1GD3A

Refined solution structure of human cystatin a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CYSTATIN A
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd3A00
1GD3A 5LC7A 2BO9B 1FA3A 1IV9A 4N6MA 4N6TA 2W9QA 4CCVA 1FUWA 3PYJA 3UL6A 4TX4A 3NX0A 4N6LA 4N6OB 5LC6A 2OCTA 1YVBI 1MNLA 1CYUA 3PXMA 3UL5A 1CYVA 3LH4A 1IV7A 1N5HA 4N6NB 3KSED 5A0OB 1CEWI 1NB5I 1DVCA 1GD4A 1R4CA 5EQLA 1EQKA 1A90A 4IT7A 1DVDA 1MOLA 4N6V0 5ELUA 1KWIA 3KFQC 1LXEA 3PS8A 1STFI 3K9MC 1TIJA 2O9UX 4EYCA 4ZM8A 1M9GA 2W9PA 5ELJA 1PFPA 4LZIA 1RN7A 1G96A 1WNHA 3SVAA 1N5PA 2KXGA 3L0RA 3Q2PA 1A67A 3GAXA 1NB3I 2CH9A 3QRDA 3MWZA 3S67A 3IMAB 4N6UA 1ROAA 1N9JA
chains in the Genus database with same CATH superfamily
1B2XA 1MWSA 1X1UA 4K90B 5DRVA 1RGEA 1YNVX 1IQYA 2L4VA 1FUSA 1UI7A 2QIYA 5TGNA 3UNLA 2WGOA 1CQSA 1WMPA 1B2MA 1T5YA 3MSOA 4MJDA 3NQYA 5LC6A 1K734 1ROVA 5JBSA 1YIT3 1K8A4 1NU3A 3BLZA 3NBBA 3D5GA 2F56A 4R9LA 3IJEB 3GZXB 5EVHA 4STDA 1V57A 1BNJA 2P09A 1M1XB 3KCHA 1SIHA 3AGNA 1M904 2CC3A 4JF8A 2FXTA 1M1K4 1IVXA 2CG1A 3AMOA 2GBXB 3LXUX 5ELJA 3T8UA 1RRLA 4EV5A 3FLJA 1BNFA 1OHOA 5CK6A 4FMCA 4WWUC 5M19A 1HU9A 1TRPA 1PYLA 3DY5A 4KFDA 1BOXA 1RNBA 3G16A 1E3RA 2L1SA 1ULIB 3HIIA 4JRFA 3GZRA 4GL6A 1KQS2 2E2UA 3JUOA 5CLKA 3WDGB 1BVIA 2CFLA 3OWYA 2IYJA 3EC9A 3LMLA 3CXC2 5BXQA 4HM8B 2GEXA 1GOUA 1GY5A 3X40A 2OTJ3 1A90A 3ZG5A 7STDA 4HM6B 4LYLB 1LXEA 1Q9EA 5IG4A 1UGHI 1NJI4 2W56B 4EV2A 1A2VA 2CG0A 3CC43 4GHOA 3X3YA 1UCIA 2IA7A 2OQEA 1LQGC 6RNTA 4FCMA 2WOFA 4IPBA 2CX1A 1I2EA 2Y73A 1TRQA 3DM8A 1Z1SA 5DREA 2BMOB 1IVWA 2IY2A 2A15A 1D6UA 2AAEA 1FUWA 1DMQA 1TFOA 2BMRB 1BNIA 1FGRA 3UJMA 4R1KA 1FGQA 1W6GA 1TTOA 3PXMA 1QVG2 4J9AA 4NPBA 3KSED 2ZHXB 2R4IA 4OUQA 2F5MA 1ZGXA 1Q42A 1FUTA 2KF5A 4O8SA 1KWIA 3JUNA 3OWSA 5EEOA 1EUIC 1GOYA 1DETA 1OCVA 2IMJA 5FGOA 2W9PA 1N9EA 3CCL3 1S723 1WNHA 3D9RA 2QEX3 2GEYA 3SVAA 3GZYB 3PGBA 1VQP3 2P05A 1PU4A 2YFLB 1BRJA 1Q7HA 1N9JA 3FCSB 1UW1A 3Q90A 3TDGA 1VQ43 4NHFA 4BTYA 4XDVA 1IK3A 2ZL8A 1YVSA 2H0GA 4J5GA 2BIRA 3KIIA 1BUJA 4BU4A 3ALAA 3G4S3 4N6NB 3EBTA 1CEWI 3K63A 1AY7A 1JB5A 2XRXB 3LTDA 1W00A 5D83A 8CHOA 3CNMA 1B2UA 3MYTA 5AYRB 3B4OA 3X3XA 3K7CA 4HAAA 1RN4A 1RGGA 2ML5A 2XFSA 5AIFA 1M9GA 3BNBA 4H61A 2UX0A 5D82A 1O7WB 1A67A 2Y74A 2XH9A 3QRDA 1W7CA 3MWZA 2BMQB 1AVKA 3VSYA 1GMPA 4EBGA 4MMYB 3URPA 2RFRA 4FMDA 1FA3A 2CHCA 1BSBA 2KF4A 2F4YA 1Q824 2BU4A 2Z7AA 5AIIA 3A76A 3S27A 2Q07A 1PY3A 1IU7A 1YGEA 2W0QA 1CYVA 3KN4A 2P0MA 2QGUA 1BRIA 1C7HA 2KF3A 1UDII 2YFIB 4MMXB 2XR8B 4N3VA 4WYKA 5HGRA 5M1AA 4CDLA 3I563 2JQ5A 3O8YA 1DVDA 2FNQA 1GMRA 1I3FA 3AHSA 2BT3A 1LQMB 1WMOA 1BSEA 2B1XB 1SIIA 3STDA 1Q40A 3WODG 1X1XA 5IG5A 1BNGA 1IQXA 2INXA 5IENA 1OACA 4LSOA 1N5PA 3BNDA 4HZ9B 2XGNA 3CPW2 2ZDJA 3JUMA 4L8PA 1GS3A 1JZOA 4RNTA 4XBYA 1W6YA 3EE1A 3NM7A 1YIJ3 2F98A 2UGIA 3WHOA 1B3SA 1DMMA 1BANA 1K9M4 2CW9A 2SBLA 2J8XB 1EKMA 2F86B 1B2SA 3DZLA 4FMBA 4N6OB 1YI23 1A2PA 1AQZA 4Q53A 4GSPA 1RGCA 1CH0A 3JVCA 4WP5A 1JV2B 3OX9A 1L5GB 2MF7A 3SYUA 5AIHA 3JUQA 1LVNA 2OQEC 1I2FA 2LYXA 1O7GB 1RN7A 3D5IA 1UUVB 3A5EA 3NBRA 4FCZA 2KXGA 2OWPA 2K0MA 2E2TA 3CNXA 2GSPA 3EQQB 4AEQA 2XSHB 3D3LA 3G6E3 1VQ93 5D81A 3CC23 2BO9B 5AEWB 3LT9A 2W9QA 2RSXA 3PYJA 5AEUB 1T3BA 3U1WA 1RKYA 1B20A 1FYSA 3PZWA 1W2ZA 4AKZA 7GSPA 1KC84 3WA2X 1CYUA 1N5HA 1TFKA 3FZWA 5IG0A 2M7OA 3EF8A 1JKGA 5IW9A 2HMMB 3FG4A 3EHCA 2IUKA 4CPKA 3K9MC 1QMAA 2UUGC 3DXOA 1T2HA 4XDWA 1UCKA 1BSDA 2QA43 3OW22 1RGLA 1JJ22 1G96A 1W6CA 5GSPA 3RGRA 4KVHA 3HZPA 1OUNA 3RGAA 1VQM3 3HIGA 1TJDA 3B4PA 3DH2A 5LC7A 1IT8A 1JRQA 1IV9A 2F5WA 1JBRA 4I5QA 4K61A 1K41A 1VQ53 3ER7A 2OOVA 3PCSA 5JPUA 3FGYA 1RHLA 1RCLA 3MPHA 3UB1A 2YX9A 2C10A 2HOHA 1US1A 3BNEA 5I97A 1YJN3 1JBSA 1WQLB 3D79A 4XM4A 1IVVA 3CD63 3J7Yd 2CWUA 5KP4A 4WYKB 9RNTA 2OOVC 1BRNL 3EB8A 2XF3A 3DGLA 1HKXA 5RNTA 3CME3 3Q3FA 3F8XA 3KE7A 1ZO2A 2ML6A 4FR9A 3SXXA 2C11A 4HM4B 3Q1CA 5HOHA 2HMOB 1ISKA 3DGOA 5BU4A 1ZS7A 1W2B2 3FG3A 3VF1A 1JKGB 1QJGA 2B24B 1V58A 4QWTA 3EN1B 5ELUA 2RGQA 1VQN3 2WO0A 1LOWA 2WGQA 4HOHA 1N8QA 3G8ZA 1A2KA 3OWUA 1Q7Y4 1RN1A 6GSPA 2OCTA 4O3VA 4BTWA 4KFFA 4HM0B 1QVF2 1BIRA 1LRAA 1RGHA 3ECFA 4WHAA 2CK3H 4HBRA 1D6ZA 3NBJA 3HK4A 1AVLA 3VGNA 1X1YA 1RRHA 3KFQC 4HM1B 3LTBA 4O02B 3AMOB 1EEJA 3LYGA 2W03A 4R9KA 4BL2A 2AADA 2YFJB 2FGTA 3NM2A 1GSPA 1N8R4 2RNTA 4R80A 3GSPA 1UUGB 2I9WA 1BRKA 1Y4KA 2HMKB 3H51A 1GOVA 1QAKA 2CX0A 1BRHA 3G713 1W4NA 3UL6A 3K0ZA 4N6LA 2GU3A 3SOYA 1JN5B 1C54A 1RLSA 1BNRA 3CCS3 5KP1A 1AR0A 1JB2A 4K1VA 4PEJA 1DMNA 3FH1A 4J5KA 1R4CA 1VQ73 1T2IA 1WMNA 2R41A 1EQKA 3V98A 4MEIA 3EX9A 1UI8A 7RNTA 2GBWB 2XEPA 4LMIA 3SX1A 2O9UX 4X2OA 3HOHA 2GU1A 1JN5A 1RNTA 2CIUA 2PZVA 3OV4A 3F40A 4H3UA 3RDEA 1NNVA 4LEHA 3B8LA 3S67A 3NX0A 3CCQ3 1I2GA 4BTXA 3V99A 1BSAA 1IYYA 3NXJA 1VZZA 3OXAA 4U13A 1OGXA 2JDIH 3ZFZA 3FF2A 2ZA4A 4LGQA 1OF5B 1BU4A 1FGMA 1JZDA 2CWVA 2W04A 1IQ8A 1UCJA 4ORLA 5CF2A 3F7SA 3IPTA 3FSDA 3MHEA 1J2BA 5AIGA 1GD4A 3V92A 1UCLA 1BRSA 2BNGA 5FW5A 1BSCA 3KZTA 1STFI 4XB5A 4EYCA 4ZM8A 2Z77A 4LZIA 4MMZB 1VQ63 1ASKA 4KT3B 3WMDA 1NB3I 2H0HA 3SOAA 3WA3A 1KSIA 1QAFA 3DGYA 4KZ1A 1LNHA 2OTL3 3CPOA 2CFGA 5IERA 5KP3A 1SPUA 1W5ZA 4NREA 4N6TA 1Q40B 3S29A 1B27A 1JB4A 2E2VA 2XFTA 3JUPA 8RNTA 2W56A 1IDPA 1O7NB 1LOYA 1MNLA 1FGOA 4OVMA 4BIRA 4L7KA 3CCU3 1OHPA 4R4KA 3HI7A 1NB5I 1BRGA 2K54A 1LNIA 3KSPA 6STDA 3CC73 3WR2A 2IUJA 3DUKA 5IEOA 4HZBB 1OGZA 3I0YA 2CWTA 1NWWA 3RNTA 3NV0A 2F99A 1OHSA 5G1KA 1W02A 3CCE3 3MG1A 2Z6BA 3L0RA 3Q2PA 4L8OA 3GAXA 1F8NA 2CH9A 3MKIA 1JNQA 1RGKA 4N6UA 1RJOA 3LZAA 4EC6A 1FZUA 1GYBA 2H0IA 1I0VA 3NUVA 1S5AA 4I4KA 1FW7A 1MWUA 1MGRA 5CXOA 1ZX2A 1VQO3 1IT7A 3F9SA 5G2GA 1VQ83 3LT8A 3GWRA 3CCR3 2HMNB 1YVBI 3BNCA 4HYZA 4J8TA 3UL5A 3LTCA 1IV7A 2O3OA 1AV4A 3I553 2KF6A 1RGFA 5BIRA 1TP6A 4IT7A 1DE3A 1MGWA 4XBXA 2CKFB 1X1WA 5IEPA 1TUHA 1E97A 3U97A 1YJW3 5JPPA 4RNYA 5AYSC 3N54B 1VQQA 1UGIA 1ULJB 3GZBA 2HMLB 2KCDA 3ZG0A 3NHXA 5IG3A 3BB9A 3KKGA 1Q864 3GRDA 1LOXA 3FKAA 2V1LA 1I0XA 3EN8A 5CF1A 2D1WA 3K5TA 3AGOA 4ILFA 1BNEA 4FCJA 1EG9B 3BIRA 2WOHA 4RNZA 5M18A 1O7PB 3BU4A 3WOEB 2KAAA 4G1MB 1HYFA 3LH4A 2P38A 3N9HA 1SARA 3SLUA 3LOYA 1YHQ3 1U5OA 1RMSA 1Q814 1E3VA 1GMQA 1LOVA 1I70A 3AHWA 3LTAA 5EQLA 2P0XA 1VQL3 3CMA3 1SJWA 1I8VA 1D6YA 3MG3A 4HM2B 4HJLB 4GB5A 4HVNA 3FG1A 3G0KA 1RSNA 3S5CA 3NQZA 2HMJB 1PFPA 2CFWA 2PNCA 2BHMA 2RBIA 3NV0B 3PCRA 2MC8A 3T8NA 1JBTA 2C4BA 4BL3A 2XGLA 1GY6A 1VQK3 1UUWB 4HM5B 3T0UA 1GD3A 1K28A 4CJNA 3CCM3 1R4YA 4K1UA 2CFDA 1WTHA 1I3IA 3H3HA 4EXRA 3WOFB 5AI1A 2XSOB 1B21A 1O7HB 3D4AA 4WFOA 3X3ZA 1BGSA 2Z76A 1MOLA 3DMCA 3CCV3 2W6JH 1B2ZA 2W2CA 1BNSA 1RCKA 3MG2A 4HM7B 1G0TA 3S28A 1V74A 1YJ93 3B7CA 1HZ1A 1O7MB 4HKVB 4X2HA 4DKIA 4EW5A 4OK0A 1EA2A 1W01A 3M8CA 5BVBA 3DGMA 1MWTA 1U8CB 3X41A 1OH0A 1FGTA 1OPYA 1TU5A 1BAOA 1SQWA 3EJVA 1IVUA 2D42A 2SARA 4N6MA 4CCVA 2K3DA 1MWRA 1STDA 4TX4A 3DGNA 1RTUA 3N8BA 5STDA 4O2HA 3F7XA 3CCJ3 1QALA 5G1LA 3ROBA 3QK9A 1OF5A 2KRTA 5A0OB 1NDOB 1YGWA 3X42A 1DVCA 2GXFA 1RGAA 2STDA 2RCDA 3EBYA 1GY7A 4N6V0 3HX8A 3PS8A 2LQVA 3F14A 5IF6A 3E99A 4FMAA 1TIJA 3SEDA 3F8HA 4AKYA 1G02A 1BUQA 4XBTA 2CFKA 3FF0A 4HM3B 4IIAA 1DYUA 1RDSA 3CU3A 4RBNA 4RZMA 1KD14 1NO3A 3IMAB 1ROAA 4KFEA
chains in the Genus database with same CATH topology
4K90B 5DRVA 1IQYA 2L4VA 1UI7A 2QIYA 5TGNA 3UNLA 2WGOA 1CQSA 1WMPA 1T5YA 3MSOA 4MJDA 3NQYA 5LC6A 1K734 1ROVA 5JBSA 1YIT3 1K8A4 1NU3A 3BLZA 3NBBA 4R9LA 5EVHA 3IJEB 3GZXB 4STDA 2P09A 1M1XB 1M904 1SIHA 2CC3A 4JF8A 2FXTA 1M1K4 1IVXA 2CG1A 3AMOA 2GBXB 3LXUX 5ELJA 3T8UA 1RRLA 4EV5A 3FLJA 1OHOA 5CK6A 4FMCA 4WWUC 1HU9A 3DY5A 4KFDA 3G16A 1E3RA 4JRFA 1ULIB 3HIIA 3GZRA 4GL6A 1KQS2 2E2UA 3JUOA 5CLKA 3WDGB 2CFLA 3OWYA 3EC9A 3LMLA 3CXC2 5BXQA 4HM8B 2GEXA 3X40A 1GY5A 2OTJ3 1A90A 7STDA 4HM6B 1LXEA 5IG4A 1NJI4 2W56B 4EV2A 1A2VA 2CG0A 3CC43 3X3YA 2OQEA 2IA7A 4FCMA 2WOFA 4IPBA 2Y73A 3DM8A 1Z1SA 5DREA 2BMOB 1IVWA 2A15A 1D6UA 1FUWA 1DMQA 1TFOA 2BMRB 1FGRA 3UJMA 4R1KA 1FGQA 1W6GA 3PXMA 1QVG2 4J9AA 3KSED 2R4IA 4OUQA 1Q42A 4O8SA 1KWIA 3JUNA 3OWSA 5EEOA 2IMJA 1OCVA 5FGOA 2W9PA 1N9EA 3CCL3 1S723 1WNHA 3D9RA 2QEX3 2GEYA 3SVAA 3GZYB 3PGBA 1VQP3 2P05A 1PU4A 2YFLB 1N9JA 3FCSB 1UW1A 3Q90A 3TDGA 1VQ43 4NHFA 4BTYA 4XDVA 1IK3A 2ZL8A 3KIIA 3ALAA 3G4S3 4N6NB 3EBTA 1CEWI 3K63A 2XRXB 1JB5A 3LTDA 1W00A 5D83A 8CHOA 3CNMA 3MYTA 5AYRB 3B4OA 3X3XA 3K7CA 5AIFA 2XFSA 2ML5A 1M9GA 3BNBA 4H61A 2UX0A 5D82A 1O7WB 1A67A 2Y74A 2XH9A 3QRDA 1W7CA 3MWZA 2BMQB 1AVKA 3VSYA 4EBGA 4MMYB 2RFRA 4FMDA 1FA3A 2CHCA 1Q824 2Z7AA 5AIIA 3A76A 3S27A 2Q07A 1IU7A 1YGEA 2W0QA 1CYVA 3KN4A 2P0MA 2QGUA 1C7HA 2YFIB 4N3VA 5HGRA 4MMXB 2XR8B 4WYKA 4CDLA 3I563 2JQ5A 3O8YA 1DVDA 2FNQA 2BT3A 1WMOA 2B1XB 1SIIA 3STDA 1Q40A 3WODG 5IG5A 1IQXA 2INXA 5IENA 1OACA 4LSOA 1N5PA 3BNDA 4HZ9B 2XGNA 3CPW2 2ZDJA 3JUMA 4L8PA 1GS3A 4XBYA 1W6YA 3EE1A 3NM7A 1YIJ3 2F98A 1DMMA 1K9M4 2CW9A 2SBLA 1EKMA 2F86B 3DZLA 4N6OB 4FMBA 1YI23 4Q53A 3JVCA 4WP5A 1JV2B 3OX9A 1L5GB 2MF7A 5AIHA 3JUQA 1LVNA 2OQEC 2LYXA 1TU5A 1O7GB 1RN7A 3NBRA 1UUVB 4FCZA 2KXGA 2OWPA 2K0MA 2E2TA 3CNXA 3EQQB 3G6E3 4AEQA 2XSHB 3D3LA 1VQ93 5D81A 3CC23 2BO9B 5AEWB 3LT9A 2W9QA 2RSXA 3PYJA 5AEUB 3U1WA 1RKYA 3PZWA 1W2ZA 4AKZA 1KC84 1CYUA 3WA2X 1N5HA 1TFKA 3FZWA 5IG0A 2M7OA 3EF8A 1JKGA 5IW9A 2HMMB 3FG4A 3EHCA 2IUKA 3K9MC 1QMAA 3DXOA 4XDWA 2QA43 3OW22 1JJ22 1G96A 1W6CA 3RGRA 4KVHA 3HZPA 1OUNA 3RGAA 1VQM3 3HIGA 3B4PA 5LC7A 1IT8A 1JRQA 1IV9A 4K61A 1K41A 1VQ53 3ER7A 2OOVA 3PCSA 5JPUA 3FGYA 3MPHA 5I97A 3UB1A 2YX9A 2C10A 1YJN3 1US1A 3BNEA 1WQLB 4XM4A 1IVVA 3CD63 3J7Yd 2CWUA 5KP4A 4WYKB 2OOVC 3EB8A 2XF3A 3DGLA 1HKXA 3CME3 3F8XA 3KE7A 1ZO2A 2ML6A 4FR9A 3SXXA 2C11A 4HM4B 3Q1CA 1ISKA 2HMOB 3DGOA 1W2B2 3FG3A 3VF1A 1JKGB 1QJGA 2B24B 4QWTA 5ELUA 3EN1B 1VQN3 2RGQA 2WO0A 2WGQA 1N8QA 3G8ZA 1A2KA 3OWUA 1Q7Y4 2OCTA 4O3VA 4BTWA 4KFFA 4HM0B 1QVF2 3ECFA 4WHAA 2CK3H 4HBRA 1D6ZA 3NBJA 3HK4A 1AVLA 3VGNA 1RRHA 3KFQC 4HM1B 3LTBA 4O02B 3AMOB 3LYGA 2W03A 4R9KA 1N8R4 2YFJB 1VQ83 2FGTA 3NM2A 4R80A 2I9WA 1Y4KA 2HMKB 3H51A 1QAKA 3G713 1W4NA 3UL6A 3K0ZA 4N6LA 2GU3A 3SOYA 1JN5B 3CCS3 5KP1A 1AR0A 1JB2A 4K1VA 4PEJA 1DMNA 3FH1A 1R4CA 1VQ73 1WMNA 1EQKA 3V98A 4MEIA 3EX9A 1UI8A 2GBWB 2XEPA 4LMIA 3SX1A 2O9UX 4X2OA 2GU1A 1JN5A 2CIUA 2PZVA 3OV4A 4H3UA 3F40A 3RDEA 4LEHA 3B8LA 3S67A 3NX0A 3CCQ3 4BTXA 3V99A 3NXJA 1VZZA 3OXAA 4U13A 1OGXA 2JDIH 3FF2A 4LGQA 1OF5B 1FGMA 2CWVA 2W04A 1IQ8A 4ORLA 5CF2A 3F7SA 3IPTA 3FSDA 3MHEA 1J2BA 5AIGA 1GD4A 3V92A 2BNGA 5FW5A 3KZTA 1STFI 4XB5A 4EYCA 4ZM8A 2Z77A 4LZIA 4MMZB 1VQ63 1ASKA 3WMDA 1NB3I 3WA3A 3SOAA 1KSIA 1QAFA 4KZ1A 1LNHA 2OTL3 3CPOA 2CFGA 5IERA 5KP3A 1SPUA 1W5ZA 4NREA 4N6TA 1Q40B 3S29A 1JB4A 2E2VA 2XFTA 3JUPA 2W56A 1IDPA 1O7NB 1MNLA 1FGOA 4OVMA 4L7KA 3CCU3 1OHPA 4R4KA 3HI7A 1NB5I 2K54A 3KSPA 6STDA 3CC73 2IUJA 3DUKA 5IEOA 4HZBB 1OGZA 3I0YA 2CWTA 1NWWA 3NV0A 2F99A 1OHSA 1W02A 3CCE3 3MG1A 2Z6BA 3L0RA 3Q2PA 4L8OA 3GAXA 1F8NA 2CH9A 3MKIA 1JNQA 4N6UA 1RJOA 3LZAA 4EC6A 1GYBA 3NUVA 1S5AA 4I4KA 1VQO3 5CXOA 1ZX2A 1IT7A 3F9SA 5G2GA 3LT8A 3GWRA 3CCR3 2HMNB 1YVBI 3BNCA 4HYZA 4J8TA 3UL5A 3LTCA 1IV7A 2O3OA 1AV4A 3I553 1TP6A 4IT7A 4XBXA 2CKFB 5IEPA 1TUHA 1E97A 3U97A 1YJW3 5JPPA 4RNYA 5AYSC 3N54B 1ULJB 3GZBA 2HMLB 2KCDA 3NHXA 5IG3A 3BB9A 3KKGA 1Q864 3GRDA 1LOXA 3FKAA 2V1LA 3EN8A 5CF1A 2D1WA 3K5TA 4FCJA 1EG9B 2WOHA 4RNZA 1O7PB 3WOEB 4G1MB 3LH4A 2P38A 3N9HA 1YHQ3 3SLUA 3LOYA 1U5OA 1Q814 1E3VA 5EQLA 3LTAA 1VQL3 3CMA3 2P0XA 1SJWA 3MG3A 1D6YA 4HM2B 4HJLB 4GB5A 4HVNA 3FG1A 3G0KA 3S5CA 3NQZA 2HMJB 1PFPA 2CFWA 2PNCA 2BHMA 3PCRA 3NV0B 3T8NA 2MC8A 2XGLA 1GY6A 1VQK3 1UUWB 4HM5B 3T0UA 1GD3A 1K28A 3CCM3 4K1UA 2CFDA 1WTHA 3H3HA 4EXRA 3WOFB 5AI1A 2XSOB 1O7HB 4WFOA 3X3ZA 2Z76A 3DMCA 1MOLA 3CCV3 2W6JH 2W2CA 3MG2A 4HM7B 3S28A 1V74A 1YJ93 3B7CA 1O7MB 4HKVB 4X2HA 4OK0A 1EA2A 1W01A 3M8CA 5BVBA 3DGMA 1U8CB 3X41A 1OH0A 1FGTA 1OPYA 1SQWA 3EJVA 1IVUA 2D42A 4N6MA 4CCVA 1STDA 4TX4A 3DGNA 3N8BA 5STDA 3CCJ3 4O2HA 3F7XA 1QALA 3ROBA 3QK9A 1OF5A 2KRTA 5A0OB 1NDOB 3X42A 1DVCA 2GXFA 2STDA 2RCDA 3EBYA 1GY7A 4N6V0 3HX8A 3PS8A 2LQVA 3F14A 5IF6A 3E99A 4FMAA 1TIJA 3SEDA 3F8HA 4AKYA 1BUQA 4XBTA 2CFKA 3FF0A 4HM3B 4IIAA 1DYUA 3CU3A 4RBNA 4RZMA 1KD14 1NO3A 3IMAB 1ROAA 4KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD3 A;  5LC7 A;  2BO9 B;  1FA3 A;  1IV9 A;  4N6M A;  4N6T A;  2W9Q A;  4CCV A;  1FUW A;  3PYJ A;  3UL6 A;  4TX4 A;  3NX0 A;  4N6L A;  4N6O B;  5LC6 A;  2OCT A;  1YVB I;  1MNL A;  1CYU A;  3PXM A;  3UL5 A;  1CYV A;  3LH4 A;  1IV7 A;  1N5H A;  4N6N B;  3KSE D;  5A0O B;  1CEW I;  1NB5 I;  1DVC A;  1GD4 A;  1R4C A;  5EQL A;  1EQK A;  1A90 A;  4IT7 A;  1DVD A;  1MOL A;  4N6V 0;  5ELU A;  1KWI A;  3KFQ C;  1LXE A;  3PS8 A;  1STF I;  3K9M C;  1TIJ A;  2O9U X;  4EYC A;  4ZM8 A;  1M9G A;  2W9P A;  5ELJ A;  1PFP A;  4LZI A;  1RN7 A;  1G96 A;  1WNH A;  3SVA A;  1N5P A;  2KXG A;  3L0R A;  3Q2P A;  1A67 A;  3GAX A;  1NB3 I;  2CH9 A;  3QRD A;  3MWZ A;  3S67 A;  3IMA B;  4N6U A;  1ROA A;  1N9J A; 
#chains in the Genus database with same CATH topology
 1B2X A;  1MWS A;  1X1U A;  4K90 B;  5DRV A;  1RGE A;  1YNV X;  1IQY A;  2L4V A;  1FUS A;  1UI7 A;  2QIY A;  5TGN A;  3UNL A;  2WGO A;  1CQS A;  1WMP A;  1B2M A;  1T5Y A;  3MSO A;  4MJD A;  3NQY A;  5LC6 A;  1K73 4;  1ROV A;  5JBS A;  1YIT 3;  1K8A 4;  1NU3 A;  3BLZ A;  3NBB A;  3D5G A;  2F56 A;  4R9L A;  3IJE B;  3GZX B;  5EVH A;  4STD A;  1V57 A;  1BNJ A;  2P09 A;  1M1X B;  3KCH A;  1SIH A;  3AGN A;  1M90 4;  2CC3 A;  4JF8 A;  2FXT A;  1M1K 4;  1IVX A;  2CG1 A;  3AMO A;  2GBX B;  3LXU X;  5ELJ A;  3T8U A;  1RRL A;  4EV5 A;  3FLJ A;  1BNF A;  1OHO A;  5CK6 A;  4FMC A;  4WWU C;  5M19 A;  1HU9 A;  1TRP A;  1PYL A;  3DY5 A;  4KFD A;  1BOX A;  1RNB A;  3G16 A;  1E3R A;  2L1S A;  1ULI B;  3HII A;  4JRF A;  3GZR A;  4GL6 A;  1KQS 2;  2E2U A;  3JUO A;  5CLK A;  3WDG B;  1BVI A;  2CFL A;  3OWY A;  2IYJ A;  3EC9 A;  3LML A;  3CXC 2;  5BXQ A;  4HM8 B;  2GEX A;  1GOU A;  1GY5 A;  3X40 A;  2OTJ 3;  1A90 A;  3ZG5 A;  7STD A;  4HM6 B;  4LYL B;  1LXE A;  1Q9E A;  5IG4 A;  1UGH I;  1NJI 4;  2W56 B;  4EV2 A;  1A2V A;  2CG0 A;  3CC4 3;  4GHO A;  3X3Y A;  1UCI A;  2IA7 A;  2OQE A;  1LQG C;  6RNT A;  4FCM A;  2WOF A;  4IPB A;  2CX1 A;  1I2E A;  2Y73 A;  1TRQ A;  3DM8 A;  1Z1S A;  5DRE A;  2BMO B;  1IVW A;  2IY2 A;  2A15 A;  1D6U A;  2AAE A;  1FUW A;  1DMQ A;  1TFO A;  2BMR B;  1BNI A;  1FGR A;  3UJM A;  4R1K A;  1FGQ A;  1W6G A;  1TTO A;  3PXM A;  1QVG 2;  4J9A A;  4NPB A;  3KSE D;  2ZHX B;  2R4I A;  4OUQ A;  2F5M A;  1ZGX A;  1Q42 A;  1FUT A;  2KF5 A;  4O8S A;  1KWI A;  3JUN A;  3OWS A;  5EEO A;  1EUI C;  1GOY A;  1DET A;  1OCV A;  2IMJ A;  5FGO A;  2W9P A;  1N9E A;  3CCL 3;  1S72 3;  1WNH A;  3D9R A;  2QEX 3;  2GEY A;  3SVA A;  3GZY B;  3PGB A;  1VQP 3;  2P05 A;  1PU4 A;  2YFL B;  1BRJ A;  1Q7H A;  1N9J A;  3FCS B;  1UW1 A;  3Q90 A;  3TDG A;  1VQ4 3;  4NHF A;  4BTY A;  4XDV A;  1IK3 A;  2ZL8 A;  1YVS A;  2H0G A;  4J5G A;  2BIR A;  3KII A;  1BUJ A;  4BU4 A;  3ALA A;  3G4S 3;  4N6N B;  3EBT A;  1CEW I;  3K63 A;  1AY7 A;  1JB5 A;  2XRX B;  3LTD A;  1W00 A;  5D83 A;  8CHO A;  3CNM A;  1B2U A;  3MYT A;  5AYR B;  3B4O A;  3X3X A;  3K7C A;  4HAA A;  1RN4 A;  1RGG A;  2ML5 A;  2XFS A;  5AIF A;  1M9G A;  3BNB A;  4H61 A;  2UX0 A;  5D82 A;  1O7W B;  1A67 A;  2Y74 A;  2XH9 A;  3QRD A;  1W7C A;  3MWZ A;  2BMQ B;  1AVK A;  3VSY A;  1GMP A;  4EBG A;  4MMY B;  3URP A;  2RFR A;  4FMD A;  1FA3 A;  2CHC A;  1BSB A;  2KF4 A;  2F4Y A;  1Q82 4;  2BU4 A;  2Z7A A;  5AII A;  3A76 A;  3S27 A;  2Q07 A;  1PY3 A;  1IU7 A;  1YGE A;  2W0Q A;  1CYV A;  3KN4 A;  2P0M A;  2QGU A;  1BRI A;  1C7H A;  2KF3 A;  1UDI I;  2YFI B;  4MMX B;  2XR8 B;  4N3V A;  4WYK A;  5HGR A;  5M1A A;  4CDL A;  3I56 3;  2JQ5 A;  3O8Y A;  1DVD A;  2FNQ A;  1GMR A;  1I3F A;  3AHS A;  2BT3 A;  1LQM B;  1WMO A;  1BSE A;  2B1X B;  1SII A;  3STD A;  1Q40 A;  3WOD G;  1X1X A;  5IG5 A;  1BNG A;  1IQX A;  2INX A;  5IEN A;  1OAC A;  4LSO A;  1N5P A;  3BND A;  4HZ9 B;  2XGN A;  3CPW 2;  2ZDJ A;  3JUM A;  4L8P A;  1GS3 A;  1JZO A;  4RNT A;  4XBY A;  1W6Y A;  3EE1 A;  3NM7 A;  1YIJ 3;  2F98 A;  2UGI A;  3WHO A;  1B3S A;  1DMM A;  1BAN A;  1K9M 4;  2CW9 A;  2SBL A;  2J8X B;  1EKM A;  2F86 B;  1B2S A;  3DZL A;  4FMB A;  4N6O B;  1YI2 3;  1A2P A;  1AQZ A;  4Q53 A;  4GSP A;  1RGC A;  1CH0 A;  3JVC A;  4WP5 A;  1JV2 B;  3OX9 A;  1L5G B;  2MF7 A;  3SYU A;  5AIH A;  3JUQ A;  1LVN A;  2OQE C;  1I2F A;  2LYX A;  1O7G B;  1RN7 A;  3D5I A;  1UUV B;  3A5E A;  3NBR A;  4FCZ A;  2KXG A;  2OWP A;  2K0M A;  2E2T A;  3CNX A;  2GSP A;  3EQQ B;  4AEQ A;  2XSH B;  3D3L A;  3G6E 3;  1VQ9 3;  5D81 A;  3CC2 3;  2BO9 B;  5AEW B;  3LT9 A;  2W9Q A;  2RSX A;  3PYJ A;  5AEU B;  1T3B A;  3U1W A;  1RKY A;  1B20 A;  1FYS A;  3PZW A;  1W2Z A;  4AKZ A;  7GSP A;  1KC8 4;  3WA2 X;  1CYU A;  1N5H A;  1TFK A;  3FZW A;  5IG0 A;  2M7O A;  3EF8 A;  1JKG A;  5IW9 A;  2HMM B;  3FG4 A;  3EHC A;  2IUK A;  4CPK A;  3K9M C;  1QMA A;  2UUG C;  3DXO A;  1T2H A;  4XDW A;  1UCK A;  1BSD A;  2QA4 3;  3OW2 2;  1RGL A;  1JJ2 2;  1G96 A;  1W6C A;  5GSP A;  3RGR A;  4KVH A;  3HZP A;  1OUN A;  3RGA A;  1VQM 3;  3HIG A;  1TJD A;  3B4P A;  3DH2 A;  5LC7 A;  1IT8 A;  1JRQ A;  1IV9 A;  2F5W A;  1JBR A;  4I5Q A;  4K61 A;  1K41 A;  1VQ5 3;  3ER7 A;  2OOV A;  3PCS A;  5JPU A;  3FGY A;  1RHL A;  1RCL A;  3MPH A;  3UB1 A;  2YX9 A;  2C10 A;  2HOH A;  1US1 A;  3BNE A;  5I97 A;  1YJN 3;  1JBS A;  1WQL B;  3D79 A;  4XM4 A;  1IVV A;  3CD6 3;  3J7Y d;  2CWU A;  5KP4 A;  4WYK B;  9RNT A;  2OOV C;  1BRN L;  3EB8 A;  2XF3 A;  3DGL A;  1HKX A;  5RNT A;  3CME 3;  3Q3F A;  3F8X A;  3KE7 A;  1ZO2 A;  2ML6 A;  4FR9 A;  3SXX A;  2C11 A;  4HM4 B;  3Q1C A;  5HOH A;  2HMO B;  1ISK A;  3DGO A;  5BU4 A;  1ZS7 A;  1W2B 2;  3FG3 A;  3VF1 A;  1JKG B;  1QJG A;  2B24 B;  1V58 A;  4QWT A;  3EN1 B;  5ELU A;  2RGQ A;  1VQN 3;  2WO0 A;  1LOW A;  2WGQ A;  4HOH A;  1N8Q A;  3G8Z A;  1A2K A;  3OWU A;  1Q7Y 4;  1RN1 A;  6GSP A;  2OCT A;  4O3V A;  4BTW A;  4KFF A;  4HM0 B;  1QVF 2;  1BIR A;  1LRA A;  1RGH A;  3ECF A;  4WHA A;  2CK3 H;  4HBR A;  1D6Z A;  3NBJ A;  3HK4 A;  1AVL A;  3VGN A;  1X1Y A;  1RRH A;  3KFQ C;  4HM1 B;  3LTB A;  4O02 B;  3AMO B;  1EEJ A;  3LYG A;  2W03 A;  4R9K A;  4BL2 A;  2AAD A;  2YFJ B;  2FGT A;  3NM2 A;  1GSP A;  1N8R 4;  2RNT A;  4R80 A;  3GSP A;  1UUG B;  2I9W A;  1BRK A;  1Y4K A;  2HMK B;  3H51 A;  1GOV A;  1QAK A;  2CX0 A;  1BRH A;  3G71 3;  1W4N A;  3UL6 A;  3K0Z A;  4N6L A;  2GU3 A;  3SOY A;  1JN5 B;  1C54 A;  1RLS A;  1BNR A;  3CCS 3;  5KP1 A;  1AR0 A;  1JB2 A;  4K1V A;  4PEJ A;  1DMN A;  3FH1 A;  4J5K A;  1R4C A;  1VQ7 3;  1T2I A;  1WMN A;  2R41 A;  1EQK A;  3V98 A;  4MEI A;  3EX9 A;  1UI8 A;  7RNT A;  2GBW B;  2XEP A;  4LMI A;  3SX1 A;  2O9U X;  4X2O A;  3HOH A;  2GU1 A;  1JN5 A;  1RNT A;  2CIU A;  2PZV A;  3OV4 A;  3F40 A;  4H3U A;  3RDE A;  1NNV A;  4LEH A;  3B8L A;  3S67 A;  3NX0 A;  3CCQ 3;  1I2G A;  4BTX A;  3V99 A;  1BSA A;  1IYY A;  3NXJ A;  1VZZ A;  3OXA A;  4U13 A;  1OGX A;  2JDI H;  3ZFZ A;  3FF2 A;  2ZA4 A;  4LGQ A;  1OF5 B;  1BU4 A;  1FGM A;  1JZD A;  2CWV A;  2W04 A;  1IQ8 A;  1UCJ A;  4ORL A;  5CF2 A;  3F7S A;  3IPT A;  3FSD A;  3MHE A;  1J2B A;  5AIG A;  1GD4 A;  3V92 A;  1UCL A;  1BRS A;  2BNG A;  5FW5 A;  1BSC A;  3KZT A;  1STF I;  4XB5 A;  4EYC A;  4ZM8 A;  2Z77 A;  4LZI A;  4MMZ B;  1VQ6 3;  1ASK A;  4KT3 B;  3WMD A;  1NB3 I;  2H0H A;  3SOA A;  3WA3 A;  1KSI A;  1QAF A;  3DGY A;  4KZ1 A;  1LNH A;  2OTL 3;  3CPO A;  2CFG A;  5IER A;  5KP3 A;  1SPU A;  1W5Z A;  4NRE A;  4N6T A;  1Q40 B;  3S29 A;  1B27 A;  1JB4 A;  2E2V A;  2XFT A;  3JUP A;  8RNT A;  2W56 A;  1IDP A;  1O7N B;  1LOY A;  1MNL A;  1FGO A;  4OVM A;  4BIR A;  4L7K A;  3CCU 3;  1OHP A;  4R4K A;  3HI7 A;  1NB5 I;  1BRG A;  2K54 A;  1LNI A;  3KSP A;  6STD A;  3CC7 3;  3WR2 A;  2IUJ A;  3DUK A;  5IEO A;  4HZB B;  1OGZ A;  3I0Y A;  2CWT A;  1NWW A;  3RNT A;  3NV0 A;  2F99 A;  1OHS A;  5G1K A;  1W02 A;  3CCE 3;  3MG1 A;  2Z6B A;  3L0R A;  3Q2P A;  4L8O A;  3GAX A;  1F8N A;  2CH9 A;  3MKI A;  1JNQ A;  1RGK A;  4N6U A;  1RJO A;  3LZA A;  4EC6 A;  1FZU A;  1GYB A;  2H0I A;  1I0V A;  3NUV A;  1S5A A;  4I4K A;  1FW7 A;  1MWU A;  1MGR A;  5CXO A;  1ZX2 A;  1VQO 3;  1IT7 A;  3F9S A;  5G2G A;  1VQ8 3;  3LT8 A;  3GWR A;  3CCR 3;  2HMN B;  1YVB I;  3BNC A;  4HYZ A;  4J8T A;  3UL5 A;  3LTC A;  1IV7 A;  2O3O A;  1AV4 A;  3I55 3;  2KF6 A;  1RGF A;  5BIR A;  1TP6 A;  4IT7 A;  1DE3 A;  1MGW A;  4XBX A;  2CKF B;  1X1W A;  5IEP A;  1TUH A;  1E97 A;  3U97 A;  1YJW 3;  5JPP A;  4RNY A;  5AYS C;  3N54 B;  1VQQ A;  1UGI A;  1ULJ B;  3GZB A;  2HML B;  2KCD A;  3ZG0 A;  3NHX A;  5IG3 A;  3BB9 A;  3KKG A;  1Q86 4;  3GRD A;  1LOX A;  3FKA A;  2V1L A;  1I0X A;  3EN8 A;  5CF1 A;  2D1W A;  3K5T A;  3AGO A;  4ILF A;  1BNE A;  4FCJ A;  1EG9 B;  3BIR A;  2WOH A;  4RNZ A;  5M18 A;  1O7P B;  3BU4 A;  3WOE B;  2KAA A;  4G1M B;  1HYF A;  3LH4 A;  2P38 A;  3N9H A;  1SAR A;  3SLU A;  3LOY A;  1YHQ 3;  1U5O A;  1RMS A;  1Q81 4;  1E3V A;  1GMQ A;  1LOV A;  1I70 A;  3AHW A;  3LTA A;  5EQL A;  2P0X A;  1VQL 3;  3CMA 3;  1SJW A;  1I8V A;  1D6Y A;  3MG3 A;  4HM2 B;  4HJL B;  4GB5 A;  4HVN A;  3FG1 A;  3G0K A;  1RSN A;  3S5C A;  3NQZ A;  2HMJ B;  1PFP A;  2CFW A;  2PNC A;  2BHM A;  2RBI A;  3NV0 B;  3PCR A;  2MC8 A;  3T8N A;  1JBT A;  2C4B A;  4BL3 A;  2XGL A;  1GY6 A;  1VQK 3;  1UUW B;  4HM5 B;  3T0U A;  1GD3 A;  1K28 A;  4CJN A;  3CCM 3;  1R4Y A;  4K1U A;  2CFD A;  1WTH A;  1I3I A;  3H3H A;  4EXR A;  3WOF B;  5AI1 A;  2XSO B;  1B21 A;  1O7H B;  3D4A A;  4WFO A;  3X3Z A;  1BGS A;  2Z76 A;  1MOL A;  3DMC A;  3CCV 3;  2W6J H;  1B2Z A;  2W2C A;  1BNS A;  1RCK A;  3MG2 A;  4HM7 B;  1G0T A;  3S28 A;  1V74 A;  1YJ9 3;  3B7C A;  1HZ1 A;  1O7M B;  4HKV B;  4X2H A;  4DKI A;  4EW5 A;  4OK0 A;  1EA2 A;  1W01 A;  3M8C A;  5BVB A;  3DGM A;  1MWT A;  1U8C B;  3X41 A;  1OH0 A;  1FGT A;  1OPY A;  1TU5 A;  1BAO A;  1SQW A;  3EJV A;  1IVU A;  2D42 A;  2SAR A;  4N6M A;  4CCV A;  2K3D A;  1MWR A;  1STD A;  4TX4 A;  3DGN A;  1RTU A;  3N8B A;  5STD A;  4O2H A;  3F7X A;  3CCJ 3;  1QAL A;  5G1L A;  3ROB A;  3QK9 A;  1OF5 A;  2KRT A;  5A0O B;  1NDO B;  1YGW A;  3X42 A;  1DVC A;  2GXF A;  1RGA A;  2STD A;  2RCD A;  3EBY A;  1GY7 A;  4N6V 0;  3HX8 A;  3PS8 A;  2LQV A;  3F14 A;  5IF6 A;  3E99 A;  4FMA A;  1TIJ A;  3SED A;  3F8H A;  4AKY A;  1G02 A;  1BUQ A;  4XBT A;  2CFK A;  3FF0 A;  4HM3 B;  4IIA A;  1DYU A;  1RDS A;  3CU3 A;  4RBN A;  4RZM A;  1KD1 4;  1NO3 A;  3IMA B;  1ROA A;  4KFE A; 
#chains in the Genus database with same CATH homology
 4K90 B;  5DRV A;  1IQY A;  2L4V A;  1UI7 A;  2QIY A;  5TGN A;  3UNL A;  2WGO A;  1CQS A;  1WMP A;  1T5Y A;  3MSO A;  4MJD A;  3NQY A;  5LC6 A;  1K73 4;  1ROV A;  5JBS A;  1YIT 3;  1K8A 4;  1NU3 A;  3BLZ A;  3NBB A;  4R9L A;  5EVH A;  3IJE B;  3GZX B;  4STD A;  2P09 A;  1M1X B;  1M90 4;  1SIH A;  2CC3 A;  4JF8 A;  2FXT A;  1M1K 4;  1IVX A;  2CG1 A;  3AMO A;  2GBX B;  3LXU X;  5ELJ A;  3T8U A;  1RRL A;  4EV5 A;  3FLJ A;  1OHO A;  5CK6 A;  4FMC A;  4WWU C;  1HU9 A;  3DY5 A;  4KFD A;  3G16 A;  1E3R A;  4JRF A;  1ULI B;  3HII A;  3GZR A;  4GL6 A;  1KQS 2;  2E2U A;  3JUO A;  5CLK A;  3WDG B;  2CFL A;  3OWY A;  3EC9 A;  3LML A;  3CXC 2;  5BXQ A;  4HM8 B;  2GEX A;  3X40 A;  1GY5 A;  2OTJ 3;  1A90 A;  7STD A;  4HM6 B;  1LXE A;  5IG4 A;  1NJI 4;  2W56 B;  4EV2 A;  1A2V A;  2CG0 A;  3CC4 3;  3X3Y A;  2OQE A;  2IA7 A;  4FCM A;  2WOF A;  4IPB A;  2Y73 A;  3DM8 A;  1Z1S A;  5DRE A;  2BMO B;  1IVW A;  2A15 A;  1D6U A;  1FUW A;  1DMQ A;  1TFO A;  2BMR B;  1FGR A;  3UJM A;  4R1K A;  1FGQ A;  1W6G A;  3PXM A;  1QVG 2;  4J9A A;  3KSE D;  2R4I A;  4OUQ A;  1Q42 A;  4O8S A;  1KWI A;  3JUN A;  3OWS A;  5EEO A;  2IMJ A;  1OCV A;  5FGO A;  2W9P A;  1N9E A;  3CCL 3;  1S72 3;  1WNH A;  3D9R A;  2QEX 3;  2GEY A;  3SVA A;  3GZY B;  3PGB A;  1VQP 3;  2P05 A;  1PU4 A;  2YFL B;  1N9J A;  3FCS B;  1UW1 A;  3Q90 A;  3TDG A;  1VQ4 3;  4NHF A;  4BTY A;  4XDV A;  1IK3 A;  2ZL8 A;  3KII A;  3ALA A;  3G4S 3;  4N6N B;  3EBT A;  1CEW I;  3K63 A;  2XRX B;  1JB5 A;  3LTD A;  1W00 A;  5D83 A;  8CHO A;  3CNM A;  3MYT A;  5AYR B;  3B4O A;  3X3X A;  3K7C A;  5AIF A;  2XFS A;  2ML5 A;  1M9G A;  3BNB A;  4H61 A;  2UX0 A;  5D82 A;  1O7W B;  1A67 A;  2Y74 A;  2XH9 A;  3QRD A;  1W7C A;  3MWZ A;  2BMQ B;  1AVK A;  3VSY A;  4EBG A;  4MMY B;  2RFR A;  4FMD A;  1FA3 A;  2CHC A;  1Q82 4;  2Z7A A;  5AII A;  3A76 A;  3S27 A;  2Q07 A;  1IU7 A;  1YGE A;  2W0Q A;  1CYV A;  3KN4 A;  2P0M A;  2QGU A;  1C7H A;  2YFI B;  4N3V A;  5HGR A;  4MMX B;  2XR8 B;  4WYK A;  4CDL A;  3I56 3;  2JQ5 A;  3O8Y A;  1DVD A;  2FNQ A;  2BT3 A;  1WMO A;  2B1X B;  1SII A;  3STD A;  1Q40 A;  3WOD G;  5IG5 A;  1IQX A;  2INX A;  5IEN A;  1OAC A;  4LSO A;  1N5P A;  3BND A;  4HZ9 B;  2XGN A;  3CPW 2;  2ZDJ A;  3JUM A;  4L8P A;  1GS3 A;  4XBY A;  1W6Y A;  3EE1 A;  3NM7 A;  1YIJ 3;  2F98 A;  1DMM A;  1K9M 4;  2CW9 A;  2SBL A;  1EKM A;  2F86 B;  3DZL A;  4N6O B;  4FMB A;  1YI2 3;  4Q53 A;  3JVC A;  4WP5 A;  1JV2 B;  3OX9 A;  1L5G B;  2MF7 A;  5AIH A;  3JUQ A;  1LVN A;  2OQE C;  2LYX A;  1TU5 A;  1O7G B;  1RN7 A;  3NBR A;  1UUV B;  4FCZ A;  2KXG A;  2OWP A;  2K0M A;  2E2T A;  3CNX A;  3EQQ B;  3G6E 3;  4AEQ A;  2XSH B;  3D3L A;  1VQ9 3;  5D81 A;  3CC2 3;  2BO9 B;  5AEW B;  3LT9 A;  2W9Q A;  2RSX A;  3PYJ A;  5AEU B;  3U1W A;  1RKY A;  3PZW A;  1W2Z A;  4AKZ A;  1KC8 4;  1CYU A;  3WA2 X;  1N5H A;  1TFK A;  3FZW A;  5IG0 A;  2M7O A;  3EF8 A;  1JKG A;  5IW9 A;  2HMM B;  3FG4 A;  3EHC A;  2IUK A;  3K9M C;  1QMA A;  3DXO A;  4XDW A;  2QA4 3;  3OW2 2;  1JJ2 2;  1G96 A;  1W6C A;  3RGR A;  4KVH A;  3HZP A;  1OUN A;  3RGA A;  1VQM 3;  3HIG A;  3B4P A;  5LC7 A;  1IT8 A;  1JRQ A;  1IV9 A;  4K61 A;  1K41 A;  1VQ5 3;  3ER7 A;  2OOV A;  3PCS A;  5JPU A;  3FGY A;  3MPH A;  5I97 A;  3UB1 A;  2YX9 A;  2C10 A;  1YJN 3;  1US1 A;  3BNE A;  1WQL B;  4XM4 A;  1IVV A;  3CD6 3;  3J7Y d;  2CWU A;  5KP4 A;  4WYK B;  2OOV C;  3EB8 A;  2XF3 A;  3DGL A;  1HKX A;  3CME 3;  3F8X A;  3KE7 A;  1ZO2 A;  2ML6 A;  4FR9 A;  3SXX A;  2C11 A;  4HM4 B;  3Q1C A;  1ISK A;  2HMO B;  3DGO A;  1W2B 2;  3FG3 A;  3VF1 A;  1JKG B;  1QJG A;  2B24 B;  4QWT A;  5ELU A;  3EN1 B;  1VQN 3;  2RGQ A;  2WO0 A;  2WGQ A;  1N8Q A;  3G8Z A;  1A2K A;  3OWU A;  1Q7Y 4;  2OCT A;  4O3V A;  4BTW A;  4KFF A;  4HM0 B;  1QVF 2;  3ECF A;  4WHA A;  2CK3 H;  4HBR A;  1D6Z A;  3NBJ A;  3HK4 A;  1AVL A;  3VGN A;  1RRH A;  3KFQ C;  4HM1 B;  3LTB A;  4O02 B;  3AMO B;  3LYG A;  2W03 A;  4R9K A;  1N8R 4;  2YFJ B;  1VQ8 3;  2FGT A;  3NM2 A;  4R80 A;  2I9W A;  1Y4K A;  2HMK B;  3H51 A;  1QAK A;  3G71 3;  1W4N A;  3UL6 A;  3K0Z A;  4N6L A;  2GU3 A;  3SOY A;  1JN5 B;  3CCS 3;  5KP1 A;  1AR0 A;  1JB2 A;  4K1V A;  4PEJ A;  1DMN A;  3FH1 A;  1R4C A;  1VQ7 3;  1WMN A;  1EQK A;  3V98 A;  4MEI A;  3EX9 A;  1UI8 A;  2GBW B;  2XEP A;  4LMI A;  3SX1 A;  2O9U X;  4X2O A;  2GU1 A;  1JN5 A;  2CIU A;  2PZV A;  3OV4 A;  4H3U A;  3F40 A;  3RDE A;  4LEH A;  3B8L A;  3S67 A;  3NX0 A;  3CCQ 3;  4BTX A;  3V99 A;  3NXJ A;  1VZZ A;  3OXA A;  4U13 A;  1OGX A;  2JDI H;  3FF2 A;  4LGQ A;  1OF5 B;  1FGM A;  2CWV A;  2W04 A;  1IQ8 A;  4ORL A;  5CF2 A;  3F7S A;  3IPT A;  3FSD A;  3MHE A;  1J2B A;  5AIG A;  1GD4 A;  3V92 A;  2BNG A;  5FW5 A;  3KZT A;  1STF I;  4XB5 A;  4EYC A;  4ZM8 A;  2Z77 A;  4LZI A;  4MMZ B;  1VQ6 3;  1ASK A;  3WMD A;  1NB3 I;  3WA3 A;  3SOA A;  1KSI A;  1QAF A;  4KZ1 A;  1LNH A;  2OTL 3;  3CPO A;  2CFG A;  5IER A;  5KP3 A;  1SPU A;  1W5Z A;  4NRE A;  4N6T A;  1Q40 B;  3S29 A;  1JB4 A;  2E2V A;  2XFT A;  3JUP A;  2W56 A;  1IDP A;  1O7N B;  1MNL A;  1FGO A;  4OVM A;  4L7K A;  3CCU 3;  1OHP A;  4R4K A;  3HI7 A;  1NB5 I;  2K54 A;  3KSP A;  6STD A;  3CC7 3;  2IUJ A;  3DUK A;  5IEO A;  4HZB B;  1OGZ A;  3I0Y A;  2CWT A;  1NWW A;  3NV0 A;  2F99 A;  1OHS A;  1W02 A;  3CCE 3;  3MG1 A;  2Z6B A;  3L0R A;  3Q2P A;  4L8O A;  3GAX A;  1F8N A;  2CH9 A;  3MKI A;  1JNQ A;  4N6U A;  1RJO A;  3LZA A;  4EC6 A;  1GYB A;  3NUV A;  1S5A A;  4I4K A;  1VQO 3;  5CXO A;  1ZX2 A;  1IT7 A;  3F9S A;  5G2G A;  3LT8 A;  3GWR A;  3CCR 3;  2HMN B;  1YVB I;  3BNC A;  4HYZ A;  4J8T A;  3UL5 A;  3LTC A;  1IV7 A;  2O3O A;  1AV4 A;  3I55 3;  1TP6 A;  4IT7 A;  4XBX A;  2CKF B;  5IEP A;  1TUH A;  1E97 A;  3U97 A;  1YJW 3;  5JPP A;  4RNY A;  5AYS C;  3N54 B;  1ULJ B;  3GZB A;  2HML B;  2KCD A;  3NHX A;  5IG3 A;  3BB9 A;  3KKG A;  1Q86 4;  3GRD A;  1LOX A;  3FKA A;  2V1L A;  3EN8 A;  5CF1 A;  2D1W A;  3K5T A;  4FCJ A;  1EG9 B;  2WOH A;  4RNZ A;  1O7P B;  3WOE B;  4G1M B;  3LH4 A;  2P38 A;  3N9H A;  1YHQ 3;  3SLU A;  3LOY A;  1U5O A;  1Q81 4;  1E3V A;  5EQL A;  3LTA A;  1VQL 3;  3CMA 3;  2P0X A;  1SJW A;  3MG3 A;  1D6Y A;  4HM2 B;  4HJL B;  4GB5 A;  4HVN A;  3FG1 A;  3G0K A;  3S5C A;  3NQZ A;  2HMJ B;  1PFP A;  2CFW A;  2PNC A;  2BHM A;  3PCR A;  3NV0 B;  3T8N A;  2MC8 A;  2XGL A;  1GY6 A;  1VQK 3;  1UUW B;  4HM5 B;  3T0U A;  1GD3 A;  1K28 A;  3CCM 3;  4K1U A;  2CFD A;  1WTH A;  3H3H A;  4EXR A;  3WOF B;  5AI1 A;  2XSO B;  1O7H B;  4WFO A;  3X3Z A;  2Z76 A;  3DMC A;  1MOL A;  3CCV 3;  2W6J H;  2W2C A;  3MG2 A;  4HM7 B;  3S28 A;  1V74 A;  1YJ9 3;  3B7C A;  1O7M B;  4HKV B;  4X2H A;  4OK0 A;  1EA2 A;  1W01 A;  3M8C A;  5BVB A;  3DGM A;  1U8C B;  3X41 A;  1OH0 A;  1FGT A;  1OPY A;  1SQW A;  3EJV A;  1IVU A;  2D42 A;  4N6M A;  4CCV A;  1STD A;  4TX4 A;  3DGN A;  3N8B A;  5STD A;  3CCJ 3;  4O2H A;  3F7X A;  1QAL A;  3ROB A;  3QK9 A;  1OF5 A;  2KRT A;  5A0O B;  1NDO B;  3X42 A;  1DVC A;  2GXF A;  2STD A;  2RCD A;  3EBY A;  1GY7 A;  4N6V 0;  3HX8 A;  3PS8 A;  2LQV A;  3F14 A;  5IF6 A;  3E99 A;  4FMA A;  1TIJ A;  3SED A;  3F8H A;  4AKY A;  1BUQ A;  4XBT A;  2CFK A;  3FF0 A;  4HM3 B;  4IIA A;  1DYU A;  3CU3 A;  4RBN A;  4RZM A;  1KD1 4;  1NO3 A;  3IMA B;  1ROA A;  4KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...