1GD3A

Refined solution structure of human cystatin a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd3A00
4ZM8A 4CCVA 4TX4A 3GAXA 3UL6A 1NB5I 3QRDA 1WNHA 1IV9A 1CYVA 1STFI 5ELJA 5ELUA 1A90A 3PYJA 4N6NB 3K9MC 4EYCA 3NX0A 2O9UX 1MNLA 3Q2PA 1FA3A 1NB3I 3MWZA 1G96A 1MOLA 4N6MA 3KSED 1EQKA 4N6UA 1R4CA 1ROAA 2BO9B 1N5PA 3PS8A 1N5HA 1M9GA 2KXGA 1A67A 1PFPA 4N6OB 3IMAB 5A0OB 1CEWI 1LXEA 2CH9A 2W9PA 1N9JA 1DVCA 3S67A 3UL5A 3KFQC 4N6V0 3LH4A 4IT7A 3L0RA 4N6TA 1GD4A 1KWIA 1RN7A 5LC7A 1DVDA 3PXMA 4LZIA 5LC6A 2OCTA 1TIJA 1GD3A 5EQLA 1FUWA 2W9QA 1CYUA 1IV7A 4N6LA 1YVBI 3SVAA
chains in the Genus database with same CATH superfamily
2IY2A 2IA7A 4ZM8A 1YHQ3 3RNTA 4CCVA 1F8NA 1IYYA 1YGEA 5BU4A 4FMAA 2HMNB 4LEHA 2W04A 3RGRA 2A15A 2XSOB 3UL6A 5EVHA 1AV4A 1M1XB 1SPUA 1WNHA 3SLUA 3CCL3 4HM2B 3WA2X 3WODG 3SOAA 4K1UA 1IV9A 1CYVA 1UGIA 1RLSA 1W7CA 3ROBA 1B2ZA 3LTCA 3WDGB 5TGNA 5AI1A 3T0UA 1AVKA 1SQWA 5I97A 3CPW2 3PYJA 1RHLA 5HOHA 3ECFA 2H0HA 1GYBA 3CC43 1YJW3 4EYCA 1VQK3 3DGMA 2O9UX 3ZFZA 1MNLA 4L8PA 1IQYA 1CH0A 1RRHA 1K734 3MWZA 4EBGA 2CC3A 1BRNL 2R41A 1PY3A 1SJWA 1MOLA 2KF4A 2IMJA 1RRLA 2ZL8A 3EBYA 1K8A4 3EF8A 4N6MA 3OXAA 2MF7A 4WWUC 1TU5A 1UDII 2KAAA 4MMYB 2KF5A 4N6UA 3TDGA 1R4YA 2XFTA 4RZMA 5HGRA 3N54B 2QEX3 1VQ83 4RNYA 1RJOA 5G1LA 4NREA 6RNTA 5G1KA 1L5GB 2BO9B 3UNLA 2IUKA 1BSBA 3G0KA 3PS8A 1W6CA 4WYKA 2Z6BA 2W2CA 4WFOA 1UUWB 1RCKA 4K90B 3X3XA 2Z76A 4L8OA 2JDIH 3HOHA 1KQS2 5AEWB 1OCVA 3FCSB 3FSDA 3GSPA 1IVWA 1OUNA 1SARA 2E2VA 2PZVA 2R4IA 3PZWA 4FMBA 4O8SA 3NV0B 3X3YA 3CME3 3K7CA 1BANA 4QWTA 3BLZA 2IUJA 1W01A 1CEWI 3ALAA 4BTYA 1T5YA 1JJ22 3PCSA 3KCHA 3WMDA 2F5MA 1N9JA 3KZTA 4BTWA 1O7HB 4AKZA 2CWUA 3CCQ3 1PU4A 2GBXB 2BIRA 3DGLA 1ROVA 2BT3A 1BRHA 3S27A 3QK9A 2CFDA 1YIT3 4N3VA 1JZDA 5JPPA 2L1SA 2WOHA 3X40A 6STDA 3OV4A 2F86B 3CD63 4X2HA 3LT9A 1BRKA 1C7HA 2UX0A 3BIRA 1RCLA 1TFKA 4HM1B 3SXXA 1DMMA 1WMNA 1UCLA 3D5IA 4GSPA 2W6JH 1Q864 5D81A 1MWRA 2KRTA 1BSDA 3X3ZA 4KFFA 1K9M4 4LYLB 3G6E3 4XBYA 5FW5A 1W2B2 4LGQA 1KSIA 9RNTA 2W03A 3DMCA 3LTDA 2CWVA 1UW1A 3NXJA 2AAEA 3CU3A 3FGYA 1RNBA 1QAKA 5EQLA 4KT3B 2P0XA 4FCJA 3BB9A 1Q7Y4 4ILFA 1FUWA 3IJEB 3M8CA 3PCRA 3MYTA 1IV7A 4KVHA 1FGQA 3V99A 3B4PA 1Q40B 1T3BA 2C4BA 3LTBA 3FG3A 3JVCA 1IT8A 1N8QA 2OOVC 1BSCA 1JKGA 1V74A 3ER7A 2CFGA 1B27A 1BSEA 1W00A 3MG3A 1U5OA 2AADA 4HVNA 2HMLB 3GZBA 4OUQA 1I2GA 4K1VA 5CK6A 1FGMA 1GS3A 1ZGXA 3OWUA 4HOHA 3CCV3 1TFOA 5AIHA 2CHCA 1B2UA 1IDPA 1UI8A 3A76A 3DGNA 5IENA 1AR0A 3FG4A 1JBRA 2FNQA 5IEPA 1DETA 4HM5B 1RMSA 5ELUA 1HZ1A 3F40A 4I4KA 4N6NB 1JB4A 1NNVA 4L7KA 1OGXA 1NU3A 4R9KA 3NX0A 2XR8B 4EXRA 2PNCA 1VQQA 2CG1A 1GMRA 3AHSA 2YFLB 3DY5A 4BU4A 1JBTA 2CK3H 1W5ZA 2XEPA 1LNIA 3N9HA 5BVBA 3CC23 4CPKA 4EW5A 3OWSA 3V98A 1RGGA 5FGOA 4RNZA 1ZX2A 1JZOA 4GHOA 1GSPA 2ZHXB 5AIFA 5JPUA 2BNGA 5KP3A 2XGLA 1VQM3 1JN5B 1ROAA 2YFIB 3EN8A 2LQVA 3OX9A 1GY7A 2F4YA 3AMOB 3DZLA 3O8YA 1OHOA 2KXGA 3BNCA 3BNDA 2MC8A 2XGNA 1A67A 1A2VA 2GSPA 1QVG2 5CF2A 4X2OA 1PFPA 2UGIA 2XF3A 1RGKA 1W6GA 3LMLA 2OOVA 2W56B 5M18A 1D6UA 1IU7A 1BVIA 1BRIA 2P05A 2FXTA 3K5TA 1FGTA 1YJ93 1DMQA 4O2HA 5BIRA 2V1LA 4HYZA 4MJDA 5A0OB 2K3DA 1HU9A 4XBXA 1BIRA 5AIIA 1RN1A 5STDA 1SIIA 2CH9A 2Y74A 3RDEA 1WMPA 2CWTA 5IG0A 3CCJ3 2C11A 3X41A 2CX0A 4BL3A 3SX1A 3J7Yd 1AQZA 3EE1A 1D6ZA 2WOFA 1U8CB 3GZYB 4ORLA 1IVVA 4RBNA 4AKYA 3EJVA 1VQ93 2WGOA 1UGHI 1DE3A 1UCKA 1B20A 4XDWA 1GY6A 1I3IA 2P0MA 2GEYA 1X1YA 3LH4A 5CXOA 3L0RA 1X1WA 1N8R4 2QGUA 5AYRB 4DKIA 1RDSA 2KF6A 3MG1A 1KWIA 1RN7A 1FGRA 2GU3A 2H0IA 1LRAA 1LOVA 1E97A 4HM0B 1YI23 3PXMA 1OACA 2STDA 3FF2A 3EB8A 4KFEA 4LZIA 2JQ5A 1QVF2 4HZBB 5AEUB 1RGLA 1RGHA 1TIJA 1EKMA 3NQYA 1GD3A 4EV2A 1HKXA 4NPBA 5KP1A 4HM6B 2OWPA 2BMQB 2L4VA 1BNFA 5IEOA 1KC84 1CYUA 1T2IA 1EEJA 3D9RA 1FZUA 2BMRB 5JBSA 1JB2A 4O3VA 1RN4A 3E99A 3AGOA 3MSOA 3NBBA 4RNTA 2CFKA 1NO3A 1IVUA 4FMDA 4TX4A 3S29A 2OTL3 3NUVA 3SYUA 3WHOA 3I563 4CDLA 3BNBA 5D83A 5CF1A 3WA3A 2E2TA 3EBTA 1NB5I 1VQ43 3FF0A 1Q42A 3CNXA 3NBRA 1WQLB 1Q40A 2CFWA 3F8HA 2C10A 3QRDA 5DREA 3T8NA 1OPYA 4JRFA 4J5KA 1I0VA 3B7CA 2P09A 3X42A 2K54A 4JF8A 3D3LA 4HJLB 4FR9A 5BXQA 4HZ9B 3U97A 1BUJA 3OW22 4HBRA 4GB5A 3MKIA 1UCJA 1QALA 3OWYA 2INXA 4XBTA 5DRVA 1OF5B 3AGNA 2XSHB 4HM7B 3CCU3 1BSAA 2H0GA 1YJN3 1I0XA 2P38A 3LXUX 3HK4A 5EEOA 2RNTA 1IK3A 2OTJ3 5GSPA 3SOYA 2UUGC 1BRSA 4HM8B 3CXC2 3EX9A 3LYGA 1KD14 2IYJA 3JUPA 3G16A 3HIGA 1OGZA 3ZG0A 4LSOA 1MWUA 1YVSA 4WP5A 3HI7A 3H51A 1EQKA 3K0ZA 5IW9A 1N9EA 1ISKA 1A2KA 5IG3A 1O7MB 1VQ73 2K0MA 4HM3B 8RNTA 1IQXA 1MGRA 1X1UA 4MMXB 1JB5A 7GSPA 4U13A 2ZDJA 1M9GA 1N5HA 4H3UA 3FKAA 3JUMA 1BNEA 3UB1A 1TRPA 2ML5A 2QIYA 1RKYA 4FCMA 1UUVB 1TTOA 1CQSA 1LQGC 3GRDA 3V92A 1OHSA 4N6OB 2D1WA 2I9WA 2RCDA 1IVXA 2ML6A 1BNGA 1TUHA 3CCE3 3Q1CA 1JNQA 3CCR3 5G2GA 1MGWA 2W0QA 1LXEA 3F9SA 1I2EA 2W9PA 4J9AA 3FZWA 1W4NA 2QA43 3UJMA 4FMCA 3N8BA 3U1WA 2F98A 4CJNA 1K28A 1WMOA 1B2XA 4PEJA 3S67A 1AY7A 1S723 1OHPA 1GOUA 3KFQC 1Q824 4FCZA 4N6V0 2FGTA 2CKFB 1V57A 2CFLA 4BTXA 2CX1A 3DGOA 1GY5A 2O3OA 1VQP3 1B2MA 4N6TA 5IERA 1GD4A 1WTHA 2HMMB 1S5AA 1VQL3 1GOYA 1T2HA 3URPA 5AIGA 1Q814 1DVDA 1UI7A 2WGQA 1TP6A 1US1A 1O7PB 2CIUA 3B8LA 3HZPA 4HKVB 3S5CA 3NBJA 2XFSA 1NDOB 3HIIA 2D42A 2RSXA 4EC6A 2F5WA 2OCTA 1RGCA 1O7NB 2F56A 3NV0A 1J2BA 2HMJB 3T8UA 3FLJA 8CHOA 3WR2A 1BNIA 1BU4A 4J5GA 3CCS3 4BIRA 3SEDA 1X1XA 2W9QA 2CW9A 3I0YA 1BOXA 4Q53A 1W6YA 1IQ8A 3CC73 2RGQA 1LOYA 4XB5A 4KFDA 3GWRA 3ZG5A 2BHMA 3MPHA 1Y4KA 1W2ZA 3F8XA 3NQZA 3DXOA 1ASKA 2B24B 1VQ63 3CPOA 3LT8A 4R1KA 3GAXA 4OK0A 1Q7HA 3BU4A 2HMKB 3Q90A 1JV2B 3EHCA 3JUQA 3K63A 2Z77A 3CCM3 1STDA 1ULIB 1GMPA 2M7OA 3EC9A 1LVNA 1MWSA 2KCDA 1FW7A 4HM4B 2OQEA 1STFI 3G4S3 1W02A 3EN1B 1TRQA 1FYSA 1D6YA 1FUSA 2YX9A 1UCIA 1RNTA 5ELJA 5IF6A 2B1XB 4BL2A 1O7WB 4EV5A 1A90A 1ZO2A 1DMNA 3K9MC 1QAFA 1UUGB 3AHWA 3RGAA 1BRJA 1NWWA 1B21A 3D79A 3Q2PA 3DUKA 1FA3A 1YNVX 1NB3I 1LOWA 3JUOA 4WHAA 1E3RA 1G96A 1OF5A 2BMOB 5RNTA 1I8VA 1B3SA 1RGAA 2RBIA 2CG0A 3MG2A 1EG9B 1HYFA 3BNEA 3KSED 4R4KA 4WYKB 3CMA3 4NHFA 1VQO3 1FUTA 3F7XA 3VGNA 4R9LA 1R4CA 3EQQB 2SARA 3KIIA 1I3FA 1BRGA 4K61A 3NM7A 1OH0A 1RTUA 3JUNA 1N5PA 3GZRA 3F14A 1MWTA 1RGEA 1ULJB 1Z1SA 1YGWA 1TJDA 4O02B 3LZAA 1C54A 3LOYA 1BNSA 2SBLA 3S28A 1JBSA 1GMQA 2GEXA 4XDVA 1LQMB 2HOHA 2RFRA 3IMAB 4GL6A 3CNMA 4MEIA 1SIHA 1LOXA 3MHEA 1B2SA 1O7GB 2WO0A 2LYXA 2ZA4A 1A2PA 1V58A 3KKGA 4AEQA 1AVLA 1GOVA 3FG1A 3IPTA 4I5QA 2Y73A 3DH2A 1DYUA 1ZS7A 3KSPA 2Z7AA 3LTAA 1RGFA 3PGBA 3G8ZA 1JRQA 6GSPA 1DVCA 4IPBA 3D4AA 4MMZB 1I2FA 3NM2A 3FH1A 5M1AA 2YFJB 5M19A 1G0TA 3Q3FA 5D82A 1QMAA 3UL5A 3DM8A 3STDA 3DGYA 5KP4A 3WOFB 1NJI4 4G1MB 1E3VA 1QJGA 4J8TA 5IG4A 3B4OA 1JN5A 4IT7A 1VQ53 1BAOA 1EUIC 2E2UA 3VSYA 1BUQA 3I553 1EA2A 1BNRA 3VF1A 4IIAA 1G02A 1K41A 1LNHA 3KE7A 2GXFA 3AMOA 4H61A 5LC7A 4STDA 3G713 3NHXA 1FGOA 5AYSC 5CLKA 4R80A 3WOEB 1VQN3 4OVMA 1M904 2F99A 2GU1A 2W56A 5LC6A 1VZZA 1Q9EA 7RNTA 2HMOB 3F7SA 2BU4A 1I70A 2GBWB 7STDA 1IT7A 3GZXB 1PYLA 2Q07A 2KF3A 2OQEC 1BNJA 1JKGB 1M1K4 3A5EA 4LMIA 2XRXB 4HAAA 5IG5A 3H3HA 4KZ1A 3D5GA 4XM4A 2J8XB 1BGSA 1RSNA 4N6LA 1YVBI 2XH9A 1YIJ3 3HX8A 3KN4A 3SVAA
chains in the Genus database with same CATH topology
2IA7A 4ZM8A 1YHQ3 4CCVA 1F8NA 1YGEA 4FMAA 2HMNB 4LEHA 2W04A 3RGRA 2A15A 2XSOB 3UL6A 5EVHA 1AV4A 1M1XB 1SPUA 1WNHA 3SLUA 3CCL3 4HM2B 3WA2X 3WODG 3SOAA 4K1UA 1IV9A 1CYVA 1W7CA 3ROBA 3LTCA 3WDGB 5TGNA 5AI1A 3T0UA 1AVKA 1SQWA 5I97A 3CPW2 3PYJA 3ECFA 1GYBA 3CC43 1YJW3 4EYCA 1VQK3 3DGMA 2O9UX 1MNLA 4L8PA 1IQYA 1K734 1RRHA 3MWZA 4EBGA 2CC3A 1SJWA 1MOLA 2ZL8A 2IMJA 1RRLA 3EBYA 1K8A4 3EF8A 4N6MA 3OXAA 2MF7A 4WWUC 1TU5A 4MMYB 4N6UA 3TDGA 2XFTA 4RZMA 5HGRA 3N54B 2QEX3 1VQ83 4RNYA 1RJOA 4NREA 1L5GB 2BO9B 3UNLA 2IUKA 3G0KA 4WFOA 3PS8A 1W6CA 4WYKA 2Z6BA 2W2CA 1UUWB 4K90B 3X3XA 2Z76A 4L8OA 2JDIH 1KQS2 5AEWB 1OCVA 3FCSB 3FSDA 1IVWA 1OUNA 2E2VA 4FMBA 2PZVA 2R4IA 3PZWA 4O8SA 3NV0B 3X3YA 3CME3 3K7CA 4QWTA 3BLZA 2IUJA 1W01A 1CEWI 3ALAA 4BTYA 1T5YA 1JJ22 3PCSA 3WMDA 1N9JA 3KZTA 4BTWA 1O7HB 4AKZA 2CWUA 3CCQ3 1PU4A 2GBXB 3DGLA 1ROVA 2BT3A 3S27A 3QK9A 2CFDA 1YIT3 4N3VA 5JPPA 2WOHA 3X40A 6STDA 3OV4A 2F86B 3CD63 4X2HA 3LT9A 1C7HA 2UX0A 4HM1B 1TFKA 3SXXA 1DMMA 1WMNA 2W6JH 1Q864 5D81A 2KRTA 3X3ZA 4KFFA 1K9M4 3G6E3 4XBYA 5FW5A 1W2B2 4LGQA 1KSIA 2W03A 3DMCA 3LTDA 2CWVA 1UW1A 3NXJA 3FGYA 3CU3A 1QAKA 5EQLA 2P0XA 4FCJA 3BB9A 1Q7Y4 1FUWA 3IJEB 3M8CA 3PCRA 3MYTA 1IV7A 4KVHA 1FGQA 3V99A 3B4PA 1Q40B 3LTBA 3FG3A 3JVCA 1IT8A 1N8QA 2OOVC 1JKGA 1V74A 3ER7A 2CFGA 1W00A 3MG3A 1U5OA 4HVNA 2HMLB 3GZBA 4OUQA 4K1VA 5CK6A 1FGMA 1GS3A 3OWUA 3CCV3 1TFOA 5AIHA 2CHCA 1IDPA 3A76A 1UI8A 3DGNA 5IENA 1AR0A 3FG4A 2FNQA 5IEPA 4HM5B 5ELUA 3F40A 4I4KA 4N6NB 1JB4A 4L7KA 1OGXA 1NU3A 4R9KA 3NX0A 2XR8B 4EXRA 2PNCA 2CG1A 2YFLB 3DY5A 2CK3H 1W5ZA 2XEPA 3N9HA 5BVBA 3CC23 3OWSA 3V98A 5FGOA 4RNZA 1ZX2A 5JPUA 5AIFA 1VQM3 2BNGA 5KP3A 2XGLA 1JN5B 1ROAA 2YFIB 3EN8A 2LQVA 3OX9A 1GY7A 3DZLA 3AMOB 2MC8A 3O8YA 1OHOA 2KXGA 3BNCA 3BNDA 2XGNA 1A67A 1A2VA 1QVG2 5CF2A 4X2OA 1PFPA 2XF3A 3LMLA 1W6GA 2OOVA 2W56B 1D6UA 1IU7A 2P05A 2FXTA 3K5TA 1FGTA 1YJ93 1DMQA 4O2HA 2V1LA 4HYZA 4MJDA 5A0OB 1HU9A 4XBXA 5AIIA 5STDA 1SIIA 2CH9A 2Y74A 3RDEA 1WMPA 2CWTA 5IG0A 3CCJ3 2C11A 3X41A 3SX1A 3J7Yd 3EE1A 1D6ZA 2WOFA 1U8CB 3GZYB 4ORLA 1IVVA 4RBNA 4AKYA 3EJVA 1VQ93 2WGOA 4XDWA 1GY6A 2P0MA 2GEYA 5CXOA 3LH4A 3L0RA 1N8R4 2QGUA 5AYRB 3MG1A 1KWIA 1RN7A 1FGRA 2GU3A 1E97A 4HM0B 1YI23 3PXMA 1OACA 2STDA 3FF2A 3EB8A 4KFEA 4LZIA 2JQ5A 1QVF2 4HZBB 5AEUB 1TIJA 1EKMA 3NQYA 1GD3A 4EV2A 1HKXA 5KP1A 4HM6B 2OWPA 2BMQB 2L4VA 5IEOA 1KC84 1CYUA 3D9RA 2BMRB 5JBSA 1JB2A 4O3VA 3E99A 3MSOA 3NBBA 2CFKA 1NO3A 1IVUA 4FMDA 4TX4A 3S29A 2OTL3 3NUVA 3I563 4CDLA 3BNBA 5D83A 5CF1A 3WA3A 2E2TA 3EBTA 1NB5I 1VQ43 3FF0A 1Q42A 3CNXA 3NBRA 1WQLB 1Q40A 2CFWA 3F8HA 2C10A 3QRDA 5DREA 3T8NA 1OPYA 4JRFA 3B7CA 2P09A 3X42A 2K54A 4JF8A 3D3LA 4HJLB 4FR9A 5BXQA 4HZ9B 3U97A 3OW22 4HBRA 4GB5A 3MKIA 1QALA 3OWYA 2INXA 4XBTA 5DRVA 1OF5B 4HM7B 2XSHB 3CCU3 1YJN3 2P38A 3LXUX 3HK4A 5EEOA 1IK3A 2OTJ3 3SOYA 3CXC2 4HM8B 3EX9A 3LYGA 1KD14 3JUPA 3G16A 3HIGA 1OGZA 4LSOA 4WP5A 3HI7A 3H51A 1EQKA 3K0ZA 5IW9A 1N9EA 1ISKA 1A2KA 5IG3A 1O7MB 1VQ73 2K0MA 4HM3B 1IQXA 4MMXB 1JB5A 4U13A 2ZDJA 1M9GA 1N5HA 4H3UA 3FKAA 3JUMA 3UB1A 2QIYA 2ML5A 1RKYA 4FCMA 1UUVB 1CQSA 3V92A 3GRDA 1OHSA 4N6OB 2D1WA 2I9WA 2RCDA 1IVXA 2ML6A 3CCE3 1TUHA 3Q1CA 1JNQA 3CCR3 5G2GA 2W0QA 1LXEA 3F9SA 2W9PA 4J9AA 3FZWA 1W4NA 2QA43 3UJMA 4FMCA 3N8BA 3U1WA 2F98A 1K28A 1WMOA 4PEJA 3S67A 1S723 1OHPA 1Q824 3KFQC 4FCZA 4N6V0 2FGTA 2CKFB 2CFLA 4BTXA 3DGOA 1VQP3 1GY5A 2O3OA 4N6TA 5IERA 1GD4A 1WTHA 2HMMB 1S5AA 1VQL3 5AIGA 1Q814 1DVDA 1UI7A 2WGQA 1TP6A 1US1A 1O7PB 2CIUA 3B8LA 3HZPA 4HKVB 3S5CA 3NBJA 2XFSA 1NDOB 3HIIA 2D42A 2RSXA 4EC6A 2OCTA 1O7NB 3NV0A 1J2BA 2HMJB 3T8UA 3FLJA 8CHOA 3CCS3 3SEDA 2W9QA 2CW9A 3I0YA 4Q53A 1W6YA 1IQ8A 3CC73 2RGQA 4XB5A 4KFDA 3GWRA 2BHMA 3MPHA 1Y4KA 1W2ZA 3F8XA 3NQZA 3DXOA 1ASKA 2B24B 1VQ63 3CPOA 3LT8A 4R1KA 3GAXA 4OK0A 2HMKB 3Q90A 1JV2B 3EHCA 3JUQA 3K63A 2Z77A 3CCM3 1STDA 1ULIB 2M7OA 3EC9A 1LVNA 2KCDA 4HM4B 2OQEA 1STFI 3G4S3 1W02A 3EN1B 1D6YA 2YX9A 5ELJA 5IF6A 2B1XB 1O7WB 4EV5A 1A90A 1ZO2A 1DMNA 3K9MC 1QAFA 3RGAA 1NWWA 3Q2PA 1FA3A 3DUKA 1NB3I 3JUOA 4WHAA 1E3RA 1G96A 1OF5A 2BMOB 2CG0A 3MG2A 1EG9B 3BNEA 3KSED 3CMA3 4R4KA 4WYKB 4NHFA 1VQO3 3F7XA 3VGNA 4R9LA 1R4CA 3EQQB 3KIIA 4K61A 3NM7A 1OH0A 3JUNA 1N5PA 3GZRA 3F14A 1ULJB 1Z1SA 4O02B 3LZAA 3LOYA 2SBLA 3S28A 2GEXA 4XDVA 2RFRA 3IMAB 4GL6A 3CNMA 4MEIA 1SIHA 1LOXA 3MHEA 1O7GB 2WO0A 2LYXA 4AEQA 3KKGA 1AVLA 3FG1A 3IPTA 2Y73A 1DYUA 3KSPA 2Z7AA 3LTAA 3PGBA 3G8ZA 1JRQA 1DVCA 4IPBA 4MMZB 3NM2A 3FH1A 2YFJB 3UL5A 5D82A 1QMAA 3DM8A 3STDA 5KP4A 3WOFB 1NJI4 4G1MB 1E3VA 1QJGA 4J8TA 5IG4A 3B4OA 1JN5A 4IT7A 1VQ53 2E2UA 3VSYA 1BUQA 3I553 1EA2A 3VF1A 4IIAA 3KE7A 1K41A 1LNHA 4H61A 2GXFA 3AMOA 5LC7A 4STDA 3G713 3NHXA 1FGOA 5AYSC 5CLKA 4R80A 3WOEB 1VQN3 4OVMA 1M904 2F99A 2GU1A 2W56A 5LC6A 1VZZA 2HMOB 3F7SA 2GBWB 7STDA 1IT7A 3GZXB 2Q07A 2OQEC 1JKGB 1M1K4 4LMIA 2XRXB 5IG5A 3H3HA 4KZ1A 4XM4A 1YIJ3 4N6LA 1YVBI 2XH9A 3HX8A 3KN4A 3SVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZM8 A;  4CCV A;  4TX4 A;  3GAX A;  3UL6 A;  1NB5 I;  3QRD A;  1WNH A;  1IV9 A;  1CYV A;  1STF I;  5ELJ A;  5ELU A;  1A90 A;  3PYJ A;  4N6N B;  3K9M C;  4EYC A;  3NX0 A;  2O9U X;  1MNL A;  3Q2P A;  1FA3 A;  1NB3 I;  3MWZ A;  1G96 A;  1MOL A;  4N6M A;  3KSE D;  1EQK A;  4N6U A;  1R4C A;  1ROA A;  2BO9 B;  1N5P A;  3PS8 A;  1N5H A;  1M9G A;  2KXG A;  1A67 A;  1PFP A;  4N6O B;  3IMA B;  5A0O B;  1CEW I;  1LXE A;  2CH9 A;  2W9P A;  1N9J A;  1DVC A;  3S67 A;  3UL5 A;  3KFQ C;  4N6V 0;  3LH4 A;  4IT7 A;  3L0R A;  4N6T A;  1GD4 A;  1KWI A;  1RN7 A;  5LC7 A;  1DVD A;  3PXM A;  4LZI A;  5LC6 A;  2OCT A;  1TIJ A;  1GD3 A;  5EQL A;  1FUW A;  2W9Q A;  1CYU A;  1IV7 A;  4N6L A;  1YVB I;  3SVA A; 
#chains in the Genus database with same CATH topology
 2IY2 A;  2IA7 A;  4ZM8 A;  1YHQ 3;  3RNT A;  4CCV A;  1F8N A;  1IYY A;  1YGE A;  5BU4 A;  4FMA A;  2HMN B;  4LEH A;  2W04 A;  3RGR A;  2A15 A;  2XSO B;  3UL6 A;  5EVH A;  1AV4 A;  1M1X B;  1SPU A;  1WNH A;  3SLU A;  3CCL 3;  4HM2 B;  3WA2 X;  3WOD G;  3SOA A;  4K1U A;  1IV9 A;  1CYV A;  1UGI A;  1RLS A;  1W7C A;  3ROB A;  1B2Z A;  3LTC A;  3WDG B;  5TGN A;  5AI1 A;  3T0U A;  1AVK A;  1SQW A;  5I97 A;  3CPW 2;  3PYJ A;  1RHL A;  5HOH A;  3ECF A;  2H0H A;  1GYB A;  3CC4 3;  1YJW 3;  4EYC A;  1VQK 3;  3DGM A;  2O9U X;  3ZFZ A;  1MNL A;  4L8P A;  1IQY A;  1CH0 A;  1RRH A;  1K73 4;  3MWZ A;  4EBG A;  2CC3 A;  1BRN L;  2R41 A;  1PY3 A;  1SJW A;  1MOL A;  2KF4 A;  2IMJ A;  1RRL A;  2ZL8 A;  3EBY A;  1K8A 4;  3EF8 A;  4N6M A;  3OXA A;  2MF7 A;  4WWU C;  1TU5 A;  1UDI I;  2KAA A;  4MMY B;  2KF5 A;  4N6U A;  3TDG A;  1R4Y A;  2XFT A;  4RZM A;  5HGR A;  3N54 B;  2QEX 3;  1VQ8 3;  4RNY A;  1RJO A;  5G1L A;  4NRE A;  6RNT A;  5G1K A;  1L5G B;  2BO9 B;  3UNL A;  2IUK A;  1BSB A;  3G0K A;  3PS8 A;  1W6C A;  4WYK A;  2Z6B A;  2W2C A;  4WFO A;  1UUW B;  1RCK A;  4K90 B;  3X3X A;  2Z76 A;  4L8O A;  2JDI H;  3HOH A;  1KQS 2;  5AEW B;  1OCV A;  3FCS B;  3FSD A;  3GSP A;  1IVW A;  1OUN A;  1SAR A;  2E2V A;  2PZV A;  2R4I A;  3PZW A;  4FMB A;  4O8S A;  3NV0 B;  3X3Y A;  3CME 3;  3K7C A;  1BAN A;  4QWT A;  3BLZ A;  2IUJ A;  1W01 A;  1CEW I;  3ALA A;  4BTY A;  1T5Y A;  1JJ2 2;  3PCS A;  3KCH A;  3WMD A;  2F5M A;  1N9J A;  3KZT A;  4BTW A;  1O7H B;  4AKZ A;  2CWU A;  3CCQ 3;  1PU4 A;  2GBX B;  2BIR A;  3DGL A;  1ROV A;  2BT3 A;  1BRH A;  3S27 A;  3QK9 A;  2CFD A;  1YIT 3;  4N3V A;  1JZD A;  5JPP A;  2L1S A;  2WOH A;  3X40 A;  6STD A;  3OV4 A;  2F86 B;  3CD6 3;  4X2H A;  3LT9 A;  1BRK A;  1C7H A;  2UX0 A;  3BIR A;  1RCL A;  1TFK A;  4HM1 B;  3SXX A;  1DMM A;  1WMN A;  1UCL A;  3D5I A;  4GSP A;  2W6J H;  1Q86 4;  5D81 A;  1MWR A;  2KRT A;  1BSD A;  3X3Z A;  4KFF A;  1K9M 4;  4LYL B;  3G6E 3;  4XBY A;  5FW5 A;  1W2B 2;  4LGQ A;  1KSI A;  9RNT A;  2W03 A;  3DMC A;  3LTD A;  2CWV A;  1UW1 A;  3NXJ A;  2AAE A;  3CU3 A;  3FGY A;  1RNB A;  1QAK A;  5EQL A;  4KT3 B;  2P0X A;  4FCJ A;  3BB9 A;  1Q7Y 4;  4ILF A;  1FUW A;  3IJE B;  3M8C A;  3PCR A;  3MYT A;  1IV7 A;  4KVH A;  1FGQ A;  3V99 A;  3B4P A;  1Q40 B;  1T3B A;  2C4B A;  3LTB A;  3FG3 A;  3JVC A;  1IT8 A;  1N8Q A;  2OOV C;  1BSC A;  1JKG A;  1V74 A;  3ER7 A;  2CFG A;  1B27 A;  1BSE A;  1W00 A;  3MG3 A;  1U5O A;  2AAD A;  4HVN A;  2HML B;  3GZB A;  4OUQ A;  1I2G A;  4K1V A;  5CK6 A;  1FGM A;  1GS3 A;  1ZGX A;  3OWU A;  4HOH A;  3CCV 3;  1TFO A;  5AIH A;  2CHC A;  1B2U A;  1IDP A;  1UI8 A;  3A76 A;  3DGN A;  5IEN A;  1AR0 A;  3FG4 A;  1JBR A;  2FNQ A;  5IEP A;  1DET A;  4HM5 B;  1RMS A;  5ELU A;  1HZ1 A;  3F40 A;  4I4K A;  4N6N B;  1JB4 A;  1NNV A;  4L7K A;  1OGX A;  1NU3 A;  4R9K A;  3NX0 A;  2XR8 B;  4EXR A;  2PNC A;  1VQQ A;  2CG1 A;  1GMR A;  3AHS A;  2YFL B;  3DY5 A;  4BU4 A;  1JBT A;  2CK3 H;  1W5Z A;  2XEP A;  1LNI A;  3N9H A;  5BVB A;  3CC2 3;  4CPK A;  4EW5 A;  3OWS A;  3V98 A;  1RGG A;  5FGO A;  4RNZ A;  1ZX2 A;  1JZO A;  4GHO A;  1GSP A;  2ZHX B;  5AIF A;  5JPU A;  2BNG A;  5KP3 A;  2XGL A;  1VQM 3;  1JN5 B;  1ROA A;  2YFI B;  3EN8 A;  2LQV A;  3OX9 A;  1GY7 A;  2F4Y A;  3AMO B;  3DZL A;  3O8Y A;  1OHO A;  2KXG A;  3BNC A;  3BND A;  2MC8 A;  2XGN A;  1A67 A;  1A2V A;  2GSP A;  1QVG 2;  5CF2 A;  4X2O A;  1PFP A;  2UGI A;  2XF3 A;  1RGK A;  1W6G A;  3LML A;  2OOV A;  2W56 B;  5M18 A;  1D6U A;  1IU7 A;  1BVI A;  1BRI A;  2P05 A;  2FXT A;  3K5T A;  1FGT A;  1YJ9 3;  1DMQ A;  4O2H A;  5BIR A;  2V1L A;  4HYZ A;  4MJD A;  5A0O B;  2K3D A;  1HU9 A;  4XBX A;  1BIR A;  5AII A;  1RN1 A;  5STD A;  1SII A;  2CH9 A;  2Y74 A;  3RDE A;  1WMP A;  2CWT A;  5IG0 A;  3CCJ 3;  2C11 A;  3X41 A;  2CX0 A;  4BL3 A;  3SX1 A;  3J7Y d;  1AQZ A;  3EE1 A;  1D6Z A;  2WOF A;  1U8C B;  3GZY B;  4ORL A;  1IVV A;  4RBN A;  4AKY A;  3EJV A;  1VQ9 3;  2WGO A;  1UGH I;  1DE3 A;  1UCK A;  1B20 A;  4XDW A;  1GY6 A;  1I3I A;  2P0M A;  2GEY A;  1X1Y A;  3LH4 A;  5CXO A;  3L0R A;  1X1W A;  1N8R 4;  2QGU A;  5AYR B;  4DKI A;  1RDS A;  2KF6 A;  3MG1 A;  1KWI A;  1RN7 A;  1FGR A;  2GU3 A;  2H0I A;  1LRA A;  1LOV A;  1E97 A;  4HM0 B;  1YI2 3;  3PXM A;  1OAC A;  2STD A;  3FF2 A;  3EB8 A;  4KFE A;  4LZI A;  2JQ5 A;  1QVF 2;  4HZB B;  5AEU B;  1RGL A;  1RGH A;  1TIJ A;  1EKM A;  3NQY A;  1GD3 A;  4EV2 A;  1HKX A;  4NPB A;  5KP1 A;  4HM6 B;  2OWP A;  2BMQ B;  2L4V A;  1BNF A;  5IEO A;  1KC8 4;  1CYU A;  1T2I A;  1EEJ A;  3D9R A;  1FZU A;  2BMR B;  5JBS A;  1JB2 A;  4O3V A;  1RN4 A;  3E99 A;  3AGO A;  3MSO A;  3NBB A;  4RNT A;  2CFK A;  1NO3 A;  1IVU A;  4FMD A;  4TX4 A;  3S29 A;  2OTL 3;  3NUV A;  3SYU A;  3WHO A;  3I56 3;  4CDL A;  3BNB A;  5D83 A;  5CF1 A;  3WA3 A;  2E2T A;  3EBT A;  1NB5 I;  1VQ4 3;  3FF0 A;  1Q42 A;  3CNX A;  3NBR A;  1WQL B;  1Q40 A;  2CFW A;  3F8H A;  2C10 A;  3QRD A;  5DRE A;  3T8N A;  1OPY A;  4JRF A;  4J5K A;  1I0V A;  3B7C A;  2P09 A;  3X42 A;  2K54 A;  4JF8 A;  3D3L A;  4HJL B;  4FR9 A;  5BXQ A;  4HZ9 B;  3U97 A;  1BUJ A;  3OW2 2;  4HBR A;  4GB5 A;  3MKI A;  1UCJ A;  1QAL A;  3OWY A;  2INX A;  4XBT A;  5DRV A;  1OF5 B;  3AGN A;  2XSH B;  4HM7 B;  3CCU 3;  1BSA A;  2H0G A;  1YJN 3;  1I0X A;  2P38 A;  3LXU X;  3HK4 A;  5EEO A;  2RNT A;  1IK3 A;  2OTJ 3;  5GSP A;  3SOY A;  2UUG C;  1BRS A;  4HM8 B;  3CXC 2;  3EX9 A;  3LYG A;  1KD1 4;  2IYJ A;  3JUP A;  3G16 A;  3HIG A;  1OGZ A;  3ZG0 A;  4LSO A;  1MWU A;  1YVS A;  4WP5 A;  3HI7 A;  3H51 A;  1EQK A;  3K0Z A;  5IW9 A;  1N9E A;  1ISK A;  1A2K A;  5IG3 A;  1O7M B;  1VQ7 3;  2K0M A;  4HM3 B;  8RNT A;  1IQX A;  1MGR A;  1X1U A;  4MMX B;  1JB5 A;  7GSP A;  4U13 A;  2ZDJ A;  1M9G A;  1N5H A;  4H3U A;  3FKA A;  3JUM A;  1BNE A;  3UB1 A;  1TRP A;  2ML5 A;  2QIY A;  1RKY A;  4FCM A;  1UUV B;  1TTO A;  1CQS A;  1LQG C;  3GRD A;  3V92 A;  1OHS A;  4N6O B;  2D1W A;  2I9W A;  2RCD A;  1IVX A;  2ML6 A;  1BNG A;  1TUH A;  3CCE 3;  3Q1C A;  1JNQ A;  3CCR 3;  5G2G A;  1MGW A;  2W0Q A;  1LXE A;  3F9S A;  1I2E A;  2W9P A;  4J9A A;  3FZW A;  1W4N A;  2QA4 3;  3UJM A;  4FMC A;  3N8B A;  3U1W A;  2F98 A;  4CJN A;  1K28 A;  1WMO A;  1B2X A;  4PEJ A;  3S67 A;  1AY7 A;  1S72 3;  1OHP A;  1GOU A;  3KFQ C;  1Q82 4;  4FCZ A;  4N6V 0;  2FGT A;  2CKF B;  1V57 A;  2CFL A;  4BTX A;  2CX1 A;  3DGO A;  1GY5 A;  2O3O A;  1VQP 3;  1B2M A;  4N6T A;  5IER A;  1GD4 A;  1WTH A;  2HMM B;  1S5A A;  1VQL 3;  1GOY A;  1T2H A;  3URP A;  5AIG A;  1Q81 4;  1DVD A;  1UI7 A;  2WGQ A;  1TP6 A;  1US1 A;  1O7P B;  2CIU A;  3B8L A;  3HZP A;  4HKV B;  3S5C A;  3NBJ A;  2XFS A;  1NDO B;  3HII A;  2D42 A;  2RSX A;  4EC6 A;  2F5W A;  2OCT A;  1RGC A;  1O7N B;  2F56 A;  3NV0 A;  1J2B A;  2HMJ B;  3T8U A;  3FLJ A;  8CHO A;  3WR2 A;  1BNI A;  1BU4 A;  4J5G A;  3CCS 3;  4BIR A;  3SED A;  1X1X A;  2W9Q A;  2CW9 A;  3I0Y A;  1BOX A;  4Q53 A;  1W6Y A;  1IQ8 A;  3CC7 3;  2RGQ A;  1LOY A;  4XB5 A;  4KFD A;  3GWR A;  3ZG5 A;  2BHM A;  3MPH A;  1Y4K A;  1W2Z A;  3F8X A;  3NQZ A;  3DXO A;  1ASK A;  2B24 B;  1VQ6 3;  3CPO A;  3LT8 A;  4R1K A;  3GAX A;  4OK0 A;  1Q7H A;  3BU4 A;  2HMK B;  3Q90 A;  1JV2 B;  3EHC A;  3JUQ A;  3K63 A;  2Z77 A;  3CCM 3;  1STD A;  1ULI B;  1GMP A;  2M7O A;  3EC9 A;  1LVN A;  1MWS A;  2KCD A;  1FW7 A;  4HM4 B;  2OQE A;  1STF I;  3G4S 3;  1W02 A;  3EN1 B;  1TRQ A;  1FYS A;  1D6Y A;  1FUS A;  2YX9 A;  1UCI A;  1RNT A;  5ELJ A;  5IF6 A;  2B1X B;  4BL2 A;  1O7W B;  4EV5 A;  1A90 A;  1ZO2 A;  1DMN A;  3K9M C;  1QAF A;  1UUG B;  3AHW A;  3RGA A;  1BRJ A;  1NWW A;  1B21 A;  3D79 A;  3Q2P A;  3DUK A;  1FA3 A;  1YNV X;  1NB3 I;  1LOW A;  3JUO A;  4WHA A;  1E3R A;  1G96 A;  1OF5 A;  2BMO B;  5RNT A;  1I8V A;  1B3S A;  1RGA A;  2RBI A;  2CG0 A;  3MG2 A;  1EG9 B;  1HYF A;  3BNE A;  3KSE D;  4R4K A;  4WYK B;  3CMA 3;  4NHF A;  1VQO 3;  1FUT A;  3F7X A;  3VGN A;  4R9L A;  1R4C A;  3EQQ B;  2SAR A;  3KII A;  1I3F A;  1BRG A;  4K61 A;  3NM7 A;  1OH0 A;  1RTU A;  3JUN A;  1N5P A;  3GZR A;  3F14 A;  1MWT A;  1RGE A;  1ULJ B;  1Z1S A;  1YGW A;  1TJD A;  4O02 B;  3LZA A;  1C54 A;  3LOY A;  1BNS A;  2SBL A;  3S28 A;  1JBS A;  1GMQ A;  2GEX A;  4XDV A;  1LQM B;  2HOH A;  2RFR A;  3IMA B;  4GL6 A;  3CNM A;  4MEI A;  1SIH A;  1LOX A;  3MHE A;  1B2S A;  1O7G B;  2WO0 A;  2LYX A;  2ZA4 A;  1A2P A;  1V58 A;  3KKG A;  4AEQ A;  1AVL A;  1GOV A;  3FG1 A;  3IPT A;  4I5Q A;  2Y73 A;  3DH2 A;  1DYU A;  1ZS7 A;  3KSP A;  2Z7A A;  3LTA A;  1RGF A;  3PGB A;  3G8Z A;  1JRQ A;  6GSP A;  1DVC A;  4IPB A;  3D4A A;  4MMZ B;  1I2F A;  3NM2 A;  3FH1 A;  5M1A A;  2YFJ B;  5M19 A;  1G0T A;  3Q3F A;  5D82 A;  1QMA A;  3UL5 A;  3DM8 A;  3STD A;  3DGY A;  5KP4 A;  3WOF B;  1NJI 4;  4G1M B;  1E3V A;  1QJG A;  4J8T A;  5IG4 A;  3B4O A;  1JN5 A;  4IT7 A;  1VQ5 3;  1BAO A;  1EUI C;  2E2U A;  3VSY A;  1BUQ A;  3I55 3;  1EA2 A;  1BNR A;  3VF1 A;  4IIA A;  1G02 A;  1K41 A;  1LNH A;  3KE7 A;  2GXF A;  3AMO A;  4H61 A;  5LC7 A;  4STD A;  3G71 3;  3NHX A;  1FGO A;  5AYS C;  5CLK A;  4R80 A;  3WOE B;  1VQN 3;  4OVM A;  1M90 4;  2F99 A;  2GU1 A;  2W56 A;  5LC6 A;  1VZZ A;  1Q9E A;  7RNT A;  2HMO B;  3F7S A;  2BU4 A;  1I70 A;  2GBW B;  7STD A;  1IT7 A;  3GZX B;  1PYL A;  2Q07 A;  2KF3 A;  2OQE C;  1BNJ A;  1JKG B;  1M1K 4;  3A5E A;  4LMI A;  2XRX B;  4HAA A;  5IG5 A;  3H3H A;  4KZ1 A;  3D5G A;  4XM4 A;  2J8X B;  1BGS A;  1RSN A;  4N6L A;  1YVB I;  2XH9 A;  1YIJ 3;  3HX8 A;  3KN4 A;  3SVA A; 
#chains in the Genus database with same CATH homology
 2IA7 A;  4ZM8 A;  1YHQ 3;  4CCV A;  1F8N A;  1YGE A;  4FMA A;  2HMN B;  4LEH A;  2W04 A;  3RGR A;  2A15 A;  2XSO B;  3UL6 A;  5EVH A;  1AV4 A;  1M1X B;  1SPU A;  1WNH A;  3SLU A;  3CCL 3;  4HM2 B;  3WA2 X;  3WOD G;  3SOA A;  4K1U A;  1IV9 A;  1CYV A;  1W7C A;  3ROB A;  3LTC A;  3WDG B;  5TGN A;  5AI1 A;  3T0U A;  1AVK A;  1SQW A;  5I97 A;  3CPW 2;  3PYJ A;  3ECF A;  1GYB A;  3CC4 3;  1YJW 3;  4EYC A;  1VQK 3;  3DGM A;  2O9U X;  1MNL A;  4L8P A;  1IQY A;  1K73 4;  1RRH A;  3MWZ A;  4EBG A;  2CC3 A;  1SJW A;  1MOL A;  2ZL8 A;  2IMJ A;  1RRL A;  3EBY A;  1K8A 4;  3EF8 A;  4N6M A;  3OXA A;  2MF7 A;  4WWU C;  1TU5 A;  4MMY B;  4N6U A;  3TDG A;  2XFT A;  4RZM A;  5HGR A;  3N54 B;  2QEX 3;  1VQ8 3;  4RNY A;  1RJO A;  4NRE A;  1L5G B;  2BO9 B;  3UNL A;  2IUK A;  3G0K A;  4WFO A;  3PS8 A;  1W6C A;  4WYK A;  2Z6B A;  2W2C A;  1UUW B;  4K90 B;  3X3X A;  2Z76 A;  4L8O A;  2JDI H;  1KQS 2;  5AEW B;  1OCV A;  3FCS B;  3FSD A;  1IVW A;  1OUN A;  2E2V A;  4FMB A;  2PZV A;  2R4I A;  3PZW A;  4O8S A;  3NV0 B;  3X3Y A;  3CME 3;  3K7C A;  4QWT A;  3BLZ A;  2IUJ A;  1W01 A;  1CEW I;  3ALA A;  4BTY A;  1T5Y A;  1JJ2 2;  3PCS A;  3WMD A;  1N9J A;  3KZT A;  4BTW A;  1O7H B;  4AKZ A;  2CWU A;  3CCQ 3;  1PU4 A;  2GBX B;  3DGL A;  1ROV A;  2BT3 A;  3S27 A;  3QK9 A;  2CFD A;  1YIT 3;  4N3V A;  5JPP A;  2WOH A;  3X40 A;  6STD A;  3OV4 A;  2F86 B;  3CD6 3;  4X2H A;  3LT9 A;  1C7H A;  2UX0 A;  4HM1 B;  1TFK A;  3SXX A;  1DMM A;  1WMN A;  2W6J H;  1Q86 4;  5D81 A;  2KRT A;  3X3Z A;  4KFF A;  1K9M 4;  3G6E 3;  4XBY A;  5FW5 A;  1W2B 2;  4LGQ A;  1KSI A;  2W03 A;  3DMC A;  3LTD A;  2CWV A;  1UW1 A;  3NXJ A;  3FGY A;  3CU3 A;  1QAK A;  5EQL A;  2P0X A;  4FCJ A;  3BB9 A;  1Q7Y 4;  1FUW A;  3IJE B;  3M8C A;  3PCR A;  3MYT A;  1IV7 A;  4KVH A;  1FGQ A;  3V99 A;  3B4P A;  1Q40 B;  3LTB A;  3FG3 A;  3JVC A;  1IT8 A;  1N8Q A;  2OOV C;  1JKG A;  1V74 A;  3ER7 A;  2CFG A;  1W00 A;  3MG3 A;  1U5O A;  4HVN A;  2HML B;  3GZB A;  4OUQ A;  4K1V A;  5CK6 A;  1FGM A;  1GS3 A;  3OWU A;  3CCV 3;  1TFO A;  5AIH A;  2CHC A;  1IDP A;  3A76 A;  1UI8 A;  3DGN A;  5IEN A;  1AR0 A;  3FG4 A;  2FNQ A;  5IEP A;  4HM5 B;  5ELU A;  3F40 A;  4I4K A;  4N6N B;  1JB4 A;  4L7K A;  1OGX A;  1NU3 A;  4R9K A;  3NX0 A;  2XR8 B;  4EXR A;  2PNC A;  2CG1 A;  2YFL B;  3DY5 A;  2CK3 H;  1W5Z A;  2XEP A;  3N9H A;  5BVB A;  3CC2 3;  3OWS A;  3V98 A;  5FGO A;  4RNZ A;  1ZX2 A;  5JPU A;  5AIF A;  1VQM 3;  2BNG A;  5KP3 A;  2XGL A;  1JN5 B;  1ROA A;  2YFI B;  3EN8 A;  2LQV A;  3OX9 A;  1GY7 A;  3DZL A;  3AMO B;  2MC8 A;  3O8Y A;  1OHO A;  2KXG A;  3BNC A;  3BND A;  2XGN A;  1A67 A;  1A2V A;  1QVG 2;  5CF2 A;  4X2O A;  1PFP A;  2XF3 A;  3LML A;  1W6G A;  2OOV A;  2W56 B;  1D6U A;  1IU7 A;  2P05 A;  2FXT A;  3K5T A;  1FGT A;  1YJ9 3;  1DMQ A;  4O2H A;  2V1L A;  4HYZ A;  4MJD A;  5A0O B;  1HU9 A;  4XBX A;  5AII A;  5STD A;  1SII A;  2CH9 A;  2Y74 A;  3RDE A;  1WMP A;  2CWT A;  5IG0 A;  3CCJ 3;  2C11 A;  3X41 A;  3SX1 A;  3J7Y d;  3EE1 A;  1D6Z A;  2WOF A;  1U8C B;  3GZY B;  4ORL A;  1IVV A;  4RBN A;  4AKY A;  3EJV A;  1VQ9 3;  2WGO A;  4XDW A;  1GY6 A;  2P0M A;  2GEY A;  5CXO A;  3LH4 A;  3L0R A;  1N8R 4;  2QGU A;  5AYR B;  3MG1 A;  1KWI A;  1RN7 A;  1FGR A;  2GU3 A;  1E97 A;  4HM0 B;  1YI2 3;  3PXM A;  1OAC A;  2STD A;  3FF2 A;  3EB8 A;  4KFE A;  4LZI A;  2JQ5 A;  1QVF 2;  4HZB B;  5AEU B;  1TIJ A;  1EKM A;  3NQY A;  1GD3 A;  4EV2 A;  1HKX A;  5KP1 A;  4HM6 B;  2OWP A;  2BMQ B;  2L4V A;  5IEO A;  1KC8 4;  1CYU A;  3D9R A;  2BMR B;  5JBS A;  1JB2 A;  4O3V A;  3E99 A;  3MSO A;  3NBB A;  2CFK A;  1NO3 A;  1IVU A;  4FMD A;  4TX4 A;  3S29 A;  2OTL 3;  3NUV A;  3I56 3;  4CDL A;  3BNB A;  5D83 A;  5CF1 A;  3WA3 A;  2E2T A;  3EBT A;  1NB5 I;  1VQ4 3;  3FF0 A;  1Q42 A;  3CNX A;  3NBR A;  1WQL B;  1Q40 A;  2CFW A;  3F8H A;  2C10 A;  3QRD A;  5DRE A;  3T8N A;  1OPY A;  4JRF A;  3B7C A;  2P09 A;  3X42 A;  2K54 A;  4JF8 A;  3D3L A;  4HJL B;  4FR9 A;  5BXQ A;  4HZ9 B;  3U97 A;  3OW2 2;  4HBR A;  4GB5 A;  3MKI A;  1QAL A;  3OWY A;  2INX A;  4XBT A;  5DRV A;  1OF5 B;  4HM7 B;  2XSH B;  3CCU 3;  1YJN 3;  2P38 A;  3LXU X;  3HK4 A;  5EEO A;  1IK3 A;  2OTJ 3;  3SOY A;  3CXC 2;  4HM8 B;  3EX9 A;  3LYG A;  1KD1 4;  3JUP A;  3G16 A;  3HIG A;  1OGZ A;  4LSO A;  4WP5 A;  3HI7 A;  3H51 A;  1EQK A;  3K0Z A;  5IW9 A;  1N9E A;  1ISK A;  1A2K A;  5IG3 A;  1O7M B;  1VQ7 3;  2K0M A;  4HM3 B;  1IQX A;  4MMX B;  1JB5 A;  4U13 A;  2ZDJ A;  1M9G A;  1N5H A;  4H3U A;  3FKA A;  3JUM A;  3UB1 A;  2QIY A;  2ML5 A;  1RKY A;  4FCM A;  1UUV B;  1CQS A;  3V92 A;  3GRD A;  1OHS A;  4N6O B;  2D1W A;  2I9W A;  2RCD A;  1IVX A;  2ML6 A;  3CCE 3;  1TUH A;  3Q1C A;  1JNQ A;  3CCR 3;  5G2G A;  2W0Q A;  1LXE A;  3F9S A;  2W9P A;  4J9A A;  3FZW A;  1W4N A;  2QA4 3;  3UJM A;  4FMC A;  3N8B A;  3U1W A;  2F98 A;  1K28 A;  1WMO A;  4PEJ A;  3S67 A;  1S72 3;  1OHP A;  1Q82 4;  3KFQ C;  4FCZ A;  4N6V 0;  2FGT A;  2CKF B;  2CFL A;  4BTX A;  3DGO A;  1VQP 3;  1GY5 A;  2O3O A;  4N6T A;  5IER A;  1GD4 A;  1WTH A;  2HMM B;  1S5A A;  1VQL 3;  5AIG A;  1Q81 4;  1DVD A;  1UI7 A;  2WGQ A;  1TP6 A;  1US1 A;  1O7P B;  2CIU A;  3B8L A;  3HZP A;  4HKV B;  3S5C A;  3NBJ A;  2XFS A;  1NDO B;  3HII A;  2D42 A;  2RSX A;  4EC6 A;  2OCT A;  1O7N B;  3NV0 A;  1J2B A;  2HMJ B;  3T8U A;  3FLJ A;  8CHO A;  3CCS 3;  3SED A;  2W9Q A;  2CW9 A;  3I0Y A;  4Q53 A;  1W6Y A;  1IQ8 A;  3CC7 3;  2RGQ A;  4XB5 A;  4KFD A;  3GWR A;  2BHM A;  3MPH A;  1Y4K A;  1W2Z A;  3F8X A;  3NQZ A;  3DXO A;  1ASK A;  2B24 B;  1VQ6 3;  3CPO A;  3LT8 A;  4R1K A;  3GAX A;  4OK0 A;  2HMK B;  3Q90 A;  1JV2 B;  3EHC A;  3JUQ A;  3K63 A;  2Z77 A;  3CCM 3;  1STD A;  1ULI B;  2M7O A;  3EC9 A;  1LVN A;  2KCD A;  4HM4 B;  2OQE A;  1STF I;  3G4S 3;  1W02 A;  3EN1 B;  1D6Y A;  2YX9 A;  5ELJ A;  5IF6 A;  2B1X B;  1O7W B;  4EV5 A;  1A90 A;  1ZO2 A;  1DMN A;  3K9M C;  1QAF A;  3RGA A;  1NWW A;  3Q2P A;  1FA3 A;  3DUK A;  1NB3 I;  3JUO A;  4WHA A;  1E3R A;  1G96 A;  1OF5 A;  2BMO B;  2CG0 A;  3MG2 A;  1EG9 B;  3BNE A;  3KSE D;  3CMA 3;  4R4K A;  4WYK B;  4NHF A;  1VQO 3;  3F7X A;  3VGN A;  4R9L A;  1R4C A;  3EQQ B;  3KII A;  4K61 A;  3NM7 A;  1OH0 A;  3JUN A;  1N5P A;  3GZR A;  3F14 A;  1ULJ B;  1Z1S A;  4O02 B;  3LZA A;  3LOY A;  2SBL A;  3S28 A;  2GEX A;  4XDV A;  2RFR A;  3IMA B;  4GL6 A;  3CNM A;  4MEI A;  1SIH A;  1LOX A;  3MHE A;  1O7G B;  2WO0 A;  2LYX A;  4AEQ A;  3KKG A;  1AVL A;  3FG1 A;  3IPT A;  2Y73 A;  1DYU A;  3KSP A;  2Z7A A;  3LTA A;  3PGB A;  3G8Z A;  1JRQ A;  1DVC A;  4IPB A;  4MMZ B;  3NM2 A;  3FH1 A;  2YFJ B;  3UL5 A;  5D82 A;  1QMA A;  3DM8 A;  3STD A;  5KP4 A;  3WOF B;  1NJI 4;  4G1M B;  1E3V A;  1QJG A;  4J8T A;  5IG4 A;  3B4O A;  1JN5 A;  4IT7 A;  1VQ5 3;  2E2U A;  3VSY A;  1BUQ A;  3I55 3;  1EA2 A;  3VF1 A;  4IIA A;  3KE7 A;  1K41 A;  1LNH A;  4H61 A;  2GXF A;  3AMO A;  5LC7 A;  4STD A;  3G71 3;  3NHX A;  1FGO A;  5AYS C;  5CLK A;  4R80 A;  3WOE B;  1VQN 3;  4OVM A;  1M90 4;  2F99 A;  2GU1 A;  2W56 A;  5LC6 A;  1VZZ A;  2HMO B;  3F7S A;  2GBW B;  7STD A;  1IT7 A;  3GZX B;  2Q07 A;  2OQE C;  1JKG B;  1M1K 4;  4LMI A;  2XRX B;  5IG5 A;  3H3H A;  4KZ1 A;  4XM4 A;  1YIJ 3;  4N6L A;  1YVB I;  2XH9 A;  3HX8 A;  3KN4 A;  3SVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...