1GD3A

Refined solution structure of human cystatin a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd3A00
1DVDA 3Q2PA 1IV9A 4N6LA 4N6V0 2CH9A 1KWIA 5LC7A 3PS8A 3S67A 3L0RA 1LXEA 1A67A 1R4CA 3UL5A 2W9PA 1CYVA 3UL6A 4N6UA 3LH4A 5ELUA 1WNHA 1NB5I 4TX4A 2O9UX 3MWZA 4N6OB 4N6NB 1MNLA 1CYUA 3SVAA 1MOLA 1FUWA 3PXMA 3KFQC 1GD4A 3NX0A 1EQKA 1DVCA 1ROAA 1TIJA 1YVBI 3IMAB 1STFI 3PYJA 4N6MA 1NB3I 1CEWI 3QRDA 1PFPA 1G96A 2OCTA 1N5HA 1GD3A 3KSED 4ZM8A 4CCVA 5ELJA 5EQLA 5LC6A 2KXGA 1N9JA 2W9QA 3GAXA 4LZIA 1A90A 1N5PA 1IV7A 1RN7A 4N6TA 2BO9B 4EYCA 1FA3A 4IT7A 5A0OB 3K9MC 1M9GA
chains in the Genus database with same CATH superfamily
3CXC2 1DVDA 1IT8A 3S27A 5AIHA 5CXOA 3CU3A 2CHCA 3SXXA 1BNGA 1OH0A 3DGLA 3B8LA 4N6LA 1OGZA 3PCSA 1DETA 3D79A 1RHLA 3WOFB 2CH9A 1RDSA 3N9HA 2RFRA 1Q40B 1UCJA 1YIJ3 4CPKA 2Y73A 5LC7A 4ORLA 3PS8A 4HOHA 4LMIA 1Q42A 5IG5A 5IENA 1ASKA 1LOVA 3K63A 4JRFA 3NBRA 3CNXA 3F14A 3HIGA 1LXEA 2V1LA 1N8R4 2J8XB 3U1WA 2A15A 3B4OA 3EN1B 3HOHA 4XDVA 2F5WA 1ULIB 1CYVA 2B24B 3F7XA 2W56A 4N6UA 1OF5A 3D9RA 1EUIC 2R41A 1IQXA 3LH4A 3KE7A 4CJNA 2W2CA 3EBTA 3FGYA 1UW1A 3NQYA 1TFKA 5G1KA 5JBSA 2WO0A 5BU4A 1IVXA 1B2UA 4HM5B 1VQL3 3NV0A 1VQ43 1VQ93 2UX0A 2CC3A 4NHFA 4NPBA 2XGLA 2YFLB 4KZ1A 3WMDA 1B27A 1FGTA 3KZTA 1PY3A 1FUWA 6STDA 3NX0A 5DRVA 6RNTA 1JBTA 3LOYA 1LQGC 2GXFA 3DGYA 1J2BA 4HM6B 1OHSA 3HX8A 5IG0A 2CW9A 3FCSB 1T2HA 4MMXB 2XFSA 1YJW3 2OOVA 1BSCA 3EB8A 1B2XA 1YVBI 3IMAB 3G16A 3RGAA 3CCU3 2W56B 1GOUA 3DM8A 3KN4A 3AMOA 1OF5B 1STFI 2BHMA 4XBYA 1W00A 1FW7A 4BU4A 4OK0A 3LTCA 2W04A 1PFPA 3QRDA 2IUKA 5RNTA 5BVBA 4RNYA 1TFOA 1GOYA 2YFJB 3NV0B 2GSPA 1JZDA 1BGSA 1LNIA 1O7WB 1UDII 2I9WA 3TDGA 2WOHA 1FGOA 3FF2A 3EC9A 3UB1A 3BB9A 4LEHA 5IERA 1TRQA 3MG1A 3Q1CA 1YGWA 1LVNA 1BUJA 5AIGA 1OACA 3JUPA 3DMCA 3LTBA 4L8PA 1VQM3 2GBXB 3NM7A 1QVG2 1N9JA 2KXGA 1K41A 1US1A 2W9QA 1F8NA 3F9SA 3E99A 1I2EA 1OHOA 2GBWB 2ML6A 1VQO3 8RNTA 2Z77A 1T3BA 3AMOB 1GMPA 2FXTA 3AGNA 1E97A 1S5AA 3KKGA 4RBNA 4J9AA 3WA2X 1UGIA 3DY5A 2LYXA 3I563 4N6TA 9RNTA 1E3VA 2ZL8A 2BO9B 2OQEA 3O8YA 3OXAA 1NJI4 1W4NA 3FH1A 3HI7A 1EEJA 3MYTA 3SX1A 3SYUA 1OHPA 3D5GA 4HM3B 2XRXB 4X2OA 1RNBA 1EA2A 1N9EA 2IA7A 4J5GA 1M9GA 1Q7HA 1HYFA 1C54A 1JN5A 1DE3A 1NO3A 1D6ZA 1MWUA 1AVLA 2FNQA 1JKGA 4HAAA 1A2KA 3FG3A 3MSOA 4GSPA 3JUQA 3CME3 1VQ63 4KFFA 2BMOB 1V74A 3X41A 2CG0A 3OV4A 2XEPA 3STDA 5IEOA 1QAKA 1GMRA 1GSPA 5EVHA 7RNTA 5IW9A 3AHWA 3U97A 1RGHA 2KAAA 1O7MB 1X1XA 2F86B 3S67A 5DREA 1FUSA 4FMCA 2PZVA 1OUNA 5I97A 1VQK3 3L0RA 2IUJA 4U13A 1A67A 1OGXA 1STDA 3DGOA 3UL5A 3ZG0A 1BRHA 4BTYA 1I0XA 1VQ53 1LQMB 3UL6A 1K9M4 3LTAA 1LRAA 3WHOA 3SOAA 1BNSA 3CCV3 2Z76A 1JN5B 1AR0A 6GSPA 3CD63 1BSEA 1RRLA 1BNJA 1U5OA 4IPBA 1JKGB 2AAEA 2M7OA 2XFTA 3HIIA 4HZBB 3CC73 3CCE3 1IQ8A 1NB5I 4FMDA 4TX4A 1BANA 3JVCA 1IQYA 2IYJA 3LTDA 4EV5A 4BTXA 1FGRA 2E2UA 4NREA 4PEJA 4HM2B 3F40A 3CPOA 3FF0A 3G8ZA 1I2GA 2P05A 4FMAA 3G0KA 3BLZA 3LYGA 3PXMA 4WWUC 8CHOA 3CCJ3 1S723 1EQKA 1BIRA 3N54B 5KP1A 3F7SA 1JBRA 4EV2A 3ZG5A 4L8OA 1PYLA 1QJGA 1GMQA 2L1SA 1ROAA 3ECFA 5M18A 3M8CA 1RGFA 2H0GA 2RBIA 2MF7A 3HZPA 5STDA 1SIIA 1X1WA 2STDA 1B2ZA 1B21A 1BU4A 1W6YA 3OWYA 4FCMA 5IEPA 1WQLB 3IPTA 1CEWI 5G1LA 3CPW2 2YX9A 5IG4A 1ULJB 4XBXA 4XBTA 5EEOA 2XH9A 1RKYA 4BL2A 1QAFA 1G96A 3S5CA 3EJVA 2HMNB 2P09A 4HBRA 1CQSA 1RSNA 3DGNA 3OW22 3EHCA 3QK9A 4O2HA 3F8HA 3KSED 1DMMA 2GEXA 1E3RA 4ZM8A 1O7GB 1FYSA 1WTHA 3SOYA 4CCVA 5D83A 3NHXA 5ELJA 5EQLA 1MWRA 4K1VA 4K61A 2L4VA 3V92A 1K8A4 1AV4A 2RSXA 4R1KA 5AI1A 3FKAA 3WR2A 2CX0A 2RGQA 4FCZA 3Q3FA 1TU5A 2JQ5A 5AIFA 3JUOA 1G02A 1G0TA 3ER7A 4H61A 4KVHA 1EG9B 4K90B 1L5GB 1OPYA 3PZWA 1T2IA 3X3XA 1JV2B 4WFOA 3D5IA 3FG1A 1JB5A 1MGRA 1BNFA 2HMKB 3NQZA 2R4IA 4R9LA 5JPUA 3CCQ3 1Q814 1IV7A 2PNCA 1RN7A 3ALAA 1BRNL 5FW5A 2GEYA 4R80A 2BT3A 1I0VA 2IY2A 3LT9A 3WOEB 4GHOA 4XDWA 3D4AA 4H3UA 4EYCA 2XSHB 1AVKA 3DH2A 4X2HA 1WMPA 1IT7A 1K734 3GWRA 3JUMA 5FGOA 1LOWA 2AADA 4HM1B 5A0OB 1JB2A 1BSDA 3K9MC 3I553 1W6GA 5AEWB 5D82A 2QA43 2F5MA 2INXA 4FMBA 5D81A 3GZRA 2XSOB 3LMLA 3EBYA 1TJDA 1X1YA 1JJ22 2OOVC 4MMZB 3X3YA 3ZFZA 1W2B2 3Q2PA 4MEIA 1BAOA 2JDIH 4RZMA 2W6JH 3D3LA 4N6V0 1I2FA 5GSPA 1QMAA 2HOHA 5TGNA 4WYKA 3OWUA 1I70A 1UGHI 2E2TA 1BRGA 3G713 1TTOA 3CCM3 1M1K4 3BNBA 1HZ1A 1BRIA 5BIRA 2Q07A 1W5ZA 3GZXB 2WGQA 3AGOA 3A5EA 2WOFA 1YJ93 5HOHA 1R4CA 3S29A 2SARA 3CCR3 1NNVA 1GY5A 2ZHXB 5CLKA 4HM8B 1RGCA 1MWSA 2HMJB 1JB4A 5CK6A 1U8CB 1MWTA 3V98A 1FGQA 3UNLA 2CWUA 3X42A 2D1WA 1D6YA 1GYBA 1KQS2 2HMLB 2LQVA 3X40A 4HVNA 3DZLA 1A2VA 1W02A 1YGEA 1A2PA 1I8VA 4N6OB 4N6NB 3WA3A 3NM2A 4OVMA 2OTJ3 1MNLA 1W6CA 1IK3A 3K0ZA 3FLJA 3K5TA 4J5KA 2SBLA 3T0UA 4EXRA 2QGUA 1SJWA 3Q90A 4HM4B 1YHQ3 1W2ZA 3LT8A 1TIJA 4IIAA 4KFEA 1JNQA 4WP5A 4HZ9B 1ZX2A 2CK3H 1BNEA 1TUHA 2RCDA 3BNDA 5HGRA 1HU9A 1O7NB 1V58A 2CWTA 1NB3I 3PYJA 4HM7B 1K28A 3JUNA 1UUGB 2GU1A 1Q40A 3EX9A 7STDA 2BMRB 3PCRA 2CG1A 1JRQA 2QIYA 2CFWA 1B2SA 1N5HA 1MGWA 2CFKA 2GU3A 1B3SA 1GD3A 1Q864 5KP4A 1VQP3 4I5QA 3B7CA 5AYRB 1B2MA 1BSAA 1VQ83 1RGEA 2QEX3 1RLSA 4O02B 4RNZA 3KIIA 1GY7A 2YFIB 1BRKA 5LC6A 1ZS7A 5KP3A 3FZWA 3KCHA 4EW5A 1YI23 3T8NA 4OUQA 2KCDA 3UJMA 4BTWA 3H3HA 1WMNA 3VF1A 3GAXA 2XR8B 1Q824 4EC6A 4LZIA 5CF1A 1JBSA 1N5PA 3GZBA 2C4BA 4R4KA 1RN4A 1TP6A 1TRPA 3HK4A 2KF5A 3NUVA 3CCL3 1RTUA 1BVIA 3LZAA 1DMQA 3MG3A 1BUQA 2Z6BA 2IMJA 5AYSC 2C11A 4J8TA 4BL3A 1YVSA 2KRTA 1RNTA 1VZZA 3T8UA 1QALA 3DGMA 5G2GA 1M904 1UCKA 4O3VA 4HM0B 2P38A 4EBGA 1RJOA 4LGQA 1ZGXA 1UCLA 2H0HA 4LYLB 1YIT3 4MJDA 3MHEA 1ROVA 2F56A 1PU4A 1VQ73 2E2VA 1Q7Y4 1WMOA 1RGKA 3OX9A 1B20A 3CC43 4HYZA 3MPHA 1IU7A 1KC84 3MKIA 1LNHA 2Y74A 2OWPA 1IV9A 3SEDA 1ZO2A 2BIRA 2C10A 1O7HB 3IJEB 1KWIA 1UI8A 1NDOB 1RCKA 1SQWA 2B1XB 3X3ZA 1IVUA 2CWVA 1AQZA 3PGBA 2HMOB 2RNTA 4KFDA 1BRJA 3AHSA 4DKIA 1CH0A 3CMA3 1ISKA 5M1AA 2XF3A 3FSDA 3DXOA 1OCVA 2W9PA 3NBJA 4RNTA 1BOXA 1GOVA 1NU3A 4MMYB 1O7PB 2HMMB 4AKZA 3EN8A 3BIRA 2ZDJA 2O3OA 5AIIA 2H0IA 5JPPA 5ELUA 1DYUA 1WNHA 1C7HA 2ZA4A 3CC23 1Q9EA 1YNVX 3FG4A 2O9UX 1GY6A 1X1UA 3A76A 3MWZA 2KF4A 2D42A 1EKMA 2BMQB 2XGNA 1FGMA 1CYUA 1RGLA 4I4KA 1VQQA 3SVAA 3G4S3 1MOLA 3OWSA 3KFQC 1GD4A 1V57A 4CDLA 3DUKA 3RDEA 3GSPA 1DVCA 1N8QA 1JZOA 3GZYB 1I3FA 2BNGA 1UCIA 1R4YA 1RGGA 1UUVB 4BIRA 1IVVA 2Z7AA 4L7KA 4O8SA 3WODG 4QWTA 1KD14 3EE1A 2UUGC 4WHAA 1BNRA 1RGAA 2P0XA 2W03A 1VQN3 1GS3A 2CIUA 1NWWA 3K7CA 4JF8A 3H51A 4HKVB 3RGRA 4N6MA 3S28A 3NBBA 1YJN3 1I3IA 1LOYA 2F98A 2F99A 1FZUA 5IF6A 2W0QA 2OCTA 1RCLA 4XB5A 2K3DA 1LOXA 3BNEA 3KSPA 5M19A 1BSBA 2KF3A 1D6UA 1RMSA 4HJLB 2CKFB 4Q53A 4WYKB 1W01A 2FGTA 2P0MA 1DMNA 2CX1A 2WGOA 4GB5A 4XM4A 3VGNA 3SLUA 3EQQB 3J7Yd 4N3VA 4K1UA 3V99A 1SIHA 4LSOA 1QVF2 2KF6A 2F4YA 2OQEC 3URPA 2UGIA 3GRDA 3G6E3 4G1MB 1BRSA 2CFGA 1IDPA 3ROBA 3VSYA 2K0MA 1UUWB 1UI7A 2CFLA 3EF8A 1A90A 4ILFA 1M1XB 1RN1A 1T5YA 3RNTA 3CCS3 2ML5A 2K54A 1BNIA 3F8XA 3BU4A 3I0YA 5IG3A 1AY7A 5CF2A 4FR9A 4R9KA 2BU4A 3CNMA 3B4PA 4FCJA 3N8BA 1RRHA 4AKYA 2CFDA 4GL6A 5AEUB 1SARA 1FA3A 2MC8A 4IT7A 5BXQA 3BNCA 1W7CA 3NXJA 3MG2A 3WDGB 1IVWA 3LXUX 4AEQA 1KSIA 4STDA 1HKXA 1FUTA 1IYYA 1Y4KA 2OTL3 1Z1SA 1SPUA 7GSPA 4KT3B
chains in the Genus database with same CATH topology
3CXC2 1DVDA 1IT8A 3S27A 5AIHA 5CXOA 3CU3A 2CHCA 3SXXA 1OH0A 3DGLA 3B8LA 4N6LA 1OGZA 3PCSA 3WOFB 2CH9A 3N9HA 2RFRA 1Q40B 1YIJ3 2Y73A 5LC7A 4ORLA 3PS8A 4LMIA 1Q42A 5IG5A 5IENA 1ASKA 3K63A 4JRFA 3NBRA 3CNXA 3F14A 3HIGA 1LXEA 2V1LA 1N8R4 3U1WA 2A15A 3B4OA 3EN1B 4XDVA 1ULIB 1CYVA 2B24B 3F7XA 2W56A 4N6UA 1OF5A 3D9RA 1IQXA 3LH4A 3KE7A 2W2CA 3EBTA 3FGYA 1UW1A 3NQYA 1TFKA 5JBSA 2WO0A 1VQL3 1IVXA 4HM5B 3NV0A 1VQ43 1VQ93 2UX0A 2CC3A 4NHFA 2XGLA 2YFLB 4KZ1A 3WMDA 1FGTA 1FUWA 3KZTA 6STDA 3NX0A 5DRVA 3LOYA 2GXFA 1J2BA 4HM6B 1OHSA 3HX8A 5IG0A 2CW9A 3FCSB 4MMXB 2XFSA 1YJW3 2OOVA 3EB8A 1YVBI 3IMAB 3G16A 3RGAA 3CCU3 2W56B 3DM8A 3KN4A 3AMOA 1OF5B 1STFI 2BHMA 4XBYA 1W00A 4OK0A 3LTCA 2W04A 1PFPA 3QRDA 2IUKA 5BVBA 4RNYA 1TFOA 2YFJB 3NV0B 2I9WA 1O7WB 3TDGA 2WOHA 1FGOA 3FF2A 3EC9A 3UB1A 3BB9A 4LEHA 5IERA 3MG1A 3Q1CA 1LVNA 5AIGA 1OACA 3JUPA 3DMCA 3LTBA 4L8PA 1VQM3 2GBXB 3NM7A 1QVG2 1N9JA 2KXGA 1K41A 1US1A 2W9QA 1F8NA 3F9SA 3E99A 2GBWB 1OHOA 2ML6A 1VQO3 2Z77A 3AMOB 2FXTA 1E97A 1S5AA 3KKGA 4RBNA 4J9AA 3WA2X 3DY5A 2LYXA 3I563 4N6TA 1E3VA 2ZL8A 2BO9B 2OQEA 3O8YA 3OXAA 1NJI4 1W4NA 3FH1A 3HI7A 3MYTA 3SX1A 1OHPA 4HM3B 4X2OA 2XRXB 1EA2A 1N9EA 2IA7A 1M9GA 1JN5A 1NO3A 1D6ZA 2FNQA 1AVLA 1JKGA 1A2KA 3FG3A 3MSOA 3JUQA 3CME3 1VQ63 4KFFA 2BMOB 1V74A 3X41A 2CG0A 3OV4A 2XEPA 3STDA 5IEOA 1QAKA 5EVHA 5IW9A 3U97A 1O7MB 2F86B 3S67A 5DREA 4FMCA 2PZVA 1OUNA 5I97A 1VQK3 3L0RA 2IUJA 4U13A 1A67A 1OGXA 1STDA 3DGOA 3UL5A 4BTYA 1VQ53 3UL6A 1K9M4 3LTAA 3SOAA 3CCV3 2Z76A 1JN5B 1AR0A 3CD63 1RRLA 1U5OA 4IPBA 1JKGB 2M7OA 2XFTA 3HIIA 4HZBB 3CC73 3CCE3 1IQ8A 1NB5I 4FMDA 4TX4A 3JVCA 1IQYA 3LTDA 4EV5A 4BTXA 1FGRA 2E2UA 4NREA 4PEJA 4HM2B 3F40A 3CPOA 3FF0A 3G8ZA 2P05A 4FMAA 3G0KA 3BLZA 3LYGA 3PXMA 4WWUC 8CHOA 3CCJ3 1S723 1EQKA 3N54B 5KP1A 3F7SA 4EV2A 4L8OA 1QJGA 1ROAA 3ECFA 3M8CA 2MF7A 3HZPA 5STDA 1SIIA 2STDA 1W6YA 3OWYA 4FCMA 5IEPA 1WQLB 3IPTA 1CEWI 3CPW2 2YX9A 5IG4A 1ULJB 4XBXA 4XBTA 5EEOA 2XH9A 1RKYA 1QAFA 1G96A 3S5CA 3EJVA 2HMNB 2P09A 4HBRA 1CQSA 3DGNA 3OW22 3EHCA 3QK9A 4O2HA 3F8HA 3KSED 1DMMA 2GEXA 1E3RA 4ZM8A 1O7GB 1WTHA 4CCVA 3SOYA 5D83A 3NHXA 5ELJA 5EQLA 1K8A4 4K1VA 4K61A 2L4VA 3V92A 1AV4A 2RSXA 4R1KA 5AI1A 3FKAA 2RGQA 4FCZA 1TU5A 2JQ5A 5AIFA 3JUOA 4H61A 3ER7A 4KVHA 1L5GB 1EG9B 4K90B 1OPYA 3PZWA 3X3XA 1JV2B 4WFOA 3FG1A 1JB5A 2HMKB 3NQZA 2R4IA 4R9LA 5JPUA 3CCQ3 1Q814 1IV7A 2PNCA 1RN7A 3ALAA 5FW5A 2GEYA 4R80A 2BT3A 3WOEB 3LT9A 4XDWA 4H3UA 4EYCA 2XSHB 1AVKA 4X2HA 1WMPA 1IT7A 1K734 3GWRA 3JUMA 5FGOA 4HM1B 5A0OB 1JB2A 3K9MC 3I553 1W6GA 5AEWB 5D82A 2QA43 2INXA 4FMBA 5D81A 3GZRA 2XSOB 3LMLA 3EBYA 1JJ22 2OOVC 4MMZB 3X3YA 1W2B2 3Q2PA 4MEIA 2JDIH 4RZMA 2W6JH 3D3LA 4N6V0 1QMAA 5TGNA 4WYKA 3OWUA 2E2TA 3G713 3CCM3 1M1K4 3BNBA 2Q07A 1W5ZA 3GZXB 2WGQA 2WOFA 1YJ93 1R4CA 3S29A 3CCR3 1GY5A 5CLKA 4HM8B 2HMJB 1JB4A 5CK6A 1U8CB 3V98A 1FGQA 3UNLA 2CWUA 3X42A 2D1WA 1D6YA 1GYBA 1KQS2 2HMLB 2LQVA 3X40A 4HVNA 3DZLA 1A2VA 1W02A 1YGEA 4N6OB 3WA3A 4N6NB 3NM2A 4OVMA 2OTJ3 1MNLA 1W6CA 1IK3A 3K0ZA 3FLJA 3K5TA 2SBLA 3T0UA 4EXRA 2QGUA 1SJWA 3Q90A 4HM4B 1YHQ3 1W2ZA 3LT8A 1TIJA 4IIAA 4KFEA 1JNQA 4WP5A 4HZ9B 1ZX2A 2CK3H 3BNDA 1TUHA 2RCDA 5HGRA 1HU9A 1O7NB 3PYJA 2CWTA 1NB3I 4HM7B 1K28A 3JUNA 2GU1A 1Q40A 3EX9A 7STDA 2BMRB 3PCRA 2CG1A 1JRQA 2QIYA 2CFWA 1N5HA 2CFKA 2GU3A 1GD3A 1Q864 5KP4A 1VQP3 3B7CA 5AYRB 1VQ83 2QEX3 4O02B 4RNZA 3KIIA 1GY7A 2YFIB 5LC6A 5KP3A 3FZWA 1YI23 3T8NA 4OUQA 2KCDA 3UJMA 4BTWA 3H3HA 1WMNA 3VF1A 3GAXA 2XR8B 1Q824 4EC6A 4LZIA 5CF1A 1N5PA 3GZBA 4R4KA 1TP6A 3NUVA 3HK4A 3CCL3 3LZAA 1DMQA 3MG3A 1BUQA 2Z6BA 2IMJA 5AYSC 2C11A 4J8TA 2KRTA 1VZZA 3T8UA 1QALA 3DGMA 5G2GA 1M904 4O3VA 4HM0B 2P38A 4EBGA 1RJOA 4LGQA 1YIT3 4MJDA 3MHEA 1ROVA 1PU4A 1VQ73 2E2VA 1Q7Y4 1WMOA 3OX9A 3CC43 4HYZA 3MPHA 1IU7A 1KC84 3MKIA 1LNHA 2Y74A 2OWPA 1IV9A 3SEDA 1ZO2A 2C10A 1O7HB 3IJEB 1KWIA 1UI8A 1NDOB 1SQWA 2B1XB 3X3ZA 1IVUA 2CWVA 3PGBA 2HMOB 4KFDA 3CMA3 1ISKA 2XF3A 3FSDA 3DXOA 1OCVA 2W9PA 3NBJA 1NU3A 4MMYB 1O7PB 2HMMB 4AKZA 3EN8A 2ZDJA 2O3OA 5AIIA 5JPPA 5ELUA 1DYUA 1WNHA 1C7HA 3CC23 3FG4A 2O9UX 1GY6A 3A76A 3MWZA 2D42A 1EKMA 2BMQB 2XGNA 1FGMA 1CYUA 4I4KA 3SVAA 3G4S3 1MOLA 3OWSA 3KFQC 1GD4A 4CDLA 3DUKA 3RDEA 1DVCA 1N8QA 3GZYB 2BNGA 1UUVB 1IVVA 2Z7AA 4L7KA 4O8SA 3WODG 4QWTA 1KD14 3EE1A 4WHAA 2P0XA 2W03A 1VQN3 1GS3A 2CIUA 1NWWA 3K7CA 4JF8A 3H51A 4HKVB 3RGRA 4N6MA 3S28A 3NBBA 1YJN3 2F98A 2F99A 5IF6A 2W0QA 2OCTA 4XB5A 1LOXA 3BNEA 3KSPA 4HJLB 1D6UA 4WYKB 2CKFB 4Q53A 1W01A 2FGTA 2P0MA 1DMNA 3VGNA 2WGOA 4GB5A 4XM4A 3SLUA 3EQQB 3J7Yd 4N3VA 4K1UA 3V99A 1SIHA 4LSOA 1QVF2 2OQEC 3GRDA 3G6E3 4G1MB 2CFGA 1IDPA 3ROBA 3VSYA 2K0MA 1UUWB 1UI7A 2CFLA 3EF8A 1A90A 1M1XB 1T5YA 3CCS3 2ML5A 2K54A 3F8XA 3I0YA 5IG3A 5CF2A 4FR9A 4R9KA 3CNMA 3B4PA 4FCJA 3N8BA 1RRHA 4AKYA 2CFDA 4GL6A 5AEUB 1FA3A 2MC8A 4IT7A 5BXQA 3BNCA 1W7CA 3NXJA 3MG2A 3WDGB 1IVWA 3LXUX 4AEQA 1KSIA 4STDA 1HKXA 1Y4KA 2OTL3 1Z1SA 1SPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVD A;  3Q2P A;  1IV9 A;  4N6L A;  4N6V 0;  2CH9 A;  1KWI A;  5LC7 A;  3PS8 A;  3S67 A;  3L0R A;  1LXE A;  1A67 A;  1R4C A;  3UL5 A;  2W9P A;  1CYV A;  3UL6 A;  4N6U A;  3LH4 A;  5ELU A;  1WNH A;  1NB5 I;  4TX4 A;  2O9U X;  3MWZ A;  4N6O B;  4N6N B;  1MNL A;  1CYU A;  3SVA A;  1MOL A;  1FUW A;  3PXM A;  3KFQ C;  1GD4 A;  3NX0 A;  1EQK A;  1DVC A;  1ROA A;  1TIJ A;  1YVB I;  3IMA B;  1STF I;  3PYJ A;  4N6M A;  1NB3 I;  1CEW I;  3QRD A;  1PFP A;  1G96 A;  2OCT A;  1N5H A;  1GD3 A;  3KSE D;  4ZM8 A;  4CCV A;  5ELJ A;  5EQL A;  5LC6 A;  2KXG A;  1N9J A;  2W9Q A;  3GAX A;  4LZI A;  1A90 A;  1N5P A;  1IV7 A;  1RN7 A;  4N6T A;  2BO9 B;  4EYC A;  1FA3 A;  4IT7 A;  5A0O B;  3K9M C;  1M9G A; 
#chains in the Genus database with same CATH topology
 3CXC 2;  1DVD A;  1IT8 A;  3S27 A;  5AIH A;  5CXO A;  3CU3 A;  2CHC A;  3SXX A;  1BNG A;  1OH0 A;  3DGL A;  3B8L A;  4N6L A;  1OGZ A;  3PCS A;  1DET A;  3D79 A;  1RHL A;  3WOF B;  2CH9 A;  1RDS A;  3N9H A;  2RFR A;  1Q40 B;  1UCJ A;  1YIJ 3;  4CPK A;  2Y73 A;  5LC7 A;  4ORL A;  3PS8 A;  4HOH A;  4LMI A;  1Q42 A;  5IG5 A;  5IEN A;  1ASK A;  1LOV A;  3K63 A;  4JRF A;  3NBR A;  3CNX A;  3F14 A;  3HIG A;  1LXE A;  2V1L A;  1N8R 4;  2J8X B;  3U1W A;  2A15 A;  3B4O A;  3EN1 B;  3HOH A;  4XDV A;  2F5W A;  1ULI B;  1CYV A;  2B24 B;  3F7X A;  2W56 A;  4N6U A;  1OF5 A;  3D9R A;  1EUI C;  2R41 A;  1IQX A;  3LH4 A;  3KE7 A;  4CJN A;  2W2C A;  3EBT A;  3FGY A;  1UW1 A;  3NQY A;  1TFK A;  5G1K A;  5JBS A;  2WO0 A;  5BU4 A;  1IVX A;  1B2U A;  4HM5 B;  1VQL 3;  3NV0 A;  1VQ4 3;  1VQ9 3;  2UX0 A;  2CC3 A;  4NHF A;  4NPB A;  2XGL A;  2YFL B;  4KZ1 A;  3WMD A;  1B27 A;  1FGT A;  3KZT A;  1PY3 A;  1FUW A;  6STD A;  3NX0 A;  5DRV A;  6RNT A;  1JBT A;  3LOY A;  1LQG C;  2GXF A;  3DGY A;  1J2B A;  4HM6 B;  1OHS A;  3HX8 A;  5IG0 A;  2CW9 A;  3FCS B;  1T2H A;  4MMX B;  2XFS A;  1YJW 3;  2OOV A;  1BSC A;  3EB8 A;  1B2X A;  1YVB I;  3IMA B;  3G16 A;  3RGA A;  3CCU 3;  2W56 B;  1GOU A;  3DM8 A;  3KN4 A;  3AMO A;  1OF5 B;  1STF I;  2BHM A;  4XBY A;  1W00 A;  1FW7 A;  4BU4 A;  4OK0 A;  3LTC A;  2W04 A;  1PFP A;  3QRD A;  2IUK A;  5RNT A;  5BVB A;  4RNY A;  1TFO A;  1GOY A;  2YFJ B;  3NV0 B;  2GSP A;  1JZD A;  1BGS A;  1LNI A;  1O7W B;  1UDI I;  2I9W A;  3TDG A;  2WOH A;  1FGO A;  3FF2 A;  3EC9 A;  3UB1 A;  3BB9 A;  4LEH A;  5IER A;  1TRQ A;  3MG1 A;  3Q1C A;  1YGW A;  1LVN A;  1BUJ A;  5AIG A;  1OAC A;  3JUP A;  3DMC A;  3LTB A;  4L8P A;  1VQM 3;  2GBX B;  3NM7 A;  1QVG 2;  1N9J A;  2KXG A;  1K41 A;  1US1 A;  2W9Q A;  1F8N A;  3F9S A;  3E99 A;  1I2E A;  1OHO A;  2GBW B;  2ML6 A;  1VQO 3;  8RNT A;  2Z77 A;  1T3B A;  3AMO B;  1GMP A;  2FXT A;  3AGN A;  1E97 A;  1S5A A;  3KKG A;  4RBN A;  4J9A A;  3WA2 X;  1UGI A;  3DY5 A;  2LYX A;  3I56 3;  4N6T A;  9RNT A;  1E3V A;  2ZL8 A;  2BO9 B;  2OQE A;  3O8Y A;  3OXA A;  1NJI 4;  1W4N A;  3FH1 A;  3HI7 A;  1EEJ A;  3MYT A;  3SX1 A;  3SYU A;  1OHP A;  3D5G A;  4HM3 B;  2XRX B;  4X2O A;  1RNB A;  1EA2 A;  1N9E A;  2IA7 A;  4J5G A;  1M9G A;  1Q7H A;  1HYF A;  1C54 A;  1JN5 A;  1DE3 A;  1NO3 A;  1D6Z A;  1MWU A;  1AVL A;  2FNQ A;  1JKG A;  4HAA A;  1A2K A;  3FG3 A;  3MSO A;  4GSP A;  3JUQ A;  3CME 3;  1VQ6 3;  4KFF A;  2BMO B;  1V74 A;  3X41 A;  2CG0 A;  3OV4 A;  2XEP A;  3STD A;  5IEO A;  1QAK A;  1GMR A;  1GSP A;  5EVH A;  7RNT A;  5IW9 A;  3AHW A;  3U97 A;  1RGH A;  2KAA A;  1O7M B;  1X1X A;  2F86 B;  3S67 A;  5DRE A;  1FUS A;  4FMC A;  2PZV A;  1OUN A;  5I97 A;  1VQK 3;  3L0R A;  2IUJ A;  4U13 A;  1A67 A;  1OGX A;  1STD A;  3DGO A;  3UL5 A;  3ZG0 A;  1BRH A;  4BTY A;  1I0X A;  1VQ5 3;  1LQM B;  3UL6 A;  1K9M 4;  3LTA A;  1LRA A;  3WHO A;  3SOA A;  1BNS A;  3CCV 3;  2Z76 A;  1JN5 B;  1AR0 A;  6GSP A;  3CD6 3;  1BSE A;  1RRL A;  1BNJ A;  1U5O A;  4IPB A;  1JKG B;  2AAE A;  2M7O A;  2XFT A;  3HII A;  4HZB B;  3CC7 3;  3CCE 3;  1IQ8 A;  1NB5 I;  4FMD A;  4TX4 A;  1BAN A;  3JVC A;  1IQY A;  2IYJ A;  3LTD A;  4EV5 A;  4BTX A;  1FGR A;  2E2U A;  4NRE A;  4PEJ A;  4HM2 B;  3F40 A;  3CPO A;  3FF0 A;  3G8Z A;  1I2G A;  2P05 A;  4FMA A;  3G0K A;  3BLZ A;  3LYG A;  3PXM A;  4WWU C;  8CHO A;  3CCJ 3;  1S72 3;  1EQK A;  1BIR A;  3N54 B;  5KP1 A;  3F7S A;  1JBR A;  4EV2 A;  3ZG5 A;  4L8O A;  1PYL A;  1QJG A;  1GMQ A;  2L1S A;  1ROA A;  3ECF A;  5M18 A;  3M8C A;  1RGF A;  2H0G A;  2RBI A;  2MF7 A;  3HZP A;  5STD A;  1SII A;  1X1W A;  2STD A;  1B2Z A;  1B21 A;  1BU4 A;  1W6Y A;  3OWY A;  4FCM A;  5IEP A;  1WQL B;  3IPT A;  1CEW I;  5G1L A;  3CPW 2;  2YX9 A;  5IG4 A;  1ULJ B;  4XBX A;  4XBT A;  5EEO A;  2XH9 A;  1RKY A;  4BL2 A;  1QAF A;  1G96 A;  3S5C A;  3EJV A;  2HMN B;  2P09 A;  4HBR A;  1CQS A;  1RSN A;  3DGN A;  3OW2 2;  3EHC A;  3QK9 A;  4O2H A;  3F8H A;  3KSE D;  1DMM A;  2GEX A;  1E3R A;  4ZM8 A;  1O7G B;  1FYS A;  1WTH A;  3SOY A;  4CCV A;  5D83 A;  3NHX A;  5ELJ A;  5EQL A;  1MWR A;  4K1V A;  4K61 A;  2L4V A;  3V92 A;  1K8A 4;  1AV4 A;  2RSX A;  4R1K A;  5AI1 A;  3FKA A;  3WR2 A;  2CX0 A;  2RGQ A;  4FCZ A;  3Q3F A;  1TU5 A;  2JQ5 A;  5AIF A;  3JUO A;  1G02 A;  1G0T A;  3ER7 A;  4H61 A;  4KVH A;  1EG9 B;  4K90 B;  1L5G B;  1OPY A;  3PZW A;  1T2I A;  3X3X A;  1JV2 B;  4WFO A;  3D5I A;  3FG1 A;  1JB5 A;  1MGR A;  1BNF A;  2HMK B;  3NQZ A;  2R4I A;  4R9L A;  5JPU A;  3CCQ 3;  1Q81 4;  1IV7 A;  2PNC A;  1RN7 A;  3ALA A;  1BRN L;  5FW5 A;  2GEY A;  4R80 A;  2BT3 A;  1I0V A;  2IY2 A;  3LT9 A;  3WOE B;  4GHO A;  4XDW A;  3D4A A;  4H3U A;  4EYC A;  2XSH B;  1AVK A;  3DH2 A;  4X2H A;  1WMP A;  1IT7 A;  1K73 4;  3GWR A;  3JUM A;  5FGO A;  1LOW A;  2AAD A;  4HM1 B;  5A0O B;  1JB2 A;  1BSD A;  3K9M C;  3I55 3;  1W6G A;  5AEW B;  5D82 A;  2QA4 3;  2F5M A;  2INX A;  4FMB A;  5D81 A;  3GZR A;  2XSO B;  3LML A;  3EBY A;  1TJD A;  1X1Y A;  1JJ2 2;  2OOV C;  4MMZ B;  3X3Y A;  3ZFZ A;  1W2B 2;  3Q2P A;  4MEI A;  1BAO A;  2JDI H;  4RZM A;  2W6J H;  3D3L A;  4N6V 0;  1I2F A;  5GSP A;  1QMA A;  2HOH A;  5TGN A;  4WYK A;  3OWU A;  1I70 A;  1UGH I;  2E2T A;  1BRG A;  3G71 3;  1TTO A;  3CCM 3;  1M1K 4;  3BNB A;  1HZ1 A;  1BRI A;  5BIR A;  2Q07 A;  1W5Z A;  3GZX B;  2WGQ A;  3AGO A;  3A5E A;  2WOF A;  1YJ9 3;  5HOH A;  1R4C A;  3S29 A;  2SAR A;  3CCR 3;  1NNV A;  1GY5 A;  2ZHX B;  5CLK A;  4HM8 B;  1RGC A;  1MWS A;  2HMJ B;  1JB4 A;  5CK6 A;  1U8C B;  1MWT A;  3V98 A;  1FGQ A;  3UNL A;  2CWU A;  3X42 A;  2D1W A;  1D6Y A;  1GYB A;  1KQS 2;  2HML B;  2LQV A;  3X40 A;  4HVN A;  3DZL A;  1A2V A;  1W02 A;  1YGE A;  1A2P A;  1I8V A;  4N6O B;  4N6N B;  3WA3 A;  3NM2 A;  4OVM A;  2OTJ 3;  1MNL A;  1W6C A;  1IK3 A;  3K0Z A;  3FLJ A;  3K5T A;  4J5K A;  2SBL A;  3T0U A;  4EXR A;  2QGU A;  1SJW A;  3Q90 A;  4HM4 B;  1YHQ 3;  1W2Z A;  3LT8 A;  1TIJ A;  4IIA A;  4KFE A;  1JNQ A;  4WP5 A;  4HZ9 B;  1ZX2 A;  2CK3 H;  1BNE A;  1TUH A;  2RCD A;  3BND A;  5HGR A;  1HU9 A;  1O7N B;  1V58 A;  2CWT A;  1NB3 I;  3PYJ A;  4HM7 B;  1K28 A;  3JUN A;  1UUG B;  2GU1 A;  1Q40 A;  3EX9 A;  7STD A;  2BMR B;  3PCR A;  2CG1 A;  1JRQ A;  2QIY A;  2CFW A;  1B2S A;  1N5H A;  1MGW A;  2CFK A;  2GU3 A;  1B3S A;  1GD3 A;  1Q86 4;  5KP4 A;  1VQP 3;  4I5Q A;  3B7C A;  5AYR B;  1B2M A;  1BSA A;  1VQ8 3;  1RGE A;  2QEX 3;  1RLS A;  4O02 B;  4RNZ A;  3KII A;  1GY7 A;  2YFI B;  1BRK A;  5LC6 A;  1ZS7 A;  5KP3 A;  3FZW A;  3KCH A;  4EW5 A;  1YI2 3;  3T8N A;  4OUQ A;  2KCD A;  3UJM A;  4BTW A;  3H3H A;  1WMN A;  3VF1 A;  3GAX A;  2XR8 B;  1Q82 4;  4EC6 A;  4LZI A;  5CF1 A;  1JBS A;  1N5P A;  3GZB A;  2C4B A;  4R4K A;  1RN4 A;  1TP6 A;  1TRP A;  3HK4 A;  2KF5 A;  3NUV A;  3CCL 3;  1RTU A;  1BVI A;  3LZA A;  1DMQ A;  3MG3 A;  1BUQ A;  2Z6B A;  2IMJ A;  5AYS C;  2C11 A;  4J8T A;  4BL3 A;  1YVS A;  2KRT A;  1RNT A;  1VZZ A;  3T8U A;  1QAL A;  3DGM A;  5G2G A;  1M90 4;  1UCK A;  4O3V A;  4HM0 B;  2P38 A;  4EBG A;  1RJO A;  4LGQ A;  1ZGX A;  1UCL A;  2H0H A;  4LYL B;  1YIT 3;  4MJD A;  3MHE A;  1ROV A;  2F56 A;  1PU4 A;  1VQ7 3;  2E2V A;  1Q7Y 4;  1WMO A;  1RGK A;  3OX9 A;  1B20 A;  3CC4 3;  4HYZ A;  3MPH A;  1IU7 A;  1KC8 4;  3MKI A;  1LNH A;  2Y74 A;  2OWP A;  1IV9 A;  3SED A;  1ZO2 A;  2BIR A;  2C10 A;  1O7H B;  3IJE B;  1KWI A;  1UI8 A;  1NDO B;  1RCK A;  1SQW A;  2B1X B;  3X3Z A;  1IVU A;  2CWV A;  1AQZ A;  3PGB A;  2HMO B;  2RNT A;  4KFD A;  1BRJ A;  3AHS A;  4DKI A;  1CH0 A;  3CMA 3;  1ISK A;  5M1A A;  2XF3 A;  3FSD A;  3DXO A;  1OCV A;  2W9P A;  3NBJ A;  4RNT A;  1BOX A;  1GOV A;  1NU3 A;  4MMY B;  1O7P B;  2HMM B;  4AKZ A;  3EN8 A;  3BIR A;  2ZDJ A;  2O3O A;  5AII A;  2H0I A;  5JPP A;  5ELU A;  1DYU A;  1WNH A;  1C7H A;  2ZA4 A;  3CC2 3;  1Q9E A;  1YNV X;  3FG4 A;  2O9U X;  1GY6 A;  1X1U A;  3A76 A;  3MWZ A;  2KF4 A;  2D42 A;  1EKM A;  2BMQ B;  2XGN A;  1FGM A;  1CYU A;  1RGL A;  4I4K A;  1VQQ A;  3SVA A;  3G4S 3;  1MOL A;  3OWS A;  3KFQ C;  1GD4 A;  1V57 A;  4CDL A;  3DUK A;  3RDE A;  3GSP A;  1DVC A;  1N8Q A;  1JZO A;  3GZY B;  1I3F A;  2BNG A;  1UCI A;  1R4Y A;  1RGG A;  1UUV B;  4BIR A;  1IVV A;  2Z7A A;  4L7K A;  4O8S A;  3WOD G;  4QWT A;  1KD1 4;  3EE1 A;  2UUG C;  4WHA A;  1BNR A;  1RGA A;  2P0X A;  2W03 A;  1VQN 3;  1GS3 A;  2CIU A;  1NWW A;  3K7C A;  4JF8 A;  3H51 A;  4HKV B;  3RGR A;  4N6M A;  3S28 A;  3NBB A;  1YJN 3;  1I3I A;  1LOY A;  2F98 A;  2F99 A;  1FZU A;  5IF6 A;  2W0Q A;  2OCT A;  1RCL A;  4XB5 A;  2K3D A;  1LOX A;  3BNE A;  3KSP A;  5M19 A;  1BSB A;  2KF3 A;  1D6U A;  1RMS A;  4HJL B;  2CKF B;  4Q53 A;  4WYK B;  1W01 A;  2FGT A;  2P0M A;  1DMN A;  2CX1 A;  2WGO A;  4GB5 A;  4XM4 A;  3VGN A;  3SLU A;  3EQQ B;  3J7Y d;  4N3V A;  4K1U A;  3V99 A;  1SIH A;  4LSO A;  1QVF 2;  2KF6 A;  2F4Y A;  2OQE C;  3URP A;  2UGI A;  3GRD A;  3G6E 3;  4G1M B;  1BRS A;  2CFG A;  1IDP A;  3ROB A;  3VSY A;  2K0M A;  1UUW B;  1UI7 A;  2CFL A;  3EF8 A;  1A90 A;  4ILF A;  1M1X B;  1RN1 A;  1T5Y A;  3RNT A;  3CCS 3;  2ML5 A;  2K54 A;  1BNI A;  3F8X A;  3BU4 A;  3I0Y A;  5IG3 A;  1AY7 A;  5CF2 A;  4FR9 A;  4R9K A;  2BU4 A;  3CNM A;  3B4P A;  4FCJ A;  3N8B A;  1RRH A;  4AKY A;  2CFD A;  4GL6 A;  5AEU B;  1SAR A;  1FA3 A;  2MC8 A;  4IT7 A;  5BXQ A;  3BNC A;  1W7C A;  3NXJ A;  3MG2 A;  3WDG B;  1IVW A;  3LXU X;  4AEQ A;  1KSI A;  4STD A;  1HKX A;  1FUT A;  1IYY A;  1Y4K A;  2OTL 3;  1Z1S A;  1SPU A;  7GSP A;  4KT3 B; 
#chains in the Genus database with same CATH homology
 3CXC 2;  1DVD A;  1IT8 A;  3S27 A;  5AIH A;  5CXO A;  3CU3 A;  2CHC A;  3SXX A;  1OH0 A;  3DGL A;  3B8L A;  4N6L A;  1OGZ A;  3PCS A;  3WOF B;  2CH9 A;  3N9H A;  2RFR A;  1Q40 B;  1YIJ 3;  2Y73 A;  5LC7 A;  4ORL A;  3PS8 A;  4LMI A;  1Q42 A;  5IG5 A;  5IEN A;  1ASK A;  3K63 A;  4JRF A;  3NBR A;  3CNX A;  3F14 A;  3HIG A;  1LXE A;  2V1L A;  1N8R 4;  3U1W A;  2A15 A;  3B4O A;  3EN1 B;  4XDV A;  1ULI B;  1CYV A;  2B24 B;  3F7X A;  2W56 A;  4N6U A;  1OF5 A;  3D9R A;  1IQX A;  3LH4 A;  3KE7 A;  2W2C A;  3EBT A;  3FGY A;  1UW1 A;  3NQY A;  1TFK A;  5JBS A;  2WO0 A;  1VQL 3;  1IVX A;  4HM5 B;  3NV0 A;  1VQ4 3;  1VQ9 3;  2UX0 A;  2CC3 A;  4NHF A;  2XGL A;  2YFL B;  4KZ1 A;  3WMD A;  1FGT A;  1FUW A;  3KZT A;  6STD A;  3NX0 A;  5DRV A;  3LOY A;  2GXF A;  1J2B A;  4HM6 B;  1OHS A;  3HX8 A;  5IG0 A;  2CW9 A;  3FCS B;  4MMX B;  2XFS A;  1YJW 3;  2OOV A;  3EB8 A;  1YVB I;  3IMA B;  3G16 A;  3RGA A;  3CCU 3;  2W56 B;  3DM8 A;  3KN4 A;  3AMO A;  1OF5 B;  1STF I;  2BHM A;  4XBY A;  1W00 A;  4OK0 A;  3LTC A;  2W04 A;  1PFP A;  3QRD A;  2IUK A;  5BVB A;  4RNY A;  1TFO A;  2YFJ B;  3NV0 B;  2I9W A;  1O7W B;  3TDG A;  2WOH A;  1FGO A;  3FF2 A;  3EC9 A;  3UB1 A;  3BB9 A;  4LEH A;  5IER A;  3MG1 A;  3Q1C A;  1LVN A;  5AIG A;  1OAC A;  3JUP A;  3DMC A;  3LTB A;  4L8P A;  1VQM 3;  2GBX B;  3NM7 A;  1QVG 2;  1N9J A;  2KXG A;  1K41 A;  1US1 A;  2W9Q A;  1F8N A;  3F9S A;  3E99 A;  2GBW B;  1OHO A;  2ML6 A;  1VQO 3;  2Z77 A;  3AMO B;  2FXT A;  1E97 A;  1S5A A;  3KKG A;  4RBN A;  4J9A A;  3WA2 X;  3DY5 A;  2LYX A;  3I56 3;  4N6T A;  1E3V A;  2ZL8 A;  2BO9 B;  2OQE A;  3O8Y A;  3OXA A;  1NJI 4;  1W4N A;  3FH1 A;  3HI7 A;  3MYT A;  3SX1 A;  1OHP A;  4HM3 B;  4X2O A;  2XRX B;  1EA2 A;  1N9E A;  2IA7 A;  1M9G A;  1JN5 A;  1NO3 A;  1D6Z A;  2FNQ A;  1AVL A;  1JKG A;  1A2K A;  3FG3 A;  3MSO A;  3JUQ A;  3CME 3;  1VQ6 3;  4KFF A;  2BMO B;  1V74 A;  3X41 A;  2CG0 A;  3OV4 A;  2XEP A;  3STD A;  5IEO A;  1QAK A;  5EVH A;  5IW9 A;  3U97 A;  1O7M B;  2F86 B;  3S67 A;  5DRE A;  4FMC A;  2PZV A;  1OUN A;  5I97 A;  1VQK 3;  3L0R A;  2IUJ A;  4U13 A;  1A67 A;  1OGX A;  1STD A;  3DGO A;  3UL5 A;  4BTY A;  1VQ5 3;  3UL6 A;  1K9M 4;  3LTA A;  3SOA A;  3CCV 3;  2Z76 A;  1JN5 B;  1AR0 A;  3CD6 3;  1RRL A;  1U5O A;  4IPB A;  1JKG B;  2M7O A;  2XFT A;  3HII A;  4HZB B;  3CC7 3;  3CCE 3;  1IQ8 A;  1NB5 I;  4FMD A;  4TX4 A;  3JVC A;  1IQY A;  3LTD A;  4EV5 A;  4BTX A;  1FGR A;  2E2U A;  4NRE A;  4PEJ A;  4HM2 B;  3F40 A;  3CPO A;  3FF0 A;  3G8Z A;  2P05 A;  4FMA A;  3G0K A;  3BLZ A;  3LYG A;  3PXM A;  4WWU C;  8CHO A;  3CCJ 3;  1S72 3;  1EQK A;  3N54 B;  5KP1 A;  3F7S A;  4EV2 A;  4L8O A;  1QJG A;  1ROA A;  3ECF A;  3M8C A;  2MF7 A;  3HZP A;  5STD A;  1SII A;  2STD A;  1W6Y A;  3OWY A;  4FCM A;  5IEP A;  1WQL B;  3IPT A;  1CEW I;  3CPW 2;  2YX9 A;  5IG4 A;  1ULJ B;  4XBX A;  4XBT A;  5EEO A;  2XH9 A;  1RKY A;  1QAF A;  1G96 A;  3S5C A;  3EJV A;  2HMN B;  2P09 A;  4HBR A;  1CQS A;  3DGN A;  3OW2 2;  3EHC A;  3QK9 A;  4O2H A;  3F8H A;  3KSE D;  1DMM A;  2GEX A;  1E3R A;  4ZM8 A;  1O7G B;  1WTH A;  4CCV A;  3SOY A;  5D83 A;  3NHX A;  5ELJ A;  5EQL A;  1K8A 4;  4K1V A;  4K61 A;  2L4V A;  3V92 A;  1AV4 A;  2RSX A;  4R1K A;  5AI1 A;  3FKA A;  2RGQ A;  4FCZ A;  1TU5 A;  2JQ5 A;  5AIF A;  3JUO A;  4H61 A;  3ER7 A;  4KVH A;  1L5G B;  1EG9 B;  4K90 B;  1OPY A;  3PZW A;  3X3X A;  1JV2 B;  4WFO A;  3FG1 A;  1JB5 A;  2HMK B;  3NQZ A;  2R4I A;  4R9L A;  5JPU A;  3CCQ 3;  1Q81 4;  1IV7 A;  2PNC A;  1RN7 A;  3ALA A;  5FW5 A;  2GEY A;  4R80 A;  2BT3 A;  3WOE B;  3LT9 A;  4XDW A;  4H3U A;  4EYC A;  2XSH B;  1AVK A;  4X2H A;  1WMP A;  1IT7 A;  1K73 4;  3GWR A;  3JUM A;  5FGO A;  4HM1 B;  5A0O B;  1JB2 A;  3K9M C;  3I55 3;  1W6G A;  5AEW B;  5D82 A;  2QA4 3;  2INX A;  4FMB A;  5D81 A;  3GZR A;  2XSO B;  3LML A;  3EBY A;  1JJ2 2;  2OOV C;  4MMZ B;  3X3Y A;  1W2B 2;  3Q2P A;  4MEI A;  2JDI H;  4RZM A;  2W6J H;  3D3L A;  4N6V 0;  1QMA A;  5TGN A;  4WYK A;  3OWU A;  2E2T A;  3G71 3;  3CCM 3;  1M1K 4;  3BNB A;  2Q07 A;  1W5Z A;  3GZX B;  2WGQ A;  2WOF A;  1YJ9 3;  1R4C A;  3S29 A;  3CCR 3;  1GY5 A;  5CLK A;  4HM8 B;  2HMJ B;  1JB4 A;  5CK6 A;  1U8C B;  3V98 A;  1FGQ A;  3UNL A;  2CWU A;  3X42 A;  2D1W A;  1D6Y A;  1GYB A;  1KQS 2;  2HML B;  2LQV A;  3X40 A;  4HVN A;  3DZL A;  1A2V A;  1W02 A;  1YGE A;  4N6O B;  3WA3 A;  4N6N B;  3NM2 A;  4OVM A;  2OTJ 3;  1MNL A;  1W6C A;  1IK3 A;  3K0Z A;  3FLJ A;  3K5T A;  2SBL A;  3T0U A;  4EXR A;  2QGU A;  1SJW A;  3Q90 A;  4HM4 B;  1YHQ 3;  1W2Z A;  3LT8 A;  1TIJ A;  4IIA A;  4KFE A;  1JNQ A;  4WP5 A;  4HZ9 B;  1ZX2 A;  2CK3 H;  3BND A;  1TUH A;  2RCD A;  5HGR A;  1HU9 A;  1O7N B;  3PYJ A;  2CWT A;  1NB3 I;  4HM7 B;  1K28 A;  3JUN A;  2GU1 A;  1Q40 A;  3EX9 A;  7STD A;  2BMR B;  3PCR A;  2CG1 A;  1JRQ A;  2QIY A;  2CFW A;  1N5H A;  2CFK A;  2GU3 A;  1GD3 A;  1Q86 4;  5KP4 A;  1VQP 3;  3B7C A;  5AYR B;  1VQ8 3;  2QEX 3;  4O02 B;  4RNZ A;  3KII A;  1GY7 A;  2YFI B;  5LC6 A;  5KP3 A;  3FZW A;  1YI2 3;  3T8N A;  4OUQ A;  2KCD A;  3UJM A;  4BTW A;  3H3H A;  1WMN A;  3VF1 A;  3GAX A;  2XR8 B;  1Q82 4;  4EC6 A;  4LZI A;  5CF1 A;  1N5P A;  3GZB A;  4R4K A;  1TP6 A;  3NUV A;  3HK4 A;  3CCL 3;  3LZA A;  1DMQ A;  3MG3 A;  1BUQ A;  2Z6B A;  2IMJ A;  5AYS C;  2C11 A;  4J8T A;  2KRT A;  1VZZ A;  3T8U A;  1QAL A;  3DGM A;  5G2G A;  1M90 4;  4O3V A;  4HM0 B;  2P38 A;  4EBG A;  1RJO A;  4LGQ A;  1YIT 3;  4MJD A;  3MHE A;  1ROV A;  1PU4 A;  1VQ7 3;  2E2V A;  1Q7Y 4;  1WMO A;  3OX9 A;  3CC4 3;  4HYZ A;  3MPH A;  1IU7 A;  1KC8 4;  3MKI A;  1LNH A;  2Y74 A;  2OWP A;  1IV9 A;  3SED A;  1ZO2 A;  2C10 A;  1O7H B;  3IJE B;  1KWI A;  1UI8 A;  1NDO B;  1SQW A;  2B1X B;  3X3Z A;  1IVU A;  2CWV A;  3PGB A;  2HMO B;  4KFD A;  3CMA 3;  1ISK A;  2XF3 A;  3FSD A;  3DXO A;  1OCV A;  2W9P A;  3NBJ A;  1NU3 A;  4MMY B;  1O7P B;  2HMM B;  4AKZ A;  3EN8 A;  2ZDJ A;  2O3O A;  5AII A;  5JPP A;  5ELU A;  1DYU A;  1WNH A;  1C7H A;  3CC2 3;  3FG4 A;  2O9U X;  1GY6 A;  3A76 A;  3MWZ A;  2D42 A;  1EKM A;  2BMQ B;  2XGN A;  1FGM A;  1CYU A;  4I4K A;  3SVA A;  3G4S 3;  1MOL A;  3OWS A;  3KFQ C;  1GD4 A;  4CDL A;  3DUK A;  3RDE A;  1DVC A;  1N8Q A;  3GZY B;  2BNG A;  1UUV B;  1IVV A;  2Z7A A;  4L7K A;  4O8S A;  3WOD G;  4QWT A;  1KD1 4;  3EE1 A;  4WHA A;  2P0X A;  2W03 A;  1VQN 3;  1GS3 A;  2CIU A;  1NWW A;  3K7C A;  4JF8 A;  3H51 A;  4HKV B;  3RGR A;  4N6M A;  3S28 A;  3NBB A;  1YJN 3;  2F98 A;  2F99 A;  5IF6 A;  2W0Q A;  2OCT A;  4XB5 A;  1LOX A;  3BNE A;  3KSP A;  4HJL B;  1D6U A;  4WYK B;  2CKF B;  4Q53 A;  1W01 A;  2FGT A;  2P0M A;  1DMN A;  3VGN A;  2WGO A;  4GB5 A;  4XM4 A;  3SLU A;  3EQQ B;  3J7Y d;  4N3V A;  4K1U A;  3V99 A;  1SIH A;  4LSO A;  1QVF 2;  2OQE C;  3GRD A;  3G6E 3;  4G1M B;  2CFG A;  1IDP A;  3ROB A;  3VSY A;  2K0M A;  1UUW B;  1UI7 A;  2CFL A;  3EF8 A;  1A90 A;  1M1X B;  1T5Y A;  3CCS 3;  2ML5 A;  2K54 A;  3F8X A;  3I0Y A;  5IG3 A;  5CF2 A;  4FR9 A;  4R9K A;  3CNM A;  3B4P A;  4FCJ A;  3N8B A;  1RRH A;  4AKY A;  2CFD A;  4GL6 A;  5AEU B;  1FA3 A;  2MC8 A;  4IT7 A;  5BXQ A;  3BNC A;  1W7C A;  3NXJ A;  3MG2 A;  3WDG B;  1IVW A;  3LXU X;  4AEQ A;  1KSI A;  4STD A;  1HKX A;  1Y4K A;  2OTL 3;  1Z1S A;  1SPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...