1G02A

Ribonuclease t1 v16s mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDSSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title Hydrophobic core manipulations in ribonuclease T1.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2000-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1g02A00
3D5GA 3HOHA 1B27A 3WR2A 1JBRA 1B20A 1BOXA 1UCKA 5GSPA 1BSDA 9RNTA 1RGFA 1GOVA 3KCHA 1BRKA 1LOWA 2KAAA 1JBSA 3BU4A 1AY7A 1BSAA 1FUTA 2KF3A 4J5KA 1BNGA 1LNIA 1RGHA 1RN4A 3DGYA 2RNTA 1B2UA 3AGNA 1ZGXA 1RGLA 1BANA 1RNBA 1BNIA 1PY3A 5RNTA 2RBIA 1BUJA 1RN1A 1GMQA 1I2GA 3D4AA 1RHLA 1YVSA 1B2SA 1RGAA 1C54A 1BNEA 1RMSA 1RTUA 1T2IA 1B2XA 2GSPA 1FYSA 2BIRA 1BRHA 1BVIA 2KF6A 1X1UA 1CH0A 1BRIA 6GSPA 1R4YA 3WHOA 3AGOA 1I2FA 1I70A 1GMPA 1T2HA 2KF5A 1UCLA 2ZA4A 8RNTA 1RGEA 3GSPA 1B2ZA 1BAOA 1I3IA 1BSCA 1FUSA 3A5EA 1BSEA 1I2EA 1RSNA 1LOVA 1RNTA 1I0VA 1RCKA 4RNTA 4BU4A 1RDSA 1BGSA 2HOHA 1BNJA 1BNFA 3Q3FA 1RLSA 1MGWA 3DH2A 3AHSA 1GSPA 3RNTA 1G02A 2AADA 1GMRA 1DETA 2KF4A 2F56A 5HOHA 4HOHA 1UCIA 2BU4A 2F5WA 5BU4A 1HZ1A 7RNTA 7GSPA 1GOYA 1RGCA 1IYYA 2F4YA 1DE3A 1I8VA 1X1WA 3BIRA 1TTOA 3SYUA 1AQZA 1BRNL 5BIRA 1BRJA 1UCJA 1YGWA 3AHWA 1FW7A 4HAAA 1RGGA 4BIRA 1I0XA 1Q9EA 1B21A 1BNRA 2C4BA 1SARA 1YNVX 1MGRA 3URPA 1LRAA 1PYLA 1BSBA 1X1YA 4GHOA 4J5GA 1LOYA 1RCLA 1X1XA 1BRGA 2F5MA 1FZUA 1HYFA 4GSPA 2AAEA 1RGKA 1BIRA 1BNSA 1JBTA 1B2MA 1BRSA 1GOUA 1B3SA 1A2PA 1TRQA 1TRPA 2SARA 1BU4A 6RNTA 1I3FA 3D5IA
chains in the Genus database with same CATH superfamily
4HM2B 1TFOA 4H3UA 1JZDA 3EHCA 1JJ22 1B20A 2KCDA 3VF1A 1A67A 2BHMA 2W56A 2IYJA 4R9LA 1J2BA 1BSDA 1W2ZA 1N5HA 2BNGA 1PFPA 3B4PA 1JKGA 1VQN3 1FGTA 2MF7A 2OQEC 1LQGC 3LT8A 3KCHA 4FCJA 4XBXA 1LOWA 1A90A 3DUKA 1YIJ3 2XR8B 2OTL3 3WMDA 4K61A 1BSAA 3WODG 1JZOA 1FUTA 3NBRA 3CCV3 4AKZA 1N9JA 2GXFA 4XDVA 3DGYA 1B2UA 4KFEA 4KZ1A 1Q7HA 3EC9A 3NHXA 3GZYB 1SJWA 5G1KA 2BO9B 5EVHA 1PY3A 4CDLA 1O7NB 5M1AA 2W2CA 2RBIA 4NPBA 1N8R4 5TGNA 3S27A 1VQO3 3LOYA 3QRDA 3KSED 2UGIA 3NBBA 3UJMA 1T2IA 3KSPA 1G96A 1FYSA 2GSPA 2W03A 4STDA 4I5QA 2P0MA 3HIGA 5AIGA 2ML6A 3CCU3 2KF6A 4EC6A 1ULIB 2CW9A 1UI8A 4EV2A 1LXEA 3FF2A 4HM7B 3SOYA 3LTAA 1M1XB 3AGOA 1I2FA 2PZVA 1T2HA 2ZA4A 2MC8A 1OPYA 1UCLA 3PYJA 3Q2PA 1RGEA 3AMOA 3GSPA 3NXJA 8RNTA 5STDA 1CEWI 5JBSA 1WMNA 2CG1A 1I2EA 3WOEB 1PU4A 3JUNA 1IVUA 1TUHA 3WDGB 6STDA 3GZXB 2L4VA 1M904 2HOHA 4AEQA 4FCMA 3CD63 3NM2A 3PCSA 4HBRA 3K7CA 1RLSA 2E2TA 3DH2A 4K1UA 1VQL3 4I4KA 5AIIA 3WA3A 3QK9A 1K9M4 2AADA 1OGXA 2KF4A 3IPTA 2WO0A 1SPUA 3OXAA 1O7PB 3EB8A 3S28A 1YJ93 1K41A 4HOHA 1A2KA 1Z1SA 4KVHA 2BU4A 3D9RA 3I0YA 3OX9A 1YHQ3 3BNDA 2FXTA 3MPHA 1GOYA 1OHOA 2I9WA 4WHAA 3A76A 1YJW3 5BXQA 1Q824 1TTOA 1TFKA 2Z6BA 4XDWA 1IVXA 2HMJB 3BLZA 4ZM8A 2OOVC 5IW9A 4N6MA 5D81A 2W6JH 3OV4A 1YNVX 1MGRA 4H61A 1QALA 1QAFA 1U5OA 2LYXA 3CC43 1OUNA 1IU7A 2GEXA 3STDA 3CME3 4FMBA 2QA43 1KD14 3EBYA 3X42A 5AYSC 1X1XA 1OF5B 1O7HB 1FGOA 4NREA 1FZUA 1HYFA 3NX0A 1HKXA 2CFKA 3G4S3 4Q53A 1MOLA 3NV0B 1GYBA 4HZ9B 2HMOB 2JDIH 2YFIB 1B2MA 1BRSA 2CWTA 2H0GA 3HIIA 1TRPA 1A2PA 1TRQA 2SARA 4XB5A 5JPUA 1Q814 1AR0A 3K5TA 4KFFA 3GRDA 4XBTA 1RJOA 1O7WB 5D82A 2P38A 3D5GA 5KP4A 2ZDJA 1FW7A 3JUPA 1B27A 3WR2A 3CPOA 4ILFA 4FMCA 1UCKA 4N6TA 4CCVA 3EN1B 1N8QA 3GZBA 2ZHXB 1ZS7A 3SVAA 1TU5A 3S67A 3G8ZA 3X3ZA 5CK6A 9RNTA 2Y74A 2K3DA 4KT3B 1IQXA 2O9UX 3IMAB 3BU4A 3X41A 4WYKB 3ALAA 4HM3B 2CFDA 4GB5A 2JQ5A 1JN5A 4LMIA 3DZLA 3IJEB 3GZRA 1IK3A 1DVCA 1BNGA 2R4IA 3NQZA 1FA3A 3PGBA 1CQSA 2FGTA 3HK4A 3MYTA 8CHOA 4G1MB 1V58A 1VQQA 1MNLA 1M9GA 4MJDA 2F99A 1VQ93 2P09A 1CYUA 1O7GB 1RN1A 3CNXA 3D4AA 1RHLA 1K28A 1RGAA 5AIFA 1AVKA 3S29A 1RTUA 1W5ZA 2V1LA 1STDA 4LGQA 4R4KA 5DREA 1G0TA 3BNBA 3BNEA 2HMLB 3N8BA 4HM5B 2OQEA 1BRHA 2WGQA 3U1WA 2CFWA 1CH0A 3D3LA 1K734 1WMPA 1WTHA 1S5AA 2XF3A 3G16A 3X3YA 1KQS2 3WHOA 2BMRB 1SQWA 3FCSB 1GMPA 3D79A 1KSIA 5HGRA 1IQYA 1YGEA 3V92A 2ZL8A 1BAOA 1I3IA 1BSCA 1TP6A 5IF6A 1STFI 4NHFA 1VQ53 3A5EA 4OVMA 2A15A 1RSNA 3SEDA 4BTXA 4OUQA 4EW5A 4EV5A 3F40A 3HX8A 2E2UA 1RDSA 5CLKA 1W6CA 4GL6A 2XGNA 3CNMA 3FF0A 2GBWB 1BGSA 3EN8A 2W9QA 3CXC2 3Q90A 1VQK3 1K8A4 3ER7A 1D6UA 4L7KA 1RN7A 1Y4KA 1ISKA 1OH0A 1G02A 1GMRA 1DETA 2CG0A 3DXOA 3MKIA 2F56A 5HOHA 5IEPA 3B4OA 4O8SA 1Q864 2CK3H 3FG3A 1QVG2 2KXGA 3CCJ3 1NO3A 5BU4A 5EEOA 1M1K4 2RSXA 7GSPA 3N54B 4FMAA 1VQP3 3FKAA 3CCL3 3EF8A 3BIRA 3VGNA 1AQZA 2Z76A 2QGUA 2OTJ3 2CFLA 4HAAA 3LT9A 4U13A 1Q9EA 1N5PA 1ROVA 2Y73A 4R80A 2XRXB 4X2HA 1SARA 5JPPA 6RNTA 1T3BA 2B1XB 1YI23 1QVF2 3OWYA 2C11A 2K0MA 1PYLA 1W01A 1VQ73 1LQMB 1FUWA 3PS8A 2GU3A 1NWWA 3K9MC 1E3RA 4N6V0 3FH1A 5IG0A 4RNYA 3DM8A 2RCDA 3NUVA 2YFJB 3T8UA 1V57A 1TIJA 3KIIA 2XFSA 3LTBA 3N9HA 4O02B 1Q7Y4 1AV4A 1GY5A 2FNQA 3KE7A 1GY6A 4WP5A 5KP1A 5ELUA 2INXA 3EE1A 3JUOA 4LEHA 3X3XA 1I3FA 1YVBI 3D5IA 2XGLA 4N6LA 4L8OA 1RKYA 3F7SA 2OOVA 1JBRA 2GBXB 2IMJA 1GY7A 3E99A 4N6NB 3KFQC 1BOXA 3B8LA 5GSPA 3FSDA 1EKMA 1RGFA 5FGOA 1GOVA 2RGQA 1BRKA 7STDA 1Q42A 3UL6A 1U8CB 1SIIA 1TJDA 2CFGA 3F14A 1GD3A 1AY7A 3JUQA 4XM4A 1OF5A 5EQLA 2C10A 3CCE3 4IPBA 3EBTA 4J5KA 2YFLB 3NV0A 3CCR3 4WFOA 2RNTA 3NQYA 1GS3A 5IERA 3CPW2 1OGZA 4J9AA 1QJGA 3EJVA 1UUVB 1RNBA 1ULJB 2E2VA 3DMCA 2OCTA 1AVLA 1IVWA 1T5YA 2BT3A 3ROBA 3K63A 1L5GB 1EQKA 2BMQB 1BUJA 3LXUX 4FCZA 2ML5A 1D6YA 1FGQA 1EUIC 1ZX2A 1RMSA 1DYUA 4PEJA 1US1A 4FMDA 1OACA 2BIRA 1BVIA 3CC73 3V99A 2CHCA 4RZMA 1UW1A 2P05A 1BRIA 4WYKA 6GSPA 1Q40B 3JUMA 1QAKA 5AYRB 1ROAA 4ORLA 1NJI4 4HYZA 1YIT3 1D6ZA 1BSEA 4XBYA 4BL3A 3EQQB 3FG1A 1LVNA 2CH9A 1LOVA 1RCKA 4RNTA 3NBJA 1LOXA 1OHSA 3K0ZA 3ZG0A 1IV9A 1BNJA 4LYLB 3DY5A 1GD4A 3Q3FA 2CKFB 1W2B2 1F8NA 1MGWA 3ZFZA 4BL2A 3J7Yd 4HM4B 1FGRA 1GSPA 4JRFA 1C7HA 1LNHA 2B24B 3G6E3 2XSOB 4IIAA 1UGIA 3MSOA 3B7CA 1UCIA 5A0OB 3O8YA 3G713 4X2OA 2W9PA 3DGOA 1VQM3 1WQLB 3X40A 1JB4A 3GAXA 4AKYA 5IG3A 1RGCA 1ZO2A 1W6GA 3SYUA 2QEX3 5BIRA 1DVDA 4N3VA 4KFDA 4K1VA 1UCJA 5D83A 3WA2X 5IG5A 3FGYA 3PZWA 1RGGA 2CWVA 3FZWA 3MHEA 1HU9A 1I0XA 4O3VA 4QWTA 4BIRA 1B21A 1BNRA 2UUGC 3LTCA 2W56B 1W6YA 4IT7A 1BUQA 3T8NA 3URPA 2D1WA 1LRAA 1JKGB 3MG1A 1FGMA 4HM0B 4N6OB 1BSBA 3F9SA 3Q1CA 1MWSA 1IDPA 3OWUA 2GEYA 1RCLA 1EG9B 2IUKA 1BRGA 5G2GA 1EEJA 3RGRA 4EYCA 3HZPA 5DRVA 1VZZA 3M8CA 3UL5A 4GSPA 3PCRA 1IV7A 4DKIA 2Z7AA 1W4NA 1RGKA 3MWZA 1BNSA 1JBTA 3UB1A 1W7CA 2HMKB 5M18A 1CYVA 1B3SA 1GOUA 5AEWB 3DGLA 5LC6A 1NNVA 2XEPA 3G0KA 1RN4A 5KP3A 5AI1A 3HOHA 3CU3A 3CC23 1W00A 3GWRA 4FR9A 4R1KA 2OWPA 1SIHA 1JV2B 1MWTA 2Q07A 4R9KA 1DMMA 2HMMB 2IY2A 2KAAA 1DMQA 1JBSA 3LZAA 4MMZB 1VQ63 2L1SA 2H0HA 1WMOA 4J8TA 2KF3A 3AMOB 5BVBA 1LNIA 1RGHA 2CIUA 2RFRA 3U97A 3T0UA 1RRLA 1DMNA 1JB2A 3LH4A 2PNCA 1OCVA 1ZGXA 1RGLA 1BANA 1QMAA 1IT8A 2WOFA 3AGNA 1VQ83 2BMOB 1BNIA 5RNTA 1RRHA 5G1LA 1IT7A 1UI7A 1WNHA 3F8XA 1ASKA 3OWSA 1VQ43 1GMQA 1I2GA 1YVSA 1B2SA 2XH9A 1C54A 1R4CA 1BNEA 5AIHA 3KN4A 5IEOA 1B2XA 3CCM3 2Z77A 2M7OA 1N9EA 4JF8A 4HZBB 4RBNA 5CF2A 3CCQ3 2KRTA 1X1UA 3I553 4CJNA 1E97A 3SX1A 2CX0A 1R4YA 1YJN3 1I70A 4K90B 2QIYA 2KF5A 4HKVB 4LZIA 1A2VA 1B2ZA 3JVCA 3I563 3ZG5A 1FUSA 4EXRA 1NB3I 1UGHI 3RGAA 4HM1B 1UDII 2XSHB 1RNTA 1EA2A 1I0VA 4LSOA 4RNZA 2CWUA 1NDOB 3WOFB 3F7XA 2SBLA 4BU4A 5I97A 3PXMA 1JRQA 5M19A 1KWIA 2CC3A 3BB9A 3VSYA 1BNFA 3NM7A 3L0RA 4BTYA 3AHSA 3LYGA 3FLJA 3S5CA 3RNTA 1IVVA 3HI7A 2GU1A 2D42A 2WGOA 3EX9A 2IUJA 1JNQA 3DGNA 3KZTA 1OHPA 2F86B 2W04A 4N6UA 2STDA 2F5WA 1HZ1A 2K54A 2WOHA 1Q40A 7RNTA 2W0QA 3BNCA 1IYYA 2F4YA 1DE3A 3ECFA 3OW22 1I8VA 1X1WA 3MG2A 1BRNL 2CX1A 1UUWB 3H3HA 3CCS3 5CXOA 4O2HA 1NU3A 5IENA 1KC84 1BRJA 1V74A 2YX9A 1YGWA 3H51A 3AHWA 4HM6B 2P0XA 4WWUC 5ELJA 2J8XB 3DGMA 3LMLA 1E3VA 5IG4A 2H0IA 4HM8B 4CPKA 2C4BA 4L8PA 3KKGA 3MG3A 2HMNB 4MMYB 4TX4A 3SXXA 4HJLB 3CMA3 4J5GA 1W02A 1X1YA 4GHOA 3RDEA 4BTWA 3LTDA 1LOYA 2UX0A 2R41A 5AEUB 1MWRA 3FG4A 4HVNA 1S723 2IA7A 1JN5B 2F5MA 1MWUA 2O3OA 1JB5A 2LQVA 3SLUA 3TDGA 3UNLA 1NB5I 2AAEA 3SOAA 3F8HA 1IQ8A 4OK0A 5CF1A 1BIRA 4MMXB 2XFTA 5FW5A 4MEIA 5LC7A 2F98A 4EBGA 1BU4A 3V98A 1UUGB 1O7MB
chains in the Genus database with same CATH topology
3D5GA 3HOHA 1B27A 3WR2A 1JBRA 1B20A 1BOXA 1UCKA 5GSPA 1BSDA 9RNTA 1RGFA 1GOVA 3KCHA 1BRKA 1LOWA 2KAAA 1JBSA 3BU4A 1AY7A 1BSAA 1FUTA 2KF3A 4J5KA 1BNGA 1LNIA 1RGHA 1RN4A 3DGYA 2RNTA 1B2UA 3AGNA 1ZGXA 1RGLA 1BANA 1RNBA 1BNIA 1PY3A 5RNTA 2RBIA 1BUJA 1RN1A 1GMQA 1I2GA 3D4AA 1RHLA 1YVSA 1B2SA 1RGAA 1C54A 1BNEA 1RMSA 1RTUA 1T2IA 1B2XA 2GSPA 1FYSA 2BIRA 1BRHA 1BVIA 2KF6A 1X1UA 1CH0A 1BRIA 6GSPA 1R4YA 3WHOA 3AGOA 1I2FA 1I70A 1GMPA 1T2HA 2KF5A 1UCLA 2ZA4A 8RNTA 1RGEA 3GSPA 1B2ZA 1BAOA 1I3IA 1BSCA 1FUSA 3A5EA 1BSEA 1I2EA 1RSNA 1LOVA 1RNTA 1I0VA 1RCKA 4RNTA 4BU4A 1RDSA 1BGSA 2HOHA 1BNJA 1BNFA 3Q3FA 1RLSA 1MGWA 3DH2A 3AHSA 1GSPA 3RNTA 1G02A 2AADA 1GMRA 1DETA 2KF4A 2F56A 5HOHA 4HOHA 1UCIA 2BU4A 2F5WA 5BU4A 1HZ1A 7RNTA 7GSPA 1GOYA 1RGCA 1IYYA 2F4YA 1DE3A 1I8VA 1X1WA 3BIRA 1TTOA 3SYUA 1AQZA 1BRNL 5BIRA 1BRJA 1UCJA 1YGWA 3AHWA 1FW7A 4HAAA 1RGGA 4BIRA 1I0XA 1Q9EA 1B21A 1BNRA 2C4BA 1SARA 1YNVX 1MGRA 3URPA 1LRAA 1PYLA 1BSBA 1X1YA 4GHOA 4J5GA 1LOYA 1RCLA 1X1XA 1BRGA 2F5MA 1FZUA 1HYFA 4GSPA 2AAEA 1RGKA 1BIRA 1BNSA 1JBTA 1B2MA 1BRSA 1GOUA 1B3SA 1A2PA 1TRQA 1TRPA 2SARA 1BU4A 6RNTA 1I3FA 3D5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D5G A;  3HOH A;  1B27 A;  3WR2 A;  1JBR A;  1B20 A;  1BOX A;  1UCK A;  5GSP A;  1BSD A;  9RNT A;  1RGF A;  1GOV A;  3KCH A;  1BRK A;  1LOW A;  2KAA A;  1JBS A;  3BU4 A;  1AY7 A;  1BSA A;  1FUT A;  2KF3 A;  4J5K A;  1BNG A;  1LNI A;  1RGH A;  1RN4 A;  3DGY A;  2RNT A;  1B2U A;  3AGN A;  1ZGX A;  1RGL A;  1BAN A;  1RNB A;  1BNI A;  1PY3 A;  5RNT A;  2RBI A;  1BUJ A;  1RN1 A;  1GMQ A;  1I2G A;  3D4A A;  1RHL A;  1YVS A;  1B2S A;  1RGA A;  1C54 A;  1BNE A;  1RMS A;  1RTU A;  1T2I A;  1B2X A;  2GSP A;  1FYS A;  2BIR A;  1BRH A;  1BVI A;  2KF6 A;  1X1U A;  1CH0 A;  1BRI A;  6GSP A;  1R4Y A;  3WHO A;  3AGO A;  1I2F A;  1I70 A;  1GMP A;  1T2H A;  2KF5 A;  1UCL A;  2ZA4 A;  8RNT A;  1RGE A;  3GSP A;  1B2Z A;  1BAO A;  1I3I A;  1BSC A;  1FUS A;  3A5E A;  1BSE A;  1I2E A;  1RSN A;  1LOV A;  1RNT A;  1I0V A;  1RCK A;  4RNT A;  4BU4 A;  1RDS A;  1BGS A;  2HOH A;  1BNJ A;  1BNF A;  3Q3F A;  1RLS A;  1MGW A;  3DH2 A;  3AHS A;  1GSP A;  3RNT A;  1G02 A;  2AAD A;  1GMR A;  1DET A;  2KF4 A;  2F56 A;  5HOH A;  4HOH A;  1UCI A;  2BU4 A;  2F5W A;  5BU4 A;  1HZ1 A;  7RNT A;  7GSP A;  1GOY A;  1RGC A;  1IYY A;  2F4Y A;  1DE3 A;  1I8V A;  1X1W A;  3BIR A;  1TTO A;  3SYU A;  1AQZ A;  1BRN L;  5BIR A;  1BRJ A;  1UCJ A;  1YGW A;  3AHW A;  1FW7 A;  4HAA A;  1RGG A;  4BIR A;  1I0X A;  1Q9E A;  1B21 A;  1BNR A;  2C4B A;  1SAR A;  1YNV X;  1MGR A;  3URP A;  1LRA A;  1PYL A;  1BSB A;  1X1Y A;  4GHO A;  4J5G A;  1LOY A;  1RCL A;  1X1X A;  1BRG A;  2F5M A;  1FZU A;  1HYF A;  4GSP A;  2AAE A;  1RGK A;  1BIR A;  1BNS A;  1JBT A;  1B2M A;  1BRS A;  1GOU A;  1B3S A;  1A2P A;  1TRQ A;  1TRP A;  2SAR A;  1BU4 A;  6RNT A;  1I3F A;  3D5I A; 
#chains in the Genus database with same CATH topology
 4HM2 B;  1TFO A;  4H3U A;  1JZD A;  3EHC A;  1JJ2 2;  1B20 A;  2KCD A;  3VF1 A;  1A67 A;  2BHM A;  2W56 A;  2IYJ A;  4R9L A;  1J2B A;  1BSD A;  1W2Z A;  1N5H A;  2BNG A;  1PFP A;  3B4P A;  1JKG A;  1VQN 3;  1FGT A;  2MF7 A;  2OQE C;  1LQG C;  3LT8 A;  3KCH A;  4FCJ A;  4XBX A;  1LOW A;  1A90 A;  3DUK A;  1YIJ 3;  2XR8 B;  2OTL 3;  3WMD A;  4K61 A;  1BSA A;  3WOD G;  1JZO A;  1FUT A;  3NBR A;  3CCV 3;  4AKZ A;  1N9J A;  2GXF A;  4XDV A;  3DGY A;  1B2U A;  4KFE A;  4KZ1 A;  1Q7H A;  3EC9 A;  3NHX A;  3GZY B;  1SJW A;  5G1K A;  2BO9 B;  5EVH A;  1PY3 A;  4CDL A;  1O7N B;  5M1A A;  2W2C A;  2RBI A;  4NPB A;  1N8R 4;  5TGN A;  3S27 A;  1VQO 3;  3LOY A;  3QRD A;  3KSE D;  2UGI A;  3NBB A;  3UJM A;  1T2I A;  3KSP A;  1G96 A;  1FYS A;  2GSP A;  2W03 A;  4STD A;  4I5Q A;  2P0M A;  3HIG A;  5AIG A;  2ML6 A;  3CCU 3;  2KF6 A;  4EC6 A;  1ULI B;  2CW9 A;  1UI8 A;  4EV2 A;  1LXE A;  3FF2 A;  4HM7 B;  3SOY A;  3LTA A;  1M1X B;  3AGO A;  1I2F A;  2PZV A;  1T2H A;  2ZA4 A;  2MC8 A;  1OPY A;  1UCL A;  3PYJ A;  3Q2P A;  1RGE A;  3AMO A;  3GSP A;  3NXJ A;  8RNT A;  5STD A;  1CEW I;  5JBS A;  1WMN A;  2CG1 A;  1I2E A;  3WOE B;  1PU4 A;  3JUN A;  1IVU A;  1TUH A;  3WDG B;  6STD A;  3GZX B;  2L4V A;  1M90 4;  2HOH A;  4AEQ A;  4FCM A;  3CD6 3;  3NM2 A;  3PCS A;  4HBR A;  3K7C A;  1RLS A;  2E2T A;  3DH2 A;  4K1U A;  1VQL 3;  4I4K A;  5AII A;  3WA3 A;  3QK9 A;  1K9M 4;  2AAD A;  1OGX A;  2KF4 A;  3IPT A;  2WO0 A;  1SPU A;  3OXA A;  1O7P B;  3EB8 A;  3S28 A;  1YJ9 3;  1K41 A;  4HOH A;  1A2K A;  1Z1S A;  4KVH A;  2BU4 A;  3D9R A;  3I0Y A;  3OX9 A;  1YHQ 3;  3BND A;  2FXT A;  3MPH A;  1GOY A;  1OHO A;  2I9W A;  4WHA A;  3A76 A;  1YJW 3;  5BXQ A;  1Q82 4;  1TTO A;  1TFK A;  2Z6B A;  4XDW A;  1IVX A;  2HMJ B;  3BLZ A;  4ZM8 A;  2OOV C;  5IW9 A;  4N6M A;  5D81 A;  2W6J H;  3OV4 A;  1YNV X;  1MGR A;  4H61 A;  1QAL A;  1QAF A;  1U5O A;  2LYX A;  3CC4 3;  1OUN A;  1IU7 A;  2GEX A;  3STD A;  3CME 3;  4FMB A;  2QA4 3;  1KD1 4;  3EBY A;  3X42 A;  5AYS C;  1X1X A;  1OF5 B;  1O7H B;  1FGO A;  4NRE A;  1FZU A;  1HYF A;  3NX0 A;  1HKX A;  2CFK A;  3G4S 3;  4Q53 A;  1MOL A;  3NV0 B;  1GYB A;  4HZ9 B;  2HMO B;  2JDI H;  2YFI B;  1B2M A;  1BRS A;  2CWT A;  2H0G A;  3HII A;  1TRP A;  1A2P A;  1TRQ A;  2SAR A;  4XB5 A;  5JPU A;  1Q81 4;  1AR0 A;  3K5T A;  4KFF A;  3GRD A;  4XBT A;  1RJO A;  1O7W B;  5D82 A;  2P38 A;  3D5G A;  5KP4 A;  2ZDJ A;  1FW7 A;  3JUP A;  1B27 A;  3WR2 A;  3CPO A;  4ILF A;  4FMC A;  1UCK A;  4N6T A;  4CCV A;  3EN1 B;  1N8Q A;  3GZB A;  2ZHX B;  1ZS7 A;  3SVA A;  1TU5 A;  3S67 A;  3G8Z A;  3X3Z A;  5CK6 A;  9RNT A;  2Y74 A;  2K3D A;  4KT3 B;  1IQX A;  2O9U X;  3IMA B;  3BU4 A;  3X41 A;  4WYK B;  3ALA A;  4HM3 B;  2CFD A;  4GB5 A;  2JQ5 A;  1JN5 A;  4LMI A;  3DZL A;  3IJE B;  3GZR A;  1IK3 A;  1DVC A;  1BNG A;  2R4I A;  3NQZ A;  1FA3 A;  3PGB A;  1CQS A;  2FGT A;  3HK4 A;  3MYT A;  8CHO A;  4G1M B;  1V58 A;  1VQQ A;  1MNL A;  1M9G A;  4MJD A;  2F99 A;  1VQ9 3;  2P09 A;  1CYU A;  1O7G B;  1RN1 A;  3CNX A;  3D4A A;  1RHL A;  1K28 A;  1RGA A;  5AIF A;  1AVK A;  3S29 A;  1RTU A;  1W5Z A;  2V1L A;  1STD A;  4LGQ A;  4R4K A;  5DRE A;  1G0T A;  3BNB A;  3BNE A;  2HML B;  3N8B A;  4HM5 B;  2OQE A;  1BRH A;  2WGQ A;  3U1W A;  2CFW A;  1CH0 A;  3D3L A;  1K73 4;  1WMP A;  1WTH A;  1S5A A;  2XF3 A;  3G16 A;  3X3Y A;  1KQS 2;  3WHO A;  2BMR B;  1SQW A;  3FCS B;  1GMP A;  3D79 A;  1KSI A;  5HGR A;  1IQY A;  1YGE A;  3V92 A;  2ZL8 A;  1BAO A;  1I3I A;  1BSC A;  1TP6 A;  5IF6 A;  1STF I;  4NHF A;  1VQ5 3;  3A5E A;  4OVM A;  2A15 A;  1RSN A;  3SED A;  4BTX A;  4OUQ A;  4EW5 A;  4EV5 A;  3F40 A;  3HX8 A;  2E2U A;  1RDS A;  5CLK A;  1W6C A;  4GL6 A;  2XGN A;  3CNM A;  3FF0 A;  2GBW B;  1BGS A;  3EN8 A;  2W9Q A;  3CXC 2;  3Q90 A;  1VQK 3;  1K8A 4;  3ER7 A;  1D6U A;  4L7K A;  1RN7 A;  1Y4K A;  1ISK A;  1OH0 A;  1G02 A;  1GMR A;  1DET A;  2CG0 A;  3DXO A;  3MKI A;  2F56 A;  5HOH A;  5IEP A;  3B4O A;  4O8S A;  1Q86 4;  2CK3 H;  3FG3 A;  1QVG 2;  2KXG A;  3CCJ 3;  1NO3 A;  5BU4 A;  5EEO A;  1M1K 4;  2RSX A;  7GSP A;  3N54 B;  4FMA A;  1VQP 3;  3FKA A;  3CCL 3;  3EF8 A;  3BIR A;  3VGN A;  1AQZ A;  2Z76 A;  2QGU A;  2OTJ 3;  2CFL A;  4HAA A;  3LT9 A;  4U13 A;  1Q9E A;  1N5P A;  1ROV A;  2Y73 A;  4R80 A;  2XRX B;  4X2H A;  1SAR A;  5JPP A;  6RNT A;  1T3B A;  2B1X B;  1YI2 3;  1QVF 2;  3OWY A;  2C11 A;  2K0M A;  1PYL A;  1W01 A;  1VQ7 3;  1LQM B;  1FUW A;  3PS8 A;  2GU3 A;  1NWW A;  3K9M C;  1E3R A;  4N6V 0;  3FH1 A;  5IG0 A;  4RNY A;  3DM8 A;  2RCD A;  3NUV A;  2YFJ B;  3T8U A;  1V57 A;  1TIJ A;  3KII A;  2XFS A;  3LTB A;  3N9H A;  4O02 B;  1Q7Y 4;  1AV4 A;  1GY5 A;  2FNQ A;  3KE7 A;  1GY6 A;  4WP5 A;  5KP1 A;  5ELU A;  2INX A;  3EE1 A;  3JUO A;  4LEH A;  3X3X A;  1I3F A;  1YVB I;  3D5I A;  2XGL A;  4N6L A;  4L8O A;  1RKY A;  3F7S A;  2OOV A;  1JBR A;  2GBX B;  2IMJ A;  1GY7 A;  3E99 A;  4N6N B;  3KFQ C;  1BOX A;  3B8L A;  5GSP A;  3FSD A;  1EKM A;  1RGF A;  5FGO A;  1GOV A;  2RGQ A;  1BRK A;  7STD A;  1Q42 A;  3UL6 A;  1U8C B;  1SII A;  1TJD A;  2CFG A;  3F14 A;  1GD3 A;  1AY7 A;  3JUQ A;  4XM4 A;  1OF5 A;  5EQL A;  2C10 A;  3CCE 3;  4IPB A;  3EBT A;  4J5K A;  2YFL B;  3NV0 A;  3CCR 3;  4WFO A;  2RNT A;  3NQY A;  1GS3 A;  5IER A;  3CPW 2;  1OGZ A;  4J9A A;  1QJG A;  3EJV A;  1UUV B;  1RNB A;  1ULJ B;  2E2V A;  3DMC A;  2OCT A;  1AVL A;  1IVW A;  1T5Y A;  2BT3 A;  3ROB A;  3K63 A;  1L5G B;  1EQK A;  2BMQ B;  1BUJ A;  3LXU X;  4FCZ A;  2ML5 A;  1D6Y A;  1FGQ A;  1EUI C;  1ZX2 A;  1RMS A;  1DYU A;  4PEJ A;  1US1 A;  4FMD A;  1OAC A;  2BIR A;  1BVI A;  3CC7 3;  3V99 A;  2CHC A;  4RZM A;  1UW1 A;  2P05 A;  1BRI A;  4WYK A;  6GSP A;  1Q40 B;  3JUM A;  1QAK A;  5AYR B;  1ROA A;  4ORL A;  1NJI 4;  4HYZ A;  1YIT 3;  1D6Z A;  1BSE A;  4XBY A;  4BL3 A;  3EQQ B;  3FG1 A;  1LVN A;  2CH9 A;  1LOV A;  1RCK A;  4RNT A;  3NBJ A;  1LOX A;  1OHS A;  3K0Z A;  3ZG0 A;  1IV9 A;  1BNJ A;  4LYL B;  3DY5 A;  1GD4 A;  3Q3F A;  2CKF B;  1W2B 2;  1F8N A;  1MGW A;  3ZFZ A;  4BL2 A;  3J7Y d;  4HM4 B;  1FGR A;  1GSP A;  4JRF A;  1C7H A;  1LNH A;  2B24 B;  3G6E 3;  2XSO B;  4IIA A;  1UGI A;  3MSO A;  3B7C A;  1UCI A;  5A0O B;  3O8Y A;  3G71 3;  4X2O A;  2W9P A;  3DGO A;  1VQM 3;  1WQL B;  3X40 A;  1JB4 A;  3GAX A;  4AKY A;  5IG3 A;  1RGC A;  1ZO2 A;  1W6G A;  3SYU A;  2QEX 3;  5BIR A;  1DVD A;  4N3V A;  4KFD A;  4K1V A;  1UCJ A;  5D83 A;  3WA2 X;  5IG5 A;  3FGY A;  3PZW A;  1RGG A;  2CWV A;  3FZW A;  3MHE A;  1HU9 A;  1I0X A;  4O3V A;  4QWT A;  4BIR A;  1B21 A;  1BNR A;  2UUG C;  3LTC A;  2W56 B;  1W6Y A;  4IT7 A;  1BUQ A;  3T8N A;  3URP A;  2D1W A;  1LRA A;  1JKG B;  3MG1 A;  1FGM A;  4HM0 B;  4N6O B;  1BSB A;  3F9S A;  3Q1C A;  1MWS A;  1IDP A;  3OWU A;  2GEY A;  1RCL A;  1EG9 B;  2IUK A;  1BRG A;  5G2G A;  1EEJ A;  3RGR A;  4EYC A;  3HZP A;  5DRV A;  1VZZ A;  3M8C A;  3UL5 A;  4GSP A;  3PCR A;  1IV7 A;  4DKI A;  2Z7A A;  1W4N A;  1RGK A;  3MWZ A;  1BNS A;  1JBT A;  3UB1 A;  1W7C A;  2HMK B;  5M18 A;  1CYV A;  1B3S A;  1GOU A;  5AEW B;  3DGL A;  5LC6 A;  1NNV A;  2XEP A;  3G0K A;  1RN4 A;  5KP3 A;  5AI1 A;  3HOH A;  3CU3 A;  3CC2 3;  1W00 A;  3GWR A;  4FR9 A;  4R1K A;  2OWP A;  1SIH A;  1JV2 B;  1MWT A;  2Q07 A;  4R9K A;  1DMM A;  2HMM B;  2IY2 A;  2KAA A;  1DMQ A;  1JBS A;  3LZA A;  4MMZ B;  1VQ6 3;  2L1S A;  2H0H A;  1WMO A;  4J8T A;  2KF3 A;  3AMO B;  5BVB A;  1LNI A;  1RGH A;  2CIU A;  2RFR A;  3U97 A;  3T0U A;  1RRL A;  1DMN A;  1JB2 A;  3LH4 A;  2PNC A;  1OCV A;  1ZGX A;  1RGL A;  1BAN A;  1QMA A;  1IT8 A;  2WOF A;  3AGN A;  1VQ8 3;  2BMO B;  1BNI A;  5RNT A;  1RRH A;  5G1L A;  1IT7 A;  1UI7 A;  1WNH A;  3F8X A;  1ASK A;  3OWS A;  1VQ4 3;  1GMQ A;  1I2G A;  1YVS A;  1B2S A;  2XH9 A;  1C54 A;  1R4C A;  1BNE A;  5AIH A;  3KN4 A;  5IEO A;  1B2X A;  3CCM 3;  2Z77 A;  2M7O A;  1N9E A;  4JF8 A;  4HZB B;  4RBN A;  5CF2 A;  3CCQ 3;  2KRT A;  1X1U A;  3I55 3;  4CJN A;  1E97 A;  3SX1 A;  2CX0 A;  1R4Y A;  1YJN 3;  1I70 A;  4K90 B;  2QIY A;  2KF5 A;  4HKV B;  4LZI A;  1A2V A;  1B2Z A;  3JVC A;  3I56 3;  3ZG5 A;  1FUS A;  4EXR A;  1NB3 I;  1UGH I;  3RGA A;  4HM1 B;  1UDI I;  2XSH B;  1RNT A;  1EA2 A;  1I0V A;  4LSO A;  4RNZ A;  2CWU A;  1NDO B;  3WOF B;  3F7X A;  2SBL A;  4BU4 A;  5I97 A;  3PXM A;  1JRQ A;  5M19 A;  1KWI A;  2CC3 A;  3BB9 A;  3VSY A;  1BNF A;  3NM7 A;  3L0R A;  4BTY A;  3AHS A;  3LYG A;  3FLJ A;  3S5C A;  3RNT A;  1IVV A;  3HI7 A;  2GU1 A;  2D42 A;  2WGO A;  3EX9 A;  2IUJ A;  1JNQ A;  3DGN A;  3KZT A;  1OHP A;  2F86 B;  2W04 A;  4N6U A;  2STD A;  2F5W A;  1HZ1 A;  2K54 A;  2WOH A;  1Q40 A;  7RNT A;  2W0Q A;  3BNC A;  1IYY A;  2F4Y A;  1DE3 A;  3ECF A;  3OW2 2;  1I8V A;  1X1W A;  3MG2 A;  1BRN L;  2CX1 A;  1UUW B;  3H3H A;  3CCS 3;  5CXO A;  4O2H A;  1NU3 A;  5IEN A;  1KC8 4;  1BRJ A;  1V74 A;  2YX9 A;  1YGW A;  3H51 A;  3AHW A;  4HM6 B;  2P0X A;  4WWU C;  5ELJ A;  2J8X B;  3DGM A;  3LML A;  1E3V A;  5IG4 A;  2H0I A;  4HM8 B;  4CPK A;  2C4B A;  4L8P A;  3KKG A;  3MG3 A;  2HMN B;  4MMY B;  4TX4 A;  3SXX A;  4HJL B;  3CMA 3;  4J5G A;  1W02 A;  1X1Y A;  4GHO A;  3RDE A;  4BTW A;  3LTD A;  1LOY A;  2UX0 A;  2R41 A;  5AEU B;  1MWR A;  3FG4 A;  4HVN A;  1S72 3;  2IA7 A;  1JN5 B;  2F5M A;  1MWU A;  2O3O A;  1JB5 A;  2LQV A;  3SLU A;  3TDG A;  3UNL A;  1NB5 I;  2AAE A;  3SOA A;  3F8H A;  1IQ8 A;  4OK0 A;  5CF1 A;  1BIR A;  4MMX B;  2XFT A;  5FW5 A;  4MEI A;  5LC7 A;  2F98 A;  4EBG A;  1BU4 A;  3V98 A;  1UUG B;  1O7M B; 
#chains in the Genus database with same CATH homology
 3D5G A;  3HOH A;  1B27 A;  3WR2 A;  1JBR A;  1B20 A;  1BOX A;  1UCK A;  5GSP A;  1BSD A;  9RNT A;  1RGF A;  1GOV A;  3KCH A;  1BRK A;  1LOW A;  2KAA A;  1JBS A;  3BU4 A;  1AY7 A;  1BSA A;  1FUT A;  2KF3 A;  4J5K A;  1BNG A;  1LNI A;  1RGH A;  1RN4 A;  3DGY A;  2RNT A;  1B2U A;  3AGN A;  1ZGX A;  1RGL A;  1BAN A;  1RNB A;  1BNI A;  1PY3 A;  5RNT A;  2RBI A;  1BUJ A;  1RN1 A;  1GMQ A;  1I2G A;  3D4A A;  1RHL A;  1YVS A;  1B2S A;  1RGA A;  1C54 A;  1BNE A;  1RMS A;  1RTU A;  1T2I A;  1B2X A;  2GSP A;  1FYS A;  2BIR A;  1BRH A;  1BVI A;  2KF6 A;  1X1U A;  1CH0 A;  1BRI A;  6GSP A;  1R4Y A;  3WHO A;  3AGO A;  1I2F A;  1I70 A;  1GMP A;  1T2H A;  2KF5 A;  1UCL A;  2ZA4 A;  8RNT A;  1RGE A;  3GSP A;  1B2Z A;  1BAO A;  1I3I A;  1BSC A;  1FUS A;  3A5E A;  1BSE A;  1I2E A;  1RSN A;  1LOV A;  1RNT A;  1I0V A;  1RCK A;  4RNT A;  4BU4 A;  1RDS A;  1BGS A;  2HOH A;  1BNJ A;  1BNF A;  3Q3F A;  1RLS A;  1MGW A;  3DH2 A;  3AHS A;  1GSP A;  3RNT A;  1G02 A;  2AAD A;  1GMR A;  1DET A;  2KF4 A;  2F56 A;  5HOH A;  4HOH A;  1UCI A;  2BU4 A;  2F5W A;  5BU4 A;  1HZ1 A;  7RNT A;  7GSP A;  1GOY A;  1RGC A;  1IYY A;  2F4Y A;  1DE3 A;  1I8V A;  1X1W A;  3BIR A;  1TTO A;  3SYU A;  1AQZ A;  1BRN L;  5BIR A;  1BRJ A;  1UCJ A;  1YGW A;  3AHW A;  1FW7 A;  4HAA A;  1RGG A;  4BIR A;  1I0X A;  1Q9E A;  1B21 A;  1BNR A;  2C4B A;  1SAR A;  1YNV X;  1MGR A;  3URP A;  1LRA A;  1PYL A;  1BSB A;  1X1Y A;  4GHO A;  4J5G A;  1LOY A;  1RCL A;  1X1X A;  1BRG A;  2F5M A;  1FZU A;  1HYF A;  4GSP A;  2AAE A;  1RGK A;  1BIR A;  1BNS A;  1JBT A;  1B2M A;  1BRS A;  1GOU A;  1B3S A;  1A2P A;  1TRQ A;  1TRP A;  2SAR A;  1BU4 A;  6RNT A;  1I3F A;  3D5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...