1GD3A

Refined solution structure of human cystatin a
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
b'MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
molecule tags Protein binding
source organism Homo sapiens
publication title Structural comparison between wild-type and P25S human cystatin A by NMR spectroscopy. Does this mutation affect the a-helix conformation ?
pubmed doi rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1gd3A00
5ELUA 1IV7A 1MOLA 1STFI 2OCTA 1FUWA 4N6LA 3IMAB 1TIJA 3KFQC 4EYCA 1R4CA 1A67A 3NX0A 1DVDA 3GAXA 5A0OB 4TX4A 1GD4A 1M9GA 1CYVA 1N5PA 2W9QA 3QRDA 1PFPA 3LH4A 4LZIA 4N6TA 2W9PA 3KSED 3Q2PA 5LC7A 1NB3I 2O9UX 3K9MC 5LC6A 4N6NB 3S67A 3UL5A 1CEWI 5EQLA 3UL6A 3L0RA 1N5HA 4N6MA 1FA3A 1YVBI 1IV9A 1KWIA 2CH9A 4N6V0 1A90A 3PYJA 3MWZA 1WNHA 1DVCA 4N6OB 4N6UA 4CCVA 1EQKA 1CYUA 1RN7A 3PXMA 1GD3A 1ROAA 3SVAA 4IT7A 1LXEA 2BO9B 1MNLA 3PS8A 2KXGA 5ELJA 4ZM8A 1N9JA 1G96A 1NB5I
chains in the Genus database with same CATH superfamily
3CCR3 2HMLB 1O7WB 1X1WA 3FGYA 3UNLA 1VZZA 3KKGA 2F86B 1IK3A 1DMNA 1FUWA 1KSIA 4EXRA 3M8CA 5DREA 1RGEA 1MGRA 4J8TA 1D6ZA 3B8LA 5BXQA 1CYVA 1Z1SA 3LTDA 1YIJ3 1WMOA 4N6TA 2W9PA 3KSED 1ZS7A 1OCVA 3EN8A 3CC43 1T2IA 2CG1A 2F99A 3UL6A 4XM4A 1B2SA 6RNTA 1B2XA 3EB8A 1DMMA 1UGIA 1BNSA 1UCJA 4NPBA 4NREA 1RGKA 3EF8A 2H0IA 4HZBB 4XDVA 2CFDA 4ORLA 2CFKA 1IT7A 4KVHA 3DXOA 1O7PB 4XBXA 3EN1B 3HOHA 1EEJA 4FMCA 3TDGA 4J5KA 1UUVB 1WMPA 1T2HA 1Q40B 4Q53A 2O3OA 5AIHA 5FGOA 1QJGA 1I2GA 2XSHB 2W04A 2OTL3 1I0VA 5G1KA 3DGNA 2CG0A 1ULIB 2KF4A 4H61A 1GMPA 1V58A 5LC6A 3V98A 4HOHA 2L4VA 1NNVA 3DUKA 1PYLA 3PGBA 4RNYA 1YVBI 3LT9A 3SOYA 4J5GA 1KD14 1LOWA 4X2OA 5D83A 1JRQA 3MYTA 5I97A 4N3VA 1EG9B 3NQZA 1K8A4 2XH9A 1BNFA 1OPYA 4HM8B 1RN1A 1YJ93 1OHSA 3E99A 1G96A 1RGHA 5CF1A 5IERA 2WO0A 1MOLA 1STFI 1MGWA 1RTUA 1IYYA 1BVIA 3LTCA 1A67A 3WR2A 1ZO2A 1E3VA 3STDA 2BNGA 4BTXA 4MMZB 1TRQA 2QA43 2Z76A 3RDEA 1ROVA 2ML6A 3LMLA 4GHOA 4LYLB 3BNDA 1A90A 4MEIA 1TP6A 1O7MB 2CFGA 3X3YA 1DYUA 1RCKA 3B4OA 2L1SA 1B21A 3GZXB 1BANA 3FH1A 3LTBA 1PU4A 1VQK3 3NV0B 3J7Yd 2FXTA 2P09A 1OF5B 2KF6A 1U5OA 4WYKA 1GY7A 5IG4A 3S28A 4WFOA 2HMOB 4J9AA 2OWPA 5M1AA 1BNIA 1FGMA 3EC9A 3PZWA 3URPA 5CF2A 3I0YA 1VQN3 2Z77A 2RCDA 3BNEA 3OWSA 2C11A 4EV5A 1Q864 2UUGC 4RNZA 1BRGA 4FCZA 4OK0A 1BAOA 1K734 1STDA 1VQP3 1RDSA 4HZ9B 1BRKA 3NUVA 1MWRA 4XDWA 2F4YA 1T3BA 1TFKA 5GSPA 4EV2A 5EVHA 2C10A 5AEUB 2INXA 1JV2B 2ML5A 4H3UA 1YVSA 5AYSC 2LYXA 2QIYA 1FGOA 1GOVA 3D5GA 1BNGA 2CX0A 1N8R4 4JF8A 4K90B 1QVG2 1RGCA 3GSPA 2FNQA 1TJDA 2SBLA 4FMBA 5IG3A 2HMNB 2CHCA 4IIAA 5IG0A 3IMAB 1TIJA 1Q7HA 3OW22 1M904 3BU4A 3CNXA 1B20A 3X41A 2XR8B 2KCDA 4HM7B 1UCKA 4R4KA 4TX4A 1U8CB 3LH4A 3N54B 1FA3A 1YHQ3 4FCMA 2ZL8A 4BL2A 5AI1A 1SIIA 2XFTA 3WODG 1ISKA 1UI8A 4WWUC 2BIRA 1RGGA 1TTOA 5KP3A 1W5ZA 1GY6A 1ZX2A 2PNCA 1GMQA 2BMOB 3B7CA 1ROAA 1SJWA 1MWTA 2GBXB 3T8UA 5BVBA 1M1XB 1VQQA 4GL6A 3ER7A 4K1UA 3G6E3 4R9KA 3LXUX 1B3SA 5ELUA 3NBJA 3RGAA 2YFIB 3MG2A 1B2ZA 1BSEA 2F98A 3U1WA 1V57A 1RJOA 1OH0A 1W00A 3AHWA 2CFWA 3ALAA 3HIGA 4WP5A 2Q07A 4OVMA 1E3RA 3MKIA 1JZDA 5IF6A 3WDGB 3BNCA 3X42A 1JBSA 4N6MA 1Q824 1LOYA 5HOHA 3G8ZA 3NV0A 2R41A 2W56B 3V92A 1I2EA 3H51A 2IMJA 3PCSA 3SEDA 1FZUA 3VSYA 4CCVA 2P38A 2XEPA 4LEHA 1W6YA 3RGRA 3SYUA 2CIUA 3MHEA 3ECFA 4HAAA 3CME3 5AIFA 2XGLA 1R4YA 3FG4A 3FZWA 1Q9EA 4ZM8A 1GS3A 3FKAA 1X1XA 4GB5A 2FGTA 2PZVA 4MJDA 4X2HA 4KFFA 2KRTA 3CCS3 2IYJA 2KAAA 1FUTA 4BL3A 5A0OB 3F14A 1JKGB 1W02A 1O7HB 5KP4A 3WOFB 3JUQA 1SIHA 3K9MC 2J8XB 3VF1A 1QMAA 3WOEB 2F56A 4RBNA 1BGSA 4EBGA 1N5HA 1HU9A 2CW9A 1IV9A 5DRVA 3WA2X 3JUOA 5D81A 1S723 2GU1A 3WHOA 1QAKA 5D82A 3GZYB 5G1LA 4ILFA 1RN7A 1AVLA 2HOHA 3F40A 3IJEB 1N9EA 3JUPA 4R9LA 7GSPA 2B1XB 3NBRA 3LOYA 5AIIA 1WMNA 2HMKB 3FCSB 2HMMB 1I70A 2BMRB 2YX9A 4GSPA 1YNVX 3CCU3 5CK6A 2OQEA 3BLZA 4K1VA 1Q7Y4 2ZA4A 1DVDA 2Z7AA 3OXAA 5AEWB 1RLSA 1D6UA 3HI7A 4FCJA 3DY5A 3BB9A 3S29A 2E2VA 1FGRA 3QRDA 4HM4B 3Q2PA 4R80A 3CMA3 1UCIA 4KFDA 1LNHA 3SX1A 1BRHA 1KWIA 1Q42A 2XF3A 3MG3A 1JN5B 1ZGXA 2WGOA 3PYJA 4AKYA 2R4IA 3CPOA 1X1UA 4N6UA 4QWTA 2W6JH 5CLKA 1GOUA 3SVAA 1GD3A 1RGAA 5IG5A 4HYZA 1FW7A 3QK9A 3T8NA 3PS8A 2P05A 5JPPA 8RNTA 1CH0A 3BNBA 2KXGA 3V99A 2XSOB 3DGYA 1JB4A 2AAEA 4LSOA 4LGQA 2Y74A 1UDII 1UW1A 3FF0A 1LOVA 1B2UA 4L7KA 3GRDA 2MF7A 2I9WA 1UCLA 1EUIC 4STDA 1N5PA 3RNTA 4LZIA 1RNBA 1YJW3 3UL5A 1S5AA 4O2HA 4DKIA 1VQ93 2D1WA 2RNTA 3EBYA 3FSDA 5IW9A 1BRNL 3K5TA 1MWSA 1UUWB 3WA3A 1L5GB 2IUKA 1OF5A 7STDA 3MWZA 1VQ53 1IQYA 1BNJA 1EQKA 3S5CA 2M7OA 3VGNA 1FGTA 1DE3A 1JN5A 2F5MA 4IT7A 1US1A 3I563 5HGRA 1OHOA 3DM8A 3KIIA 3HIIA 2GBWB 3CCJ3 3OV4A 1NB5I 2W0QA 5G2GA 1BSBA 1OUNA 1SARA 3HK4A 3G4S3 3EHCA 1BUJA 1ULJB 1FUSA 1OHPA 1RCLA 3GAXA 2XGNA 2OTJ3 9RNTA 1RNTA 1GD4A 2YFJB 4KFEA 3Q3FA 2WOHA 2CX1A 5RNTA 1O7NB 3F7XA 3UB1A 1QALA 4MMYB 3G713 4N6NB 4WHAA 5EQLA 3O8YA 2OOVC 4CJNA 4R1KA 5BU4A 1W6GA 3F9SA 5KP1A 1VQ43 2A15A 1GY5A 1IQXA 1I3IA 5EEOA 3WMDA 3H3HA 3HZPA 1VQM3 1LQMB 3A5EA 3NM7A 3GZRA 3HX8A 5STDA 5M19A 1B27A 3MG1A 1BRSA 1UGHI 1IV7A 1N8QA 1PY3A 2GXFA 2JQ5A 2OCTA 1JKGA 1RN4A 2ZDJA 3NBBA 4N6LA 4KT3B 1GYBA 1RGFA 1QAFA 1BSCA 1KC84 2CWTA 3ROBA 2W03A 2MC8A 2E2TA 2IUJA 1W7CA 1FGQA 1LNIA 3CD63 1Y4KA 1LOXA 1VQ63 1Q40A 1K41A 3CCL3 2XFSA 1BSDA 1G0TA 4HM6B 2WOFA 1QVF2 1BNRA 3B4PA 1GOYA 1WTHA 2CWUA 3DZLA 1UUGB 2P0MA 1LRAA 2CWVA 1IDPA 3EE1A 2W56A 1LXEA 1C7HA 4L8PA 2BMQB 2Y73A 1JJ22 4HM3B 3LZAA 1NO3A 1A2PA 1A2VA 1I3FA 1RGLA 4FMDA 2K3DA 1YJN3 2F5WA 4HM1B 2RFRA 1W4NA 2W9QA 1I2FA 3IPTA 1PFPA 4O3VA 1GMRA 1OACA 3JUNA 5JBSA 2ZHXB 2CC3A 3X40A 4HM0B 1BUQA 3S67A 1NWWA 3DH2A 1HYFA 3ZG0A 1CEWI 1RHLA 4NHFA 4BIRA 3L0RA 2W2CA 3GZBA 4EC6A 1YIT3 4N6V0 1YI23 4U13A 2K0MA 1FYSA 3AMOA 1Q814 2WGQA 1CYUA 2QGUA 3Q1CA 4MMXB 3AGOA 3KSPA 3X3ZA 1MNLA 1AQZA 3DGLA 3OWUA 1J2BA 4XBYA 3CXC2 4O8SA 3KZTA 1NU3A 1BOXA 3LYGA 4KZ1A 3NXJA 1JB2A 4I4KA 1IVVA 1JBTA 4L8OA 3KCHA 5IEOA 1GSPA 2QEX3 1X1YA 1BU4A 2AADA 2LQVA 3I553 2JDIH 3CCV3 3KE7A 5TGNA 4AEQA 4RNTA 3ZG5A 2GSPA 1W2B2 1NDOB 3CNMA 1M1K4 1VQO3 4XBTA 2CKFB 1F8NA 3F8HA 4HJLB 1RMSA 1TFOA 4HBRA 2V1LA 4AKZA 1RKYA 2OQEC 2KF5A 3NHXA 1V74A 3F8XA 3FG1A 5BIRA 1LVNA 2CFLA 2BU4A 5ELJA 1B2MA 4EW5A 1IQ8A 2Z6BA 3D4AA 1VQL3 2D42A 2RGQA 1MWUA 4XB5A 4EYCA 2RBIA 4G1MB 3CCM3 3EQQB 3FF2A 4HVNA 4OUQA 4IPBA 1M9GA 3SXXA 4HKVB 1IVWA 1W01A 3Q90A 5LC7A 1BSAA 1BNEA 1NB3I 3GWRA 2GEXA 1DMQA 2C4BA 3OWYA 4JRFA 4LMIA 4WYKB 3CCE3 1DETA 2H0HA 3NM2A 6GSPA 2CH9A 2GU3A 1JBRA 3N9HA 3UJMA 2IA7A 5IENA 1WNHA 1DVCA 2B24B 3MSOA 4N6OB 3F7SA 2OOVA 2E2UA 3PXMA 3CC73 2K54A 1JZOA 1TUHA 1HZ1A 2RSXA 3AHSA 4FMAA 1ASKA 3SOAA 4HM5B 3D9RA 5FW5A 3CPW2 1A2KA 1RRHA 1KQS2 1HKXA 3KFQC 3FLJA 1BRJA 3S27A 1IVXA 1EKMA 2UGIA 2BT3A 1JNQA 3FG3A 3D3LA 3LTAA 1OGZA 3D79A 3CC23 2CK3H 8CHOA 1IVUA 3N8BA 2XRXB 2KF3A 1UI7A 1G02A 1I0XA 4I5QA 5AYRB 2SARA 5M18A 1O7GB 3EX9A 4HM2B 3DGOA 1K9M4 1EA2A 2GEYA 4PEJA 1VQ83 2BO9B 1W6CA 3DGMA 4CDLA 1LQGC 3OX9A 4BTYA 5IEPA 1TRPA 3NQYA 1N9JA 2IY2A 4RZMA 3G0KA 3DMCA 1AY7A 1YGWA 1RRLA 3AGNA 1YGEA 1AR0A 2BHMA 1T5YA 2UX0A 3CU3A 5CXOA 7RNTA 3K0ZA 3JVCA 1VQ73 1CQSA 1R4CA 2HMJB 3K63A 3KN4A 3LT8A 3MPHA 3NX0A 4BTWA 1C54A 5AIGA 3JUMA 1D6YA 3K7CA 1IT8A 4O02B 1NJI4 3CCQ3 3T0UA 1JB5A 3ZFZA 1K28A 1WQLB 6STDA 3PCRA 3BIRA 2P0XA 3A76A 3G16A 1BRIA 3X3XA 1AV4A 1SPUA 3EBTA 3U97A 1E97A 4BU4A 2YFLB 1TU5A 1BIRA 3SLUA 4FR9A 1RSNA 3AMOB 3EJVA 3D5IA 2STDA 5JPUA 1I8VA 1AVKA 1SQWA 1W2ZA 4K61A 2H0GA 1IU7A 1OGXA 2O9UX 4CPKA
chains in the Genus database with same CATH topology
3CCR3 2HMLB 1O7WB 3UNLA 3FGYA 1VZZA 3KKGA 2F86B 1IK3A 1DMNA 1FUWA 1KSIA 4EXRA 3M8CA 5DREA 5BXQA 4J8TA 1D6ZA 3B8LA 1YIJ3 1CYVA 1Z1SA 3LTDA 1WMOA 4N6TA 2W9PA 3KSED 1OCVA 3EN8A 3CC43 2CG1A 2F99A 3UL6A 4XM4A 3EB8A 1DMMA 4NREA 3EF8A 4HZBB 4XDVA 2CFDA 4ORLA 2CFKA 1IT7A 4KVHA 3DXOA 1O7PB 4XBXA 3EN1B 4FMCA 3TDGA 1UUVB 1WMPA 1Q40B 4Q53A 2O3OA 5AIHA 5FGOA 1QJGA 2XSHB 2W04A 2OTL3 3DGNA 2CG0A 1ULIB 4H61A 5LC6A 3V98A 2L4VA 3DUKA 3PGBA 4RNYA 1YVBI 3LT9A 3SOYA 1KD14 4X2OA 5D83A 1JRQA 3MYTA 5I97A 4N3VA 1EG9B 3NQZA 1K8A4 2XH9A 1OPYA 4HM8B 1YJ93 1OHSA 3E99A 1G96A 5IERA 2WO0A 1MOLA 1STFI 3LTCA 1A67A 1ZO2A 1E3VA 3STDA 2BNGA 4BTXA 4MMZB 2QA43 2Z76A 3RDEA 1ROVA 2ML6A 3LMLA 3BNDA 1A90A 4MEIA 1TP6A 1O7MB 2CFGA 3X3YA 1DYUA 3B4OA 3GZXB 3FH1A 3LTBA 1PU4A 1VQK3 3NV0B 3J7Yd 2FXTA 2P09A 1OF5B 1U5OA 4WYKA 1GY7A 5IG4A 3S28A 4WFOA 2HMOB 4J9AA 2OWPA 3PZWA 1FGMA 3EC9A 5CF2A 1VQN3 3I0YA 2Z77A 2RCDA 3BNEA 3OWSA 2C11A 4EV5A 1Q864 4RNZA 4FCZA 4OK0A 1K734 1STDA 1VQP3 4HZ9B 3NUVA 4XDWA 1TFKA 4EV2A 5AEUB 5EVHA 2C10A 2INXA 1JV2B 2ML5A 4H3UA 5AYSC 2LYXA 2QIYA 1FGOA 1N8R4 4JF8A 4K90B 1QVG2 2FNQA 2SBLA 4FMBA 5IG3A 2HMNB 2CHCA 4IIAA 5IG0A 3IMAB 1TIJA 3OW22 1M904 3CNXA 3X41A 2XR8B 2KCDA 4HM7B 4R4KA 4TX4A 1U8CB 3LH4A 3N54B 1FA3A 1YHQ3 4FCMA 2ZL8A 5AI1A 1SIIA 2XFTA 3WODG 1ISKA 1UI8A 4WWUC 5KP3A 1W5ZA 1GY6A 1ZX2A 2PNCA 2BMOB 3B7CA 1ROAA 1SJWA 2GBXB 3T8UA 5BVBA 1M1XB 4GL6A 3ER7A 4K1UA 3G6E3 4R9KA 3LXUX 5ELUA 3NBJA 3RGAA 2YFIB 3MG2A 2F98A 3U1WA 1W00A 1RJOA 1OH0A 2CFWA 3ALAA 3HIGA 4WP5A 2Q07A 4OVMA 1E3RA 3MKIA 5IF6A 3X42A 3BNCA 4N6MA 1Q824 3G8ZA 3NV0A 2W56B 3V92A 3H51A 2IMJA 3PCSA 3SEDA 4CCVA 3VSYA 2P38A 2XEPA 4LEHA 1W6YA 3RGRA 2CIUA 3MHEA 3ECFA 3CME3 5AIFA 2XGLA 3FG4A 3FZWA 4ZM8A 1GS3A 3FKAA 4GB5A 2PZVA 2FGTA 4MJDA 4X2HA 4KFFA 2KRTA 3CCS3 5A0OB 3F14A 1JKGB 1W02A 1O7HB 5KP4A 3WOFB 3JUQA 1SIHA 3K9MC 3VF1A 1QMAA 3WOEB 4RBNA 4EBGA 1N5HA 1HU9A 2CW9A 1IV9A 5DRVA 3WA2X 3JUOA 5D81A 1S723 2GU1A 1QAKA 5D82A 3GZYB 1RN7A 1AVLA 3F40A 3IJEB 1N9EA 3JUPA 4R9LA 2B1XB 3NBRA 3LOYA 5AIIA 1WMNA 2HMKB 3FCSB 2HMMB 2BMRB 2YX9A 3CCU3 5CK6A 2OQEA 3BLZA 4K1VA 1Q7Y4 1DVDA 2Z7AA 3OXAA 5AEWB 1D6UA 3HI7A 4FCJA 3DY5A 3BB9A 3S29A 2E2VA 1FGRA 3QRDA 4HM4B 3Q2PA 4R80A 3CMA3 4KFDA 1LNHA 3SX1A 1KWIA 1Q42A 2XF3A 3MG3A 1JN5B 2WGOA 3PYJA 4AKYA 3CPOA 2R4IA 4N6UA 4QWTA 5CLKA 2W6JH 3SVAA 1GD3A 5IG5A 4HYZA 3QK9A 3T8NA 3PS8A 2P05A 5JPPA 3V99A 3BNBA 2KXGA 2XSOB 1JB4A 4LSOA 4LGQA 2Y74A 1UW1A 3FF0A 3GRDA 2MF7A 2I9WA 4STDA 1N5PA 4LZIA 1YJW3 3UL5A 1S5AA 4O2HA 1VQ93 2D1WA 3EBYA 3FSDA 5IW9A 3K5TA 1UUWB 3WA3A 1L5GB 2IUKA 1OF5A 7STDA 3MWZA 1VQ53 1IQYA 1EQKA 3S5CA 2M7OA 1FGTA 1JN5A 4IT7A 1US1A 3I563 5HGRA 1OHOA 3DM8A 3KIIA 3HIIA 2GBWB 3CCJ3 3OV4A 1NB5I 2W0QA 5G2GA 1OUNA 3HK4A 3G4S3 3EHCA 1ULJB 1OHPA 3GAXA 2OTJ3 2XGNA 1GD4A 2YFJB 4KFEA 2WOHA 1O7NB 3F7XA 3UB1A 1QALA 4MMYB 3G713 4N6NB 4WHAA 5EQLA 3O8YA 2OOVC 4R1KA 1W6GA 3F9SA 5KP1A 1VQ43 2A15A 1GY5A 1IQXA 5EEOA 3WMDA 3H3HA 3HZPA 1VQM3 3NM7A 3GZRA 3HX8A 5STDA 3MG1A 3LZAA 5CF1A 2OCTA 1IV7A 1N8QA 2GXFA 2JQ5A 2ZDJA 1JKGA 3NXJA 3NBBA 4N6LA 1GYBA 1QAFA 1KC84 2CWTA 3ROBA 2W03A 2MC8A 2E2TA 2IUJA 1W7CA 1FGQA 3CD63 1Y4KA 1LOXA 1VQ63 1Q40A 1K41A 3CCL3 2XFSA 4HM6B 2WOFA 1QVF2 3B4PA 1WTHA 2CWUA 3DZLA 2P0MA 2CWVA 1IDPA 3EE1A 2W56A 1LXEA 1C7HA 4L8PA 2BMQB 2Y73A 1JJ22 4HM3B 1NO3A 1A2VA 4FMDA 1YJN3 4HM1B 2RFRA 1W4NA 2W9QA 3IPTA 4O3VA 1PFPA 5JBSA 1OACA 3JUNA 3X40A 2CC3A 1BUQA 4HM0B 3S67A 1NWWA 1CEWI 4NHFA 1YIT3 3L0RA 2W2CA 3GZBA 4EC6A 4N6V0 1YI23 4U13A 3AMOA 2K0MA 2WGQA 1CYUA 2QGUA 3Q1CA 4MMXB 3KSPA 3X3ZA 1MNLA 3DGLA 3OWUA 1J2BA 4XBYA 3CXC2 4O8SA 3KZTA 1NU3A 3LYGA 4KZ1A 1JB2A 4I4KA 1IVVA 4L8OA 5IEOA 2QEX3 2LQVA 3I553 2JDIH 3CCV3 3KE7A 5TGNA 4AEQA 1W2B2 1NDOB 3CNMA 1M1K4 1VQO3 4XBTA 2CKFB 1F8NA 3F8HA 4HJLB 1TFOA 4HBRA 2V1LA 4AKZA 1RKYA 2OQEC 3NHXA 1V74A 3F8XA 3FG1A 1LVNA 2CFLA 5ELJA 1IQ8A 2Z6BA 1VQL3 2D42A 2RGQA 4EYCA 4XB5A 3CCM3 4G1MB 3EQQB 3FF2A 4HVNA 4OUQA 4IPBA 1M9GA 3SXXA 4HKVB 1IVWA 1W01A 3Q90A 5LC7A 1NB3I 3GWRA 4JRFA 3OWYA 2GEXA 1DMQA 3WDGB 4LMIA 4WYKB 3CCE3 3NM2A 2CH9A 2GU3A 3N9HA 3UJMA 2IA7A 5IENA 1WNHA 1DVCA 2B24B 3MSOA 4N6OB 3F7SA 2OOVA 2E2UA 3PXMA 3CC73 2K54A 1TUHA 2RSXA 4FMAA 1ASKA 3SOAA 4HM5B 3D9RA 5FW5A 3CPW2 1A2KA 1RRHA 1KQS2 1HKXA 3KFQC 3FLJA 3S27A 1IVXA 1EKMA 2BT3A 1JNQA 3FG3A 3D3LA 3LTAA 1OGZA 3CC23 2CK3H 8CHOA 1IVUA 3N8BA 2XRXB 1UI7A 5AYRB 1O7GB 3EX9A 4HM2B 3DGOA 1K9M4 1EA2A 2GEYA 4PEJA 1VQ83 2BO9B 1W6CA 3DGMA 4CDLA 3OX9A 4BTYA 5IEPA 3NQYA 1N9JA 4RZMA 5CXOA 3G0KA 3DMCA 4L7KA 1RRLA 3CU3A 1YGEA 1AR0A 2BHMA 1T5YA 2UX0A 1VQ73 3K0ZA 3JVCA 1Q814 1CQSA 1R4CA 2HMJB 3K63A 3KN4A 3LT8A 3MPHA 3NX0A 4BTWA 5AIGA 3JUMA 1D6YA 3K7CA 1IT8A 4O02B 1NJI4 3CCQ3 3T0UA 1JB5A 1K28A 1WQLB 6STDA 3PCRA 2P0XA 3A76A 3G16A 3X3XA 3EBTA 1AV4A 1SPUA 3U97A 1E97A 2YFLB 1TU5A 3SLUA 4FR9A 3AMOB 3EJVA 2STDA 5JPUA 1SQWA 1AVKA 1W2ZA 4K61A 3VGNA 1IU7A 1OGXA 2O9UX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELU A;  1IV7 A;  1MOL A;  1STF I;  2OCT A;  1FUW A;  4N6L A;  3IMA B;  1TIJ A;  3KFQ C;  4EYC A;  1R4C A;  1A67 A;  3NX0 A;  1DVD A;  3GAX A;  5A0O B;  4TX4 A;  1GD4 A;  1M9G A;  1CYV A;  1N5P A;  2W9Q A;  3QRD A;  1PFP A;  3LH4 A;  4LZI A;  4N6T A;  2W9P A;  3KSE D;  3Q2P A;  5LC7 A;  1NB3 I;  2O9U X;  3K9M C;  5LC6 A;  4N6N B;  3S67 A;  3UL5 A;  1CEW I;  5EQL A;  3UL6 A;  3L0R A;  1N5H A;  4N6M A;  1FA3 A;  1YVB I;  1IV9 A;  1KWI A;  2CH9 A;  4N6V 0;  1A90 A;  3PYJ A;  3MWZ A;  1WNH A;  1DVC A;  4N6O B;  4N6U A;  4CCV A;  1EQK A;  1CYU A;  1RN7 A;  3PXM A;  1GD3 A;  1ROA A;  3SVA A;  4IT7 A;  1LXE A;  2BO9 B;  1MNL A;  3PS8 A;  2KXG A;  5ELJ A;  4ZM8 A;  1N9J A;  1G96 A;  1NB5 I; 
#chains in the Genus database with same CATH topology
 3CCR 3;  2HML B;  1O7W B;  1X1W A;  3FGY A;  3UNL A;  1VZZ A;  3KKG A;  2F86 B;  1IK3 A;  1DMN A;  1FUW A;  1KSI A;  4EXR A;  3M8C A;  5DRE A;  1RGE A;  1MGR A;  4J8T A;  1D6Z A;  3B8L A;  5BXQ A;  1CYV A;  1Z1S A;  3LTD A;  1YIJ 3;  1WMO A;  4N6T A;  2W9P A;  3KSE D;  1ZS7 A;  1OCV A;  3EN8 A;  3CC4 3;  1T2I A;  2CG1 A;  2F99 A;  3UL6 A;  4XM4 A;  1B2S A;  6RNT A;  1B2X A;  3EB8 A;  1DMM A;  1UGI A;  1BNS A;  1UCJ A;  4NPB A;  4NRE A;  1RGK A;  3EF8 A;  2H0I A;  4HZB B;  4XDV A;  2CFD A;  4ORL A;  2CFK A;  1IT7 A;  4KVH A;  3DXO A;  1O7P B;  4XBX A;  3EN1 B;  3HOH A;  1EEJ A;  4FMC A;  3TDG A;  4J5K A;  1UUV B;  1WMP A;  1T2H A;  1Q40 B;  4Q53 A;  2O3O A;  5AIH A;  5FGO A;  1QJG A;  1I2G A;  2XSH B;  2W04 A;  2OTL 3;  1I0V A;  5G1K A;  3DGN A;  2CG0 A;  1ULI B;  2KF4 A;  4H61 A;  1GMP A;  1V58 A;  5LC6 A;  3V98 A;  4HOH A;  2L4V A;  1NNV A;  3DUK A;  1PYL A;  3PGB A;  4RNY A;  1YVB I;  3LT9 A;  3SOY A;  4J5G A;  1KD1 4;  1LOW A;  4X2O A;  5D83 A;  1JRQ A;  3MYT A;  5I97 A;  4N3V A;  1EG9 B;  3NQZ A;  1K8A 4;  2XH9 A;  1BNF A;  1OPY A;  4HM8 B;  1RN1 A;  1YJ9 3;  1OHS A;  3E99 A;  1G96 A;  1RGH A;  5CF1 A;  5IER A;  2WO0 A;  1MOL A;  1STF I;  1MGW A;  1RTU A;  1IYY A;  1BVI A;  3LTC A;  1A67 A;  3WR2 A;  1ZO2 A;  1E3V A;  3STD A;  2BNG A;  4BTX A;  4MMZ B;  1TRQ A;  2QA4 3;  2Z76 A;  3RDE A;  1ROV A;  2ML6 A;  3LML A;  4GHO A;  4LYL B;  3BND A;  1A90 A;  4MEI A;  1TP6 A;  1O7M B;  2CFG A;  3X3Y A;  1DYU A;  1RCK A;  3B4O A;  2L1S A;  1B21 A;  3GZX B;  1BAN A;  3FH1 A;  3LTB A;  1PU4 A;  1VQK 3;  3NV0 B;  3J7Y d;  2FXT A;  2P09 A;  1OF5 B;  2KF6 A;  1U5O A;  4WYK A;  1GY7 A;  5IG4 A;  3S28 A;  4WFO A;  2HMO B;  4J9A A;  2OWP A;  5M1A A;  1BNI A;  1FGM A;  3EC9 A;  3PZW A;  3URP A;  5CF2 A;  3I0Y A;  1VQN 3;  2Z77 A;  2RCD A;  3BNE A;  3OWS A;  2C11 A;  4EV5 A;  1Q86 4;  2UUG C;  4RNZ A;  1BRG A;  4FCZ A;  4OK0 A;  1BAO A;  1K73 4;  1STD A;  1VQP 3;  1RDS A;  4HZ9 B;  1BRK A;  3NUV A;  1MWR A;  4XDW A;  2F4Y A;  1T3B A;  1TFK A;  5GSP A;  4EV2 A;  5EVH A;  2C10 A;  5AEU B;  2INX A;  1JV2 B;  2ML5 A;  4H3U A;  1YVS A;  5AYS C;  2LYX A;  2QIY A;  1FGO A;  1GOV A;  3D5G A;  1BNG A;  2CX0 A;  1N8R 4;  4JF8 A;  4K90 B;  1QVG 2;  1RGC A;  3GSP A;  2FNQ A;  1TJD A;  2SBL A;  4FMB A;  5IG3 A;  2HMN B;  2CHC A;  4IIA A;  5IG0 A;  3IMA B;  1TIJ A;  1Q7H A;  3OW2 2;  1M90 4;  3BU4 A;  3CNX A;  1B20 A;  3X41 A;  2XR8 B;  2KCD A;  4HM7 B;  1UCK A;  4R4K A;  4TX4 A;  1U8C B;  3LH4 A;  3N54 B;  1FA3 A;  1YHQ 3;  4FCM A;  2ZL8 A;  4BL2 A;  5AI1 A;  1SII A;  2XFT A;  3WOD G;  1ISK A;  1UI8 A;  4WWU C;  2BIR A;  1RGG A;  1TTO A;  5KP3 A;  1W5Z A;  1GY6 A;  1ZX2 A;  2PNC A;  1GMQ A;  2BMO B;  3B7C A;  1ROA A;  1SJW A;  1MWT A;  2GBX B;  3T8U A;  5BVB A;  1M1X B;  1VQQ A;  4GL6 A;  3ER7 A;  4K1U A;  3G6E 3;  4R9K A;  3LXU X;  1B3S A;  5ELU A;  3NBJ A;  3RGA A;  2YFI B;  3MG2 A;  1B2Z A;  1BSE A;  2F98 A;  3U1W A;  1V57 A;  1RJO A;  1OH0 A;  1W00 A;  3AHW A;  2CFW A;  3ALA A;  3HIG A;  4WP5 A;  2Q07 A;  4OVM A;  1E3R A;  3MKI A;  1JZD A;  5IF6 A;  3WDG B;  3BNC A;  3X42 A;  1JBS A;  4N6M A;  1Q82 4;  1LOY A;  5HOH A;  3G8Z A;  3NV0 A;  2R41 A;  2W56 B;  3V92 A;  1I2E A;  3H51 A;  2IMJ A;  3PCS A;  3SED A;  1FZU A;  3VSY A;  4CCV A;  2P38 A;  2XEP A;  4LEH A;  1W6Y A;  3RGR A;  3SYU A;  2CIU A;  3MHE A;  3ECF A;  4HAA A;  3CME 3;  5AIF A;  2XGL A;  1R4Y A;  3FG4 A;  3FZW A;  1Q9E A;  4ZM8 A;  1GS3 A;  3FKA A;  1X1X A;  4GB5 A;  2FGT A;  2PZV A;  4MJD A;  4X2H A;  4KFF A;  2KRT A;  3CCS 3;  2IYJ A;  2KAA A;  1FUT A;  4BL3 A;  5A0O B;  3F14 A;  1JKG B;  1W02 A;  1O7H B;  5KP4 A;  3WOF B;  3JUQ A;  1SIH A;  3K9M C;  2J8X B;  3VF1 A;  1QMA A;  3WOE B;  2F56 A;  4RBN A;  1BGS A;  4EBG A;  1N5H A;  1HU9 A;  2CW9 A;  1IV9 A;  5DRV A;  3WA2 X;  3JUO A;  5D81 A;  1S72 3;  2GU1 A;  3WHO A;  1QAK A;  5D82 A;  3GZY B;  5G1L A;  4ILF A;  1RN7 A;  1AVL A;  2HOH A;  3F40 A;  3IJE B;  1N9E A;  3JUP A;  4R9L A;  7GSP A;  2B1X B;  3NBR A;  3LOY A;  5AII A;  1WMN A;  2HMK B;  3FCS B;  2HMM B;  1I70 A;  2BMR B;  2YX9 A;  4GSP A;  1YNV X;  3CCU 3;  5CK6 A;  2OQE A;  3BLZ A;  4K1V A;  1Q7Y 4;  2ZA4 A;  1DVD A;  2Z7A A;  3OXA A;  5AEW B;  1RLS A;  1D6U A;  3HI7 A;  4FCJ A;  3DY5 A;  3BB9 A;  3S29 A;  2E2V A;  1FGR A;  3QRD A;  4HM4 B;  3Q2P A;  4R80 A;  3CMA 3;  1UCI A;  4KFD A;  1LNH A;  3SX1 A;  1BRH A;  1KWI A;  1Q42 A;  2XF3 A;  3MG3 A;  1JN5 B;  1ZGX A;  2WGO A;  3PYJ A;  4AKY A;  2R4I A;  3CPO A;  1X1U A;  4N6U A;  4QWT A;  2W6J H;  5CLK A;  1GOU A;  3SVA A;  1GD3 A;  1RGA A;  5IG5 A;  4HYZ A;  1FW7 A;  3QK9 A;  3T8N A;  3PS8 A;  2P05 A;  5JPP A;  8RNT A;  1CH0 A;  3BNB A;  2KXG A;  3V99 A;  2XSO B;  3DGY A;  1JB4 A;  2AAE A;  4LSO A;  4LGQ A;  2Y74 A;  1UDI I;  1UW1 A;  3FF0 A;  1LOV A;  1B2U A;  4L7K A;  3GRD A;  2MF7 A;  2I9W A;  1UCL A;  1EUI C;  4STD A;  1N5P A;  3RNT A;  4LZI A;  1RNB A;  1YJW 3;  3UL5 A;  1S5A A;  4O2H A;  4DKI A;  1VQ9 3;  2D1W A;  2RNT A;  3EBY A;  3FSD A;  5IW9 A;  1BRN L;  3K5T A;  1MWS A;  1UUW B;  3WA3 A;  1L5G B;  2IUK A;  1OF5 A;  7STD A;  3MWZ A;  1VQ5 3;  1IQY A;  1BNJ A;  1EQK A;  3S5C A;  2M7O A;  3VGN A;  1FGT A;  1DE3 A;  1JN5 A;  2F5M A;  4IT7 A;  1US1 A;  3I56 3;  5HGR A;  1OHO A;  3DM8 A;  3KII A;  3HII A;  2GBW B;  3CCJ 3;  3OV4 A;  1NB5 I;  2W0Q A;  5G2G A;  1BSB A;  1OUN A;  1SAR A;  3HK4 A;  3G4S 3;  3EHC A;  1BUJ A;  1ULJ B;  1FUS A;  1OHP A;  1RCL A;  3GAX A;  2XGN A;  2OTJ 3;  9RNT A;  1RNT A;  1GD4 A;  2YFJ B;  4KFE A;  3Q3F A;  2WOH A;  2CX1 A;  5RNT A;  1O7N B;  3F7X A;  3UB1 A;  1QAL A;  4MMY B;  3G71 3;  4N6N B;  4WHA A;  5EQL A;  3O8Y A;  2OOV C;  4CJN A;  4R1K A;  5BU4 A;  1W6G A;  3F9S A;  5KP1 A;  1VQ4 3;  2A15 A;  1GY5 A;  1IQX A;  1I3I A;  5EEO A;  3WMD A;  3H3H A;  3HZP A;  1VQM 3;  1LQM B;  3A5E A;  3NM7 A;  3GZR A;  3HX8 A;  5STD A;  5M19 A;  1B27 A;  3MG1 A;  1BRS A;  1UGH I;  1IV7 A;  1N8Q A;  1PY3 A;  2GXF A;  2JQ5 A;  2OCT A;  1JKG A;  1RN4 A;  2ZDJ A;  3NBB A;  4N6L A;  4KT3 B;  1GYB A;  1RGF A;  1QAF A;  1BSC A;  1KC8 4;  2CWT A;  3ROB A;  2W03 A;  2MC8 A;  2E2T A;  2IUJ A;  1W7C A;  1FGQ A;  1LNI A;  3CD6 3;  1Y4K A;  1LOX A;  1VQ6 3;  1Q40 A;  1K41 A;  3CCL 3;  2XFS A;  1BSD A;  1G0T A;  4HM6 B;  2WOF A;  1QVF 2;  1BNR A;  3B4P A;  1GOY A;  1WTH A;  2CWU A;  3DZL A;  1UUG B;  2P0M A;  1LRA A;  2CWV A;  1IDP A;  3EE1 A;  2W56 A;  1LXE A;  1C7H A;  4L8P A;  2BMQ B;  2Y73 A;  1JJ2 2;  4HM3 B;  3LZA A;  1NO3 A;  1A2P A;  1A2V A;  1I3F A;  1RGL A;  4FMD A;  2K3D A;  1YJN 3;  2F5W A;  4HM1 B;  2RFR A;  1W4N A;  2W9Q A;  1I2F A;  3IPT A;  1PFP A;  4O3V A;  1GMR A;  1OAC A;  3JUN A;  5JBS A;  2ZHX B;  2CC3 A;  3X40 A;  4HM0 B;  1BUQ A;  3S67 A;  1NWW A;  3DH2 A;  1HYF A;  3ZG0 A;  1CEW I;  1RHL A;  4NHF A;  4BIR A;  3L0R A;  2W2C A;  3GZB A;  4EC6 A;  1YIT 3;  4N6V 0;  1YI2 3;  4U13 A;  2K0M A;  1FYS A;  3AMO A;  1Q81 4;  2WGQ A;  1CYU A;  2QGU A;  3Q1C A;  4MMX B;  3AGO A;  3KSP A;  3X3Z A;  1MNL A;  1AQZ A;  3DGL A;  3OWU A;  1J2B A;  4XBY A;  3CXC 2;  4O8S A;  3KZT A;  1NU3 A;  1BOX A;  3LYG A;  4KZ1 A;  3NXJ A;  1JB2 A;  4I4K A;  1IVV A;  1JBT A;  4L8O A;  3KCH A;  5IEO A;  1GSP A;  2QEX 3;  1X1Y A;  1BU4 A;  2AAD A;  2LQV A;  3I55 3;  2JDI H;  3CCV 3;  3KE7 A;  5TGN A;  4AEQ A;  4RNT A;  3ZG5 A;  2GSP A;  1W2B 2;  1NDO B;  3CNM A;  1M1K 4;  1VQO 3;  4XBT A;  2CKF B;  1F8N A;  3F8H A;  4HJL B;  1RMS A;  1TFO A;  4HBR A;  2V1L A;  4AKZ A;  1RKY A;  2OQE C;  2KF5 A;  3NHX A;  1V74 A;  3F8X A;  3FG1 A;  5BIR A;  1LVN A;  2CFL A;  2BU4 A;  5ELJ A;  1B2M A;  4EW5 A;  1IQ8 A;  2Z6B A;  3D4A A;  1VQL 3;  2D42 A;  2RGQ A;  1MWU A;  4XB5 A;  4EYC A;  2RBI A;  4G1M B;  3CCM 3;  3EQQ B;  3FF2 A;  4HVN A;  4OUQ A;  4IPB A;  1M9G A;  3SXX A;  4HKV B;  1IVW A;  1W01 A;  3Q90 A;  5LC7 A;  1BSA A;  1BNE A;  1NB3 I;  3GWR A;  2GEX A;  1DMQ A;  2C4B A;  3OWY A;  4JRF A;  4LMI A;  4WYK B;  3CCE 3;  1DET A;  2H0H A;  3NM2 A;  6GSP A;  2CH9 A;  2GU3 A;  1JBR A;  3N9H A;  3UJM A;  2IA7 A;  5IEN A;  1WNH A;  1DVC A;  2B24 B;  3MSO A;  4N6O B;  3F7S A;  2OOV A;  2E2U A;  3PXM A;  3CC7 3;  2K54 A;  1JZO A;  1TUH A;  1HZ1 A;  2RSX A;  3AHS A;  4FMA A;  1ASK A;  3SOA A;  4HM5 B;  3D9R A;  5FW5 A;  3CPW 2;  1A2K A;  1RRH A;  1KQS 2;  1HKX A;  3KFQ C;  3FLJ A;  1BRJ A;  3S27 A;  1IVX A;  1EKM A;  2UGI A;  2BT3 A;  1JNQ A;  3FG3 A;  3D3L A;  3LTA A;  1OGZ A;  3D79 A;  3CC2 3;  2CK3 H;  8CHO A;  1IVU A;  3N8B A;  2XRX B;  2KF3 A;  1UI7 A;  1G02 A;  1I0X A;  4I5Q A;  5AYR B;  2SAR A;  5M18 A;  1O7G B;  3EX9 A;  4HM2 B;  3DGO A;  1K9M 4;  1EA2 A;  2GEY A;  4PEJ A;  1VQ8 3;  2BO9 B;  1W6C A;  3DGM A;  4CDL A;  1LQG C;  3OX9 A;  4BTY A;  5IEP A;  1TRP A;  3NQY A;  1N9J A;  2IY2 A;  4RZM A;  3G0K A;  3DMC A;  1AY7 A;  1YGW A;  1RRL A;  3AGN A;  1YGE A;  1AR0 A;  2BHM A;  1T5Y A;  2UX0 A;  3CU3 A;  5CXO A;  7RNT A;  3K0Z A;  3JVC A;  1VQ7 3;  1CQS A;  1R4C A;  2HMJ B;  3K63 A;  3KN4 A;  3LT8 A;  3MPH A;  3NX0 A;  4BTW A;  1C54 A;  5AIG A;  3JUM A;  1D6Y A;  3K7C A;  1IT8 A;  4O02 B;  1NJI 4;  3CCQ 3;  3T0U A;  1JB5 A;  3ZFZ A;  1K28 A;  1WQL B;  6STD A;  3PCR A;  3BIR A;  2P0X A;  3A76 A;  3G16 A;  1BRI A;  3X3X A;  1AV4 A;  1SPU A;  3EBT A;  3U97 A;  1E97 A;  4BU4 A;  2YFL B;  1TU5 A;  1BIR A;  3SLU A;  4FR9 A;  1RSN A;  3AMO B;  3EJV A;  3D5I A;  2STD A;  5JPU A;  1I8V A;  1AVK A;  1SQW A;  1W2Z A;  4K61 A;  2H0G A;  1IU7 A;  1OGX A;  2O9U X;  4CPK A; 
#chains in the Genus database with same CATH homology
 3CCR 3;  2HML B;  1O7W B;  3UNL A;  3FGY A;  1VZZ A;  3KKG A;  2F86 B;  1IK3 A;  1DMN A;  1FUW A;  1KSI A;  4EXR A;  3M8C A;  5DRE A;  5BXQ A;  4J8T A;  1D6Z A;  3B8L A;  1YIJ 3;  1CYV A;  1Z1S A;  3LTD A;  1WMO A;  4N6T A;  2W9P A;  3KSE D;  1OCV A;  3EN8 A;  3CC4 3;  2CG1 A;  2F99 A;  3UL6 A;  4XM4 A;  3EB8 A;  1DMM A;  4NRE A;  3EF8 A;  4HZB B;  4XDV A;  2CFD A;  4ORL A;  2CFK A;  1IT7 A;  4KVH A;  3DXO A;  1O7P B;  4XBX A;  3EN1 B;  4FMC A;  3TDG A;  1UUV B;  1WMP A;  1Q40 B;  4Q53 A;  2O3O A;  5AIH A;  5FGO A;  1QJG A;  2XSH B;  2W04 A;  2OTL 3;  3DGN A;  2CG0 A;  1ULI B;  4H61 A;  5LC6 A;  3V98 A;  2L4V A;  3DUK A;  3PGB A;  4RNY A;  1YVB I;  3LT9 A;  3SOY A;  1KD1 4;  4X2O A;  5D83 A;  1JRQ A;  3MYT A;  5I97 A;  4N3V A;  1EG9 B;  3NQZ A;  1K8A 4;  2XH9 A;  1OPY A;  4HM8 B;  1YJ9 3;  1OHS A;  3E99 A;  1G96 A;  5IER A;  2WO0 A;  1MOL A;  1STF I;  3LTC A;  1A67 A;  1ZO2 A;  1E3V A;  3STD A;  2BNG A;  4BTX A;  4MMZ B;  2QA4 3;  2Z76 A;  3RDE A;  1ROV A;  2ML6 A;  3LML A;  3BND A;  1A90 A;  4MEI A;  1TP6 A;  1O7M B;  2CFG A;  3X3Y A;  1DYU A;  3B4O A;  3GZX B;  3FH1 A;  3LTB A;  1PU4 A;  1VQK 3;  3NV0 B;  3J7Y d;  2FXT A;  2P09 A;  1OF5 B;  1U5O A;  4WYK A;  1GY7 A;  5IG4 A;  3S28 A;  4WFO A;  2HMO B;  4J9A A;  2OWP A;  3PZW A;  1FGM A;  3EC9 A;  5CF2 A;  1VQN 3;  3I0Y A;  2Z77 A;  2RCD A;  3BNE A;  3OWS A;  2C11 A;  4EV5 A;  1Q86 4;  4RNZ A;  4FCZ A;  4OK0 A;  1K73 4;  1STD A;  1VQP 3;  4HZ9 B;  3NUV A;  4XDW A;  1TFK A;  4EV2 A;  5AEU B;  5EVH A;  2C10 A;  2INX A;  1JV2 B;  2ML5 A;  4H3U A;  5AYS C;  2LYX A;  2QIY A;  1FGO A;  1N8R 4;  4JF8 A;  4K90 B;  1QVG 2;  2FNQ A;  2SBL A;  4FMB A;  5IG3 A;  2HMN B;  2CHC A;  4IIA A;  5IG0 A;  3IMA B;  1TIJ A;  3OW2 2;  1M90 4;  3CNX A;  3X41 A;  2XR8 B;  2KCD A;  4HM7 B;  4R4K A;  4TX4 A;  1U8C B;  3LH4 A;  3N54 B;  1FA3 A;  1YHQ 3;  4FCM A;  2ZL8 A;  5AI1 A;  1SII A;  2XFT A;  3WOD G;  1ISK A;  1UI8 A;  4WWU C;  5KP3 A;  1W5Z A;  1GY6 A;  1ZX2 A;  2PNC A;  2BMO B;  3B7C A;  1ROA A;  1SJW A;  2GBX B;  3T8U A;  5BVB A;  1M1X B;  4GL6 A;  3ER7 A;  4K1U A;  3G6E 3;  4R9K A;  3LXU X;  5ELU A;  3NBJ A;  3RGA A;  2YFI B;  3MG2 A;  2F98 A;  3U1W A;  1W00 A;  1RJO A;  1OH0 A;  2CFW A;  3ALA A;  3HIG A;  4WP5 A;  2Q07 A;  4OVM A;  1E3R A;  3MKI A;  5IF6 A;  3X42 A;  3BNC A;  4N6M A;  1Q82 4;  3G8Z A;  3NV0 A;  2W56 B;  3V92 A;  3H51 A;  2IMJ A;  3PCS A;  3SED A;  4CCV A;  3VSY A;  2P38 A;  2XEP A;  4LEH A;  1W6Y A;  3RGR A;  2CIU A;  3MHE A;  3ECF A;  3CME 3;  5AIF A;  2XGL A;  3FG4 A;  3FZW A;  4ZM8 A;  1GS3 A;  3FKA A;  4GB5 A;  2PZV A;  2FGT A;  4MJD A;  4X2H A;  4KFF A;  2KRT A;  3CCS 3;  5A0O B;  3F14 A;  1JKG B;  1W02 A;  1O7H B;  5KP4 A;  3WOF B;  3JUQ A;  1SIH A;  3K9M C;  3VF1 A;  1QMA A;  3WOE B;  4RBN A;  4EBG A;  1N5H A;  1HU9 A;  2CW9 A;  1IV9 A;  5DRV A;  3WA2 X;  3JUO A;  5D81 A;  1S72 3;  2GU1 A;  1QAK A;  5D82 A;  3GZY B;  1RN7 A;  1AVL A;  3F40 A;  3IJE B;  1N9E A;  3JUP A;  4R9L A;  2B1X B;  3NBR A;  3LOY A;  5AII A;  1WMN A;  2HMK B;  3FCS B;  2HMM B;  2BMR B;  2YX9 A;  3CCU 3;  5CK6 A;  2OQE A;  3BLZ A;  4K1V A;  1Q7Y 4;  1DVD A;  2Z7A A;  3OXA A;  5AEW B;  1D6U A;  3HI7 A;  4FCJ A;  3DY5 A;  3BB9 A;  3S29 A;  2E2V A;  1FGR A;  3QRD A;  4HM4 B;  3Q2P A;  4R80 A;  3CMA 3;  4KFD A;  1LNH A;  3SX1 A;  1KWI A;  1Q42 A;  2XF3 A;  3MG3 A;  1JN5 B;  2WGO A;  3PYJ A;  4AKY A;  3CPO A;  2R4I A;  4N6U A;  4QWT A;  5CLK A;  2W6J H;  3SVA A;  1GD3 A;  5IG5 A;  4HYZ A;  3QK9 A;  3T8N A;  3PS8 A;  2P05 A;  5JPP A;  3V99 A;  3BNB A;  2KXG A;  2XSO B;  1JB4 A;  4LSO A;  4LGQ A;  2Y74 A;  1UW1 A;  3FF0 A;  3GRD A;  2MF7 A;  2I9W A;  4STD A;  1N5P A;  4LZI A;  1YJW 3;  3UL5 A;  1S5A A;  4O2H A;  1VQ9 3;  2D1W A;  3EBY A;  3FSD A;  5IW9 A;  3K5T A;  1UUW B;  3WA3 A;  1L5G B;  2IUK A;  1OF5 A;  7STD A;  3MWZ A;  1VQ5 3;  1IQY A;  1EQK A;  3S5C A;  2M7O A;  1FGT A;  1JN5 A;  4IT7 A;  1US1 A;  3I56 3;  5HGR A;  1OHO A;  3DM8 A;  3KII A;  3HII A;  2GBW B;  3CCJ 3;  3OV4 A;  1NB5 I;  2W0Q A;  5G2G A;  1OUN A;  3HK4 A;  3G4S 3;  3EHC A;  1ULJ B;  1OHP A;  3GAX A;  2OTJ 3;  2XGN A;  1GD4 A;  2YFJ B;  4KFE A;  2WOH A;  1O7N B;  3F7X A;  3UB1 A;  1QAL A;  4MMY B;  3G71 3;  4N6N B;  4WHA A;  5EQL A;  3O8Y A;  2OOV C;  4R1K A;  1W6G A;  3F9S A;  5KP1 A;  1VQ4 3;  2A15 A;  1GY5 A;  1IQX A;  5EEO A;  3WMD A;  3H3H A;  3HZP A;  1VQM 3;  3NM7 A;  3GZR A;  3HX8 A;  5STD A;  3MG1 A;  3LZA A;  5CF1 A;  2OCT A;  1IV7 A;  1N8Q A;  2GXF A;  2JQ5 A;  2ZDJ A;  1JKG A;  3NXJ A;  3NBB A;  4N6L A;  1GYB A;  1QAF A;  1KC8 4;  2CWT A;  3ROB A;  2W03 A;  2MC8 A;  2E2T A;  2IUJ A;  1W7C A;  1FGQ A;  3CD6 3;  1Y4K A;  1LOX A;  1VQ6 3;  1Q40 A;  1K41 A;  3CCL 3;  2XFS A;  4HM6 B;  2WOF A;  1QVF 2;  3B4P A;  1WTH A;  2CWU A;  3DZL A;  2P0M A;  2CWV A;  1IDP A;  3EE1 A;  2W56 A;  1LXE A;  1C7H A;  4L8P A;  2BMQ B;  2Y73 A;  1JJ2 2;  4HM3 B;  1NO3 A;  1A2V A;  4FMD A;  1YJN 3;  4HM1 B;  2RFR A;  1W4N A;  2W9Q A;  3IPT A;  4O3V A;  1PFP A;  5JBS A;  1OAC A;  3JUN A;  3X40 A;  2CC3 A;  1BUQ A;  4HM0 B;  3S67 A;  1NWW A;  1CEW I;  4NHF A;  1YIT 3;  3L0R A;  2W2C A;  3GZB A;  4EC6 A;  4N6V 0;  1YI2 3;  4U13 A;  3AMO A;  2K0M A;  2WGQ A;  1CYU A;  2QGU A;  3Q1C A;  4MMX B;  3KSP A;  3X3Z A;  1MNL A;  3DGL A;  3OWU A;  1J2B A;  4XBY A;  3CXC 2;  4O8S A;  3KZT A;  1NU3 A;  3LYG A;  4KZ1 A;  1JB2 A;  4I4K A;  1IVV A;  4L8O A;  5IEO A;  2QEX 3;  2LQV A;  3I55 3;  2JDI H;  3CCV 3;  3KE7 A;  5TGN A;  4AEQ A;  1W2B 2;  1NDO B;  3CNM A;  1M1K 4;  1VQO 3;  4XBT A;  2CKF B;  1F8N A;  3F8H A;  4HJL B;  1TFO A;  4HBR A;  2V1L A;  4AKZ A;  1RKY A;  2OQE C;  3NHX A;  1V74 A;  3F8X A;  3FG1 A;  1LVN A;  2CFL A;  5ELJ A;  1IQ8 A;  2Z6B A;  1VQL 3;  2D42 A;  2RGQ A;  4EYC A;  4XB5 A;  3CCM 3;  4G1M B;  3EQQ B;  3FF2 A;  4HVN A;  4OUQ A;  4IPB A;  1M9G A;  3SXX A;  4HKV B;  1IVW A;  1W01 A;  3Q90 A;  5LC7 A;  1NB3 I;  3GWR A;  4JRF A;  3OWY A;  2GEX A;  1DMQ A;  3WDG B;  4LMI A;  4WYK B;  3CCE 3;  3NM2 A;  2CH9 A;  2GU3 A;  3N9H A;  3UJM A;  2IA7 A;  5IEN A;  1WNH A;  1DVC A;  2B24 B;  3MSO A;  4N6O B;  3F7S A;  2OOV A;  2E2U A;  3PXM A;  3CC7 3;  2K54 A;  1TUH A;  2RSX A;  4FMA A;  1ASK A;  3SOA A;  4HM5 B;  3D9R A;  5FW5 A;  3CPW 2;  1A2K A;  1RRH A;  1KQS 2;  1HKX A;  3KFQ C;  3FLJ A;  3S27 A;  1IVX A;  1EKM A;  2BT3 A;  1JNQ A;  3FG3 A;  3D3L A;  3LTA A;  1OGZ A;  3CC2 3;  2CK3 H;  8CHO A;  1IVU A;  3N8B A;  2XRX B;  1UI7 A;  5AYR B;  1O7G B;  3EX9 A;  4HM2 B;  3DGO A;  1K9M 4;  1EA2 A;  2GEY A;  4PEJ A;  1VQ8 3;  2BO9 B;  1W6C A;  3DGM A;  4CDL A;  3OX9 A;  4BTY A;  5IEP A;  3NQY A;  1N9J A;  4RZM A;  5CXO A;  3G0K A;  3DMC A;  4L7K A;  1RRL A;  3CU3 A;  1YGE A;  1AR0 A;  2BHM A;  1T5Y A;  2UX0 A;  1VQ7 3;  3K0Z A;  3JVC A;  1Q81 4;  1CQS A;  1R4C A;  2HMJ B;  3K63 A;  3KN4 A;  3LT8 A;  3MPH A;  3NX0 A;  4BTW A;  5AIG A;  3JUM A;  1D6Y A;  3K7C A;  1IT8 A;  4O02 B;  1NJI 4;  3CCQ 3;  3T0U A;  1JB5 A;  1K28 A;  1WQL B;  6STD A;  3PCR A;  2P0X A;  3A76 A;  3G16 A;  3X3X A;  3EBT A;  1AV4 A;  1SPU A;  3U97 A;  1E97 A;  2YFL B;  1TU5 A;  3SLU A;  4FR9 A;  3AMO B;  3EJV A;  2STD A;  5JPU A;  1SQW A;  1AVK A;  1W2Z A;  4K61 A;  3VGN A;  1IU7 A;  1OGX A;  2O9U X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...