1G02A

Ribonuclease t1 v16s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDSSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1g02A00
1HZ1A 3AGOA 2RBIA 1RN1A 1BGSA 1RHLA 2KF5A 1I2EA 3DGYA 1PY3A 1GMQA 3SYUA 1BSCA 5BIRA 2KAAA 1X1XA 3D4AA 3A5EA 4J5GA 1TRQA 1BOXA 2SARA 4RNTA 1I3FA 4GSPA 1RTUA 1BRSA 1AY7A 1Q9EA 1BIRA 1B21A 2F5WA 3KCHA 1MGRA 1GOVA 1BU4A 5RNTA 1C54A 3D5GA 1RGAA 1UCLA 1JBSA 1B27A 3URPA 7GSPA 1JBTA 5GSPA 1BRHA 1HYFA 1RNTA 3RNTA 4BIRA 4HOHA 2KF4A 1IYYA 1I0VA 1FW7A 4HAAA 1BNEA 1PYLA 1BNRA 1BUJA 1BANA 3DH2A 1BNFA 1CH0A 1GMRA 1RLSA 3WR2A 1GOUA 2F56A 1YGWA 1BRGA 1RGGA 1B2MA 1BSDA 1B2ZA 1I8VA 1RGLA 1SARA 1AQZA 1GOYA 1BNJA 5BU4A 1A2PA 1LRAA 1RGHA 1TTOA 1T2IA 3BIRA 1LNIA 1RMSA 3GSPA 3WHOA 1YVSA 3AGNA 1B2UA 1BRKA 3D5IA 1RCLA 1MGWA 1DE3A 2ZA4A 1BAOA 1BNIA 1JBRA 1BSEA 1G02A 1FUTA 1GSPA 1RGEA 1T2HA 4GHOA 4BU4A 1I0XA 3Q3FA 1BRIA 2GSPA 1BSBA 2RNTA 3BU4A 2F4YA 2HOHA 1FUSA 1BSAA 1YNVX 1B2SA 1RSNA 1FYSA 1LOWA 1R4YA 1GMPA 1LOYA 2BIRA 1BRJA 1RGKA 1BNGA 1UCIA 1RCKA 1UCKA 1ZGXA 2C4BA 1B20A 1B3SA 1RN4A 2AADA 2AAEA 6RNTA 9RNTA 5HOHA 1BRNL 1FZUA 1B2XA 2KF3A 1I2FA 6GSPA 2KF6A 1LOVA 2F5MA 3AHWA 1BNSA 8RNTA 1RGFA 4J5KA 1I70A 1RNBA 1RDSA 1BVIA 3AHSA 1X1YA 1I2GA 1RGCA 1X1UA 2BU4A 7RNTA 1DETA 1UCJA 1X1WA 3HOHA 1I3IA 1TRPA
chains in the Genus database with same CATH superfamily
3PZWA 5IEPA 2CC3A 3B4PA 1ZS7A 3QK9A 4N6V0 5BVBA 3LH4A 1IV9A 2KF5A 3DGYA 2OQEA 1PY3A 2BMQB 1GMQA 2MF7A 3CMA3 1NB3I 1IQYA 2CFWA 1X1XA 3D4AA 4WYKA 3UL6A 4L7KA 2A15A 3HX8A 1T5YA 3J7Yd 4CPKA 1YJN3 1BOXA 4R1KA 1EQKA 2OOVA 3SX1A 1WMNA 1I3FA 4GSPA 4XB5A 1JB4A 2HMJB 3CPOA 3F14A 3G713 1YIJ3 2QGUA 3HIIA 3LMLA 3BLZA 2W0QA 2WO0A 2J8XB 3FF2A 3UL5A 2F5WA 3FLJA 1MGRA 1BU4A 2V1LA 2KRTA 1S5AA 4KFDA 4R4KA 2GXFA 1OHSA 3PXMA 3URPA 4H3UA 7GSPA 1HYFA 2YFJB 3EB8A 1PFPA 4O8SA 3CCV3 2IUKA 4XBTA 3X3YA 2W9QA 1GD3A 3MSOA 4HOHA 5CF1A 5AIIA 1IYYA 1TP6A 1AR0A 3MKIA 4Q53A 1UGHI 2R4IA 3OX9A 1BNEA 1DVCA 1NNVA 3CU3A 4K1UA 4EYCA 2HMLB 3DH2A 2CFDA 3MYTA 2W56B 1YI23 1GMRA 1A67A 2W2CA 5IW9A 1GOUA 2CIUA 2F56A 1BRGA 1RGGA 2F86B 2YFLB 3CC73 1B2MA 4AEQA 2OQEC 1J2BA 3K9MC 5BXQA 5AIGA 1K28A 2B1XB 4O02B 1Q7HA 4N6UA 3FKAA 5M1AA 2QA43 2WOHA 1ROVA 1GOYA 4L8OA 1BNJA 5BU4A 1FA3A 2JQ5A 1IVXA 3WODG 4EV2A 1T2IA 4AKZA 1LNIA 1JN5A 3WHOA 1WMPA 1YVSA 3AGNA 1B2UA 2OOVC 1FGOA 1JNQA 1RCLA 3DGOA 1DE3A 2ZA4A 4XM4A 1BAOA 1BNIA 5EVHA 2CKFB 5AIFA 3CC43 1GSPA 1NU3A 4LZIA 4OUQA 4WFOA 3SOYA 2Q07A 1MWSA 3KIIA 3JUPA 3KSPA 3T8UA 5IF6A 2Y73A 3DUKA 2GSPA 4XDWA 3E99A 3WA3A 1OGZA 3PCSA 4EC6A 4LYLB 5JPPA 1R4CA 1LXEA 2ML6A 1RSNA 4HM8B 4IT7A 3VF1A 1QMAA 2IUJA 2ZL8A 4FMDA 4HM0B 4HM7B 3S29A 5EEOA 3FG4A 1UCIA 2GEXA 1BUQA 4MMZB 3RDEA 5KP4A 1UCKA 2C4BA 3MG2A 1NO3A 1UUWB 1RN4A 1ISKA 1N8R4 1BRNL 1ZO2A 2XH9A 4WYKB 2MC8A 1FGQA 4HM4B 1I2FA 4NPBA 4FMCA 1LQMB 3K63A 3VSYA 4BTYA 4BL2A 1IV7A 1LOVA 1N5PA 2R41A 1JRQA 4KFFA 1L5GB 4IIAA 3IPTA 3SVAA 4L8PA 1U5OA 5KP3A 3LZAA 2IYJA 1U8CB 3JVCA 4DKIA 1A90A 3PCRA 3M8CA 3NM2A 4BTWA 1D6YA 1W02A 1UCJA 3KN4A 3NQZA 1RRHA 1YVBI 1A2KA 3GZXB 3SXXA 4N6TA 4HM5B 1FGRA 2RBIA 1MOLA 5DREA 1RN1A 1V74A 1BGSA 1RHLA 1OACA 1BSCA 1VQL3 2K54A 1Q824 3K0ZA 1AVKA 2PZVA 3DY5A 3BNBA 4FMAA 5IG0A 4LMIA 2XFSA 4BTXA 3NQYA 3Q90A 3MG1A 4HVNA 3Q1CA 2RSXA 1E3RA 3GZYB 3EBYA 1Q9EA 1YJW3 4FCZA 1W4NA 2Z76A 3G16A 1GOVA 5RNTA 1C54A 3EQQB 1OHOA 1IT8A 5D83A 3QRDA 1UCLA 1T3BA 4WP5A 1OF5A 1JN5B 4CCVA 3S5CA 3DGMA 2KF4A 1TJDA 1MWUA 5FGOA 1KQS2 2E2UA 1OHPA 3S27A 1UDII 2XEPA 1D6UA 4HJLB 1LVNA 4N6MA 1YHQ3 1PYLA 1BNRA 4QWTA 3N9HA 1JKGA 4X2HA 3SLUA 1STDA 1BUJA 1CH0A 3RGRA 2FXTA 3U1WA 2WOFA 1M9GA 1RJOA 1VQO3 1Y4KA 3H3HA 2XRXB 5AIHA 1W2B2 3ER7A 4N6NB 1IQ8A 2XGLA 1B2ZA 5JPUA 1RGLA 2GEYA 3S28A 1AQZA 1DMMA 1RRLA 1W5ZA 1LRAA 1RGHA 1ZX2A 2GBXB 2IY2A 5STDA 3DZLA 3ZG5A 3BIRA 4BL3A 1Q7Y4 5CLKA 3HZPA 5IENA 3FF0A 2ZHXB 1DMQA 2BT3A 1MGWA 1YGEA 2KXGA 3A76A 4TX4A 1JBRA 2L4VA 1JJ22 2CX1A 3D3LA 2XF3A 1G96A 1I0XA 2QEX3 2LQVA 3Q3FA 1BRIA 3OW22 1VQ93 1IU7A 2F98A 1VQ53 1BSBA 3BU4A 3KKGA 1M1K4 2F4YA 2HOHA 3LT8A 1ROAA 4KFEA 4I5QA 5G2GA 1FUSA 3DGNA 1MWRA 1NDOB 3PYJA 3FGYA 1VQM3 4LSOA 4LGQA 1LOWA 3X3ZA 2CFGA 1EKMA 1GMPA 1O7GB 3NX0A 4GL6A 1ASKA 5JBSA 1BNGA 2STDA 1ZGXA 1WQLB 3FZWA 4IPBA 5DRVA 3EE1A 4XDVA 1AV4A 3X3XA 6RNTA 2SBLA 3CCE3 1OUNA 4ZM8A 2ML5A 2YFIB 2L1SA 5AEUB 1RKYA 4KZ1A 6GSPA 2KF6A 3D79A 3OXAA 3X42A 1VQ63 4MMXB 1EA2A 1BNSA 4ORLA 3CPW2 3KE7A 1EEJA 1RDSA 1TFKA 3NV0A 1CYUA 2O3OA 3JUOA 1O7MB 1Q42A 1ULJB 3HI7A 3CC23 1K8A4 3CD63 2BU4A 2RGQA 3MWZA 4N6LA 3AMOB 3V99A 3SOAA 2GU3A 1VQP3 1JV2B 3EJVA 5M18A 2LYXA 1HZ1A 1OF5B 3X40A 2IA7A 2CHCA 5G1KA 4K61A 1IVVA 1QAKA 2CX0A 1I2EA 1EG9B 1IVUA 3EX9A 5FW5A 4HZ9B 4RNZA 1FUWA 1SQWA 1JB2A 3F9SA 2KAAA 3NBRA 3RGAA 3T8NA 4WWUC 3PGBA 1LQGC 1W00A 3MHEA 1UGIA 1JKGB 3ZFZA 1HKXA 1UW1A 1E3VA 3UJMA 3LTDA 1A2VA 3Q2PA 1TRQA 5CXOA 2YX9A 2SARA 3LTCA 4O3VA 3OWUA 4RNTA 5HGRA 2W6JH 1RTUA 2OTJ3 1RN7A 1BRSA 4NHFA 3IJEB 1MWTA 4X2OA 3KZTA 1QVG2 2HMOB 1O7WB 3IMAB 1AY7A 1BIRA 3F40A 1STFI 1V58A 3CCM3 2RFRA 1JBSA 1LOXA 4HYZA 5G1LA 5GSPA 4FCMA 1GY5A 1RNTA 5TGNA 4I4KA 4RNYA 3RNTA 3TDGA 1OPYA 3G6E3 4HM3B 5IG5A 4HM2B 3ALAA 1Z1SA 5D81A 1W6GA 2W9PA 5ELJA 4WHAA 1FW7A 4HAAA 5AEWB 1WMOA 3CCQ3 2BHMA 3LXUX 1BANA 4FR9A 1MNLA 1BNFA 3ECFA 2GBWB 1VQN3 1Q40A 3G8ZA 3G4S3 4FCJA 3F8XA 1WTHA 3BNDA 1Q864 1YGWA 2CH9A 1N5HA 1UI8A 2INXA 5I97A 2E2TA 1I8VA 2FGTA 1SARA 3WA2X 5IG3A 4GB5A 3AMOA 2Z6BA 3CME3 3D9RA 3F8HA 3DMCA 4RBNA 1KWIA 1DVDA 3U97A 3CCS3 4EW5A 3DXOA 3BNEA 1O7PB 1W6CA 3CNMA 3D5IA 1IT7A 4RZMA 4R80A 4N6OB 1BSEA 1UUVB 5D82A 2OWPA 1Q814 1T2HA 1CYVA 4AKYA 1JB5A 1K734 3NUVA 3GZRA 4BU4A 1JZOA 2CWTA 3JUNA 3B7CA 4HM6B 4HM1B 1QAFA 1UI7A 4N3VA 2RNTA 2XFTA 4R9KA 5IERA 1SIHA 3NV0B 1US1A 2XSOB 1W2ZA 1SIIA 1YNVX 1SPUA 1ULIB 4KT3B 4MEIA 4CDLA 3EF8A 3BNCA 2P05A 1LOYA 3CXC2 1BRJA 2P09A 5CF2A 1M904 3N8BA 3FCSB 4EBGA 4KVHA 1KSIA 4XBXA 1EUIC 2WGOA 3EN1B 3X41A 2HMKB 4LEHA 2BMRB 2D1WA 1GYBA 4MJDA 9RNTA 5HOHA 5AYSC 1N9EA 1FZUA 1B2XA 2KF3A 3NM7A 3JUMA 1SJWA 2F5MA 1RGFA 4J5KA 1VQ83 2CW9A 3FG3A 1RNBA 3FH1A 1YJ93 3JUQA 2O9UX 3HIGA 1RGCA 2XSHB 3LYGA 1TUHA 3DM8A 4NREA 2Y74A 3EBTA 1DETA 3V92A 1X1WA 2HMNB 1I3IA 3F7XA 3HOHA 4HBRA 3CCU3 3NBJA 1QVF2 1NJI4 3B4OA 3CCJ3 3FSDA 3AGOA 7STDA 1W01A 4STDA 2P0MA 3DGLA 1TU5A 1G0TA 1OCVA 3SYUA 2IMJA 6STDA 5BIRA 3UB1A 2W04A 1KD14 3A5EA 1W7CA 4ILFA 1M1XB 2OCTA 4J5GA 2CG0A 3LT9A 3CNXA 4PEJA 3WOEB 2RCDA 1Q40B 4EXRA 2ZDJA 3GWRA 3KFQC 3O8YA 5LC6A 5CK6A 1VZZA 3N54B 3STDA 3NHXA 5AYRB 1JZDA 1FGMA 1C7HA 2Z7AA 1IVWA 2I9WA 3LTAA 1B21A 3KCHA 2HMMB 3PS8A 3WDGB 5LC7A 1E97A 2CWUA 3D5GA 1RGAA 2E2VA 3MPHA 1B27A 1D6ZA 2JDIH 2KCDA 1JBTA 1BRHA 2P0XA 4BIRA 3EC9A 1FGTA 1OGXA 3WOFB 1V57A 2CWVA 4G1MB 5IG4A 1I0VA 5ELUA 2XGNA 3CCR3 2BO9B 3GAXA 1CQSA 4XBYA 3LTBA 5AI1A 2K3DA 1KC84 1O7HB 2Z77A 1TFOA 2UUGC 4U13A 1GY7A 1LNHA 1DMNA 1RLSA 3WR2A 4J8TA 4JF8A 1BSDA 2PNCA 5A0OB 2UX0A 1N8QA 2P38A 1IQXA 3NBBA 4H61A 3GZBA 4FMBA 1A2PA 1TTOA 3V98A 3BB9A 4R9LA 1PU4A 2BMOB 1RMSA 3GSPA 1K41A 3ROBA 1BRKA 3ZG0A 1VQ73 1IK3A 3CCL3 1W6YA 2C10A 2H0IA 1G02A 1FUTA 1AVLA 1RGEA 3NXJA 1HU9A 3OWYA 2H0GA 1YIT3 4GHOA 3LOYA 2W56A 3F7SA 2CG1A 3GRDA 1VQQA 3I553 3B8LA 2UGIA 2H0HA 3I0YA 4J9AA 2W03A 3K5TA 2K0MA 1BSAA 2WGQA 1B2SA 2XR8B 5EQLA 5M19A 2OTL3 1FYSA 1GY6A 1TIJA 2CFLA 1DYUA 1R4YA 4HKVB 2BIRA 4JRFA 1NWWA 3FG1A 1F8NA 1RGKA 4EV5A 1VQK3 1O7NB 2GU1A 1RCKA 1B20A 1B3SA 2CK3H 3EHCA 1GS3A 2B24B 4CJNA 2AADA 2AAEA 3EN8A 1IDPA 4MMYB 3VGNA 3K7CA 1QJGA 1WNHA 3H51A 1GD4A 3KSED 2QIYA 2BNGA 4HZBB 3UNLA 1K9M4 2M7OA 3AHWA 5IEOA 8CHOA 8RNTA 1OH0A 3HK4A 3WMDA 1NB5I 1I70A 4K90B 5KP1A 1S723 3SEDA 3L0RA 1BVIA 3G0KA 4K1VA 4OK0A 4OVMA 3AHSA 1X1YA 3S67A 1I2GA 2D42A 2CFKA 3OV4A 3I563 1X1UA 1VQ43 1N9JA 7RNTA 3MG3A 1CEWI 2C11A 1UUGB 4O2HA 2FNQA 1QALA 2F99A 3OWSA 1TRPA 3T0UA
chains in the Genus database with same CATH topology
1HZ1A 3AGOA 2RBIA 1RN1A 1BGSA 1RHLA 2KF5A 1I2EA 3DGYA 1PY3A 1GMQA 3SYUA 1BSCA 5BIRA 2KAAA 1X1XA 3D4AA 3A5EA 4J5GA 1TRQA 1BOXA 2SARA 4RNTA 1I3FA 4GSPA 1RTUA 1BRSA 1AY7A 1Q9EA 1BIRA 1B21A 2F5WA 3KCHA 1MGRA 1GOVA 1BU4A 5RNTA 1C54A 3D5GA 1RGAA 1UCLA 1JBSA 1B27A 3URPA 7GSPA 1JBTA 5GSPA 1BRHA 1HYFA 1RNTA 3RNTA 4BIRA 4HOHA 2KF4A 1IYYA 1I0VA 1FW7A 4HAAA 1BNEA 1PYLA 1BNRA 1BUJA 1BANA 3DH2A 1BNFA 1CH0A 1GMRA 1RLSA 3WR2A 1GOUA 2F56A 1YGWA 1BRGA 1RGGA 1B2MA 1BSDA 1B2ZA 1I8VA 1RGLA 1SARA 1AQZA 1GOYA 1BNJA 5BU4A 1A2PA 1LRAA 1RGHA 1TTOA 1T2IA 3BIRA 1LNIA 1RMSA 3GSPA 3WHOA 1YVSA 3AGNA 1B2UA 1BRKA 3D5IA 1RCLA 1MGWA 1DE3A 2ZA4A 1BAOA 1BNIA 1JBRA 1BSEA 1G02A 1FUTA 1GSPA 1RGEA 1T2HA 4GHOA 4BU4A 1I0XA 3Q3FA 1BRIA 2GSPA 1BSBA 2RNTA 3BU4A 2F4YA 2HOHA 1FUSA 1BSAA 1YNVX 1B2SA 1RSNA 1FYSA 1LOWA 1R4YA 1GMPA 1LOYA 2BIRA 1BRJA 1RGKA 1BNGA 1UCIA 1RCKA 1UCKA 1ZGXA 2C4BA 1B20A 1B3SA 1RN4A 2AADA 2AAEA 6RNTA 9RNTA 5HOHA 1BRNL 1FZUA 1B2XA 2KF3A 1I2FA 6GSPA 2KF6A 1LOVA 2F5MA 3AHWA 1BNSA 8RNTA 1RGFA 4J5KA 1I70A 1RNBA 1RDSA 1BVIA 3AHSA 1X1YA 1I2GA 1RGCA 1X1UA 2BU4A 7RNTA 1DETA 1UCJA 1X1WA 3HOHA 1I3IA 1TRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ1 A;  3AGO A;  2RBI A;  1RN1 A;  1BGS A;  1RHL A;  2KF5 A;  1I2E A;  3DGY A;  1PY3 A;  1GMQ A;  3SYU A;  1BSC A;  5BIR A;  2KAA A;  1X1X A;  3D4A A;  3A5E A;  4J5G A;  1TRQ A;  1BOX A;  2SAR A;  4RNT A;  1I3F A;  4GSP A;  1RTU A;  1BRS A;  1AY7 A;  1Q9E A;  1BIR A;  1B21 A;  2F5W A;  3KCH A;  1MGR A;  1GOV A;  1BU4 A;  5RNT A;  1C54 A;  3D5G A;  1RGA A;  1UCL A;  1JBS A;  1B27 A;  3URP A;  7GSP A;  1JBT A;  5GSP A;  1BRH A;  1HYF A;  1RNT A;  3RNT A;  4BIR A;  4HOH A;  2KF4 A;  1IYY A;  1I0V A;  1FW7 A;  4HAA A;  1BNE A;  1PYL A;  1BNR A;  1BUJ A;  1BAN A;  3DH2 A;  1BNF A;  1CH0 A;  1GMR A;  1RLS A;  3WR2 A;  1GOU A;  2F56 A;  1YGW A;  1BRG A;  1RGG A;  1B2M A;  1BSD A;  1B2Z A;  1I8V A;  1RGL A;  1SAR A;  1AQZ A;  1GOY A;  1BNJ A;  5BU4 A;  1A2P A;  1LRA A;  1RGH A;  1TTO A;  1T2I A;  3BIR A;  1LNI A;  1RMS A;  3GSP A;  3WHO A;  1YVS A;  3AGN A;  1B2U A;  1BRK A;  3D5I A;  1RCL A;  1MGW A;  1DE3 A;  2ZA4 A;  1BAO A;  1BNI A;  1JBR A;  1BSE A;  1G02 A;  1FUT A;  1GSP A;  1RGE A;  1T2H A;  4GHO A;  4BU4 A;  1I0X A;  3Q3F A;  1BRI A;  2GSP A;  1BSB A;  2RNT A;  3BU4 A;  2F4Y A;  2HOH A;  1FUS A;  1BSA A;  1YNV X;  1B2S A;  1RSN A;  1FYS A;  1LOW A;  1R4Y A;  1GMP A;  1LOY A;  2BIR A;  1BRJ A;  1RGK A;  1BNG A;  1UCI A;  1RCK A;  1UCK A;  1ZGX A;  2C4B A;  1B20 A;  1B3S A;  1RN4 A;  2AAD A;  2AAE A;  6RNT A;  9RNT A;  5HOH A;  1BRN L;  1FZU A;  1B2X A;  2KF3 A;  1I2F A;  6GSP A;  2KF6 A;  1LOV A;  2F5M A;  3AHW A;  1BNS A;  8RNT A;  1RGF A;  4J5K A;  1I70 A;  1RNB A;  1RDS A;  1BVI A;  3AHS A;  1X1Y A;  1I2G A;  1RGC A;  1X1U A;  2BU4 A;  7RNT A;  1DET A;  1UCJ A;  1X1W A;  3HOH A;  1I3I A;  1TRP A; 
#chains in the Genus database with same CATH topology
 3PZW A;  5IEP A;  2CC3 A;  3B4P A;  1ZS7 A;  3QK9 A;  4N6V 0;  5BVB A;  3LH4 A;  1IV9 A;  2KF5 A;  3DGY A;  2OQE A;  1PY3 A;  2BMQ B;  1GMQ A;  2MF7 A;  3CMA 3;  1NB3 I;  1IQY A;  2CFW A;  1X1X A;  3D4A A;  4WYK A;  3UL6 A;  4L7K A;  2A15 A;  3HX8 A;  1T5Y A;  3J7Y d;  4CPK A;  1YJN 3;  1BOX A;  4R1K A;  1EQK A;  2OOV A;  3SX1 A;  1WMN A;  1I3F A;  4GSP A;  4XB5 A;  1JB4 A;  2HMJ B;  3CPO A;  3F14 A;  3G71 3;  1YIJ 3;  2QGU A;  3HII A;  3LML A;  3BLZ A;  2W0Q A;  2WO0 A;  2J8X B;  3FF2 A;  3UL5 A;  2F5W A;  3FLJ A;  1MGR A;  1BU4 A;  2V1L A;  2KRT A;  1S5A A;  4KFD A;  4R4K A;  2GXF A;  1OHS A;  3PXM A;  3URP A;  4H3U A;  7GSP A;  1HYF A;  2YFJ B;  3EB8 A;  1PFP A;  4O8S A;  3CCV 3;  2IUK A;  4XBT A;  3X3Y A;  2W9Q A;  1GD3 A;  3MSO A;  4HOH A;  5CF1 A;  5AII A;  1IYY A;  1TP6 A;  1AR0 A;  3MKI A;  4Q53 A;  1UGH I;  2R4I A;  3OX9 A;  1BNE A;  1DVC A;  1NNV A;  3CU3 A;  4K1U A;  4EYC A;  2HML B;  3DH2 A;  2CFD A;  3MYT A;  2W56 B;  1YI2 3;  1GMR A;  1A67 A;  2W2C A;  5IW9 A;  1GOU A;  2CIU A;  2F56 A;  1BRG A;  1RGG A;  2F86 B;  2YFL B;  3CC7 3;  1B2M A;  4AEQ A;  2OQE C;  1J2B A;  3K9M C;  5BXQ A;  5AIG A;  1K28 A;  2B1X B;  4O02 B;  1Q7H A;  4N6U A;  3FKA A;  5M1A A;  2QA4 3;  2WOH A;  1ROV A;  1GOY A;  4L8O A;  1BNJ A;  5BU4 A;  1FA3 A;  2JQ5 A;  1IVX A;  3WOD G;  4EV2 A;  1T2I A;  4AKZ A;  1LNI A;  1JN5 A;  3WHO A;  1WMP A;  1YVS A;  3AGN A;  1B2U A;  2OOV C;  1FGO A;  1JNQ A;  1RCL A;  3DGO A;  1DE3 A;  2ZA4 A;  4XM4 A;  1BAO A;  1BNI A;  5EVH A;  2CKF B;  5AIF A;  3CC4 3;  1GSP A;  1NU3 A;  4LZI A;  4OUQ A;  4WFO A;  3SOY A;  2Q07 A;  1MWS A;  3KII A;  3JUP A;  3KSP A;  3T8U A;  5IF6 A;  2Y73 A;  3DUK A;  2GSP A;  4XDW A;  3E99 A;  3WA3 A;  1OGZ A;  3PCS A;  4EC6 A;  4LYL B;  5JPP A;  1R4C A;  1LXE A;  2ML6 A;  1RSN A;  4HM8 B;  4IT7 A;  3VF1 A;  1QMA A;  2IUJ A;  2ZL8 A;  4FMD A;  4HM0 B;  4HM7 B;  3S29 A;  5EEO A;  3FG4 A;  1UCI A;  2GEX A;  1BUQ A;  4MMZ B;  3RDE A;  5KP4 A;  1UCK A;  2C4B A;  3MG2 A;  1NO3 A;  1UUW B;  1RN4 A;  1ISK A;  1N8R 4;  1BRN L;  1ZO2 A;  2XH9 A;  4WYK B;  2MC8 A;  1FGQ A;  4HM4 B;  1I2F A;  4NPB A;  4FMC A;  1LQM B;  3K63 A;  3VSY A;  4BTY A;  4BL2 A;  1IV7 A;  1LOV A;  1N5P A;  2R41 A;  1JRQ A;  4KFF A;  1L5G B;  4IIA A;  3IPT A;  3SVA A;  4L8P A;  1U5O A;  5KP3 A;  3LZA A;  2IYJ A;  1U8C B;  3JVC A;  4DKI A;  1A90 A;  3PCR A;  3M8C A;  3NM2 A;  4BTW A;  1D6Y A;  1W02 A;  1UCJ A;  3KN4 A;  3NQZ A;  1RRH A;  1YVB I;  1A2K A;  3GZX B;  3SXX A;  4N6T A;  4HM5 B;  1FGR A;  2RBI A;  1MOL A;  5DRE A;  1RN1 A;  1V74 A;  1BGS A;  1RHL A;  1OAC A;  1BSC A;  1VQL 3;  2K54 A;  1Q82 4;  3K0Z A;  1AVK A;  2PZV A;  3DY5 A;  3BNB A;  4FMA A;  5IG0 A;  4LMI A;  2XFS A;  4BTX A;  3NQY A;  3Q90 A;  3MG1 A;  4HVN A;  3Q1C A;  2RSX A;  1E3R A;  3GZY B;  3EBY A;  1Q9E A;  1YJW 3;  4FCZ A;  1W4N A;  2Z76 A;  3G16 A;  1GOV A;  5RNT A;  1C54 A;  3EQQ B;  1OHO A;  1IT8 A;  5D83 A;  3QRD A;  1UCL A;  1T3B A;  4WP5 A;  1OF5 A;  1JN5 B;  4CCV A;  3S5C A;  3DGM A;  2KF4 A;  1TJD A;  1MWU A;  5FGO A;  1KQS 2;  2E2U A;  1OHP A;  3S27 A;  1UDI I;  2XEP A;  1D6U A;  4HJL B;  1LVN A;  4N6M A;  1YHQ 3;  1PYL A;  1BNR A;  4QWT A;  3N9H A;  1JKG A;  4X2H A;  3SLU A;  1STD A;  1BUJ A;  1CH0 A;  3RGR A;  2FXT A;  3U1W A;  2WOF A;  1M9G A;  1RJO A;  1VQO 3;  1Y4K A;  3H3H A;  2XRX B;  5AIH A;  1W2B 2;  3ER7 A;  4N6N B;  1IQ8 A;  2XGL A;  1B2Z A;  5JPU A;  1RGL A;  2GEY A;  3S28 A;  1AQZ A;  1DMM A;  1RRL A;  1W5Z A;  1LRA A;  1RGH A;  1ZX2 A;  2GBX B;  2IY2 A;  5STD A;  3DZL A;  3ZG5 A;  3BIR A;  4BL3 A;  1Q7Y 4;  5CLK A;  3HZP A;  5IEN A;  3FF0 A;  2ZHX B;  1DMQ A;  2BT3 A;  1MGW A;  1YGE A;  2KXG A;  3A76 A;  4TX4 A;  1JBR A;  2L4V A;  1JJ2 2;  2CX1 A;  3D3L A;  2XF3 A;  1G96 A;  1I0X A;  2QEX 3;  2LQV A;  3Q3F A;  1BRI A;  3OW2 2;  1VQ9 3;  1IU7 A;  2F98 A;  1VQ5 3;  1BSB A;  3BU4 A;  3KKG A;  1M1K 4;  2F4Y A;  2HOH A;  3LT8 A;  1ROA A;  4KFE A;  4I5Q A;  5G2G A;  1FUS A;  3DGN A;  1MWR A;  1NDO B;  3PYJ A;  3FGY A;  1VQM 3;  4LSO A;  4LGQ A;  1LOW A;  3X3Z A;  2CFG A;  1EKM A;  1GMP A;  1O7G B;  3NX0 A;  4GL6 A;  1ASK A;  5JBS A;  1BNG A;  2STD A;  1ZGX A;  1WQL B;  3FZW A;  4IPB A;  5DRV A;  3EE1 A;  4XDV A;  1AV4 A;  3X3X A;  6RNT A;  2SBL A;  3CCE 3;  1OUN A;  4ZM8 A;  2ML5 A;  2YFI B;  2L1S A;  5AEU B;  1RKY A;  4KZ1 A;  6GSP A;  2KF6 A;  3D79 A;  3OXA A;  3X42 A;  1VQ6 3;  4MMX B;  1EA2 A;  1BNS A;  4ORL A;  3CPW 2;  3KE7 A;  1EEJ A;  1RDS A;  1TFK A;  3NV0 A;  1CYU A;  2O3O A;  3JUO A;  1O7M B;  1Q42 A;  1ULJ B;  3HI7 A;  3CC2 3;  1K8A 4;  3CD6 3;  2BU4 A;  2RGQ A;  3MWZ A;  4N6L A;  3AMO B;  3V99 A;  3SOA A;  2GU3 A;  1VQP 3;  1JV2 B;  3EJV A;  5M18 A;  2LYX A;  1HZ1 A;  1OF5 B;  3X40 A;  2IA7 A;  2CHC A;  5G1K A;  4K61 A;  1IVV A;  1QAK A;  2CX0 A;  1I2E A;  1EG9 B;  1IVU A;  3EX9 A;  5FW5 A;  4HZ9 B;  4RNZ A;  1FUW A;  1SQW A;  1JB2 A;  3F9S A;  2KAA A;  3NBR A;  3RGA A;  3T8N A;  4WWU C;  3PGB A;  1LQG C;  1W00 A;  3MHE A;  1UGI A;  1JKG B;  3ZFZ A;  1HKX A;  1UW1 A;  1E3V A;  3UJM A;  3LTD A;  1A2V A;  3Q2P A;  1TRQ A;  5CXO A;  2YX9 A;  2SAR A;  3LTC A;  4O3V A;  3OWU A;  4RNT A;  5HGR A;  2W6J H;  1RTU A;  2OTJ 3;  1RN7 A;  1BRS A;  4NHF A;  3IJE B;  1MWT A;  4X2O A;  3KZT A;  1QVG 2;  2HMO B;  1O7W B;  3IMA B;  1AY7 A;  1BIR A;  3F40 A;  1STF I;  1V58 A;  3CCM 3;  2RFR A;  1JBS A;  1LOX A;  4HYZ A;  5G1L A;  5GSP A;  4FCM A;  1GY5 A;  1RNT A;  5TGN A;  4I4K A;  4RNY A;  3RNT A;  3TDG A;  1OPY A;  3G6E 3;  4HM3 B;  5IG5 A;  4HM2 B;  3ALA A;  1Z1S A;  5D81 A;  1W6G A;  2W9P A;  5ELJ A;  4WHA A;  1FW7 A;  4HAA A;  5AEW B;  1WMO A;  3CCQ 3;  2BHM A;  3LXU X;  1BAN A;  4FR9 A;  1MNL A;  1BNF A;  3ECF A;  2GBW B;  1VQN 3;  1Q40 A;  3G8Z A;  3G4S 3;  4FCJ A;  3F8X A;  1WTH A;  3BND A;  1Q86 4;  1YGW A;  2CH9 A;  1N5H A;  1UI8 A;  2INX A;  5I97 A;  2E2T A;  1I8V A;  2FGT A;  1SAR A;  3WA2 X;  5IG3 A;  4GB5 A;  3AMO A;  2Z6B A;  3CME 3;  3D9R A;  3F8H A;  3DMC A;  4RBN A;  1KWI A;  1DVD A;  3U97 A;  3CCS 3;  4EW5 A;  3DXO A;  3BNE A;  1O7P B;  1W6C A;  3CNM A;  3D5I A;  1IT7 A;  4RZM A;  4R80 A;  4N6O B;  1BSE A;  1UUV B;  5D82 A;  2OWP A;  1Q81 4;  1T2H A;  1CYV A;  4AKY A;  1JB5 A;  1K73 4;  3NUV A;  3GZR A;  4BU4 A;  1JZO A;  2CWT A;  3JUN A;  3B7C A;  4HM6 B;  4HM1 B;  1QAF A;  1UI7 A;  4N3V A;  2RNT A;  2XFT A;  4R9K A;  5IER A;  1SIH A;  3NV0 B;  1US1 A;  2XSO B;  1W2Z A;  1SII A;  1YNV X;  1SPU A;  1ULI B;  4KT3 B;  4MEI A;  4CDL A;  3EF8 A;  3BNC A;  2P05 A;  1LOY A;  3CXC 2;  1BRJ A;  2P09 A;  5CF2 A;  1M90 4;  3N8B A;  3FCS B;  4EBG A;  4KVH A;  1KSI A;  4XBX A;  1EUI C;  2WGO A;  3EN1 B;  3X41 A;  2HMK B;  4LEH A;  2BMR B;  2D1W A;  1GYB A;  4MJD A;  9RNT A;  5HOH A;  5AYS C;  1N9E A;  1FZU A;  1B2X A;  2KF3 A;  3NM7 A;  3JUM A;  1SJW A;  2F5M A;  1RGF A;  4J5K A;  1VQ8 3;  2CW9 A;  3FG3 A;  1RNB A;  3FH1 A;  1YJ9 3;  3JUQ A;  2O9U X;  3HIG A;  1RGC A;  2XSH B;  3LYG A;  1TUH A;  3DM8 A;  4NRE A;  2Y74 A;  3EBT A;  1DET A;  3V92 A;  1X1W A;  2HMN B;  1I3I A;  3F7X A;  3HOH A;  4HBR A;  3CCU 3;  3NBJ A;  1QVF 2;  1NJI 4;  3B4O A;  3CCJ 3;  3FSD A;  3AGO A;  7STD A;  1W01 A;  4STD A;  2P0M A;  3DGL A;  1TU5 A;  1G0T A;  1OCV A;  3SYU A;  2IMJ A;  6STD A;  5BIR A;  3UB1 A;  2W04 A;  1KD1 4;  3A5E A;  1W7C A;  4ILF A;  1M1X B;  2OCT A;  4J5G A;  2CG0 A;  3LT9 A;  3CNX A;  4PEJ A;  3WOE B;  2RCD A;  1Q40 B;  4EXR A;  2ZDJ A;  3GWR A;  3KFQ C;  3O8Y A;  5LC6 A;  5CK6 A;  1VZZ A;  3N54 B;  3STD A;  3NHX A;  5AYR B;  1JZD A;  1FGM A;  1C7H A;  2Z7A A;  1IVW A;  2I9W A;  3LTA A;  1B21 A;  3KCH A;  2HMM B;  3PS8 A;  3WDG B;  5LC7 A;  1E97 A;  2CWU A;  3D5G A;  1RGA A;  2E2V A;  3MPH A;  1B27 A;  1D6Z A;  2JDI H;  2KCD A;  1JBT A;  1BRH A;  2P0X A;  4BIR A;  3EC9 A;  1FGT A;  1OGX A;  3WOF B;  1V57 A;  2CWV A;  4G1M B;  5IG4 A;  1I0V A;  5ELU A;  2XGN A;  3CCR 3;  2BO9 B;  3GAX A;  1CQS A;  4XBY A;  3LTB A;  5AI1 A;  2K3D A;  1KC8 4;  1O7H B;  2Z77 A;  1TFO A;  2UUG C;  4U13 A;  1GY7 A;  1LNH A;  1DMN A;  1RLS A;  3WR2 A;  4J8T A;  4JF8 A;  1BSD A;  2PNC A;  5A0O B;  2UX0 A;  1N8Q A;  2P38 A;  1IQX A;  3NBB A;  4H61 A;  3GZB A;  4FMB A;  1A2P A;  1TTO A;  3V98 A;  3BB9 A;  4R9L A;  1PU4 A;  2BMO B;  1RMS A;  3GSP A;  1K41 A;  3ROB A;  1BRK A;  3ZG0 A;  1VQ7 3;  1IK3 A;  3CCL 3;  1W6Y A;  2C10 A;  2H0I A;  1G02 A;  1FUT A;  1AVL A;  1RGE A;  3NXJ A;  1HU9 A;  3OWY A;  2H0G A;  1YIT 3;  4GHO A;  3LOY A;  2W56 A;  3F7S A;  2CG1 A;  3GRD A;  1VQQ A;  3I55 3;  3B8L A;  2UGI A;  2H0H A;  3I0Y A;  4J9A A;  2W03 A;  3K5T A;  2K0M A;  1BSA A;  2WGQ A;  1B2S A;  2XR8 B;  5EQL A;  5M19 A;  2OTL 3;  1FYS A;  1GY6 A;  1TIJ A;  2CFL A;  1DYU A;  1R4Y A;  4HKV B;  2BIR A;  4JRF A;  1NWW A;  3FG1 A;  1F8N A;  1RGK A;  4EV5 A;  1VQK 3;  1O7N B;  2GU1 A;  1RCK A;  1B20 A;  1B3S A;  2CK3 H;  3EHC A;  1GS3 A;  2B24 B;  4CJN A;  2AAD A;  2AAE A;  3EN8 A;  1IDP A;  4MMY B;  3VGN A;  3K7C A;  1QJG A;  1WNH A;  3H51 A;  1GD4 A;  3KSE D;  2QIY A;  2BNG A;  4HZB B;  3UNL A;  1K9M 4;  2M7O A;  3AHW A;  5IEO A;  8CHO A;  8RNT A;  1OH0 A;  3HK4 A;  3WMD A;  1NB5 I;  1I70 A;  4K90 B;  5KP1 A;  1S72 3;  3SED A;  3L0R A;  1BVI A;  3G0K A;  4K1V A;  4OK0 A;  4OVM A;  3AHS A;  1X1Y A;  3S67 A;  1I2G A;  2D42 A;  2CFK A;  3OV4 A;  3I56 3;  1X1U A;  1VQ4 3;  1N9J A;  7RNT A;  3MG3 A;  1CEW I;  2C11 A;  1UUG B;  4O2H A;  2FNQ A;  1QAL A;  2F99 A;  3OWS A;  1TRP A;  3T0U A; 
#chains in the Genus database with same CATH homology
 1HZ1 A;  3AGO A;  2RBI A;  1RN1 A;  1BGS A;  1RHL A;  2KF5 A;  1I2E A;  3DGY A;  1PY3 A;  1GMQ A;  3SYU A;  1BSC A;  5BIR A;  2KAA A;  1X1X A;  3D4A A;  3A5E A;  4J5G A;  1TRQ A;  1BOX A;  2SAR A;  4RNT A;  1I3F A;  4GSP A;  1RTU A;  1BRS A;  1AY7 A;  1Q9E A;  1BIR A;  1B21 A;  2F5W A;  3KCH A;  1MGR A;  1GOV A;  1BU4 A;  5RNT A;  1C54 A;  3D5G A;  1RGA A;  1UCL A;  1JBS A;  1B27 A;  3URP A;  7GSP A;  1JBT A;  5GSP A;  1BRH A;  1HYF A;  1RNT A;  3RNT A;  4BIR A;  4HOH A;  2KF4 A;  1IYY A;  1I0V A;  1FW7 A;  4HAA A;  1BNE A;  1PYL A;  1BNR A;  1BUJ A;  1BAN A;  3DH2 A;  1BNF A;  1CH0 A;  1GMR A;  1RLS A;  3WR2 A;  1GOU A;  2F56 A;  1YGW A;  1BRG A;  1RGG A;  1B2M A;  1BSD A;  1B2Z A;  1I8V A;  1RGL A;  1SAR A;  1AQZ A;  1GOY A;  1BNJ A;  5BU4 A;  1A2P A;  1LRA A;  1RGH A;  1TTO A;  1T2I A;  3BIR A;  1LNI A;  1RMS A;  3GSP A;  3WHO A;  1YVS A;  3AGN A;  1B2U A;  1BRK A;  3D5I A;  1RCL A;  1MGW A;  1DE3 A;  2ZA4 A;  1BAO A;  1BNI A;  1JBR A;  1BSE A;  1G02 A;  1FUT A;  1GSP A;  1RGE A;  1T2H A;  4GHO A;  4BU4 A;  1I0X A;  3Q3F A;  1BRI A;  2GSP A;  1BSB A;  2RNT A;  3BU4 A;  2F4Y A;  2HOH A;  1FUS A;  1BSA A;  1YNV X;  1B2S A;  1RSN A;  1FYS A;  1LOW A;  1R4Y A;  1GMP A;  1LOY A;  2BIR A;  1BRJ A;  1RGK A;  1BNG A;  1UCI A;  1RCK A;  1UCK A;  1ZGX A;  2C4B A;  1B20 A;  1B3S A;  1RN4 A;  2AAD A;  2AAE A;  6RNT A;  9RNT A;  5HOH A;  1BRN L;  1FZU A;  1B2X A;  2KF3 A;  1I2F A;  6GSP A;  2KF6 A;  1LOV A;  2F5M A;  3AHW A;  1BNS A;  8RNT A;  1RGF A;  4J5K A;  1I70 A;  1RNB A;  1RDS A;  1BVI A;  3AHS A;  1X1Y A;  1I2G A;  1RGC A;  1X1U A;  2BU4 A;  7RNT A;  1DET A;  1UCJ A;  1X1W A;  3HOH A;  1I3I A;  1TRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...