1GD3A

Refined solution structure of human cystatin a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CYSTATIN A
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd3A00
5LC7A 4N6MA 3LH4A 4TX4A 4IT7A 4ZM8A 1G96A 5A0OB 1M9GA 3PXMA 4N6V0 1A90A 1DVCA 3KSED 1N5PA 4N6TA 3PYJA 1R4CA 4N6NB 1GD4A 5ELJA 4N6OB 2W9QA 5EQLA 2KXGA 5ELUA 1CEWI 1CYUA 1LXEA 1A67A 1TIJA 5LC6A 4N6LA 1MOLA 1CYVA 3S67A 2CH9A 1N9JA 1N5HA 4EYCA 3IMAB 3QRDA 2W9PA 3UL5A 2OCTA 4N6UA 1STFI 3PS8A 3Q2PA 3K9MC 2BO9B 3NX0A 1RN7A 1YVBI 1EQKA 3L0RA 1MNLA 1IV7A 1GD3A 1DVDA 1PFPA 1NB3I 3GAXA 1FA3A 1FUWA 1NB5I 3UL6A 1KWIA 1ROAA 3KFQC 2O9UX 1WNHA 4LZIA 3SVAA 3MWZA 1IV9A 4CCVA
chains in the Genus database with same CATH superfamily
3WODG 2JQ5A 1FUSA 4N6MA 2HMKB 3EB8A 3EQQB 5IEOA 3CC43 3CCE3 4ZM8A 1OHPA 1T2HA 4EW5A 2OTJ3 2CFKA 3DH2A 2LYXA 1JZOA 1G96A 3A5EA 5DREA 5A0OB 1UCJA 4GL6A 5GSPA 5KP4A 3CPW2 5G1LA 3DGOA 4AEQA 3LTBA 1CH0A 3H3HA 4HOHA 4KFDA 5FGOA 3BNCA 1RGEA 4FCMA 3NV0B 3LMLA 1BNIA 3KSED 4K1UA 2F99A 3FKAA 2GEYA 1NJI4 2CG1A 1IYYA 1B20A 3JUOA 2HOHA 1S5AA 1Y4KA 2FXTA 1IQYA 3D79A 3HIIA 1RNBA 2Z6BA 1Q40B 3SXXA 1GS3A 1W00A 1RLSA 2JDIH 4X2OA 3ZG5A 1UI8A 2MC8A 1J2BA 2STDA 1ZX2A 4IIAA 3O8YA 4N6OB 1I2EA 3IPTA 4BIRA 3DMCA 3JVCA 1JV2B 1Q40A 2W2CA 1AQZA 3HK4A 4K1VA 1BRKA 2CX1A 5HGRA 5TGNA 1RGCA 3URPA 3NBRA 1OGXA 1A67A 5G1KA 1OHSA 1IVVA 3WOFB 1M904 1DMQA 3KE7A 1R4YA 4MMYB 1MWSA 2XSOB 4J5GA 3RDEA 1V74A 1ISKA 4X2HA 3U1WA 1SARA 3LTAA 1RGKA 3CCL3 1C54A 4GSPA 4I5QA 5IERA 2UX0A 3V99A 5AEUB 3H51A 1X1UA 2QA43 3JUMA 3G16A 4K61A 4OUQA 4HKVB 2OQEC 1O7PB 2K0MA 3Q3FA 1DETA 4N6UA 3K5TA 3K63A 5D83A 5CXOA 4L7KA 4HM4B 3DGNA 2Y74A 3F8XA 1QVF2 3EE1A 2RGQA 4RZMA 3K9MC 3X42A 1YJ93 3GZBA 1UCLA 2BO9B 3NX0A 5FW5A 2YFJB 3JUPA 5AYSC 4DKIA 3CCJ3 3EX9A 4IPBA 2J8XB 3FG4A 1BNRA 2D1WA 2KF6A 1UUWB 4H61A 3ALAA 1OACA 2HMLB 3OW22 1RN4A 5BVBA 1DVDA 1I70A 3BU4A 1RHLA 5IG3A 3QK9A 4STDA 5JPPA 1E3RA 1BSEA 1NB3I 3MHEA 3CCS3 3SYUA 4KFFA 1VQP3 1W6YA 1NB5I 1JB2A 4CPKA 3I563 2CC3A 1K28A 3UL6A 2O3OA 2QGUA 2XFTA 3F7XA 1KWIA 3MSOA 3ZFZA 5M18A 1GY5A 2ZHXB 1VZZA 3LTDA 4K90B 1RDSA 2V1LA 3E99A 4LEHA 1BVIA 3GSPA 2KF3A 3RNTA 1TFKA 5M19A 1JN5B 3AGNA 4HM7B 1F8NA 1O7HB 3SVAA 3G6E3 4LGQA 1MGRA 4HM8B 3X3ZA 2CKFB 4R9KA 1RGFA 3LZAA 3CU3A 1JN5A 1FGQA 3OWSA 5LC7A 5BXQA 1NWWA 4QWTA 2CWTA 4FCZA 2FGTA 5EVHA 4TX4A 4IT7A 1JBTA 3ROBA 2BMOB 2HMNB 1RMSA 2K3DA 2W56A 5CF2A 1JBSA 1HKXA 2P0XA 3DGLA 5EEOA 3X41A 1U5OA 3NM2A 3PXMA 1RGHA 3NQZA 3STDA 1RCLA 1BNGA 3VF1A 3CC73 3FCSB 4L8PA 4N6TA 1BSAA 1V57A 1ULIB 3CD63 3N8BA 4LSOA 4HBRA 1RRHA 2P05A 2OQEA 1O7MB 5AIFA 1UCIA 4ILFA 1VQ63 1K8A4 1TFOA 1GD4A 4R80A 2E2TA 5ELJA 1BNEA 5G2GA 1IVUA 3NBBA 3V92A 1S723 1B2MA 2CHCA 1Q9EA 1YJW3 1D6YA 1FGMA 1B27A 7STDA 3OV4A 4J5KA 3KCHA 2XGNA 1L5GB 2RSXA 3CCU3 1CEWI 1V58A 2WGQA 4BL2A 1WMPA 3F40A 2P09A 2INXA 2BMQB 1LOYA 3WR2A 3CCR3 1GMQA 3WA2X 1OUNA 1T5YA 5D81A 3DXOA 3GWRA 1SPUA 3BNBA 1KSIA 4N6LA 1DE3A 1FGTA 4EC6A 1CYVA 4KFEA 5IENA 2KF5A 3S67A 4HJLB 2CH9A 3HX8A 3OWUA 3CCQ3 5IF6A 1BNJA 1W7CA 1M1K4 4CDLA 1N5HA 1RJOA 4EYCA 3GZYB 2BT3A 1VQ43 1AVKA 3LXUX 2F56A 3NUVA 4O3VA 1JB5A 2W03A 3KN4A 3AMOB 3GZRA 4FMDA 3QRDA 4HM3B 1Q864 3BLZA 2F5MA 3RGAA 1STFI 2CWUA 3NQYA 1BU4A 2L4VA 3PS8A 3EN8A 3Q2PA 1HZ1A 1OHOA 3SX1A 2R4IA 3AMOA 2OOVA 1KQS2 1LOWA 1MWRA 3EBTA 1VQ83 2WOHA 4HM2B 1JKGB 1X1YA 1PU4A 3AHWA 4FMCA 3CMA3 1RSNA 3U97A 1A2VA 1IV7A 3FF0A 2I9WA 1BUJA 1BRSA 2ML6A 1JKGA 1PY3A 4XM4A 2UUGC 2RCDA 1GMRA 5RNTA 3M8CA 7RNTA 2P0MA 2H0GA 3WOEB 1DYUA 1US1A 1N8QA 1T3BA 1U8CB 1VQ53 3CCM3 1DMMA 1Q7HA 5DRVA 5AI1A 1IK3A 1BSBA 1I8VA 4XDWA 5M1AA 3I553 3FH1A 2GBWB 4NPBA 4BTYA 3ZG0A 1BRHA 2BHMA 2CFDA 3X3YA 1LOVA 2O9UX 1WNHA 2RFRA 1W6GA 4O02B 6RNTA 1B2UA 2GEXA 2HMMB 2BU4A 1BRIA 1I3IA 3B8LA 2QEX3 1VQ93 3MWZA 3UNLA 5BIRA 5AIGA 2IUJA 2C11A 3WHOA 3T8UA 1TRQA 3B4OA 3LTCA 4J8TA 1GOYA 2ZA4A 2CIUA 3EN1B 1M1XB 3KZTA 3DGMA 1OPYA 3LH4A 3LYGA 2QIYA 4HZBB 4HM5B 2XEPA 4BTXA 3FG1A 2E2VA 3FG3A 3MPHA 2RBIA 3MG2A 4BL3A 2YFLB 3FLJA 1UI7A 1IVXA 3LT9A 1M9GA 2H0IA 1VQL3 2KF4A 4XBTA 4KZ1A 1OGZA 2XF3A 2KAAA 4EV2A 1BNFA 6STDA 1BGSA 1DVCA 3G713 4O8SA 3SOAA 3DY5A 4H3UA 1UW1A 1YIJ3 3S29A 3X3XA 3HOHA 3PYJA 2XSHB 3AGOA 1QJGA 2IYJA 4PEJA 2W56B 1GOUA 2D42A 4WHAA 3T8NA 2ZDJA 4MJDA 3S5CA 3VGNA 1YJN3 1W6CA 3JUNA 1TU5A 3SEDA 3FGYA 2GXFA 3WDGB 3EF8A 1WQLB 4HVNA 3PGBA 4XBXA 3VSYA 1YI23 2W9QA 2C4BA 5EQLA 5KP3A 1Q824 2Z76A 1BUQA 1TTOA 5ELUA 3D3LA 6GSPA 5AYRB 1A2KA 3CC23 1RGLA 1K734 5I97A 1JBRA 3AHSA 1A2PA 1CYUA 3Q90A 2E2UA 1I3FA 1Z1SA 2CG0A 2WGOA 1IVWA 1WTHA 4WWUC 1TIJA 3ECFA 5LC6A 2Z77A 3PCRA 1EG9B 2AAEA 5IG0A 3MYTA 1W5ZA 1IDPA 4L8OA 3BB9A 4R9LA 1HYFA 1VQQA 2HMOB 1SIIA 1LRAA 2PZVA 3Q1CA 3F7SA 3EHCA 5STDA 3BIRA 5AIIA 2XGLA 4Q53A 1BOXA 3IMAB 4JF8A 5CK6A 1G0TA 3WMDA 3MKIA 3NBJA 2W9PA 2OCTA 2ZL8A 1UCKA 1IU7A 1VQM3 1LOXA 5BU4A 1TUHA 1UUGB 3DZLA 3FF2A 1LQGC 1X1XA 2L1SA 4EV5A 1VQO3 2PNCA 4RBNA 4HM1B 4EXRA 3SOYA 1BANA 1SQWA 1RN7A 1GOVA 1DMNA 4RNYA 1YVBI 2W04A 3G4S3 3CPOA 2KRTA 3I0YA 1OF5B 3L0RA 1BNSA 1B2XA 1MNLA 3S27A 1BRJA 1GD3A 3DUKA 1RGAA 2R41A 1PFPA 1VQ73 1CQSA 2CFGA 1K9M4 3TDGA 1RTUA 3GAXA 3RGRA 3N9HA 4FR9A 1OF5A 1FA3A 1TJDA 1LVNA 4NHFA 4FMBA 4HAAA 3UB1A 1UGHI 3CCV3 1FUWA 4NREA 3DM8A 4MMZB 2BNGA 2SBLA 3F8HA 1ZO2A 2XH9A 3LOYA 3SLUA 3D5GA 4JRFA 1WMNA 2F4YA 2XFSA 1W02A 3KKGA 3OXAA 1QVG2 2BMRB 1BSCA 1X1WA 2FNQA 2H0HA 1RGGA 2CK3H 2WO0A 2YX9A 3G0KA 3UJMA 1YHQ3 1ZS7A 1EA2A 4CJNA 3V98A 4GB5A 1IV9A 4CCVA 1B2ZA 2CFLA 3NV0A 1VQK3 1EEJA 1W4NA 3EJVA 4KVHA 1O7GB 4ORLA 1MWUA 4WFOA 2XRXB 4WP5A 1RKYA 2AADA 1RRLA 1UGIA 3OX9A 1BIRA 1TRPA 1RNTA 2YFIB 4MMXB 1EKMA 2F98A 1GY7A 3CNXA 5JPUA 1JB4A 1N9EA 1ZGXA 3NM7A 5IG4A 3NXJA 1KC84 2XR8B 2GU1A 2Y73A 4OVMA 2W0QA 3HI7A 4GHOA 1IT7A 4AKZA 1W2B2 3FZWA 2GU3A 2CW9A 4N6V0 4HYZA 1A90A 1E3VA 2M7OA 1N5PA 9RNTA 5IW9A 2IA7A 3ER7A 3G8ZA 2B1XB 4FCJA 1E97A 3NHXA 3IJEB 2UGIA 4EBGA 1STDA 1TP6A 1R4CA 3F14A 1UDII 1MGWA 1AR0A 2K54A 1GMPA 4N6NB 1NU3A 3EC9A 5JBSA 1WMOA 1EUIC 1IQ8A 1IQXA 1LQMB 4J9AA 2RNTA 3D9RA 3WA3A 1FGOA 1D6ZA 1SIHA 2F86B 2KXGA 5D82A 4N3VA 2KCDA 2OWPA 2WOFA 5CLKA 1MWTA 5AEWB 3D5IA 1D6UA 7GSPA 1ROVA 1IT8A 1UUVB 3HIGA 5CF1A 1KD14 1OH0A 1OCVA 4R1KA 1AVLA 3KSPA 1Q42A 2HMJB 1FUTA 4RNZA 1LXEA 3S28A 3CXC2 3B4PA 3J7Yd 2C10A 2GSPA 1YIT3 1MOLA 1AY7A 1QAFA 3BNEA 3KIIA 4BTWA 3T0UA 5IG5A 1N8R4 1B21A 3PCSA 1B2SA 1RCKA 2CFWA 1I0XA 3BNDA 3HZPA 3X40A 1BRNL 4XDVA 1N9JA 1O7NB 3F9SA 1NNVA 4BU4A 1VQN3 3UL5A 1RN1A 3A76A 3N54B 4U13A 3LT8A 2B24B 1LNHA 1T2IA 1YGWA 1B3SA 4HM0B 1FGRA 4RNTA 3FSDA 1AV4A 1JNQA 3D4AA 1GY6A 2GBXB 1FYSA 3MG3A 2OOVC 1I2GA 2SARA 4O2HA 1QALA 2MF7A 1QAKA 8CHOA 2IY2A 3K0ZA 1EQKA 1I2FA 1YGEA 3DGYA 1JRQA 1O7WB 1FW7A 1K41A 8RNTA 1NDOB 3OWYA 2F5WA 1BRGA 1NO3A 1HU9A 3MG1A 4FMAA 4AKYA 1YNVX 4XB5A 2IMJA 5HOHA 1FZUA 2CWVA 3K7CA 4WYKB 5AIHA 1JJ22 3JUQA 3GRDA 4KT3B 1BSDA 4XBYA 3EBYA 2W6JH 2Q07A 1GSPA 1JZDA 2P38A 5KP1A 2BIRA 1SJWA 2LQVA 1PYLA 1ROAA 2ML5A 1G02A 4G1MB 1GYBA 5IEPA 2A15A 4LYLB 2OTL3 4OK0A 1I0VA 1C7HA 3KFQC 4MEIA 4WYKA 3B7CA 1QMAA 4HZ9B 1W2ZA 4R4KA 1YVSA 1ASKA 3PZWA 1Q7Y4 1Q814 1BAOA 2IUKA 4I4KA 4LZIA 1W01A 3CME3 3GZXB 1ULJB 4LMIA 2Z7AA 4HM6B 2CX0A 3CNMA 1LNIA
chains in the Genus database with same CATH topology
3WODG 2JQ5A 4N6MA 2HMKB 3EB8A 3EQQB 5IEOA 3CC43 3CCE3 4ZM8A 1OHPA 2OTJ3 2CFKA 2LYXA 1G96A 5DREA 5A0OB 4GL6A 5KP4A 3CPW2 3DGOA 4AEQA 3LTBA 3H3HA 5FGOA 4KFDA 3BNCA 4FCMA 3NV0B 3LMLA 3KSED 4K1UA 2F99A 3FKAA 2GEYA 1NJI4 2CG1A 3JUOA 1S5AA 1Y4KA 2FXTA 1IQYA 3HIIA 2Z6BA 1Q40B 3SXXA 1GS3A 1W00A 2JDIH 4X2OA 1UI8A 2MC8A 1J2BA 2STDA 1ZX2A 4IIAA 3O8YA 4N6OB 3IPTA 3DMCA 3JVCA 1JV2B 1Q40A 2W2CA 3HK4A 5HGRA 4K1VA 5TGNA 3NBRA 1OGXA 1A67A 1OHSA 1IVVA 3WOFB 1M904 1DMQA 3KE7A 4MMYB 2XSOB 1ISKA 3RDEA 1V74A 4X2HA 3U1WA 3LTAA 3CCL3 5IERA 2UX0A 3V99A 5AEUB 3H51A 2QA43 3JUMA 3G16A 4K61A 4OUQA 4HKVB 2OQEC 1O7PB 2K0MA 4N6UA 3K5TA 3K63A 5D83A 5CXOA 4L7KA 4HM4B 3DGNA 2Y74A 3F8XA 1QVF2 3EE1A 2RGQA 4RZMA 3K9MC 3X42A 1YJ93 3GZBA 2BO9B 3NX0A 5FW5A 2YFJB 3JUPA 5AYSC 3EX9A 4IPBA 3FG4A 2D1WA 4H61A 1UUWB 3ALAA 1OACA 2HMLB 3OW22 5BVBA 1DVDA 5IG3A 3QK9A 4STDA 5JPPA 1E3RA 1NB3I 3MHEA 3CCS3 4KFFA 1VQP3 1W6YA 1NB5I 1JB2A 3I563 2CC3A 1K28A 3UL6A 2O3OA 2QGUA 2XFTA 3F7XA 1KWIA 3MSOA 1GY5A 1VZZA 3LTDA 4K90B 2V1LA 3E99A 4LEHA 1TFKA 1JN5B 4HM7B 1F8NA 1O7HB 3SVAA 3G6E3 4LGQA 4HM8B 3X3ZA 2CKFB 4R9KA 3LZAA 3CU3A 1JN5A 1FGQA 3OWSA 5LC7A 5BXQA 1NWWA 4QWTA 2CWTA 4FCZA 2FGTA 5EVHA 4TX4A 4IT7A 3ROBA 2BMOB 2HMNB 2W56A 5CF2A 1HKXA 2P0XA 3DGLA 5EEOA 3X41A 1U5OA 3NM2A 3PXMA 3NQZA 3STDA 3VF1A 3CC73 3FCSB 4L8PA 4N6TA 1ULIB 3CD63 3N8BA 4LSOA 4HBRA 1RRHA 2P05A 2OQEA 1O7MB 5AIFA 1VQ63 1K8A4 1TFOA 1GD4A 4R80A 2E2TA 5ELJA 5G2GA 1IVUA 3NBBA 3V92A 1S723 2CHCA 1YJW3 1D6YA 1FGMA 7STDA 3OV4A 2XGNA 1L5GB 2RSXA 3CCU3 1CEWI 2WGQA 1WMPA 3F40A 2P09A 2INXA 2BMQB 3CCR3 3WA2X 1OUNA 1T5YA 5D81A 3DXOA 3GWRA 1SPUA 3BNBA 1KSIA 4N6LA 1FGTA 4EC6A 1CYVA 4KFEA 5IENA 3S67A 4HJLB 2CH9A 3HX8A 3OWUA 3CCQ3 5IF6A 1W7CA 1M1K4 4CDLA 1N5HA 1RJOA 4EYCA 3GZYB 2BT3A 1VQ43 1AVKA 3LXUX 3NUVA 4O3VA 1JB5A 2W03A 3KN4A 3AMOB 3GZRA 4FMDA 3QRDA 4HM3B 1Q864 3BLZA 3RGAA 1STFI 2CWUA 3NQYA 3PS8A 2L4VA 3Q2PA 3EN8A 1OHOA 3SX1A 2R4IA 3AMOA 2OOVA 1KQS2 1VQ83 3EBTA 2WOHA 4HM2B 1JKGB 1PU4A 4FMCA 3CMA3 3U97A 1A2VA 1IV7A 3FF0A 2I9WA 2ML6A 1JKGA 4XM4A 2RCDA 3M8CA 2P0MA 3WOEB 1DYUA 1US1A 1N8QA 1U8CB 1VQ53 3CCM3 1DMMA 5DRVA 5AI1A 1IK3A 4XDWA 3I553 3FH1A 2GBWB 4BTYA 2BHMA 2CFDA 3X3YA 2O9UX 1WNHA 2RFRA 1W6GA 4O02B 2GEXA 2HMMB 3B8LA 1VQ93 2QEX3 3MWZA 3UNLA 5AIGA 2IUJA 2C11A 3T8UA 3B4OA 3LTCA 4J8TA 2CIUA 3EN1B 1M1XB 3KZTA 3DGMA 1OPYA 3LH4A 3LYGA 2QIYA 4HZBB 4HM5B 2XEPA 4BTXA 3FG1A 2E2VA 3FG3A 3MPHA 3MG2A 2YFLB 3FLJA 1UI7A 1IVXA 3LT9A 1M9GA 1VQL3 4XBTA 4KZ1A 1OGZA 2XF3A 4EV2A 6STDA 1DVCA 3G713 4O8SA 3SOAA 3DY5A 4H3UA 1UW1A 1YIJ3 3S29A 3X3XA 3PYJA 2XSHB 1QJGA 4PEJA 2W56B 4WHAA 2D42A 3T8NA 3VGNA 2ZDJA 4MJDA 3S5CA 1YJN3 1W6CA 3JUNA 1TU5A 3SEDA 3FGYA 2GXFA 3WDGB 3EF8A 1WQLB 4HVNA 3PGBA 4XBXA 3VSYA 1YI23 2W9QA 5EQLA 5KP3A 1Q824 2Z76A 1BUQA 5ELUA 3D3LA 5AYRB 1A2KA 3CC23 1K734 5I97A 1CYUA 3Q90A 2E2UA 1Z1SA 2CG0A 2WGOA 1IVWA 1WTHA 4WWUC 1TIJA 3ECFA 5LC6A 2Z77A 3PCRA 1EG9B 5IG0A 3MYTA 1W5ZA 1IDPA 4L8OA 3BB9A 4R9LA 2PZVA 2HMOB 1SIIA 3Q1CA 3F7SA 3EHCA 5STDA 5AIIA 2XGLA 4Q53A 4JF8A 3IMAB 5CK6A 3WMDA 3MKIA 3NBJA 2W9PA 2OCTA 2ZL8A 1IU7A 1VQM3 1LOXA 1TUHA 3DZLA 3FF2A 1VQO3 4EV5A 2PNCA 4RBNA 4HM1B 4EXRA 3SOYA 1SQWA 1RN7A 1DMNA 4RNYA 1YVBI 2W04A 3G4S3 3CPOA 2KRTA 3I0YA 1OF5B 3L0RA 1MNLA 3S27A 1GD3A 3DUKA 1PFPA 1VQ73 1CQSA 2CFGA 1K9M4 3TDGA 3GAXA 3RGRA 3N9HA 4FR9A 1OF5A 1FA3A 4NHFA 1LVNA 3UB1A 4FMBA 3CCV3 1FUWA 4NREA 3DM8A 4MMZB 2BNGA 2SBLA 3F8HA 1ZO2A 2XH9A 3LOYA 3SLUA 4JRFA 1WMNA 2XFSA 1W02A 3KKGA 3OXAA 1QVG2 2BMRB 3CCJ3 2FNQA 2CK3H 2WO0A 2YX9A 3G0KA 3UJMA 1YHQ3 1EA2A 3V98A 4GB5A 1IV9A 4CCVA 1VQK3 2CFLA 3NV0A 1W4NA 3EJVA 4KVHA 1O7GB 4ORLA 4WFOA 2XRXB 4WP5A 1RKYA 1RRLA 3OX9A 2YFIB 4MMXB 1EKMA 2F98A 1GY7A 3CNXA 5JPUA 1JB4A 1N9EA 3NM7A 5IG4A 3NXJA 1KC84 2XR8B 2GU1A 2Y73A 4OVMA 2W0QA 3HI7A 1IT7A 4AKZA 1W2B2 3FZWA 2GU3A 2CW9A 4N6V0 4HYZA 1A90A 1E3VA 2M7OA 1N5PA 5IW9A 2IA7A 3ER7A 3G8ZA 2B1XB 4FCJA 1E97A 3NHXA 3IJEB 4EBGA 1STDA 1TP6A 1R4CA 3F14A 1AR0A 2K54A 4N6NB 1NU3A 3EC9A 5JBSA 1WMOA 1IQ8A 1IQXA 4J9AA 3D9RA 3WA3A 1FGOA 1D6ZA 1SIHA 2F86B 2KXGA 5D82A 4N3VA 2KCDA 2OWPA 2WOFA 5CLKA 5AEWB 1D6UA 1KD14 1ROVA 1IT8A 1UUVB 3HIGA 5CF1A 1OH0A 1OCVA 4R1KA 1AVLA 3KSPA 1Q42A 2HMJB 4RNZA 3S28A 1LXEA 3CXC2 3B4PA 3J7Yd 2C10A 1YIT3 1MOLA 3BNEA 1QAFA 3KIIA 4BTWA 5IG5A 3T0UA 1N8R4 3PCSA 2CFWA 3BNDA 3HZPA 3X40A 4XDVA 1N9JA 1O7NB 3F9SA 1VQN3 3UL5A 3A76A 3N54B 4U13A 3LT8A 2B24B 1LNHA 4HM0B 1FGRA 3FSDA 1AV4A 1JNQA 1GY6A 2GBXB 3MG3A 2OOVC 4O2HA 1QALA 2MF7A 1QAKA 8CHOA 3K0ZA 1EQKA 1YGEA 1JRQA 1O7WB 1K41A 1NDOB 3OWYA 1NO3A 1HU9A 3MG1A 4FMAA 4AKYA 4XB5A 2IMJA 4WYKB 2CWVA 3K7CA 5AIHA 1JJ22 3JUQA 3GRDA 4XBYA 3EBYA 2W6JH 2Q07A 2P38A 5KP1A 2LQVA 1SJWA 2ML5A 1ROAA 4G1MB 5IEPA 1GYBA 2A15A 2OTL3 4OK0A 3KFQC 1C7HA 4MEIA 4WYKA 3B7CA 1QMAA 4HZ9B 1W2ZA 4R4KA 1ASKA 3PZWA 1Q7Y4 1Q814 2IUKA 4I4KA 4LZIA 1W01A 3CME3 3GZXB 1ULJB 4LMIA 2Z7AA 4HM6B 3CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LC7 A;  4N6M A;  3LH4 A;  4TX4 A;  4IT7 A;  4ZM8 A;  1G96 A;  5A0O B;  1M9G A;  3PXM A;  4N6V 0;  1A90 A;  1DVC A;  3KSE D;  1N5P A;  4N6T A;  3PYJ A;  1R4C A;  4N6N B;  1GD4 A;  5ELJ A;  4N6O B;  2W9Q A;  5EQL A;  2KXG A;  5ELU A;  1CEW I;  1CYU A;  1LXE A;  1A67 A;  1TIJ A;  5LC6 A;  4N6L A;  1MOL A;  1CYV A;  3S67 A;  2CH9 A;  1N9J A;  1N5H A;  4EYC A;  3IMA B;  3QRD A;  2W9P A;  3UL5 A;  2OCT A;  4N6U A;  1STF I;  3PS8 A;  3Q2P A;  3K9M C;  2BO9 B;  3NX0 A;  1RN7 A;  1YVB I;  1EQK A;  3L0R A;  1MNL A;  1IV7 A;  1GD3 A;  1DVD A;  1PFP A;  1NB3 I;  3GAX A;  1FA3 A;  1FUW A;  1NB5 I;  3UL6 A;  1KWI A;  1ROA A;  3KFQ C;  2O9U X;  1WNH A;  4LZI A;  3SVA A;  3MWZ A;  1IV9 A;  4CCV A; 
#chains in the Genus database with same CATH topology
 3WOD G;  2JQ5 A;  1FUS A;  4N6M A;  2HMK B;  3EB8 A;  3EQQ B;  5IEO A;  3CC4 3;  3CCE 3;  4ZM8 A;  1OHP A;  1T2H A;  4EW5 A;  2OTJ 3;  2CFK A;  3DH2 A;  2LYX A;  1JZO A;  1G96 A;  3A5E A;  5DRE A;  5A0O B;  1UCJ A;  4GL6 A;  5GSP A;  5KP4 A;  3CPW 2;  5G1L A;  3DGO A;  4AEQ A;  3LTB A;  1CH0 A;  3H3H A;  4HOH A;  4KFD A;  5FGO A;  3BNC A;  1RGE A;  4FCM A;  3NV0 B;  3LML A;  1BNI A;  3KSE D;  4K1U A;  2F99 A;  3FKA A;  2GEY A;  1NJI 4;  2CG1 A;  1IYY A;  1B20 A;  3JUO A;  2HOH A;  1S5A A;  1Y4K A;  2FXT A;  1IQY A;  3D79 A;  3HII A;  1RNB A;  2Z6B A;  1Q40 B;  3SXX A;  1GS3 A;  1W00 A;  1RLS A;  2JDI H;  4X2O A;  3ZG5 A;  1UI8 A;  2MC8 A;  1J2B A;  2STD A;  1ZX2 A;  4IIA A;  3O8Y A;  4N6O B;  1I2E A;  3IPT A;  4BIR A;  3DMC A;  3JVC A;  1JV2 B;  1Q40 A;  2W2C A;  1AQZ A;  3HK4 A;  4K1V A;  1BRK A;  2CX1 A;  5HGR A;  5TGN A;  1RGC A;  3URP A;  3NBR A;  1OGX A;  1A67 A;  5G1K A;  1OHS A;  1IVV A;  3WOF B;  1M90 4;  1DMQ A;  3KE7 A;  1R4Y A;  4MMY B;  1MWS A;  2XSO B;  4J5G A;  3RDE A;  1V74 A;  1ISK A;  4X2H A;  3U1W A;  1SAR A;  3LTA A;  1RGK A;  3CCL 3;  1C54 A;  4GSP A;  4I5Q A;  5IER A;  2UX0 A;  3V99 A;  5AEU B;  3H51 A;  1X1U A;  2QA4 3;  3JUM A;  3G16 A;  4K61 A;  4OUQ A;  4HKV B;  2OQE C;  1O7P B;  2K0M A;  3Q3F A;  1DET A;  4N6U A;  3K5T A;  3K63 A;  5D83 A;  5CXO A;  4L7K A;  4HM4 B;  3DGN A;  2Y74 A;  3F8X A;  1QVF 2;  3EE1 A;  2RGQ A;  4RZM A;  3K9M C;  3X42 A;  1YJ9 3;  3GZB A;  1UCL A;  2BO9 B;  3NX0 A;  5FW5 A;  2YFJ B;  3JUP A;  5AYS C;  4DKI A;  3CCJ 3;  3EX9 A;  4IPB A;  2J8X B;  3FG4 A;  1BNR A;  2D1W A;  2KF6 A;  1UUW B;  4H61 A;  3ALA A;  1OAC A;  2HML B;  3OW2 2;  1RN4 A;  5BVB A;  1DVD A;  1I70 A;  3BU4 A;  1RHL A;  5IG3 A;  3QK9 A;  4STD A;  5JPP A;  1E3R A;  1BSE A;  1NB3 I;  3MHE A;  3CCS 3;  3SYU A;  4KFF A;  1VQP 3;  1W6Y A;  1NB5 I;  1JB2 A;  4CPK A;  3I56 3;  2CC3 A;  1K28 A;  3UL6 A;  2O3O A;  2QGU A;  2XFT A;  3F7X A;  1KWI A;  3MSO A;  3ZFZ A;  5M18 A;  1GY5 A;  2ZHX B;  1VZZ A;  3LTD A;  4K90 B;  1RDS A;  2V1L A;  3E99 A;  4LEH A;  1BVI A;  3GSP A;  2KF3 A;  3RNT A;  1TFK A;  5M19 A;  1JN5 B;  3AGN A;  4HM7 B;  1F8N A;  1O7H B;  3SVA A;  3G6E 3;  4LGQ A;  1MGR A;  4HM8 B;  3X3Z A;  2CKF B;  4R9K A;  1RGF A;  3LZA A;  3CU3 A;  1JN5 A;  1FGQ A;  3OWS A;  5LC7 A;  5BXQ A;  1NWW A;  4QWT A;  2CWT A;  4FCZ A;  2FGT A;  5EVH A;  4TX4 A;  4IT7 A;  1JBT A;  3ROB A;  2BMO B;  2HMN B;  1RMS A;  2K3D A;  2W56 A;  5CF2 A;  1JBS A;  1HKX A;  2P0X A;  3DGL A;  5EEO A;  3X41 A;  1U5O A;  3NM2 A;  3PXM A;  1RGH A;  3NQZ A;  3STD A;  1RCL A;  1BNG A;  3VF1 A;  3CC7 3;  3FCS B;  4L8P A;  4N6T A;  1BSA A;  1V57 A;  1ULI B;  3CD6 3;  3N8B A;  4LSO A;  4HBR A;  1RRH A;  2P05 A;  2OQE A;  1O7M B;  5AIF A;  1UCI A;  4ILF A;  1VQ6 3;  1K8A 4;  1TFO A;  1GD4 A;  4R80 A;  2E2T A;  5ELJ A;  1BNE A;  5G2G A;  1IVU A;  3NBB A;  3V92 A;  1S72 3;  1B2M A;  2CHC A;  1Q9E A;  1YJW 3;  1D6Y A;  1FGM A;  1B27 A;  7STD A;  3OV4 A;  4J5K A;  3KCH A;  2XGN A;  1L5G B;  2RSX A;  3CCU 3;  1CEW I;  1V58 A;  2WGQ A;  4BL2 A;  1WMP A;  3F40 A;  2P09 A;  2INX A;  2BMQ B;  1LOY A;  3WR2 A;  3CCR 3;  1GMQ A;  3WA2 X;  1OUN A;  1T5Y A;  5D81 A;  3DXO A;  3GWR A;  1SPU A;  3BNB A;  1KSI A;  4N6L A;  1DE3 A;  1FGT A;  4EC6 A;  1CYV A;  4KFE A;  5IEN A;  2KF5 A;  3S67 A;  4HJL B;  2CH9 A;  3HX8 A;  3OWU A;  3CCQ 3;  5IF6 A;  1BNJ A;  1W7C A;  1M1K 4;  4CDL A;  1N5H A;  1RJO A;  4EYC A;  3GZY B;  2BT3 A;  1VQ4 3;  1AVK A;  3LXU X;  2F56 A;  3NUV A;  4O3V A;  1JB5 A;  2W03 A;  3KN4 A;  3AMO B;  3GZR A;  4FMD A;  3QRD A;  4HM3 B;  1Q86 4;  3BLZ A;  2F5M A;  3RGA A;  1STF I;  2CWU A;  3NQY A;  1BU4 A;  2L4V A;  3PS8 A;  3EN8 A;  3Q2P A;  1HZ1 A;  1OHO A;  3SX1 A;  2R4I A;  3AMO A;  2OOV A;  1KQS 2;  1LOW A;  1MWR A;  3EBT A;  1VQ8 3;  2WOH A;  4HM2 B;  1JKG B;  1X1Y A;  1PU4 A;  3AHW A;  4FMC A;  3CMA 3;  1RSN A;  3U97 A;  1A2V A;  1IV7 A;  3FF0 A;  2I9W A;  1BUJ A;  1BRS A;  2ML6 A;  1JKG A;  1PY3 A;  4XM4 A;  2UUG C;  2RCD A;  1GMR A;  5RNT A;  3M8C A;  7RNT A;  2P0M A;  2H0G A;  3WOE B;  1DYU A;  1US1 A;  1N8Q A;  1T3B A;  1U8C B;  1VQ5 3;  3CCM 3;  1DMM A;  1Q7H A;  5DRV A;  5AI1 A;  1IK3 A;  1BSB A;  1I8V A;  4XDW A;  5M1A A;  3I55 3;  3FH1 A;  2GBW B;  4NPB A;  4BTY A;  3ZG0 A;  1BRH A;  2BHM A;  2CFD A;  3X3Y A;  1LOV A;  2O9U X;  1WNH A;  2RFR A;  1W6G A;  4O02 B;  6RNT A;  1B2U A;  2GEX A;  2HMM B;  2BU4 A;  1BRI A;  1I3I A;  3B8L A;  2QEX 3;  1VQ9 3;  3MWZ A;  3UNL A;  5BIR A;  5AIG A;  2IUJ A;  2C11 A;  3WHO A;  3T8U A;  1TRQ A;  3B4O A;  3LTC A;  4J8T A;  1GOY A;  2ZA4 A;  2CIU A;  3EN1 B;  1M1X B;  3KZT A;  3DGM A;  1OPY A;  3LH4 A;  3LYG A;  2QIY A;  4HZB B;  4HM5 B;  2XEP A;  4BTX A;  3FG1 A;  2E2V A;  3FG3 A;  3MPH A;  2RBI A;  3MG2 A;  4BL3 A;  2YFL B;  3FLJ A;  1UI7 A;  1IVX A;  3LT9 A;  1M9G A;  2H0I A;  1VQL 3;  2KF4 A;  4XBT A;  4KZ1 A;  1OGZ A;  2XF3 A;  2KAA A;  4EV2 A;  1BNF A;  6STD A;  1BGS A;  1DVC A;  3G71 3;  4O8S A;  3SOA A;  3DY5 A;  4H3U A;  1UW1 A;  1YIJ 3;  3S29 A;  3X3X A;  3HOH A;  3PYJ A;  2XSH B;  3AGO A;  1QJG A;  2IYJ A;  4PEJ A;  2W56 B;  1GOU A;  2D42 A;  4WHA A;  3T8N A;  2ZDJ A;  4MJD A;  3S5C A;  3VGN A;  1YJN 3;  1W6C A;  3JUN A;  1TU5 A;  3SED A;  3FGY A;  2GXF A;  3WDG B;  3EF8 A;  1WQL B;  4HVN A;  3PGB A;  4XBX A;  3VSY A;  1YI2 3;  2W9Q A;  2C4B A;  5EQL A;  5KP3 A;  1Q82 4;  2Z76 A;  1BUQ A;  1TTO A;  5ELU A;  3D3L A;  6GSP A;  5AYR B;  1A2K A;  3CC2 3;  1RGL A;  1K73 4;  5I97 A;  1JBR A;  3AHS A;  1A2P A;  1CYU A;  3Q90 A;  2E2U A;  1I3F A;  1Z1S A;  2CG0 A;  2WGO A;  1IVW A;  1WTH A;  4WWU C;  1TIJ A;  3ECF A;  5LC6 A;  2Z77 A;  3PCR A;  1EG9 B;  2AAE A;  5IG0 A;  3MYT A;  1W5Z A;  1IDP A;  4L8O A;  3BB9 A;  4R9L A;  1HYF A;  1VQQ A;  2HMO B;  1SII A;  1LRA A;  2PZV A;  3Q1C A;  3F7S A;  3EHC A;  5STD A;  3BIR A;  5AII A;  2XGL A;  4Q53 A;  1BOX A;  3IMA B;  4JF8 A;  5CK6 A;  1G0T A;  3WMD A;  3MKI A;  3NBJ A;  2W9P A;  2OCT A;  2ZL8 A;  1UCK A;  1IU7 A;  1VQM 3;  1LOX A;  5BU4 A;  1TUH A;  1UUG B;  3DZL A;  3FF2 A;  1LQG C;  1X1X A;  2L1S A;  4EV5 A;  1VQO 3;  2PNC A;  4RBN A;  4HM1 B;  4EXR A;  3SOY A;  1BAN A;  1SQW A;  1RN7 A;  1GOV A;  1DMN A;  4RNY A;  1YVB I;  2W04 A;  3G4S 3;  3CPO A;  2KRT A;  3I0Y A;  1OF5 B;  3L0R A;  1BNS A;  1B2X A;  1MNL A;  3S27 A;  1BRJ A;  1GD3 A;  3DUK A;  1RGA A;  2R41 A;  1PFP A;  1VQ7 3;  1CQS A;  2CFG A;  1K9M 4;  3TDG A;  1RTU A;  3GAX A;  3RGR A;  3N9H A;  4FR9 A;  1OF5 A;  1FA3 A;  1TJD A;  1LVN A;  4NHF A;  4FMB A;  4HAA A;  3UB1 A;  1UGH I;  3CCV 3;  1FUW A;  4NRE A;  3DM8 A;  4MMZ B;  2BNG A;  2SBL A;  3F8H A;  1ZO2 A;  2XH9 A;  3LOY A;  3SLU A;  3D5G A;  4JRF A;  1WMN A;  2F4Y A;  2XFS A;  1W02 A;  3KKG A;  3OXA A;  1QVG 2;  2BMR B;  1BSC A;  1X1W A;  2FNQ A;  2H0H A;  1RGG A;  2CK3 H;  2WO0 A;  2YX9 A;  3G0K A;  3UJM A;  1YHQ 3;  1ZS7 A;  1EA2 A;  4CJN A;  3V98 A;  4GB5 A;  1IV9 A;  4CCV A;  1B2Z A;  2CFL A;  3NV0 A;  1VQK 3;  1EEJ A;  1W4N A;  3EJV A;  4KVH A;  1O7G B;  4ORL A;  1MWU A;  4WFO A;  2XRX B;  4WP5 A;  1RKY A;  2AAD A;  1RRL A;  1UGI A;  3OX9 A;  1BIR A;  1TRP A;  1RNT A;  2YFI B;  4MMX B;  1EKM A;  2F98 A;  1GY7 A;  3CNX A;  5JPU A;  1JB4 A;  1N9E A;  1ZGX A;  3NM7 A;  5IG4 A;  3NXJ A;  1KC8 4;  2XR8 B;  2GU1 A;  2Y73 A;  4OVM A;  2W0Q A;  3HI7 A;  4GHO A;  1IT7 A;  4AKZ A;  1W2B 2;  3FZW A;  2GU3 A;  2CW9 A;  4N6V 0;  4HYZ A;  1A90 A;  1E3V A;  2M7O A;  1N5P A;  9RNT A;  5IW9 A;  2IA7 A;  3ER7 A;  3G8Z A;  2B1X B;  4FCJ A;  1E97 A;  3NHX A;  3IJE B;  2UGI A;  4EBG A;  1STD A;  1TP6 A;  1R4C A;  3F14 A;  1UDI I;  1MGW A;  1AR0 A;  2K54 A;  1GMP A;  4N6N B;  1NU3 A;  3EC9 A;  5JBS A;  1WMO A;  1EUI C;  1IQ8 A;  1IQX A;  1LQM B;  4J9A A;  2RNT A;  3D9R A;  3WA3 A;  1FGO A;  1D6Z A;  1SIH A;  2F86 B;  2KXG A;  5D82 A;  4N3V A;  2KCD A;  2OWP A;  2WOF A;  5CLK A;  1MWT A;  5AEW B;  3D5I A;  1D6U A;  7GSP A;  1ROV A;  1IT8 A;  1UUV B;  3HIG A;  5CF1 A;  1KD1 4;  1OH0 A;  1OCV A;  4R1K A;  1AVL A;  3KSP A;  1Q42 A;  2HMJ B;  1FUT A;  4RNZ A;  1LXE A;  3S28 A;  3CXC 2;  3B4P A;  3J7Y d;  2C10 A;  2GSP A;  1YIT 3;  1MOL A;  1AY7 A;  1QAF A;  3BNE A;  3KII A;  4BTW A;  3T0U A;  5IG5 A;  1N8R 4;  1B21 A;  3PCS A;  1B2S A;  1RCK A;  2CFW A;  1I0X A;  3BND A;  3HZP A;  3X40 A;  1BRN L;  4XDV A;  1N9J A;  1O7N B;  3F9S A;  1NNV A;  4BU4 A;  1VQN 3;  3UL5 A;  1RN1 A;  3A76 A;  3N54 B;  4U13 A;  3LT8 A;  2B24 B;  1LNH A;  1T2I A;  1YGW A;  1B3S A;  4HM0 B;  1FGR A;  4RNT A;  3FSD A;  1AV4 A;  1JNQ A;  3D4A A;  1GY6 A;  2GBX B;  1FYS A;  3MG3 A;  2OOV C;  1I2G A;  2SAR A;  4O2H A;  1QAL A;  2MF7 A;  1QAK A;  8CHO A;  2IY2 A;  3K0Z A;  1EQK A;  1I2F A;  1YGE A;  3DGY A;  1JRQ A;  1O7W B;  1FW7 A;  1K41 A;  8RNT A;  1NDO B;  3OWY A;  2F5W A;  1BRG A;  1NO3 A;  1HU9 A;  3MG1 A;  4FMA A;  4AKY A;  1YNV X;  4XB5 A;  2IMJ A;  5HOH A;  1FZU A;  2CWV A;  3K7C A;  4WYK B;  5AIH A;  1JJ2 2;  3JUQ A;  3GRD A;  4KT3 B;  1BSD A;  4XBY A;  3EBY A;  2W6J H;  2Q07 A;  1GSP A;  1JZD A;  2P38 A;  5KP1 A;  2BIR A;  1SJW A;  2LQV A;  1PYL A;  1ROA A;  2ML5 A;  1G02 A;  4G1M B;  1GYB A;  5IEP A;  2A15 A;  4LYL B;  2OTL 3;  4OK0 A;  1I0V A;  1C7H A;  3KFQ C;  4MEI A;  4WYK A;  3B7C A;  1QMA A;  4HZ9 B;  1W2Z A;  4R4K A;  1YVS A;  1ASK A;  3PZW A;  1Q7Y 4;  1Q81 4;  1BAO A;  2IUK A;  4I4K A;  4LZI A;  1W01 A;  3CME 3;  3GZX B;  1ULJ B;  4LMI A;  2Z7A A;  4HM6 B;  2CX0 A;  3CNM A;  1LNI A; 
#chains in the Genus database with same CATH homology
 3WOD G;  2JQ5 A;  4N6M A;  2HMK B;  3EB8 A;  3EQQ B;  5IEO A;  3CC4 3;  3CCE 3;  4ZM8 A;  1OHP A;  2OTJ 3;  2CFK A;  2LYX A;  1G96 A;  5DRE A;  5A0O B;  4GL6 A;  5KP4 A;  3CPW 2;  3DGO A;  4AEQ A;  3LTB A;  3H3H A;  5FGO A;  4KFD A;  3BNC A;  4FCM A;  3NV0 B;  3LML A;  3KSE D;  4K1U A;  2F99 A;  3FKA A;  2GEY A;  1NJI 4;  2CG1 A;  3JUO A;  1S5A A;  1Y4K A;  2FXT A;  1IQY A;  3HII A;  2Z6B A;  1Q40 B;  3SXX A;  1GS3 A;  1W00 A;  2JDI H;  4X2O A;  1UI8 A;  2MC8 A;  1J2B A;  2STD A;  1ZX2 A;  4IIA A;  3O8Y A;  4N6O B;  3IPT A;  3DMC A;  3JVC A;  1JV2 B;  1Q40 A;  2W2C A;  3HK4 A;  5HGR A;  4K1V A;  5TGN A;  3NBR A;  1OGX A;  1A67 A;  1OHS A;  1IVV A;  3WOF B;  1M90 4;  1DMQ A;  3KE7 A;  4MMY B;  2XSO B;  1ISK A;  3RDE A;  1V74 A;  4X2H A;  3U1W A;  3LTA A;  3CCL 3;  5IER A;  2UX0 A;  3V99 A;  5AEU B;  3H51 A;  2QA4 3;  3JUM A;  3G16 A;  4K61 A;  4OUQ A;  4HKV B;  2OQE C;  1O7P B;  2K0M A;  4N6U A;  3K5T A;  3K63 A;  5D83 A;  5CXO A;  4L7K A;  4HM4 B;  3DGN A;  2Y74 A;  3F8X A;  1QVF 2;  3EE1 A;  2RGQ A;  4RZM A;  3K9M C;  3X42 A;  1YJ9 3;  3GZB A;  2BO9 B;  3NX0 A;  5FW5 A;  2YFJ B;  3JUP A;  5AYS C;  3EX9 A;  4IPB A;  3FG4 A;  2D1W A;  4H61 A;  1UUW B;  3ALA A;  1OAC A;  2HML B;  3OW2 2;  5BVB A;  1DVD A;  5IG3 A;  3QK9 A;  4STD A;  5JPP A;  1E3R A;  1NB3 I;  3MHE A;  3CCS 3;  4KFF A;  1VQP 3;  1W6Y A;  1NB5 I;  1JB2 A;  3I56 3;  2CC3 A;  1K28 A;  3UL6 A;  2O3O A;  2QGU A;  2XFT A;  3F7X A;  1KWI A;  3MSO A;  1GY5 A;  1VZZ A;  3LTD A;  4K90 B;  2V1L A;  3E99 A;  4LEH A;  1TFK A;  1JN5 B;  4HM7 B;  1F8N A;  1O7H B;  3SVA A;  3G6E 3;  4LGQ A;  4HM8 B;  3X3Z A;  2CKF B;  4R9K A;  3LZA A;  3CU3 A;  1JN5 A;  1FGQ A;  3OWS A;  5LC7 A;  5BXQ A;  1NWW A;  4QWT A;  2CWT A;  4FCZ A;  2FGT A;  5EVH A;  4TX4 A;  4IT7 A;  3ROB A;  2BMO B;  2HMN B;  2W56 A;  5CF2 A;  1HKX A;  2P0X A;  3DGL A;  5EEO A;  3X41 A;  1U5O A;  3NM2 A;  3PXM A;  3NQZ A;  3STD A;  3VF1 A;  3CC7 3;  3FCS B;  4L8P A;  4N6T A;  1ULI B;  3CD6 3;  3N8B A;  4LSO A;  4HBR A;  1RRH A;  2P05 A;  2OQE A;  1O7M B;  5AIF A;  1VQ6 3;  1K8A 4;  1TFO A;  1GD4 A;  4R80 A;  2E2T A;  5ELJ A;  5G2G A;  1IVU A;  3NBB A;  3V92 A;  1S72 3;  2CHC A;  1YJW 3;  1D6Y A;  1FGM A;  7STD A;  3OV4 A;  2XGN A;  1L5G B;  2RSX A;  3CCU 3;  1CEW I;  2WGQ A;  1WMP A;  3F40 A;  2P09 A;  2INX A;  2BMQ B;  3CCR 3;  3WA2 X;  1OUN A;  1T5Y A;  5D81 A;  3DXO A;  3GWR A;  1SPU A;  3BNB A;  1KSI A;  4N6L A;  1FGT A;  4EC6 A;  1CYV A;  4KFE A;  5IEN A;  3S67 A;  4HJL B;  2CH9 A;  3HX8 A;  3OWU A;  3CCQ 3;  5IF6 A;  1W7C A;  1M1K 4;  4CDL A;  1N5H A;  1RJO A;  4EYC A;  3GZY B;  2BT3 A;  1VQ4 3;  1AVK A;  3LXU X;  3NUV A;  4O3V A;  1JB5 A;  2W03 A;  3KN4 A;  3AMO B;  3GZR A;  4FMD A;  3QRD A;  4HM3 B;  1Q86 4;  3BLZ A;  3RGA A;  1STF I;  2CWU A;  3NQY A;  3PS8 A;  2L4V A;  3Q2P A;  3EN8 A;  1OHO A;  3SX1 A;  2R4I A;  3AMO A;  2OOV A;  1KQS 2;  1VQ8 3;  3EBT A;  2WOH A;  4HM2 B;  1JKG B;  1PU4 A;  4FMC A;  3CMA 3;  3U97 A;  1A2V A;  1IV7 A;  3FF0 A;  2I9W A;  2ML6 A;  1JKG A;  4XM4 A;  2RCD A;  3M8C A;  2P0M A;  3WOE B;  1DYU A;  1US1 A;  1N8Q A;  1U8C B;  1VQ5 3;  3CCM 3;  1DMM A;  5DRV A;  5AI1 A;  1IK3 A;  4XDW A;  3I55 3;  3FH1 A;  2GBW B;  4BTY A;  2BHM A;  2CFD A;  3X3Y A;  2O9U X;  1WNH A;  2RFR A;  1W6G A;  4O02 B;  2GEX A;  2HMM B;  3B8L A;  1VQ9 3;  2QEX 3;  3MWZ A;  3UNL A;  5AIG A;  2IUJ A;  2C11 A;  3T8U A;  3B4O A;  3LTC A;  4J8T A;  2CIU A;  3EN1 B;  1M1X B;  3KZT A;  3DGM A;  1OPY A;  3LH4 A;  3LYG A;  2QIY A;  4HZB B;  4HM5 B;  2XEP A;  4BTX A;  3FG1 A;  2E2V A;  3FG3 A;  3MPH A;  3MG2 A;  2YFL B;  3FLJ A;  1UI7 A;  1IVX A;  3LT9 A;  1M9G A;  1VQL 3;  4XBT A;  4KZ1 A;  1OGZ A;  2XF3 A;  4EV2 A;  6STD A;  1DVC A;  3G71 3;  4O8S A;  3SOA A;  3DY5 A;  4H3U A;  1UW1 A;  1YIJ 3;  3S29 A;  3X3X A;  3PYJ A;  2XSH B;  1QJG A;  4PEJ A;  2W56 B;  4WHA A;  2D42 A;  3T8N A;  3VGN A;  2ZDJ A;  4MJD A;  3S5C A;  1YJN 3;  1W6C A;  3JUN A;  1TU5 A;  3SED A;  3FGY A;  2GXF A;  3WDG B;  3EF8 A;  1WQL B;  4HVN A;  3PGB A;  4XBX A;  3VSY A;  1YI2 3;  2W9Q A;  5EQL A;  5KP3 A;  1Q82 4;  2Z76 A;  1BUQ A;  5ELU A;  3D3L A;  5AYR B;  1A2K A;  3CC2 3;  1K73 4;  5I97 A;  1CYU A;  3Q90 A;  2E2U A;  1Z1S A;  2CG0 A;  2WGO A;  1IVW A;  1WTH A;  4WWU C;  1TIJ A;  3ECF A;  5LC6 A;  2Z77 A;  3PCR A;  1EG9 B;  5IG0 A;  3MYT A;  1W5Z A;  1IDP A;  4L8O A;  3BB9 A;  4R9L A;  2PZV A;  2HMO B;  1SII A;  3Q1C A;  3F7S A;  3EHC A;  5STD A;  5AII A;  2XGL A;  4Q53 A;  4JF8 A;  3IMA B;  5CK6 A;  3WMD A;  3MKI A;  3NBJ A;  2W9P A;  2OCT A;  2ZL8 A;  1IU7 A;  1VQM 3;  1LOX A;  1TUH A;  3DZL A;  3FF2 A;  1VQO 3;  4EV5 A;  2PNC A;  4RBN A;  4HM1 B;  4EXR A;  3SOY A;  1SQW A;  1RN7 A;  1DMN A;  4RNY A;  1YVB I;  2W04 A;  3G4S 3;  3CPO A;  2KRT A;  3I0Y A;  1OF5 B;  3L0R A;  1MNL A;  3S27 A;  1GD3 A;  3DUK A;  1PFP A;  1VQ7 3;  1CQS A;  2CFG A;  1K9M 4;  3TDG A;  3GAX A;  3RGR A;  3N9H A;  4FR9 A;  1OF5 A;  1FA3 A;  4NHF A;  1LVN A;  3UB1 A;  4FMB A;  3CCV 3;  1FUW A;  4NRE A;  3DM8 A;  4MMZ B;  2BNG A;  2SBL A;  3F8H A;  1ZO2 A;  2XH9 A;  3LOY A;  3SLU A;  4JRF A;  1WMN A;  2XFS A;  1W02 A;  3KKG A;  3OXA A;  1QVG 2;  2BMR B;  3CCJ 3;  2FNQ A;  2CK3 H;  2WO0 A;  2YX9 A;  3G0K A;  3UJM A;  1YHQ 3;  1EA2 A;  3V98 A;  4GB5 A;  1IV9 A;  4CCV A;  1VQK 3;  2CFL A;  3NV0 A;  1W4N A;  3EJV A;  4KVH A;  1O7G B;  4ORL A;  4WFO A;  2XRX B;  4WP5 A;  1RKY A;  1RRL A;  3OX9 A;  2YFI B;  4MMX B;  1EKM A;  2F98 A;  1GY7 A;  3CNX A;  5JPU A;  1JB4 A;  1N9E A;  3NM7 A;  5IG4 A;  3NXJ A;  1KC8 4;  2XR8 B;  2GU1 A;  2Y73 A;  4OVM A;  2W0Q A;  3HI7 A;  1IT7 A;  4AKZ A;  1W2B 2;  3FZW A;  2GU3 A;  2CW9 A;  4N6V 0;  4HYZ A;  1A90 A;  1E3V A;  2M7O A;  1N5P A;  5IW9 A;  2IA7 A;  3ER7 A;  3G8Z A;  2B1X B;  4FCJ A;  1E97 A;  3NHX A;  3IJE B;  4EBG A;  1STD A;  1TP6 A;  1R4C A;  3F14 A;  1AR0 A;  2K54 A;  4N6N B;  1NU3 A;  3EC9 A;  5JBS A;  1WMO A;  1IQ8 A;  1IQX A;  4J9A A;  3D9R A;  3WA3 A;  1FGO A;  1D6Z A;  1SIH A;  2F86 B;  2KXG A;  5D82 A;  4N3V A;  2KCD A;  2OWP A;  2WOF A;  5CLK A;  5AEW B;  1D6U A;  1KD1 4;  1ROV A;  1IT8 A;  1UUV B;  3HIG A;  5CF1 A;  1OH0 A;  1OCV A;  4R1K A;  1AVL A;  3KSP A;  1Q42 A;  2HMJ B;  4RNZ A;  3S28 A;  1LXE A;  3CXC 2;  3B4P A;  3J7Y d;  2C10 A;  1YIT 3;  1MOL A;  3BNE A;  1QAF A;  3KII A;  4BTW A;  5IG5 A;  3T0U A;  1N8R 4;  3PCS A;  2CFW A;  3BND A;  3HZP A;  3X40 A;  4XDV A;  1N9J A;  1O7N B;  3F9S A;  1VQN 3;  3UL5 A;  3A76 A;  3N54 B;  4U13 A;  3LT8 A;  2B24 B;  1LNH A;  4HM0 B;  1FGR A;  3FSD A;  1AV4 A;  1JNQ A;  1GY6 A;  2GBX B;  3MG3 A;  2OOV C;  4O2H A;  1QAL A;  2MF7 A;  1QAK A;  8CHO A;  3K0Z A;  1EQK A;  1YGE A;  1JRQ A;  1O7W B;  1K41 A;  1NDO B;  3OWY A;  1NO3 A;  1HU9 A;  3MG1 A;  4FMA A;  4AKY A;  4XB5 A;  2IMJ A;  4WYK B;  2CWV A;  3K7C A;  5AIH A;  1JJ2 2;  3JUQ A;  3GRD A;  4XBY A;  3EBY A;  2W6J H;  2Q07 A;  2P38 A;  5KP1 A;  2LQV A;  1SJW A;  2ML5 A;  1ROA A;  4G1M B;  5IEP A;  1GYB A;  2A15 A;  2OTL 3;  4OK0 A;  3KFQ C;  1C7H A;  4MEI A;  4WYK A;  3B7C A;  1QMA A;  4HZ9 B;  1W2Z A;  4R4K A;  1ASK A;  3PZW A;  1Q7Y 4;  1Q81 4;  2IUK A;  4I4K A;  4LZI A;  1W01 A;  3CME 3;  3GZX B;  1ULJ B;  4LMI A;  2Z7A A;  4HM6 B;  3CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...