA B;  2X4A A;  1T2H A;  3HVS A;  3LTB A;  5IG3 A;  1CQG A;  3TOT A;  5J3R A;  4EW5 A;  3OW2 2;  3WGE A;  1EOH A;  1EOG A;  2R41 A;  2ZCT A;  5EL8 A;  4BTY A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  1DE3 A;  2KLX A;  4TR0 A;  2LJA A;  1STF I;  5D83 A;  3KMO A;  3KCM A;  1MGW A;  2YV9 A;  1DMQ A;  3EQQ B;  3GST A;  5BRT A;  1RJO A;  3KJY A;  2X64 A;  4MAB A;  3W8J A;  3FZ5 A;  1BNS A;  3N54 B;  1A0F A;  1IV7 A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  4EV5 A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  1IT8 A;  5ID2 A;  4K5R A;  4XTS A;  1SL1 B;  3CC4 3;  1ASK A;  3P2A A;  2ZUP A;  1PKW A;  1URM A;  2VCQ A;  5CRE A;  1OGZ A;  3RHC A;  3JUN A;  2J8X B;  3EBY A;  1ULJ B;  2CWT A;  1JZW A;  1BQ7 A;  2AAE A;  1J08 A;  1MTC A;  4G10 A;  3PS8 A;  1K0M A;  3FRC A;  1IVW A;  3I0Y A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2CFW A;  2IYJ A;  1EV4 A;  2E7P A;  3MSZ A;  2CFK A;  3LML A;  3L9V A;  4IJI A;  1NM3 A;  2XEP A;  1BRN L;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1BAO A;  1W00 A;  1R5A A;  3VSY A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  5AEU B;  2Y74 A;  2OE3 A;  1LRA A;  1OHO A;  3Q18 A;  4FMA A;  5HOH A;  3LOY A;  1VQN 3;  1YI2 3;  2STD A;  2KF6 A;  3TJF A;  3JCM L;  3D5I A;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1STD A;  1GSS A;  3S67 A;  3E9J B;  4H61 A;  2UUG C;  5ECK B;  3DGO A;  3BNB A;  2HE3 A;  5J41 A;  1AV4 A;  1EEM A;  5IG4 A;  5GSS A;  1U3I A;  2KCD A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  3ZFZ A;  4IIA A;  3GSP A;  1NB3 I;  1ZGX A;  2DJJ A;  2UZ8 A;  4IS0 A;  1A2P A;  1NHO A;  1ZYE A;  5M18 A;  1K0A A;  1UCK A;  1QFN A;  3WT1 A;  4BU4 A;  2GST A;  5HR0 A;  1JRQ A;  1WE0 A;  2GU3 A;  3L0R A;  3EX9 A;  2YWI A;  4RNZ A;  4NWY A;  2KP2 A;  1XOB A;  3AGN A;  5BU4 A;  5JCU A;  4IPB A;  1GUL A; 
#chains in the Genus database with same CATH homology
 2I3Y A;  1BG5 A;  4I2T A;  2R3X A;  4MP4 A;  3IC4 A;  1S3C A;  3HXS A;  4D73 A;  1VGL A;  3GH6 A;  1YF1 A;  3O6T A;  3ZIJ A;  2L6D A;  2AV4 A;  4MLY A;  5D9V A;  2B6M A;  3LFL A;  1XPV A;  3F6F A;  5F0G A;  2KHP A;  3HZ4 A;  4ZL7 A;  5IOW A;  4HOJ A;  5KEJ A;  2KUC A;  1TDI A;  4TVE A;  2IFQ B;  5IMA A;  1EP8 A;  4KDX A;  3ERF A;  2HZE B;  3EMX A;  1T3B A;  1T4Z A;  1ACV A;  6GSW A;  3FZ9 A;  2A2R A;  4K9Z A;  3H1N A;  4K7O A;  1SEN A;  2GQK A;  1X5E A;  2RUF A;  1KNG A;  3RBT A;  4J57 E;  4XRD A;  1B9X C;  3O3T A;  5IO2 A;  1PN9 A;  4LL1 B;  2FNO A;  3GL5 A;  5G5E A;  2L5L A;  1G6W A;  4CW9 A;  2LQO A;  3ZVJ D;  4PX1 A;  4JRR A;  2C0D A;  1TXX A;  2I81 A;  2MMZ A;  1ZYQ B;  4POM A;  4QQ7 A;  3DKS A;  4WET A;  2A4V A;  3MYD A;  1GUK A;  2L6C A;  3ME8 A;  1T1V A;  3CSI A;  1GSY A;  2VAF A;  1WOU A;  3CXG A;  2PU9 C;  3BD2 A;  4JR6 A;  3IC8 A;  2H1A A;  4KAE A;  4PNG A;  4YH2 A;  2C3Q A;  1FAA A;  1G7O A;  5GAN D;  3H8Q A;  3IAM 2;  2OE0 A;  4EUY A;  2O85 A;  2DKI A;  3QMX A;  2DLX A;  4BL7 B;  1MDK A;  2OJL A;  4POB A;  1FVJ A;  1VF2 A;  1YY7 A;  4TN8 A;  2IFQ A;  4JED A;  3QAV A;  4HS1 A;  2DIY A;  1G0T A;  2OBK A;  2QC7 A;  2B1L A;  4J56 E;  1HYU A;  5KN0 A;  19GS A;  3BCK A;  3L0H A;  3WGX A;  2H75 A;  4N10 A;  1BAY A;  4FYU A;  5COH A;  1ZYP A;  1SL2 B;  4GQF A;  1XWG A;  1N8J A;  4CY6 A;  3P90 A;  3I69 A;  5D9W A;  1TP9 A;  4O5Q A;  5KN2 A;  1VRS D;  4QL9 A;  3GHA A;  2QKE A;  5ABR A;  1M9A A;  3MNG A;  3ME7 A;  2LRT A;  3DVW A;  4ZXG A;  4EC0 A;  1GSU A;  1QGV A;  3ZRD A;  1USB A;  2FD3 A;  4XS6 A;  1ON4 A;  2CQ9 A;  3ZL5 A;  4F2I A;  4IQA A;  4EF0 A;  4ZB6 A;  4G9H A;  3UL3 A;  1X5C A;  3L9S A;  4V2M A;  1EGR A;  2G0F A;  4IVF A;  2WDU A;  3A5W A;  1W89 A;  3CSJ A;  4BVX B;  1IYI A;  3UVH A;  6GSV A;  2LNT A;  10GS A;  2FGX A;  4MF5 A;  20GS A;  1GTA A;  3TJG A;  4XS1 A;  2GZZ A;  4MDC A;  3EYT A;  5G31 A;  2FUG 2;  5A4U A;  3D0Z A;  1PA3 A;  3PIN A;  3UBK A;  3I43 A;  4EDZ A;  1M7T A;  4F0C A;  3KTB A;  4GTU A;  4IEL A;  2F9S A;  2DML A;  5CRH A;  4PUA A;  4NAX A;  1G7E A;  2IPA A;  3VI5 A;  1U88 A;  1GTI A;  1XBS A;  5H5S A;  2F51 A;  2ALB A;  2VL3 A;  1OC9 A;  1AW9 A;  2C0G A;  3VWX A;  3L4N A;  3MIX A;  1A23 A;  5HFK A;  4ML6 A;  2AHE A;  2LUS A;  3LJR A;  5DAK B;  3HKR A;  1F6M C;  2CAI A;  5GST A;  1YEX A;  2PER A;  3LXZ A;  2M46 A;  4DSS B;  3ISO A;  3HY2 A;  2LQQ A;  4FYB A;  2AJQ B;  2HLS A;  1MD4 A;  3I9V 2;  3VWV A;  4GXZ A;  5KOW A;  4O32 A;  2V32 A;  1MD3 A;  2IMD A;  1YQ1 A;  2NDO A;  2OAD A;  4MZC A;  3M9K A;  2OBI A;  4ID0 A;  1G6Y A;  2YJH A;  3TKS A;  4BVX A;  3ZIV A;  5E4W A;  1R26 A;  3TJJ A;  1XW5 A;  1XXU A;  2VCX A;  2XBQ A;  2PN8 A;  1C72 A;  2J23 A;  3IXR A;  1KBN A;  2TRC P;  4XS4 B;  1M2B A;  2DKH A;  3KD0 A;  1SKR B;  3APO A;  2PPT A;  4G19 A;  4OWY A;  4WEY A;  2YV7 A;  3DIE A;  3EC3 A;  4IW9 A;  3DVX A;  5IPH A;  2PUK C;  1HD2 A;  1ERU A;  5B6M A;  3CBU A;  1F3A A;  3G7J A;  5H5Q A;  2IL3 A;  5A4W A;  1XWK A;  5CRD A;  1HNA A;  1YEP A;  4MH3 A;  4HDE A;  2FA4 A;  3P7X A;  5ECO B;  1PGT A;  1LU4 A;  2DJK A;  4K6X A;  3F9U A;  3G7Y A;  4TXO B;  5HR3 A;  1O81 A;  2VL9 A;  3IPZ A;  2YWO A;  2CAQ A;  3DML A;  2VO4 A;  2VIM A;  1O85 A;  2CZ2 A;  2A2P A;  1B8X A;  5CAX A;  5KN1 A;  3F4T A;  1XZO A;  2X99 A;  1GLQ A;  2VCV A;  4NMU A;  3WYW A;  4LMW A;  4BVY B;  5IMD A;  2P31 A;  2RUE A;  2GVP A;  4FYC A;  3UIW A;  2R6K A;  4GWR A;  4N30 A;  2K18 A;  1BX9 A;  1FHE A;  3UEM A;  1EWX A;  2MMA A;  2AAW A;  1R5P A;  1UC7 A;  4K2D A;  2XHF A;  3F0I A;  4OCE A;  5LNK e;  2XC2 A;  5IO0 A;  1WJK A;  1KTE A;  1GH2 A;  1SK2 A;  4OCF A;  1O8W A;  2H30 A;  4BA7 A;  1A8L A;  3R3E A;  3GYK A;  1NSW A;  6GSU A;  3GTU A;  4F0B A;  2V1M A;  5B6N A;  5G1K A;  1TU7 A;  2QSI A;  4KF9 A;  3MAK A;  5HFI A;  4PNF A;  4HJM A;  1H75 A;  1AXD A;  3IHQ A;  2GSS A;  4AJ7 A;  2YWN A;  2YPM A;  1YZX A;  4MNN A;  1EV9 A;  2V6K A;  1F2E A;  2VCW A;  2B3S A;  6GST A;  2C1Y A;  3DEX A;  2CT6 A;  3TKR A;  2DJ2 A;  3TJB A;  4OFM A;  2EC4 A;  1O73 A;  4ACS A;  4LA1 A;  3QAW A;  5JCG A;  3KTL A;  3HZ8 A;  4L0W A;  1XVW A;  1KEB A;  1O6J A;  3EPT A;  5FT3 A;  5AIS A;  5DJM A;  1SK1 A;  1BYE A;  4PUF C;  5FWG A;  5CP1 A;  1S3D A;  5F8B A;  5EY6 A;  4K5S A;  1Q4J A;  2MMO A;  1XFL A;  1V98 A;  1K0D A;  4DVC A;  2L59 A;  5G30 A;  2H1G A;  3HVX A;  1QMV A;  3IK9 A;  3SWL A;  3D5J A;  4BWQ A;  1SJZ A;  2M80 A;  2C3T A;  1TTZ A;  2EIR A;  3RAZ A;  1GSE A;  4GRF A;  1XWA A;  2LNS A;  3GV1 A;  3H79 A;  4PGT A;  1TI3 A;  4L0U A;  1GTB A;  5L71 A;  1XIY A;  2IY2 A;  4H86 A;  4V2N A;  1A2J A;  3UMA A;  3TOU A;  5JWQ B;  1ERW A;  4ML1 A;  8GSS A;  3ZTL A;  1SK0 A;  3WD6 A;  4XIH A;  1A8Y A;  2IME A;  2VCT A;  1Z6N A;  2VD0 A;  2WRT A;  2MZC A;  1WRY A;  2HFD A;  3LEF A;  3GKX A;  3Q74 A;  4PTS A;  3UOM A;  1T4Y A;  3PR8 A;  3ZZX A;  5ECQ B;  3F3Q A;  3S9F A;  1V9W A;  2JZR A;  4GST A;  5HFG A;  3FYG A;  5AN1 A;  2HXK A;  2B5E A;  2WB9 A;  4EXJ A;  2WGR A;  4ZBB A;  1TRU A;  4OFT A;  2M72 A;  1GUM A;  3VFI A;  2F8F A;  1EP7 A;  3APS A;  3ED3 A;  2CX3 A;  12GS A;  4WBR D;  1ZCP A;  3KZQ A;  3VWW A;  2R0P A;  4EL1 A;  2V6O A;  2H72 A;  2PBJ A;  3GKK A;  5CYY A;  22GS A;  1QUW A;  4NV5 A;  4EDY A;  1DSB A;  4WF4 A;  2HYX A;  2EIO A;  4L5O A;  4GSN A;  5F05 A;  1O8X A;  2BJX A;  2H66 A;  5LD0 A;  5DBQ A;  1UVZ A;  1HNC A;  1FB6 A;  1Z7P A;  5KN3 A;  3DWV A;  4I2U A;  4KE3 A;  4K0G A;  1Z7R A;  3J7Y k;  5C00 A;  4IN0 A;  4X0X A;  2C4J A;  2V2G A;  1M99 A;  2B5Y A;  3QPM A;  5E59 A;  2DC5 A;  2XBI A;  2R4V A;  1BJX A;  1Y6E A;  3GMF A;  4POL A;  4KUN A;  1X9W B;  3WGD A;  1RK4 A;  1SJ6 A;  3A2W A;  1TKD B;  2E2M A;  4KGI A;  4JR4 A;  1LJR A;  2OE1 A;  2CVB A;  3L9U A;  4ZL8 A;  1AQW A;  1GLP A;  3GH9 A;  2HZE A;  2X8G A;  2TIR A;  1X5D A;  2K6V A;  4ILF A;  5D96 A;  4OFN A;  1GNE A;  1YF0 A;  4FQU A;  3EVI A;  4ZB9 A;  1XWB A;  2TRX A;  4TR3 A;  3F6D A;  5DAL B;  5D9X A;  1T8E B;  3TDG A;  5HR2 A;  2L4C A;  3SBC A;  2H70 A;  2GSR A;  4YAP A;  11GS A;  4ECC A;  2IWT A;  4JBB A;  4GF0 A;  4DEJ A;  2VUP A;  4POK A;  3M0F A;  3RHB A;  1O7U A;  1AIU A;  1W4V A;  3D22 A;  2XPD A;  3QR6 A;  3F8U A;  3EE2 A;  5J5N A;  2HRA A;  1ZL9 A;  1WIK A;  2L5O A;  2CX4 A;  4TR1 B;  2X8C A;  2A4H A;  1YDK A;  3NZN A;  4P3Y B;  2REM A;  1QQ2 A;  2NBS A;  4F03 A;  3HJO A;  4TKY A;  4MCU A;  4IGJ A;  4X43 A;  1CQH A;  2MBT A;  4BL7 A;  1SKW B;  2FWE A;  3TKS E;  2WS2 A;  2VM1 A;  4FIW A;  1M9B A;  4OD7 A;  3PPU A;  2PVO C;  1I5G A;  3NIV A;  3DRN A;  2ON7 A;  1XCC A;  1TOF A;  3C8E A;  1WWJ A;  2R37 A;  14GS A;  2OA7 A;  2KOK A;  2GT6 A;  2I1U A;  1THO A;  3FZ4 A;  5G1L A;  4KB3 A;  4RQR A;  3N5O A;  2WUL A;  2P5Q A;  4KA0 A;  1TI1 A;  4PUR A;  4G0K A;  1GTU A;  2WFC A;  5IMC A;  2HSM A;  1YKA A;  1X9S B;  4IQ1 A;  3O76 A;  4WKW A;  1PX7 A;  1X0R A;  5J4U A;  4LL4 B;  1XW9 A;  4KH7 A;  1H4O A;  2BTO T;  2K8S A;  2N5F A;  4IP6 A;  5G2Z A;  2WZ9 A;  4ZBD A;  2H8L A;  2B7J A;  3FR3 A;  4KDU A;  4LLR A;  1SD9 A;  2GZP A;  2HRN A;  5ECS A;  3Q19 A;  2H6X A;  3GX0 A;  1PX6 A;  2AYT A;  3QD9 A;  5JCW A;  1FW1 A;  4BPY A;  3TRP A;  1SL0 B;  4G2E A;  3QAG A;  1TW9 A;  1UA5 A;  3CTF A;  2C0E A;  2JSY A;  3BOA A;  1A2L A;  2C80 A;  1MDI A;  3LYK A;  3ZFB A;  1GRX A;  2H1D A;  1DBY A;  4HZ4 A;  4HI7 A;  2DIZ A;  3L78 A;  4E8H A;  1R7H A;  5JWR B;  1LBK A;  3F63 A;  3HVV A;  2FHE A;  2JU5 A;  3NOF A;  3D4M A;  5DVB A;  4Q5N A;  4K7I A;  3QOU A;  4KSM A;  4PQH A;  2XPE A;  4YQM A;  2YJ7 A;  2K9F A;  2FA8 A;  3BBY A;  3HJM A;  17GS A;  3AY8 A;  4Z2T A;  1Y25 A;  4I5Q A;  1WMJ A;  3KP8 A;  3DD3 A;  1SU9 A;  1PD2 1;  2GTU A;  3IA1 A;  1Z3E A;  2JL4 A;  5ID2 B;  2B5X A;  1K0O A;  4Z2U A;  2QA1 A;  5KOX A;  4MJA A;  4YAV A;  5GZZ B;  4MA9 A;  5DAK A;  4JZQ A;  1Z5Y E;  3C7M A;  1OAZ A;  1PKZ A;  2RM6 A;  1ERT A;  4HEA 2;  4DSS A;  3EUR A;  2LRN A;  1OVN A;  4X4J A;  3TCO A;  4MJB A;  1K3L A;  2JAD A;  3C1S A;  1PRX A;  3LG6 A;  3R2Q A;  4V1A p;  3C71 A;  1ZYN A;  3A5I A;  2WJU A;  4YKG A;  4ECJ A;  4XCS A;  4Z2R A;  2DJ1 A;  4YQU A;  4I6X A;  1HNB A;  2H0I A;  3FZA A;  5D9T A;  1BED A;  3ZVJ A;  1ABA A;  1VF1 A;  4EO3 A;  3LXT A;  3HCZ A;  4K7N A;  4MH2 A;  3W8S A;  2IN3 A;  3ZIT A;  1R4W A;  1E6B A;  3V1W A;  4XS4 A;  4O5R A;  4WR4 A;  1IYH A;  3E0U A;  3MDK A;  3TRX A;  3LYP A;  2YAN A;  1DE2 A;  1EGO A;  4NXI A;  1FOV A;  1NW2 A;  1PN0 A;  3HHV A;  2R5G A;  2RII A;  4V1A g;  4F9Z A;  5D93 A;  5INY A;  2B7K A;  4BWS A;  2GDR A;  4EKZ A;  3ZYW A;  5FHI A;  2GSQ A;  5J9B A;  4D73 B;  2YWM A;  5AGY A;  2F3M A;  4GCI A;  5ECI B;  2PGT A;  1DE1 A;  4L8E A;  2YZH A;  2WCI A;  3IDV A;  2HSY A;  6GSS A;  4TXO A;  1V40 A;  1OYJ A;  5D73 A;  1U3A A;  2IJY A;  5C04 A;  5A4V A;  1OC3 A;  1NHY A;  2I9H A;  4ZL9 A;  5IMF A;  4Q5F A;  4X1U A;  5B8A A;  4CY8 A;  1SYX A;  1WP0 A;  5ENU A;  3GL3 A;  18GS A;  1QXH A;  3IOS A;  2L4Q A;  2HI7 A;  3QFB C;  6GSX A;  1XOA A;  4MPF A;  2GZY A;  1ERV A;  2H76 A;  2LJR A;  4TR4 A;  1PSQ A;  1EEJ A;  4E8E A;  4CDO A;  2DJ0 A;  1EZK A;  3ZFL A;  1TK8 B;  5B8B A;  3KH9 A;  1M2D A;  3VI7 A;  1PMT A;  3TB2 A;  4BVY A;  1GP1 A;  1GWC A;  4MF6 A;  2NVL A;  3UJ1 A;  2E0Q A;  3IR4 A;  2YP6 A;  1J9B A;  2HNL A;  3GIX A;  3EWL A;  3K8N A;  2C0F A;  1HQO A;  2P5R A;  3ERW A;  2VLV A;  2ES7 A;  4NPB A;  2BMX A;  2Z9S A;  4KCE A;  4RI7 A;  1THX A;  2N5A A;  1SKS B;  1V57 A;  1AQX A;  3D21 A;  4KSO A;  2NPB A;  1TRW A;  2YOI A;  1A2M A;  2DMM A;  5A5K A;  3TGZ A;  4ZIL A;  5EPF A;  2X8H A;  2CA8 A;  4ECB A;  3F4R A;  2DJ3 A;  3GSS A;  4V2L A;  2IMI A;  2OAC A;  1K0N A;  4TXV A;  4WXT A;  1XWC A;  1OKT A;  2C3N A;  3PH9 A;  4MF7 A;  1ML6 A;  2VL2 C;  4O7H A;  2GQL A;  6GSY A;  3FKF A;  1MEK A;  1I9D A;  2JSZ A;  4HJ2 A;  1JLW A;  4NV2 A;  4KCA A;  5BMU A;  2H73 A;  1V58 A;  1A0R P;  2VOC A;  4RI6 A;  2FCH A;  4PQ1 A;  1TK5 B;  2J9H A;  3RPN A;  3EIN A;  2NTO A;  3MWH A;  1TU8 A;  4OO4 A;  4AJ6 A;  4EIP A;  3GUR A;  1AUC A;  3A2X A;  1T7P B;  3E3E A;  2HSH A;  3F4S A;  2IIY A;  2O8V B;  3M1G A;  1GL8 A;  1J0F A;  3KP9 A;  3FMW A;  2PVQ A;  4WR5 A;  2LS5 A;  5ECL B;  3VLN A;  5F06 A;  3RDW A;  4GSS A;  4JU5 A;  4ICY A;  4DSQ A;  2V41 A;  4N0Z A;  1DUG A;  3IBH A;  2X49 A;  3LWA A;  3FK8 A;  4XHM A;  2LV3 A;  3FR6 A;  2MYG A;  1OC8 A;  2LTK A;  1F37 A;  1GSD A;  1GSF A;  3G9B A;  5DCG A;  5G5F A;  1RW1 A;  1T00 A;  3HYP A;  3GX8 A;  3IV4 A;  5DCH A;  2KP1 A;  4KX4 A;  2YN1 A;  2IMF A;  1GSQ A;  1JZR A;  2VLT A;  1AC1 A;  3EU4 A;  2QA2 A;  3HD5 A;  2VM2 A;  1MDJ A;  1JFU A;  5IPG A;  5ECM B;  4AGS A;  2MBS A;  5D8I A;  2I4A A;  3LQ7 A;  2H71 A;  4FH8 A;  3U6V A;  4AF2 A;  3ERG A;  3N9J A;  5ECP B;  4USS A;  3CTG A;  2HRF A;  1B4Q A;  1OE7 A;  3HJP A;  4F82 A;  2DBC A;  3U5R E;  3OR5 A;  4A5P A;  1ZGN A;  1S3A A;  1U87 A;  3ZMK A;  1GNW A;  4HQS A;  5IOX A;  2A2S A;  2H0G A;  2LST A;  4NHW A;  4N0V A;  3TUE A;  2O7K A;  4HU7 A;  2ON5 A;  5IQY A;  2GT5 A;  5HR1 A;  2HT9 A;  3ZML A;  3TJK A;  1FVK A;  3EU3 A;  3HA9 A;  5IM9 A;  4ZIJ A;  2R0C A;  3FW2 A;  2R0G A;  3ZRE A;  4I97 A;  2JAC A;  2CV4 A;  2ZNM A;  3ZLP A;  1X9M B;  3IAS 2;  2EIQ A;  5ELA A;  5LCZ A;  1ILO A;  2LJK A;  4WBJ A;  3FR9 A;  3VK9 A;  3D4T A;  2LRC A;  3M3M A;  4O5U A;  3GKM A;  3UAP A;  4OO5 A;  1ST9 A;  3LGC A;  4AJ8 A;  1PL1 A;  4L5L A;  5HQP A;  3P8W A;  1AAZ A;  1OC9 B;  3CMI A;  1N2A A;  2O89 A;  2FLS A;  3GA4 A;  3IRA A;  1B48 A;  1ZZY A;  2GLR A;  4PQI A;  5IMV A;  2VLU A;  3F3R A;  3J7Y b;  5F07 A;  1K0C A;  3KH7 A;  4K0N A;  2H01 A;  1JHB A;  2LEG A;  4MK3 A;  2PMT A;  4EIQ A;  2FWF A;  2K8V A;  5DQY A;  7GSS A;  5B7C A;  2H74 A;  3M8N A;  2HRK A;  1U6T A;  3TKQ A;  1B9Y C;  2L57 A;  3LOR A;  1M2A A;  4K8M A;  4RUV A;  5CRW A;  3C73 A;  2QGV A;  3W6G A;  3PGT A;  3D6I A;  1K3O A;  4HZ2 A;  3UVT A;  4I8B A;  2OKA A;  5CNW A;  1TK0 B;  4ULX A;  4K1F A;  4KND A;  4MJC A;  4IBP A;  1XW6 A;  4Q5Q A;  3US3 A;  2H0H A;  2C8U A;  4QL7 A;  5ECN B;  3IE3 A;  5CRG A;  1WPI A;  1VF3 A;  1RQM A;  2FWG A;  3CSH A;  3IHG A;  5DAL A;  3GUS A;  1YKC A;  2VCZ A;  4MJE A;  3Q6O A;  3VPQ A;  1ZOF A;  4NHZ A;  3C1R A;  5JWO B;  1B4P A;  3A3T A;  3KIJ A;  2GQM A;  3KXO A;  1Z9H A;  3VPT A;  3QCP A;  1M0U A;  1E2Y A;  4OMV A;  3RPP A;  4XRA A;  2AB6 A;  2JZT A;  3I6A A;  2JZS A;  4IJ3 A;  4MMM A;  2H6Z A;  4YQV A;  3FHK A;  3QFA C;  5AIV A;  5IMZ A;  1K3Y A;  1TJD A;  3CRT A;  3A2V A;  4TR1 A;  4JE1 A;  1SD8 A;  1OE8 A;  1UN2 A;  3LSZ A;  4RQX A;  4YKF A;  3UBL A;  3LW9 A;  2CVD A;  1AQV A;  3GRX A;  1JZO A;  4GQC A;  3G7I A;  1PQN A;  3WT2 A;  1FOH A;  2D2Z A;  5H5R A;  4G0I A;  3TRQ A;  2DSA A;  3IK7 A;  4HU9 A;  2R2J A;  4EE0 A;  2H6Y A;  2CZ3 A;  5J9C A;  3HDC A;  4DSR A;  2YNX A;  4LMV A;  2G2Q A;  4O92 A;  16GS A;  2YCD A;  1FO5 A;  5DDL A;  2RM5 A;  3VUR A;  1F9M A;  3GFK A;  3BCI A;  3FEU A;  4HUA A;  4ISD A;  2F8A A;  4K2X A;  3DGQ A;  3KM6 A;  4EVM A;  1F3B A;  2N5B A;  1OKD A;  3H4K A;  4TRX A;  3TKP A;  1JZD A;  4KW6 A;  4KDY A;  3APQ A;  5IIZ A;  1Z6M A;  2IMK A;  1YJ6 A;  3GTU B;  5ECH B;  2RLI A;  2CVK A;  2H1B A;  2MMN A;  4WF5 A;  1JLV A;  3CRU A;  4ZB8 A;  3VWU A;  4N11 A;  3GNJ A;  4GLT A;  2FWH A;  3KMN A;  4MZW A;  4ZBA A;  2P0G A;  2FY6 A;  3DXB A;  5DJL A;  1A24 A;  4G0L A;  5GAP D;  4MZB A;  1V2A A;  2VL2 A;  3KGK A;  3FY7 A;  4ECI A;  1K0B A;  3GKN A;  3KEB A;  13GS A;  2YZU A;  5CO3 A;  1SYR A;  4Z7X A;  3BJ5 A;  4PXO A;  1Q98 A;  4Q5R A;  2LKU A;  5EVO A;  3EMP A;  1VF4 A;  3QDN A;  3DYR A;  2GS3 A;  2E2G A;  2H19 A;  9GSS A;  2X4A A;  3HVS A;  1CQG A;  3TOT A;  5J3R A;  3WGE A;  1EOH A;  1EOG A;  2ZCT A;  5EL8 A;  4IP1 A;  1XVQ A;  3CYN A;  1TRS A;  2AUV A;  2KLX A;  4TR0 A;  2LJA A;  3KMO A;  3KCM A;  2YV9 A;  3GST A;  5BRT A;  3W8J A;  3KJY A;  2X64 A;  4MAB A;  3FZ5 A;  1A0F A;  2O87 A;  1PL2 A;  5ECR B;  4FO5 A;  4HQZ A;  4IKH A;  1FB0 A;  2GGT A;  3M9J A;  3UAR A;  4TOP A;  5ID2 A;  4K5R A;  4XTS A;  1SL1 B;  3P2A A;  2ZUP A;  5CRE A;  1PKW A;  1URM A;  2VCQ A;  3RHC A;  1JZW A;  1BQ7 A;  1J08 A;  1MTC A;  4G10 A;  1K0M A;  3FRC A;  4MPG A;  5DQS A;  1GUH A;  4CHS A;  2IYJ A;  1EV4 A;  2E7P A;  3MSZ A;  3L9V A;  4IJI A;  1NM3 A;  2HZF A;  1TRV A;  5ELG A;  3H93 A;  1R5A A;  4J2F A;  1ZMA A;  3TKS C;  5AIX A;  2OE3 A;  3Q18 A;  3TJF A;  3JCM L;  1SJI A;  4TW5 A;  2B1K A;  4IHU A;  1QK8 A;  1GSS A;  3E9J B;  5ECK B;  2HE3 A;  5J41 A;  1EEM A;  5GSS A;  1U3I A;  3GN3 A;  2VD1 A;  1FG4 A;  2PWJ A;  2DJJ A;  2UZ8 A;  4IS0 A;  1NHO A;  1ZYE A;  1K0A A;  1QFN A;  3WT1 A;  2GST A;  5HR0 A;  1WE0 A;  2YWI A;  4NWY A;  2KP2 A;  1XOB A;  5JCU A;  1GUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...