1G02A

Ribonuclease t1 v16s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDSSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1g02A00
1GOUA 1BANA 4RNTA 4BU4A 1BNGA 1TRPA 2F5MA 1C54A 1RNBA 1LRAA 3D4AA 1T2HA 5GSPA 2SARA 1RGLA 1RGGA 2KAAA 1YGWA 3D5IA 1RGKA 1AY7A 1I2FA 1A2PA 5BIRA 4GHOA 1FZUA 1GSPA 1DETA 2BU4A 1FW7A 1GMQA 1BUJA 1RLSA 1BNFA 1LOVA 1DE3A 1SARA 5HOHA 1BRSA 1MGWA 1YNVX 1I3FA 1CH0A 1IYYA 1X1UA 1Q9EA 1YVSA 1BGSA 1BAOA 1PY3A 1B21A 1RNTA 1ZGXA 2GSPA 1BSDA 1RN1A 1FUTA 1GMRA 1GMPA 1JBSA 4HAAA 2BIRA 1BNEA 1BNRA 1I8VA 1BSBA 1BRNL 1JBTA 6GSPA 1BRKA 3HOHA 1UCLA 1LOYA 5BU4A 1I3IA 1I0XA 1B2UA 1X1YA 2RBIA 3DH2A 1LNIA 2AADA 3SYUA 1UCJA 3GSPA 1PYLA 2ZA4A 3WHOA 2RNTA 1BU4A 4J5GA 1FYSA 1BRGA 1T2IA 3A5EA 1B20A 1BOXA 1BSEA 1TTOA 8RNTA 1B2XA 3AGNA 1RGFA 1R4YA 1RN4A 1I0VA 1I2GA 1BIRA 1BSAA 4BIRA 7GSPA 1HZ1A 1RMSA 2F5WA 1RGHA 3DGYA 2KF4A 1BRIA 3AHWA 3BU4A 1UCKA 1RTUA 3AGOA 4J5KA 3URPA 1JBRA 1I2EA 2F4YA 1BRHA 1B2SA 2C4BA 1B27A 1LOWA 1MGRA 2KF5A 1X1WA 1UCIA 1GOYA 1BNSA 2HOHA 1RGEA 1HYFA 4HOHA 3D5GA 1B3SA 2F56A 7RNTA 5RNTA 1BNJA 1BSCA 1I70A 3BIRA 4GSPA 1FUSA 1BVIA 2AAEA 3AHSA 2KF6A 1TRQA 1B2ZA 1X1XA 1RHLA 1RSNA 3Q3FA 3WR2A 1RDSA 3RNTA 1BRJA 3KCHA 1RGCA 6RNTA 1RCLA 1BNIA 1G02A 9RNTA 1RCKA 1B2MA 1RGAA 2KF3A 1GOVA 1AQZA
chains in the Genus database with same CATH superfamily
1YHQ3 4AKYA 3JVCA 3N8BA 1YVBI 4EBGA 2P09A 3B4OA 1BANA 4RNTA 4BU4A 1JZOA 2KCDA 3BNBA 3CXC2 4WWUC 5IENA 3F8HA 5KP3A 5DRVA 2GEXA 3I553 3EE1A 4EXRA 1TIJA 1ROAA 3D3LA 3LXUX 1RNBA 1LRAA 1GS3A 1ROVA 5M19A 3VF1A 3CNMA 1LNHA 2YFJB 4G1MB 1LQMB 3D5IA 4HKVB 2FGTA 3FCSB 4IIAA 1AY7A 3LZAA 4FCMA 4EC6A 1YIT3 3KZTA 1GSPA 4H3UA 4N6LA 3TDGA 1RKYA 2BU4A 1GY7A 2H0IA 2CFWA 1QJGA 1RLSA 2XH9A 3HIGA 3F40A 1BRSA 1MGWA 1TJDA 3LT9A 5ELJA 1W02A 1CYUA 1X1UA 4XBYA 1VQ83 1QVF2 3EF8A 4KT3B 3SLUA 1LVNA 1S5AA 1NO3A 1T3BA 1FGRA 2CX1A 2BIRA 3PYJA 1LOXA 1O7HB 2XFTA 1TU5A 1C7HA 3IJEB 4L8PA 3HIIA 1BNRA 1JNQA 1UI7A 1KC84 3AMOA 1O7MB 5CXOA 3CCE3 5FGOA 2WOFA 3GRDA 1JBTA 6GSPA 2OTJ3 2XRXB 2D42A 3DGOA 5I97A 2Z7AA 2RFRA 3S28A 4LMIA 3MG2A 5CF1A 3LTCA 1LOYA 3M8CA 3T8UA 4HM8B 2CWVA 3PXMA 4CDLA 1VQ93 1IDPA 3HI7A 1VQQA 3V99A 2OQEA 3QK9A 2CHCA 1TFKA 3K0ZA 1IV9A 2KRTA 5JBSA 2RNTA 3VSYA 2WO0A 4EV2A 4I5QA 3CCL3 2CWTA 1MWRA 2W56B 1FYSA 1BRGA 1O7GB 2OQEC 2OOVC 3U1WA 3LT8A 3A5EA 3EBTA 1GY5A 3B4PA 2IY2A 3PCRA 1VQL3 1UUVB 3F7XA 3I0YA 3MG1A 4MEIA 2XF3A 1VQO3 1Q824 1BSAA 3IMAB 1MNLA 1HZ1A 1RMSA 3LMLA 3X42A 2CFKA 5KP1A 4LEHA 3T0UA 3FF2A 3DGYA 3DZLA 3O8YA 3K63A 3AGOA 5AIFA 1G96A 1YI23 1UW1A 1JKGB 5CF2A 1JRQA 3DGNA 3GZBA 1QVG2 4L8OA 4BTWA 1B27A 1DMQA 2K3DA 2L4VA 3ECFA 4NPBA 1X1WA 1Q814 1MWUA 1GOYA 3EN8A 1K41A 3JUMA 1HYFA 4HOHA 1R4CA 2F56A 2W04A 5G2GA 4EV5A 2BT3A 7RNTA 1BNJA 1IQYA 2XSOB 1JB5A 3NM2A 3PGBA 3WDGB 2GBWB 1VQ73 1IV7A 1IVXA 2KF6A 2P0MA 1YGEA 2W0QA 2WOHA 1X1XA 1CEWI 1RHLA 1RSNA 2CFDA 3SOAA 3CPOA 1RDSA 1W01A 1OCVA 1FGMA 5AYRB 3LH4A 1E3RA 1JB4A 1BNIA 3G6E3 1NB5I 3OWYA 1VZZA 2A15A 4HJLB 4HBRA 3AMOB 3URPA 1JN5B 4PEJA 1IVUA 4EYCA 1QAFA 4U13A 2F5MA 1K8A4 3NX0A 1AVKA 3BNCA 3ALAA 1EG9B 2FNQA 5LC6A 1O7NB 1T2HA 3IPTA 1OF5A 1M9GA 2SARA 4K1UA 1T5YA 4KVHA 2HMMB 4WFOA 2OCTA 1JJ22 1ASKA 3Q2PA 1I2FA 1D6UA 4MMXB 4CJNA 5IG5A 4XBXA 3U97A 5IEPA 2PNCA 1A67A 4XB5A 1RN7A 1GMQA 3MYTA 3X3XA 5D83A 2Y74A 1LQGC 1LOVA 1UDII 5IG0A 3CCM3 4ILFA 1YNVX 1CH0A 1IYYA 5DREA 4HM7B 4X2OA 2INXA 3OV4A 1PY3A 4FMBA 2W2CA 5IG3A 1ULIB 2ML6A 3FKAA 1GMPA 3FSDA 1GYBA 1V74A 3EHCA 3LYGA 3V98A 2D1WA 3D79A 5JPUA 4JF8A 3OW22 3LTDA 2GU1A 1BSBA 4BL2A 4KFFA 1OUNA 1VQK3 1KQS2 2F99A 4FMCA 3NBRA 4KZ1A 2FXTA 1EEJA 4R1KA 3DGMA 3HOHA 2R41A 2BO9B 3B8LA 2XGLA 3ZFZA 1I3IA 1A2KA 3NM7A 2BHMA 1N5PA 1K28A 2CG0A 1KWIA 4I4KA 1FGTA 4MJDA 1SQWA 2CK3H 3WHOA 2ZA4A 1BU4A 1N5HA 2XSHB 1K9M4 3WMDA 1Q42A 1WMOA 2CKFB 2MC8A 5IF6A 2R4IA 4L7KA 1BSEA 3OX9A 1TTOA 2F98A 3EB8A 2PZVA 3AGNA 8CHOA 1VQ43 3KE7A 2C10A 3UL5A 3J7Yd 1OH0A 4BIRA 4FCJA 1D6YA 3HK4A 2F5WA 4OK0A 3PCSA 2OWPA 2KF4A 4K61A 4RNZA 3AHWA 1OGZA 2W6JH 3BU4A 1RTUA 2V1LA 3ER7A 3KSPA 3BNDA 1JBRA 2C4BA 3FH1A 1EA2A 2P05A 1DMNA 1MGRA 1N8QA 1RJOA 3FG3A 3N54B 2CW9A 4N6V0 1J2BA 1YJ93 5STDA 3SX1A 2HMJB 1DVDA 2O3OA 3SEDA 1B3SA 1RRHA 2H0GA 4LSOA 3H3HA 1BSCA 1I70A 1HU9A 4LYLB 3KSED 4WHAA 1DMMA 4CPKA 5CLKA 3NUVA 1BVIA 3F7SA 1OHPA 3KN4A 2ZDJA 1DYUA 2YFLB 3BB9A 3LTBA 4XM4A 1EQKA 3DUKA 1FGOA 1B2ZA 1N9EA 2QGUA 4R9KA 1WTHA 4R4KA 4HM1B 2O9UX 3G713 1BRJA 1NJI4 5KP4A 1Z1SA 6RNTA 3FF0A 2GXFA 1G02A 4BTYA 2F86B 2GBXB 1STFI 2K54A 3G8ZA 3NBBA 5AIHA 9RNTA 1YJW3 1A90A 2KF3A 1GOVA 1AQZA 2Q07A 1KD14 4HM4B 2CIUA 3G0KA 4IT7A 2W03A 4BL3A 1OGXA 2ZL8A 4X2HA 2QA43 3D9RA 1BNGA 3HZPA 3MKIA 3Q1CA 2UUGC 4MMZB 1EKMA 1NDOB 4AEQA 1V58A 1MWTA 3FG4A 1NB3I 1UUGB 2WGOA 1RGLA 3PZWA 4N3VA 1RGGA 1SIHA 1ZS7A 2CWUA 4KFDA 3CCR3 1RGKA 3CCS3 4WYKB 3RGAA 1NU3A 1SIIA 5IG4A 1FZUA 2UGIA 1DETA 3MPHA 4FCZA 4H61A 5G1LA 3ZG5A 1M904 1FW7A 3LOYA 1IT8A 1BNFA 2BNGA 1DE3A 1SARA 2C11A 3Q90A 2YFIB 1M1K4 3NQYA 4EW5A 3GZXB 3X41A 1Q7Y4 1U8CB 2RSXA 5AIGA 2I9WA 5M18A 1YVSA 1BGSA 2Y73A 3NHXA 1B21A 1RNTA 1W5ZA 1W6GA 1ZGXA 2XGNA 3F8XA 2GSPA 3CPW2 1BSDA 1FA3A 1RN1A 5D81A 4RBNA 1FUTA 1GMRA 4FR9A 2Z77A 3SXXA 1JBSA 1JKGA 3DGLA 1BNEA 4Q53A 3CCQ3 3GWRA 1I8VA 3S27A 1NWWA 1US1A 2HMKB 3UL6A 3CCJ3 3NXJA 4RZMA 3I563 3NV0B 1BRKA 2E2UA 3NV0A 1WQLB 3STDA 2B1XB 2E2VA 4JRFA 4R9LA 5BU4A 1U5OA 4FMDA 1TUHA 1IU7A 3WA2X 1B2UA 1X1YA 1ZO2A 2UX0A 2HMNB 5EVHA 1UUWB 3B7CA 1E97A 3NBJA 2OTL3 1A2VA 1V57A 1M1XB 2RBIA 2STDA 2WGQA 4OVMA 3FGYA 1IK3A 1UCJA 2RCDA 3GSPA 1Q7HA 3QRDA 4XDVA 4NREA 2IA7A 3SOYA 3UB1A 3EQQB 1N9JA 3SVAA 5FW5A 5IERA 2H0HA 2IUKA 3KKGA 3MG3A 3VGNA 1BOXA 5BXQA 3S67A 1B2XA 3G4S3 1RGFA 1R4YA 1STDA 1RN4A 1I0VA 1I2GA 1BIRA 1O7WB 1JB2A 1F8NA 4HM0B 4TX4A 2BMQB 2XFSA 1RGHA 5EQLA 1OACA 3DXOA 1L5GB 2CC3A 1UCKA 4DKIA 1Q40A 3CMA3 2F4YA 1Y4KA 4HVNA 3K5TA 3CC23 1SJWA 4WP5A 1LOWA 5EEOA 4ZM8A 4LZIA 3F14A 1IVVA 1UCIA 3ZG0A 1BNSA 2CX0A 2HOHA 3KFQC 2BMOB 1OHOA 5JPPA 5RNTA 1FGQA 1GY6A 1VQ63 3BIRA 1YIJ3 1D6ZA 3X3ZA 3AHSA 5AIIA 3CD63 1W00A 3S5CA 4N6MA 1MWSA 3CNXA 3DM8A 5IW9A 2XEPA 4O3VA 3UNLA 3KCHA 2MF7A 1RGCA 1HKXA 4HZ9B 4O8SA 1AVLA 1UGHI 2GEYA 3GZYB 1K734 1RCKA 2M7OA 1B2MA 3MWZA 1ULJB 1JN5A 1NNVA 1GOUA 4O02B 3FLJA 3UJMA 2Z76A 4K1VA 1TRPA 3EX9A 3RGRA 2CFGA 4NHFA 3F9SA 2QEX3 3JUPA 1C54A 2W56A 3D4AA 1E3VA 1TFOA 4J9AA 5GSPA 1EUIC 4GB5A 1ZX2A 2JDIH 2KAAA 1MOLA 1YGWA 3K9MC 4HYZA 4XBTA 5AI1A 5BVBA 5IEOA 1Q864 1A2PA 5BIRA 1W7CA 3FZWA 4GHOA 5M1AA 1GD4A 4FMAA 1BUJA 3E99A 4K90B 4N6UA 3WODG 2HMLB 3FG1A 4HM5B 5HOHA 3WA3A 1VQP3 5AYSC 6STDA 3BLZA 1I3FA 5TGNA 1WMNA 3H51A 1Q9EA 4OUQA 1OHSA 1VQ53 2XR8B 4R80A 1BAOA 2CG1A 5CK6A 3RDEA 4AKZA 3NQZA 2BMRB 1JV2B 2E2TA 1G0TA 2RGQA 1QALA 4HAAA 4LGQA 1TP6A 4N6NB 1RRLA 3CME3 2CFLA 3CCU3 2LQVA 2KXGA 3OXAA 1W2B2 1LXEA 2W9PA 1W6CA 1IQXA 2J8XB 1OPYA 1VQN3 2YX9A 1BRNL 4J8TA 1KSIA 4HZBB 3EN1B 1CYVA 3A76A 4HM3B 3GAXA 3CC43 3EC9A 2SBLA 2HMOB 3K7CA 2L1SA 3HX8A 1UCLA 1W4NA 3CCV3 1SPUA 2W9QA 5AEUB 1AV4A 1I0XA 1IT7A 1N8R4 3JUQA 1DVCA 2LYXA 3MSOA 3V92A 3DH2A 1LNIA 1UGIA 2AADA 3LTAA 3SYUA 4O2HA 1ISKA 1PYLA 3JUNA 4HM2B 4N6TA 4J5GA 2ML5A 2JQ5A 1PU4A 1T2IA 1B20A 3MHEA 4GL6A 2IYJA 8RNTA 3OWSA 3S29A 1OF5B 7STDA 3EJVA 3ROBA 1GD3A 2GU3A 7GSPA 4RNYA 4WYKA 1BUQA 1QAKA 1PFPA 4QWTA 4CCVA 2P0XA 4BTXA 1BRIA 2P38A 4KFEA 2ZHXB 1Q40B 1W6YA 3OWUA 2K0MA 4J5KA 3T8NA 3X40A 1QMAA 1YJN3 1I2EA 1UI8A 1IVWA 4N6OB 1BRHA 5D82A 1B2SA 1AR0A 3EBYA 2OOVA 2Z6BA 2KF5A 5A0OB 5G1KA 4STDA 1JZDA 1RGEA 3X3YA 3D5GA 3PS8A 3DMCA 2IUJA 1WMPA 1W2ZA 1FUWA 1FUSA 2AAEA 4HM6B 5AEWB 4IPBA 1VQM3 2QIYA 1TRQA 3N9HA 4ORLA 3CU3A 3GZRA 5ELUA 3Q3FA 2B24B 3WR2A 4XDWA 3L0RA 3RNTA 1O7PB 2IMJA 3G16A 4MMYB 3KIIA 3DY5A 3BNEA 1RCLA 1WNHA 1CQSA 3WOEB 5LC7A 1S723 2CH9A 5HGRA 3WOFB 3CC73 3JUOA 1RGAA 4GSPA 1IQ8A
chains in the Genus database with same CATH topology
1GOUA 1BANA 4RNTA 4BU4A 1BNGA 1TRPA 2F5MA 1C54A 1RNBA 1LRAA 3D4AA 1T2HA 5GSPA 2SARA 1RGLA 1RGGA 2KAAA 1YGWA 3D5IA 1RGKA 1AY7A 1I2FA 1A2PA 5BIRA 4GHOA 1FZUA 1GSPA 1DETA 2BU4A 1FW7A 1GMQA 1BUJA 1RLSA 1BNFA 1LOVA 1DE3A 1SARA 5HOHA 1BRSA 1MGWA 1YNVX 1I3FA 1CH0A 1IYYA 1X1UA 1Q9EA 1YVSA 1BGSA 1BAOA 1PY3A 1B21A 1RNTA 1ZGXA 2GSPA 1BSDA 1RN1A 1FUTA 1GMRA 1GMPA 1JBSA 4HAAA 2BIRA 1BNEA 1BNRA 1I8VA 1BSBA 1BRNL 1JBTA 6GSPA 1BRKA 3HOHA 1UCLA 1LOYA 5BU4A 1I3IA 1I0XA 1B2UA 1X1YA 2RBIA 3DH2A 1LNIA 2AADA 3SYUA 1UCJA 3GSPA 1PYLA 2ZA4A 3WHOA 2RNTA 1BU4A 4J5GA 1FYSA 1BRGA 1T2IA 3A5EA 1B20A 1BOXA 1BSEA 1TTOA 8RNTA 1B2XA 3AGNA 1RGFA 1R4YA 1RN4A 1I0VA 1I2GA 1BIRA 1BSAA 4BIRA 7GSPA 1HZ1A 1RMSA 2F5WA 1RGHA 3DGYA 2KF4A 1BRIA 3AHWA 3BU4A 1UCKA 1RTUA 3AGOA 4J5KA 3URPA 1JBRA 1I2EA 2F4YA 1BRHA 1B2SA 2C4BA 1B27A 1LOWA 1MGRA 2KF5A 1X1WA 1UCIA 1GOYA 1BNSA 2HOHA 1RGEA 1HYFA 4HOHA 3D5GA 1B3SA 2F56A 7RNTA 5RNTA 1BNJA 1BSCA 1I70A 3BIRA 4GSPA 1FUSA 1BVIA 2AAEA 3AHSA 2KF6A 1TRQA 1B2ZA 1X1XA 1RHLA 1RSNA 3Q3FA 3WR2A 1RDSA 3RNTA 1BRJA 3KCHA 1RGCA 6RNTA 1RCLA 1BNIA 1G02A 9RNTA 1RCKA 1B2MA 1RGAA 2KF3A 1GOVA 1AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GOU A;  1BAN A;  4RNT A;  4BU4 A;  1BNG A;  1TRP A;  2F5M A;  1C54 A;  1RNB A;  1LRA A;  3D4A A;  1T2H A;  5GSP A;  2SAR A;  1RGL A;  1RGG A;  2KAA A;  1YGW A;  3D5I A;  1RGK A;  1AY7 A;  1I2F A;  1A2P A;  5BIR A;  4GHO A;  1FZU A;  1GSP A;  1DET A;  2BU4 A;  1FW7 A;  1GMQ A;  1BUJ A;  1RLS A;  1BNF A;  1LOV A;  1DE3 A;  1SAR A;  5HOH A;  1BRS A;  1MGW A;  1YNV X;  1I3F A;  1CH0 A;  1IYY A;  1X1U A;  1Q9E A;  1YVS A;  1BGS A;  1BAO A;  1PY3 A;  1B21 A;  1RNT A;  1ZGX A;  2GSP A;  1BSD A;  1RN1 A;  1FUT A;  1GMR A;  1GMP A;  1JBS A;  4HAA A;  2BIR A;  1BNE A;  1BNR A;  1I8V A;  1BSB A;  1BRN L;  1JBT A;  6GSP A;  1BRK A;  3HOH A;  1UCL A;  1LOY A;  5BU4 A;  1I3I A;  1I0X A;  1B2U A;  1X1Y A;  2RBI A;  3DH2 A;  1LNI A;  2AAD A;  3SYU A;  1UCJ A;  3GSP A;  1PYL A;  2ZA4 A;  3WHO A;  2RNT A;  1BU4 A;  4J5G A;  1FYS A;  1BRG A;  1T2I A;  3A5E A;  1B20 A;  1BOX A;  1BSE A;  1TTO A;  8RNT A;  1B2X A;  3AGN A;  1RGF A;  1R4Y A;  1RN4 A;  1I0V A;  1I2G A;  1BIR A;  1BSA A;  4BIR A;  7GSP A;  1HZ1 A;  1RMS A;  2F5W A;  1RGH A;  3DGY A;  2KF4 A;  1BRI A;  3AHW A;  3BU4 A;  1UCK A;  1RTU A;  3AGO A;  4J5K A;  3URP A;  1JBR A;  1I2E A;  2F4Y A;  1BRH A;  1B2S A;  2C4B A;  1B27 A;  1LOW A;  1MGR A;  2KF5 A;  1X1W A;  1UCI A;  1GOY A;  1BNS A;  2HOH A;  1RGE A;  1HYF A;  4HOH A;  3D5G A;  1B3S A;  2F56 A;  7RNT A;  5RNT A;  1BNJ A;  1BSC A;  1I70 A;  3BIR A;  4GSP A;  1FUS A;  1BVI A;  2AAE A;  3AHS A;  2KF6 A;  1TRQ A;  1B2Z A;  1X1X A;  1RHL A;  1RSN A;  3Q3F A;  3WR2 A;  1RDS A;  3RNT A;  1BRJ A;  3KCH A;  1RGC A;  6RNT A;  1RCL A;  1BNI A;  1G02 A;  9RNT A;  1RCK A;  1B2M A;  1RGA A;  2KF3 A;  1GOV A;  1AQZ A; 
#chains in the Genus database with same CATH topology
 1YHQ 3;  4AKY A;  3JVC A;  3N8B A;  1YVB I;  4EBG A;  2P09 A;  3B4O A;  1BAN A;  4RNT A;  4BU4 A;  1JZO A;  2KCD A;  3BNB A;  3CXC 2;  4WWU C;  5IEN A;  3F8H A;  5KP3 A;  5DRV A;  2GEX A;  3I55 3;  3EE1 A;  4EXR A;  1TIJ A;  1ROA A;  3D3L A;  3LXU X;  1RNB A;  1LRA A;  1GS3 A;  1ROV A;  5M19 A;  3VF1 A;  3CNM A;  1LNH A;  2YFJ B;  4G1M B;  1LQM B;  3D5I A;  4HKV B;  2FGT A;  3FCS B;  4IIA A;  1AY7 A;  3LZA A;  4FCM A;  4EC6 A;  1YIT 3;  3KZT A;  1GSP A;  4H3U A;  4N6L A;  3TDG A;  1RKY A;  2BU4 A;  1GY7 A;  2H0I A;  2CFW A;  1QJG A;  1RLS A;  2XH9 A;  3HIG A;  3F40 A;  1BRS A;  1MGW A;  1TJD A;  3LT9 A;  5ELJ A;  1W02 A;  1CYU A;  1X1U A;  4XBY A;  1VQ8 3;  1QVF 2;  3EF8 A;  4KT3 B;  3SLU A;  1LVN A;  1S5A A;  1NO3 A;  1T3B A;  1FGR A;  2CX1 A;  2BIR A;  3PYJ A;  1LOX A;  1O7H B;  2XFT A;  1TU5 A;  1C7H A;  3IJE B;  4L8P A;  3HII A;  1BNR A;  1JNQ A;  1UI7 A;  1KC8 4;  3AMO A;  1O7M B;  5CXO A;  3CCE 3;  5FGO A;  2WOF A;  3GRD A;  1JBT A;  6GSP A;  2OTJ 3;  2XRX B;  2D42 A;  3DGO A;  5I97 A;  2Z7A A;  2RFR A;  3S28 A;  4LMI A;  3MG2 A;  5CF1 A;  3LTC A;  1LOY A;  3M8C A;  3T8U A;  4HM8 B;  2CWV A;  3PXM A;  4CDL A;  1VQ9 3;  1IDP A;  3HI7 A;  1VQQ A;  3V99 A;  2OQE A;  3QK9 A;  2CHC A;  1TFK A;  3K0Z A;  1IV9 A;  2KRT A;  5JBS A;  2RNT A;  3VSY A;  2WO0 A;  4EV2 A;  4I5Q A;  3CCL 3;  2CWT A;  1MWR A;  2W56 B;  1FYS A;  1BRG A;  1O7G B;  2OQE C;  2OOV C;  3U1W A;  3LT8 A;  3A5E A;  3EBT A;  1GY5 A;  3B4P A;  2IY2 A;  3PCR A;  1VQL 3;  1UUV B;  3F7X A;  3I0Y A;  3MG1 A;  4MEI A;  2XF3 A;  1VQO 3;  1Q82 4;  1BSA A;  3IMA B;  1MNL A;  1HZ1 A;  1RMS A;  3LML A;  3X42 A;  2CFK A;  5KP1 A;  4LEH A;  3T0U A;  3FF2 A;  3DGY A;  3DZL A;  3O8Y A;  3K63 A;  3AGO A;  5AIF A;  1G96 A;  1YI2 3;  1UW1 A;  1JKG B;  5CF2 A;  1JRQ A;  3DGN A;  3GZB A;  1QVG 2;  4L8O A;  4BTW A;  1B27 A;  1DMQ A;  2K3D A;  2L4V A;  3ECF A;  4NPB A;  1X1W A;  1Q81 4;  1MWU A;  1GOY A;  3EN8 A;  1K41 A;  3JUM A;  1HYF A;  4HOH A;  1R4C A;  2F56 A;  2W04 A;  5G2G A;  4EV5 A;  2BT3 A;  7RNT A;  1BNJ A;  1IQY A;  2XSO B;  1JB5 A;  3NM2 A;  3PGB A;  3WDG B;  2GBW B;  1VQ7 3;  1IV7 A;  1IVX A;  2KF6 A;  2P0M A;  1YGE A;  2W0Q A;  2WOH A;  1X1X A;  1CEW I;  1RHL A;  1RSN A;  2CFD A;  3SOA A;  3CPO A;  1RDS A;  1W01 A;  1OCV A;  1FGM A;  5AYR B;  3LH4 A;  1E3R A;  1JB4 A;  1BNI A;  3G6E 3;  1NB5 I;  3OWY A;  1VZZ A;  2A15 A;  4HJL B;  4HBR A;  3AMO B;  3URP A;  1JN5 B;  4PEJ A;  1IVU A;  4EYC A;  1QAF A;  4U13 A;  2F5M A;  1K8A 4;  3NX0 A;  1AVK A;  3BNC A;  3ALA A;  1EG9 B;  2FNQ A;  5LC6 A;  1O7N B;  1T2H A;  3IPT A;  1OF5 A;  1M9G A;  2SAR A;  4K1U A;  1T5Y A;  4KVH A;  2HMM B;  4WFO A;  2OCT A;  1JJ2 2;  1ASK A;  3Q2P A;  1I2F A;  1D6U A;  4MMX B;  4CJN A;  5IG5 A;  4XBX A;  3U97 A;  5IEP A;  2PNC A;  1A67 A;  4XB5 A;  1RN7 A;  1GMQ A;  3MYT A;  3X3X A;  5D83 A;  2Y74 A;  1LQG C;  1LOV A;  1UDI I;  5IG0 A;  3CCM 3;  4ILF A;  1YNV X;  1CH0 A;  1IYY A;  5DRE A;  4HM7 B;  4X2O A;  2INX A;  3OV4 A;  1PY3 A;  4FMB A;  2W2C A;  5IG3 A;  1ULI B;  2ML6 A;  3FKA A;  1GMP A;  3FSD A;  1GYB A;  1V74 A;  3EHC A;  3LYG A;  3V98 A;  2D1W A;  3D79 A;  5JPU A;  4JF8 A;  3OW2 2;  3LTD A;  2GU1 A;  1BSB A;  4BL2 A;  4KFF A;  1OUN A;  1VQK 3;  1KQS 2;  2F99 A;  4FMC A;  3NBR A;  4KZ1 A;  2FXT A;  1EEJ A;  4R1K A;  3DGM A;  3HOH A;  2R41 A;  2BO9 B;  3B8L A;  2XGL A;  3ZFZ A;  1I3I A;  1A2K A;  3NM7 A;  2BHM A;  1N5P A;  1K28 A;  2CG0 A;  1KWI A;  4I4K A;  1FGT A;  4MJD A;  1SQW A;  2CK3 H;  3WHO A;  2ZA4 A;  1BU4 A;  1N5H A;  2XSH B;  1K9M 4;  3WMD A;  1Q42 A;  1WMO A;  2CKF B;  2MC8 A;  5IF6 A;  2R4I A;  4L7K A;  1BSE A;  3OX9 A;  1TTO A;  2F98 A;  3EB8 A;  2PZV A;  3AGN A;  8CHO A;  1VQ4 3;  3KE7 A;  2C10 A;  3UL5 A;  3J7Y d;  1OH0 A;  4BIR A;  4FCJ A;  1D6Y A;  3HK4 A;  2F5W A;  4OK0 A;  3PCS A;  2OWP A;  2KF4 A;  4K61 A;  4RNZ A;  3AHW A;  1OGZ A;  2W6J H;  3BU4 A;  1RTU A;  2V1L A;  3ER7 A;  3KSP A;  3BND A;  1JBR A;  2C4B A;  3FH1 A;  1EA2 A;  2P05 A;  1DMN A;  1MGR A;  1N8Q A;  1RJO A;  3FG3 A;  3N54 B;  2CW9 A;  4N6V 0;  1J2B A;  1YJ9 3;  5STD A;  3SX1 A;  2HMJ B;  1DVD A;  2O3O A;  3SED A;  1B3S A;  1RRH A;  2H0G A;  4LSO A;  3H3H A;  1BSC A;  1I70 A;  1HU9 A;  4LYL B;  3KSE D;  4WHA A;  1DMM A;  4CPK A;  5CLK A;  3NUV A;  1BVI A;  3F7S A;  1OHP A;  3KN4 A;  2ZDJ A;  1DYU A;  2YFL B;  3BB9 A;  3LTB A;  4XM4 A;  1EQK A;  3DUK A;  1FGO A;  1B2Z A;  1N9E A;  2QGU A;  4R9K A;  1WTH A;  4R4K A;  4HM1 B;  2O9U X;  3G71 3;  1BRJ A;  1NJI 4;  5KP4 A;  1Z1S A;  6RNT A;  3FF0 A;  2GXF A;  1G02 A;  4BTY A;  2F86 B;  2GBX B;  1STF I;  2K54 A;  3G8Z A;  3NBB A;  5AIH A;  9RNT A;  1YJW 3;  1A90 A;  2KF3 A;  1GOV A;  1AQZ A;  2Q07 A;  1KD1 4;  4HM4 B;  2CIU A;  3G0K A;  4IT7 A;  2W03 A;  4BL3 A;  1OGX A;  2ZL8 A;  4X2H A;  2QA4 3;  3D9R A;  1BNG A;  3HZP A;  3MKI A;  3Q1C A;  2UUG C;  4MMZ B;  1EKM A;  1NDO B;  4AEQ A;  1V58 A;  1MWT A;  3FG4 A;  1NB3 I;  1UUG B;  2WGO A;  1RGL A;  3PZW A;  4N3V A;  1RGG A;  1SIH A;  1ZS7 A;  2CWU A;  4KFD A;  3CCR 3;  1RGK A;  3CCS 3;  4WYK B;  3RGA A;  1NU3 A;  1SII A;  5IG4 A;  1FZU A;  2UGI A;  1DET A;  3MPH A;  4FCZ A;  4H61 A;  5G1L A;  3ZG5 A;  1M90 4;  1FW7 A;  3LOY A;  1IT8 A;  1BNF A;  2BNG A;  1DE3 A;  1SAR A;  2C11 A;  3Q90 A;  2YFI B;  1M1K 4;  3NQY A;  4EW5 A;  3GZX B;  3X41 A;  1Q7Y 4;  1U8C B;  2RSX A;  5AIG A;  2I9W A;  5M18 A;  1YVS A;  1BGS A;  2Y73 A;  3NHX A;  1B21 A;  1RNT A;  1W5Z A;  1W6G A;  1ZGX A;  2XGN A;  3F8X A;  2GSP A;  3CPW 2;  1BSD A;  1FA3 A;  1RN1 A;  5D81 A;  4RBN A;  1FUT A;  1GMR A;  4FR9 A;  2Z77 A;  3SXX A;  1JBS A;  1JKG A;  3DGL A;  1BNE A;  4Q53 A;  3CCQ 3;  3GWR A;  1I8V A;  3S27 A;  1NWW A;  1US1 A;  2HMK B;  3UL6 A;  3CCJ 3;  3NXJ A;  4RZM A;  3I56 3;  3NV0 B;  1BRK A;  2E2U A;  3NV0 A;  1WQL B;  3STD A;  2B1X B;  2E2V A;  4JRF A;  4R9L A;  5BU4 A;  1U5O A;  4FMD A;  1TUH A;  1IU7 A;  3WA2 X;  1B2U A;  1X1Y A;  1ZO2 A;  2UX0 A;  2HMN B;  5EVH A;  1UUW B;  3B7C A;  1E97 A;  3NBJ A;  2OTL 3;  1A2V A;  1V57 A;  1M1X B;  2RBI A;  2STD A;  2WGQ A;  4OVM A;  3FGY A;  1IK3 A;  1UCJ A;  2RCD A;  3GSP A;  1Q7H A;  3QRD A;  4XDV A;  4NRE A;  2IA7 A;  3SOY A;  3UB1 A;  3EQQ B;  1N9J A;  3SVA A;  5FW5 A;  5IER A;  2H0H A;  2IUK A;  3KKG A;  3MG3 A;  3VGN A;  1BOX A;  5BXQ A;  3S67 A;  1B2X A;  3G4S 3;  1RGF A;  1R4Y A;  1STD A;  1RN4 A;  1I0V A;  1I2G A;  1BIR A;  1O7W B;  1JB2 A;  1F8N A;  4HM0 B;  4TX4 A;  2BMQ B;  2XFS A;  1RGH A;  5EQL A;  1OAC A;  3DXO A;  1L5G B;  2CC3 A;  1UCK A;  4DKI A;  1Q40 A;  3CMA 3;  2F4Y A;  1Y4K A;  4HVN A;  3K5T A;  3CC2 3;  1SJW A;  4WP5 A;  1LOW A;  5EEO A;  4ZM8 A;  4LZI A;  3F14 A;  1IVV A;  1UCI A;  3ZG0 A;  1BNS A;  2CX0 A;  2HOH A;  3KFQ C;  2BMO B;  1OHO A;  5JPP A;  5RNT A;  1FGQ A;  1GY6 A;  1VQ6 3;  3BIR A;  1YIJ 3;  1D6Z A;  3X3Z A;  3AHS A;  5AII A;  3CD6 3;  1W00 A;  3S5C A;  4N6M A;  1MWS A;  3CNX A;  3DM8 A;  5IW9 A;  2XEP A;  4O3V A;  3UNL A;  3KCH A;  2MF7 A;  1RGC A;  1HKX A;  4HZ9 B;  4O8S A;  1AVL A;  1UGH I;  2GEY A;  3GZY B;  1K73 4;  1RCK A;  2M7O A;  1B2M A;  3MWZ A;  1ULJ B;  1JN5 A;  1NNV A;  1GOU A;  4O02 B;  3FLJ A;  3UJM A;  2Z76 A;  4K1V A;  1TRP A;  3EX9 A;  3RGR A;  2CFG A;  4NHF A;  3F9S A;  2QEX 3;  3JUP A;  1C54 A;  2W56 A;  3D4A A;  1E3V A;  1TFO A;  4J9A A;  5GSP A;  1EUI C;  4GB5 A;  1ZX2 A;  2JDI H;  2KAA A;  1MOL A;  1YGW A;  3K9M C;  4HYZ A;  4XBT A;  5AI1 A;  5BVB A;  5IEO A;  1Q86 4;  1A2P A;  5BIR A;  1W7C A;  3FZW A;  4GHO A;  5M1A A;  1GD4 A;  4FMA A;  1BUJ A;  3E99 A;  4K90 B;  4N6U A;  3WOD G;  2HML B;  3FG1 A;  4HM5 B;  5HOH A;  3WA3 A;  1VQP 3;  5AYS C;  6STD A;  3BLZ A;  1I3F A;  5TGN A;  1WMN A;  3H51 A;  1Q9E A;  4OUQ A;  1OHS A;  1VQ5 3;  2XR8 B;  4R80 A;  1BAO A;  2CG1 A;  5CK6 A;  3RDE A;  4AKZ A;  3NQZ A;  2BMR B;  1JV2 B;  2E2T A;  1G0T A;  2RGQ A;  1QAL A;  4HAA A;  4LGQ A;  1TP6 A;  4N6N B;  1RRL A;  3CME 3;  2CFL A;  3CCU 3;  2LQV A;  2KXG A;  3OXA A;  1W2B 2;  1LXE A;  2W9P A;  1W6C A;  1IQX A;  2J8X B;  1OPY A;  1VQN 3;  2YX9 A;  1BRN L;  4J8T A;  1KSI A;  4HZB B;  3EN1 B;  1CYV A;  3A76 A;  4HM3 B;  3GAX A;  3CC4 3;  3EC9 A;  2SBL A;  2HMO B;  3K7C A;  2L1S A;  3HX8 A;  1UCL A;  1W4N A;  3CCV 3;  1SPU A;  2W9Q A;  5AEU B;  1AV4 A;  1I0X A;  1IT7 A;  1N8R 4;  3JUQ A;  1DVC A;  2LYX A;  3MSO A;  3V92 A;  3DH2 A;  1LNI A;  1UGI A;  2AAD A;  3LTA A;  3SYU A;  4O2H A;  1ISK A;  1PYL A;  3JUN A;  4HM2 B;  4N6T A;  4J5G A;  2ML5 A;  2JQ5 A;  1PU4 A;  1T2I A;  1B20 A;  3MHE A;  4GL6 A;  2IYJ A;  8RNT A;  3OWS A;  3S29 A;  1OF5 B;  7STD A;  3EJV A;  3ROB A;  1GD3 A;  2GU3 A;  7GSP A;  4RNY A;  4WYK A;  1BUQ A;  1QAK A;  1PFP A;  4QWT A;  4CCV A;  2P0X A;  4BTX A;  1BRI A;  2P38 A;  4KFE A;  2ZHX B;  1Q40 B;  1W6Y A;  3OWU A;  2K0M A;  4J5K A;  3T8N A;  3X40 A;  1QMA A;  1YJN 3;  1I2E A;  1UI8 A;  1IVW A;  4N6O B;  1BRH A;  5D82 A;  1B2S A;  1AR0 A;  3EBY A;  2OOV A;  2Z6B A;  2KF5 A;  5A0O B;  5G1K A;  4STD A;  1JZD A;  1RGE A;  3X3Y A;  3D5G A;  3PS8 A;  3DMC A;  2IUJ A;  1WMP A;  1W2Z A;  1FUW A;  1FUS A;  2AAE A;  4HM6 B;  5AEW B;  4IPB A;  1VQM 3;  2QIY A;  1TRQ A;  3N9H A;  4ORL A;  3CU3 A;  3GZR A;  5ELU A;  3Q3F A;  2B24 B;  3WR2 A;  4XDW A;  3L0R A;  3RNT A;  1O7P B;  2IMJ A;  3G16 A;  4MMY B;  3KII A;  3DY5 A;  3BNE A;  1RCL A;  1WNH A;  1CQS A;  3WOE B;  5LC7 A;  1S72 3;  2CH9 A;  5HGR A;  3WOF B;  3CC7 3;  3JUO A;  1RGA A;  4GSP A;  1IQ8 A; 
#chains in the Genus database with same CATH homology
 1GOU A;  1BAN A;  4RNT A;  4BU4 A;  1BNG A;  1TRP A;  2F5M A;  1C54 A;  1RNB A;  1LRA A;  3D4A A;  1T2H A;  5GSP A;  2SAR A;  1RGL A;  1RGG A;  2KAA A;  1YGW A;  3D5I A;  1RGK A;  1AY7 A;  1I2F A;  1A2P A;  5BIR A;  4GHO A;  1FZU A;  1GSP A;  1DET A;  2BU4 A;  1FW7 A;  1GMQ A;  1BUJ A;  1RLS A;  1BNF A;  1LOV A;  1DE3 A;  1SAR A;  5HOH A;  1BRS A;  1MGW A;  1YNV X;  1I3F A;  1CH0 A;  1IYY A;  1X1U A;  1Q9E A;  1YVS A;  1BGS A;  1BAO A;  1PY3 A;  1B21 A;  1RNT A;  1ZGX A;  2GSP A;  1BSD A;  1RN1 A;  1FUT A;  1GMR A;  1GMP A;  1JBS A;  4HAA A;  2BIR A;  1BNE A;  1BNR A;  1I8V A;  1BSB A;  1BRN L;  1JBT A;  6GSP A;  1BRK A;  3HOH A;  1UCL A;  1LOY A;  5BU4 A;  1I3I A;  1I0X A;  1B2U A;  1X1Y A;  2RBI A;  3DH2 A;  1LNI A;  2AAD A;  3SYU A;  1UCJ A;  3GSP A;  1PYL A;  2ZA4 A;  3WHO A;  2RNT A;  1BU4 A;  4J5G A;  1FYS A;  1BRG A;  1T2I A;  3A5E A;  1B20 A;  1BOX A;  1BSE A;  1TTO A;  8RNT A;  1B2X A;  3AGN A;  1RGF A;  1R4Y A;  1RN4 A;  1I0V A;  1I2G A;  1BIR A;  1BSA A;  4BIR A;  7GSP A;  1HZ1 A;  1RMS A;  2F5W A;  1RGH A;  3DGY A;  2KF4 A;  1BRI A;  3AHW A;  3BU4 A;  1UCK A;  1RTU A;  3AGO A;  4J5K A;  3URP A;  1JBR A;  1I2E A;  2F4Y A;  1BRH A;  1B2S A;  2C4B A;  1B27 A;  1LOW A;  1MGR A;  2KF5 A;  1X1W A;  1UCI A;  1GOY A;  1BNS A;  2HOH A;  1RGE A;  1HYF A;  4HOH A;  3D5G A;  1B3S A;  2F56 A;  7RNT A;  5RNT A;  1BNJ A;  1BSC A;  1I70 A;  3BIR A;  4GSP A;  1FUS A;  1BVI A;  2AAE A;  3AHS A;  2KF6 A;  1TRQ A;  1B2Z A;  1X1X A;  1RHL A;  1RSN A;  3Q3F A;  3WR2 A;  1RDS A;  3RNT A;  1BRJ A;  3KCH A;  1RGC A;  6RNT A;  1RCL A;  1BNI A;  1G02 A;  9RNT A;  1RCK A;  1B2M A;  1RGA A;  2KF3 A;  1GOV A;  1AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...