3OX9A

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPRVEMVWNGQPSALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 35
structure length 128
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ox9A00
2HMLB 4IIAA 3EN8A 2XR8B 3RGAA 4J9AA 2R4IA 5G2GA 1C7HA 3I0YA 3CNMA 3HZPA 3GZYB 2YFJB 5AIFA 3F9SA 1DMNA 4J8TA 4CDLA 3OX9A 1HKXA 3NBRA 3JUPA 5JPPA 3CPOA 4L7KA 2OWPA 3D9RA 3G16A 1UUWB 5IENA 2QIYA 3BB9A 1TUHA 2GBWB 5IG3A 3EQQB 1OGXA 2B24B 3F8HA 1SJWA 2GEYA 3BLZA 3EBYA 4WYKB 3SOAA 1IDPA 2Z76A 3KZTA 1ISKA 4XB5A 4HZ9B 4H3UA 1OPYA 1O7GB 5EVHA 1TP6A 3S5CA 3T8UA 1QJGA 1GY7A 3MSOA 5IG4A 5CLKA 3NV0B 3ROBA 2B1XB 1O7HB 2K54A 3JUMA 4LEHA 1JKGA 3EC9A 3UJMA 1OUNA 1OGZA 1GS3A 3SEDA 1DMMA 2XSHB 4N3VA 3JUOA 1O7NB 3B4PA 2IMJA 1GY5A 3UNLA 2HMOB 3LYGA 2YFIB 4K1VA 3OXAA 1ASKA 4XBYA 3JUNA 3DM8A 1W6YA 1S5AA 3F7SA 1VZZA 3MYTA 3FH1A 4HZBB 3GZBA 4I4KA 1K41A 4HM6B 5AIIA 8CHOA 2BNGA 3M8CA 3VSYA 2GXFA 5D83A 2GBXB 3F8XA 3EF8A 3DMCA 2UX0A 1UUVB 5KP4A 3VGNA 4OUQA 4XM4A 4ORLA 4HM4B 5KP1A 2F98A 1OHSA 5AIHA 5JPUA 3NUVA 3DZLA 3ER7A 2YFLB 5AEUB 2I9WA 2HMKB 3OWUA 4XDVA 3MG2A 3E99A 1W02A 2XSOB 3ECFA 3RGRA 1JB5A 4X2HA 3DUKA 5CK6A 4HM7B 4X2OA 4HKVB 2STDA 4HM1B 3K7CA 2HMMB 1EA2A 3GZRA 3H3HA 1CQSA 4PEJA 2HMJB 1GYBA 3FZWA 4LGQA 2W2CA 4XBTA 1ZO2A 1A2KA 1JKGB 1O7MB 1QMAA 3KSPA 3CU3A 3GRDA 4FCJA 1OF5B 1JB4A 3FGYA 1STDA 1JB2A 3G0KA 4HVNA 1JN5B 1OHPA 3NXJA 5IEOA 5IERA 1OF5A 5CF2A 4U13A 1NWWA 3MKIA 1GY6A 1Q42A 5IF6A 4STDA 1JN5A 2Z77A 3KE7A 2CHCA 4R9KA 7STDA 3B8LA 2QGUA 5BXQA 5IG5A 3STDA 1W01A 4L8OA 2HMNB 1O7WB 2F99A 1NDOB 3F14A 3WMDA 5TGNA 4HM2B 5D82A 3B7CA 3FF0A 4HM3B 5STDA 3A76A 3FSDA 3EHCA 5BVBA 2JQ5A 5AI1A 3EX9A 2A15A 1ZX2A 3HK4A 3OWYA 3MHEA 4HM0B 2RFRA 4RZMA 2PZVA 3F40A 4FCMA 3OWSA 5CXOA 3CNXA 2F86B 4Q53A 2CKFB 4OVMA 4LMIA 3Q90A 3FKAA 4R1KA 1AR0A 5AEWB 4MJDA 1W00A 3EN1B 3B4OA 5FW5A 4XBXA 3KKGA 3FF2A 5HGRA 1ULJB 4GB5A 3T8NA 1NU3A 5AIGA 4KVHA 1E3RA 3DXOA 1U5OA 5D81A 1OHOA 1O7PB 1WQLB 3F7XA 4XDWA 1Q40B 1OCVA 4WWUC 3GZXB 5IEPA 2BMRB 5DRVA 3HX8A 4WYKA 3NHXA 1Q40A 3SOYA 5CF1A 1DMQA 3IPTA 3NM2A 4K1UA 3MG1A 1Z1SA 3LZAA 2GEXA 5KP3A 3EJVA 2Z7AA 3MG3A 3G8ZA 3NV0A 2INXA 2BMOB 1E97A 2RCDA 4WP5A 1E3VA 3FLJA 3K0ZA 1EG9B 4L8PA 5DREA 2RGQA 1ULIB 4HJLB 3GWRA 6STDA 4R9LA 3H51A 4HM8B 3JUQA 4HM5B 1OH0A 1BUQA 3EBTA 2XRXB 3OV4A 5IG0A 2BMQB
chains in the Genus database with same CATH superfamily
2HMLB 4IIAA 1MOLA 2CFWA 1STFI 2XR8B 3EN8A 3RGAA 3HI7A 3KCHA 4J9AA 3KSED 4N6V0 2R4IA 5G2GA 4BIRA 1C7HA 2CK3H 1RN1A 2XH9A 3I0YA 3CNMA 3K9MC 1CYVA 3G713 1BGSA 3HZPA 1IT7A 1SIHA 3BNCA 4AKYA 3GZYB 2MC8A 3CC23 1JNQA 2R41A 1RGFA 2YFJB 3GAXA 4N6TA 5AIFA 2P0MA 3F9SA 1CYUA 1WMPA 1DMNA 2KF4A 2ZL8A 4J8TA 3D3LA 1KD14 4FMDA 4CDLA 2OCTA 3PZWA 3OX9A 1RN4A 1I8VA 2UGIA 1NB3I 2W0QA 4EV2A 1HKXA 1MGRA 3NBRA 3UL6A 1MNLA 3JUPA 1JJ22 5JPPA 1G0TA 3CPOA 4L7KA 2BHMA 2OWPA 1YJW3 3D9RA 4N6OB 1LNIA 9RNTA 4BU4A 1LVNA 1RHLA 4FMCA 3G16A 1BSDA 3S28A 3ZG5A 1UUWB 1W6GA 1VQN3 1VQ43 5IENA 1B21A 2QIYA 5EEOA 1BRJA 1RNBA 3BB9A 4N6LA 1WMOA 3LTAA 1TUHA 4EW5A 3EB8A 1FUSA 3SVAA 1QVG2 1RCLA 1BAOA 7GSPA 2GBWB 1RRHA 4G1MB 5IG3A 1PY3A 3EQQB 1OGXA 1RGEA 3N9HA 1MGWA 1T5YA 2B24B 3F8HA 2CG1A 3AGNA 2XEPA 5HOHA 1SJWA 2GEYA 1WTHA 3BLZA 1TJDA 3EBYA 1W5ZA 3FG3A 4WYKB 3SOAA 1V74A 1X1XA 1FUTA 1EUIC 4EBGA 1V58A 1IDPA 2Z76A 3KZTA 3G6E3 3PYJA 4N6MA 2OOVA 1VQP3 1BNJA 1ISKA 4XB5A 4HZ9B 1RGLA 4H3UA 3D5IA 1OPYA 5M19A 2KAAA 1N8R4 1B27A 1I3IA 1O7GB 2QEX3 5EVHA 1M9GA 2WO0A 2GU1A 4O8SA 4KZ1A 4GL6A 3CCS3 1TP6A 1W2ZA 3S5CA 8RNTA 3T8UA 1QJGA 4RNZA 1GY7A 7RNTA 2LYXA 3MSOA 5IG4A 4NREA 1NB5I 5CLKA 1TIJA 3NV0B 4JF8A 5ELUA 3ROBA 3LTDA 2B1XB 4IT7A 1O7HB 1A67A 2K54A 3JUMA 1RGHA 1RTUA 1JKGA 3FCSB 4LEHA 1B2MA 4J5GA 2RBIA 3EC9A 3FG4A 1GSPA 1SARA 2RSXA 3CCQ3 1KSIA 1QALA 1UW1A 2E2VA 1MWTA 3UJMA 1OUNA 1N5PA 1OGZA 1GS3A 3BU4A 1IK3A 1KC84 3SEDA 3DGNA 2K0MA 5IW9A 2CWTA 1DMMA 2XSHB 1N9EA 3ZFZA 1BRGA 3CMA3 4N3VA 3JUOA 1O7NB 2Q07A 3B4PA 1JBSA 2IMJA 2CIUA 3KIIA 1VQ63 1GY5A 3UNLA 2O3OA 2HMOB 4HBRA 3LYGA 1RGGA 1W2B2 2YFIB 1IVXA 1AV4A 3MWZA 2D42A 3GSPA 1IQXA 3OXAA 4K1VA 1Q824 1ASKA 4N6NB 4FMBA 3URPA 4XBYA 3JUNA 3U97A 4AEQA 2E2TA 3DM8A 4KFDA 1W6YA 1RGKA 5FGOA 1VQ73 1S723 1S5AA 3F7SA 2XF3A 2IYJA 2J8XB 4CCVA 1VZZA 3MYTA 1Q9EA 3I553 3FH1A 4HZBB 3GZBA 5AYSC 1BNRA 1NO3A 2F56A 4I4KA 1K41A 4HM6B 2E2UA 1RGCA 5AIIA 3CC73 2Y73A 2BNGA 3M8CA 3S67A 1MWSA 3VSYA 8CHOA 1FUWA 1TFOA 2GXFA 5D83A 3CXC2 1ROVA 3CME3 2WOHA 2GBXB 3F8XA 5BU4A 3EF8A 2L1SA 3X40A 3DMCA 3UB1A 2UX0A 3WR2A 1YJN3 1UUVB 1I2GA 2MF7A 1GMPA 5KP4A 4FR9A 4R80A 1JV2B 1C54A 3VGNA 4OUQA 3LTBA 4XM4A 1IU7A 1VQQA 4ORLA 1GMQA 3S27A 1W4NA 4HM4B 5KP1A 2F98A 1OHSA 1I0XA 3V99A 4AKZA 1LOYA 5AIHA 5JPUA 5JBSA 2RNTA 1UCJA 2SBLA 1BNSA 3NUVA 3DZLA 3BIRA 1EKMA 3ER7A 3IMAB 3PCRA 2OQEA 2OTL3 1DETA 2YFLB 5AEUB 3X3ZA 2I9WA 5G1KA 1A90A 2BT3A 1US1A 2HMKB 1MWRA 1RJOA 3OWUA 3K5TA 2Y74A 4XDVA 3MG2A 1LOVA 1A2VA 3D79A 1VQL3 1Q814 1JBRA 1OACA 3E99A 1W02A 2IA7A 4NHFA 1BRSA 1Q7HA 2XSOB 3WODG 2FXTA 1I2EA 3ECFA 1ZS7A 3RGRA 2WOFA 1JB5A 2ZHXB 3HIGA 4X2HA 1VQK3 1I3FA 1G02A 2KF6A 2CWUA 4KT3B 5GSPA 3DUKA 1EQKA 2YX9A 3N8BA 1YJ93 1QVF2 5CK6A 4BTWA 1K28A 4HM7B 4X2OA 4EXRA 2F4YA 2M7OA 1KWIA 4HKVB 1FZUA 1UI8A 2STDA 3AMOB 4OK0A 1PYLA 4HM1B 3K7CA 4NPBA 2HMMB 1WNHA 1EA2A 3WDGB 3GZRA 1FGMA 1QAFA 4N6UA 3IJEB 4MMZB 3D4AA 3H3HA 1CQSA 4PEJA 3J7Yd 3DGMA 2HMJB 3SXXA 2P09A 1GYBA 2WGOA 3AMOA 1BRNL 1UDII 1FGTA 2OOVC 2ZDJA 2W2CA 3FZWA 2CG0A 4LGQA 4BTXA 4XBTA 1PU4A 1BU4A 1A2KA 1ZO2A 2CFLA 1UCLA 1JKGB 1QMAA 1O7MB 2CX0A 2FGTA 3CU3A 3KSPA 4O3VA 1RCKA 1YVSA 3PCSA 3EE1A 3D5GA 3GRDA 4FCJA 3X3XA 4ZM8A 1OF5B 1JB4A 1UCIA 2C11A 1BRIA 3DH2A 4CJNA 3BNBA 1RDSA 3FGYA 4QWTA 1RGAA 3RNTA 2K3DA 1GD3A 1STDA 1JB2A 3AGOA 1RKYA 5BIRA 1K8A4 3G0KA 1BVIA 2W9PA 4HVNA 1JN5B 1D6ZA 1UCKA 1GOYA 1OHPA 3NXJA 5IEOA 5IERA 1PFPA 2L4VA 2KXGA 4BL2A 1OF5A 1VQM3 5CF2A 4U13A 1JZOA 1AY7A 1NWWA 2CFKA 5M18A 1B20A 3MKIA 1GY6A 3SLUA 5LC6A 1Q42A 3NBJA 4TX4A 2W9QA 5IF6A 4STDA 2D1WA 1JN5A 1TFKA 2IUJA 2Z77A 3KE7A 1T2HA 2CHCA 2UUGC 1YGEA 2PNCA 2IY2A 3ZG0A 3DGOA 2ZA4A 4EYCA 3HIIA 2P0XA 2JDIH 3NM7A 4R9KA 7STDA 1D6UA 1WMNA 1FW7A 3B8LA 1FGQA 4WHAA 1RSNA 3CCV3 4J5KA 3CD63 3CPW2 1M1K4 3JVCA 3OW22 1AQZA 2QGUA 3X41A 3CCR3 1DE3A 5BXQA 1K9M4 1LRAA 5IG5A 3LMLA 4HAAA 4MMXB 6RNTA 1IT8A 3U1WA 3STDA 1L5GB 2CW9A 2F5MA 2XGNA 3A5EA 4EV5A 1NJI4 2CX1A 1RLSA 1W01A 4L8OA 3V98A 2HMNB 4O02B 1O7WB 2CFGA 3SX1A 2F99A 5G1LA 1NDOB 2XGLA 2W04A 1IVWA 1TTOA 3F14A 2LQVA 2BIRA 2V1LA 3WMDA 5TGNA 4DKIA 1M904 2CFDA 4HM2B 1BNEA 5D82A 3B7CA 3FF0A 2FNQA 4HM3B 1JBTA 1JRQA 5STDA 3A76A 3NX0A 4LYLB 3FSDA 1V57A 3EHCA 5BVBA 1N9JA 2JQ5A 1RMSA 2QA43 3ALAA 1W6CA 3CCL3 4KFEA 2W56B 1RNTA 1T3BA 1BNFA 3EX9A 3LOYA 4KFFA 4LZIA 5AI1A 1R4YA 2A15A 3FG1A 4BL3A 2W6JH 1B2SA 1ZX2A 3HK4A 3MHEA 2SARA 3OWYA 4HM0B 2RFRA 2H0GA 4HYZA 4RZMA 1JZDA 2PZVA 1HYFA 1B2ZA 1FGRA 4MEIA 3DY5A 1IVUA 2ML6A 1RN7A 3F40A 3L0RA 4GHOA 3CCM3 3LH4A 2XFSA 1VQ83 4FCMA 3OWSA 2W56A 5CXOA 1LOXA 3CNXA 1R4CA 1J2BA 4I5QA 2C4BA 1K734 2OQEC 2F86B 4RNYA 4H61A 2XFTA 3LXUX 4Q53A 1Q7Y4 2F5WA 2H0IA 1GD4A 3DGLA 4ILFA 3S29A 1N8QA 2CKFB 1IQYA 1GMRA 1BNGA 3KN4A 4OVMA 5AYRB 1NNVA 2Z6BA 4BTYA 4IPBA 4LMIA 1BOXA 1YI23 4K90B 3LT9A 3FKAA 3Q90A 4R1KA 1IYYA 3Q3FA 4JRFA 1DVDA 5LC7A 4K61A 3CCE3 2WGQA 1AR0A 1BSAA 5AEWB 4EC6A 1SIIA 1G96A 2P05A 5ELJA 1Q864 4MJDA 3QK9A 1W00A 1TU5A 3EN1B 3B4OA 3DGYA 1RRLA 5FW5A 3WA3A 3AHSA 4XBXA 4CPKA 1CEWI 1YNVX 3CC43 1ROAA 3V92A 1FGOA 3NQYA 1UGHI 1GOUA 1D6YA 1YHQ3 3KKGA 1DYUA 2GSPA 3FF2A 1UGIA 5HGRA 1ULJB 3PXMA 1LOWA 4GB5A 2CC3A 2KCDA 5M1AA 1NU3A 3T8NA 1KQS2 1BSCA 2KF5A 5AIGA 1AVLA 3LTCA 2GU3A 3WOFB 4KVHA 1N5HA 3QRDA 1E3RA 3DXOA 3WHOA 6GSPA 1U5OA 3NBBA 3HOHA 1HZ1A 1I2FA 5D81A 3WOEB 3BNDA 3NQZA 4WFOA 1FA3A 1OHOA 1T2IA 1M1XB 1O7PB 1WQLB 2HOHA 3F7XA 1VQ93 2AAEA 1GOVA 4XDWA 5I97A 1VQ53 1BANA 1YGWA 1IQ8A 4O2HA 1UUGB 1Q40B 1OCVA 2O9UX 5RNTA 2C10A 1BRKA 1ZGXA 4WWUC 1LQMB 2W03A 1FYSA 5EQLA 3GZXB 5IEPA 2BMRB 1B2XA 5DRVA 2IUKA 3BNEA 3HX8A 1LQGC 4WYKA 3NHXA 1Q40A 1U8CB 1W7CA 3X42A 3N54B 4MMYB 2ML5A 1YVBI 1TRQA 1I70A 3Q1CA 4RNTA 3MPHA 3SOYA 5CF1A 1DMQA 3IPTA 1YIT3 3NM2A 4K1UA 2BU4A 3MG1A 4FMAA 1Z1SA 3UL5A 3LZAA 2CH9A 2GEXA 3VF1A 5KP3A 3EJVA 2CWVA 5A0OB 2AADA 1UI7A 2Z7AA 1AVKA 1QAKA 2BO9B 1X1YA 3MG3A 1SPUA 1YIJ3 1BUJA 3I563 3G8ZA 3Q2PA 3NV0A 1SQWA 1CH0A 2P38A 3TDGA 2INXA 1MWUA 1A2PA 4HOHA 2BMOB 1IVVA 1LNHA 2H0HA 2KF3A 1E97A 1F8NA 2RCDA 3X3YA 4WP5A 3O8YA 2OTJ3 1E3VA 3FLJA 3K0ZA 1EEJA 1EG9B 4L8PA 5DREA 3RDEA 2RGQA 1BRHA 1ULIB 3AHWA 1TRPA 4HJLB 3KFQC 1IV9A 3CCU3 3SYUA 1IV7A 1X1UA 1X1WA 1B2UA 3CCJ3 3LT8A 1DVCA 4R4KA 3GWRA 1BNIA 3K63A 6STDA 4R9LA 1LXEA 1BIRA 3H51A 4HM8B 3JUQA 3WA2X 4HM5B 1OH0A 1BUQA 2KRTA 4LSOA 1BSBA 1HU9A 2XRXB 3EBTA 1VQO3 3PS8A 1Y4KA 1BSEA 4GSPA 3T0UA 3OV4A 5IG0A 2BMQB 3G4S3 3PGBA 4FCZA 4RBNA 1I0VA 1B3SA
chains in the Genus database with same CATH topology
2HMLB 4IIAA 1MOLA 2CFWA 1STFI 2XR8B 3EN8A 3RGAA 3HI7A 4J9AA 3KSED 4N6V0 2R4IA 5G2GA 1C7HA 2CK3H 2XH9A 3I0YA 3CNMA 3K9MC 1CYVA 3G713 3HZPA 1IT7A 1SIHA 3BNCA 4AKYA 3GZYB 2MC8A 3CC23 1JNQA 2YFJB 3GAXA 4N6TA 5AIFA 2P0MA 3F9SA 1CYUA 1WMPA 1DMNA 2ZL8A 4J8TA 3D3LA 1KD14 4FMDA 4CDLA 2OCTA 3PZWA 3OX9A 2W0QA 1NB3I 4EV2A 1HKXA 3NBRA 3UL6A 1JJ22 1MNLA 3JUPA 5JPPA 3CPOA 4L7KA 2BHMA 2OWPA 1YJW3 3D9RA 4N6OB 1LVNA 4FMCA 3G16A 3S28A 1UUWB 1W6GA 1VQN3 1VQ43 5IENA 2QIYA 5EEOA 3BB9A 4N6LA 1WMOA 3LTAA 1TUHA 3EB8A 3SVAA 1QVG2 2GBWB 1RRHA 4G1MB 5IG3A 3EQQB 1OGXA 3N9HA 1T5YA 2B24B 3F8HA 2CG1A 2XEPA 1SJWA 2GEYA 1WTHA 3BLZA 3EBYA 1W5ZA 3FG3A 4WYKB 3SOAA 1V74A 4EBGA 3G6E3 1IDPA 2Z76A 3KZTA 3PYJA 4N6MA 2OOVA 1VQP3 1ISKA 4XB5A 4HZ9B 4H3UA 1OPYA 1O7GB 2QEX3 5EVHA 1M9GA 2WO0A 2GU1A 4O8SA 4KZ1A 4GL6A 3CCS3 1TP6A 1W2ZA 3S5CA 3T8UA 1QJGA 4RNZA 1GY7A 2LYXA 3MSOA 5IG4A 4NREA 1NB5I 5CLKA 1TIJA 3NV0B 4JF8A 5ELUA 3ROBA 3LTDA 2B1XB 4IT7A 1O7HB 1A67A 2K54A 3JUMA 4LEHA 3FCSB 1JKGA 3EC9A 3FG4A 2RSXA 3CCQ3 1KSIA 1QALA 1UW1A 2E2VA 3UJMA 1OUNA 1N5PA 1OGZA 1GS3A 1IK3A 1KC84 3SEDA 3DGNA 2K0MA 5IW9A 2CWTA 1DMMA 2XSHB 1N9EA 3CMA3 4N3VA 3JUOA 1O7NB 2Q07A 3B4PA 2IMJA 2CIUA 3KIIA 1VQ63 1GY5A 3UNLA 2O3OA 2HMOB 4HBRA 3LYGA 1W2B2 2YFIB 1IVXA 1AV4A 3MWZA 2D42A 3OXAA 1IQXA 4K1VA 1Q824 1ASKA 4N6NB 4FMBA 4XBYA 3JUNA 3U97A 4AEQA 2E2TA 3DM8A 4KFDA 1W6YA 5FGOA 1VQ73 1S723 1S5AA 3F7SA 2XF3A 4CCVA 1VZZA 3MYTA 3I553 3FH1A 4HZBB 3GZBA 5AYSC 1NO3A 4I4KA 1K41A 4HM6B 2E2UA 5AIIA 3CC73 2Y73A 2BNGA 3M8CA 3S67A 3VSYA 8CHOA 1FUWA 1TFOA 2GXFA 5D83A 3CXC2 1ROVA 3CME3 2WOHA 2GBXB 3F8XA 3EF8A 3X40A 3DMCA 3UB1A 2UX0A 1YJN3 1UUVB 2MF7A 5KP4A 4FR9A 4R80A 1JV2B 3VGNA 4OUQA 3LTBA 4XM4A 1IU7A 4ORLA 3S27A 1W4NA 4HM4B 5KP1A 2F98A 1OHSA 3V99A 4AKZA 5AIHA 5JPUA 5JBSA 2SBLA 3NUVA 3DZLA 3IMAB 1EKMA 3ER7A 3PCRA 2OQEA 2OTL3 2YFLB 5AEUB 3X3ZA 2I9WA 1A90A 2BT3A 1US1A 2HMKB 1RJOA 3OWUA 3K5TA 2Y74A 4XDVA 3MG2A 1A2VA 1VQL3 1Q814 1OACA 3E99A 1W02A 2IA7A 4NHFA 2XSOB 3WODG 2FXTA 3ECFA 3RGRA 2WOFA 1JB5A 3HIGA 4X2HA 1VQK3 2CWUA 3DUKA 1EQKA 2YX9A 3N8BA 1YJ93 1QVF2 5CK6A 4BTWA 1K28A 4HM7B 4X2OA 4EXRA 2M7OA 1KWIA 4HKVB 1UI8A 2STDA 3AMOB 4OK0A 4HM1B 3K7CA 2HMMB 1WNHA 1EA2A 3WDGB 3GZRA 1FGMA 1QAFA 4N6UA 3IJEB 4MMZB 3H3HA 1CQSA 4PEJA 3J7Yd 3DGMA 2HMJB 3SXXA 2P09A 1GYBA 2WGOA 3AMOA 2ZDJA 1FGTA 2OOVC 3FZWA 2W2CA 4LGQA 2CG0A 4BTXA 1PU4A 4XBTA 1ZO2A 1A2KA 2CFLA 1JKGB 1QMAA 1O7MB 2FGTA 3CU3A 3KSPA 4O3VA 3PCSA 3EE1A 3GRDA 4FCJA 3X3XA 4ZM8A 1OF5B 1JB4A 2C11A 3BNBA 3FGYA 4QWTA 1GD3A 1STDA 1JB2A 1RKYA 1K8A4 3G0KA 2W9PA 4HVNA 1JN5B 1D6ZA 1OHPA 3NXJA 5IEOA 5IERA 1PFPA 2L4VA 2KXGA 1OF5A 1VQM3 5CF2A 4U13A 1NWWA 2CFKA 3MKIA 1GY6A 3SLUA 5LC6A 1Q42A 3NBJA 4TX4A 2W9QA 5IF6A 4STDA 2D1WA 1JN5A 1TFKA 2IUJA 2Z77A 3KE7A 2CHCA 1YGEA 2PNCA 3DGOA 4EYCA 3HIIA 2P0XA 2JDIH 3NM7A 4R9KA 7STDA 1D6UA 1WMNA 3B8LA 1FGQA 4WHAA 3CCV3 3CD63 3CPW2 1M1K4 3JVCA 3OW22 2QGUA 3X41A 3CCR3 5BXQA 1K9M4 5IG5A 3LMLA 4MMXB 1IT8A 3U1WA 3STDA 1L5GB 2CW9A 2XGNA 4EV5A 1NJI4 1W01A 4L8OA 3V98A 2HMNB 4O02B 1O7WB 2CFGA 3SX1A 2F99A 1NDOB 2XGLA 2W04A 1IVWA 3F14A 2LQVA 2V1LA 3WMDA 5TGNA 1M904 2CFDA 4HM2B 5D82A 3B7CA 3FF0A 2FNQA 4HM3B 1JRQA 5STDA 3A76A 3NX0A 3FSDA 3EHCA 5BVBA 1N9JA 2JQ5A 2QA43 3ALAA 1W6CA 3CCL3 4KFEA 2W56B 4KFFA 3LOYA 3EX9A 4LZIA 5AI1A 2A15A 3FG1A 2W6JH 1ZX2A 3HK4A 3OWYA 3MHEA 4HM0B 4JRFA 2RFRA 4HYZA 4RZMA 2PZVA 1FGRA 4MEIA 3DY5A 1IVUA 2ML6A 1RN7A 3F40A 3L0RA 3CCM3 3LH4A 2XFSA 1VQ83 4FCMA 3OWSA 2W56A 5CXOA 1LOXA 3CNXA 1R4CA 1J2BA 1K734 2OQEC 2F86B 4RNYA 4H61A 2XFTA 3LXUX 4Q53A 1Q7Y4 3DGLA 1GD4A 3S29A 1N8QA 2CKFB 1IQYA 4OVMA 3KN4A 5AYRB 2Z6BA 4BTYA 4IPBA 4LMIA 1YI23 4K90B 3LT9A 3FKAA 3Q90A 4R1KA 1DVDA 5LC7A 4K61A 3CCE3 2WGQA 1AR0A 5AEWB 4EC6A 1SIIA 1G96A 2P05A 5ELJA 1Q864 4MJDA 3QK9A 1W00A 1TU5A 3EN1B 3B4OA 1RRLA 5FW5A 3WA3A 4XBXA 1CEWI 3CC43 1ROAA 3V92A 1FGOA 3NQYA 1D6YA 1YHQ3 3KKGA 1DYUA 3FF2A 5HGRA 1ULJB 3PXMA 4GB5A 2CC3A 2KCDA 3T8NA 1NU3A 1KQS2 5AIGA 1AVLA 3LTCA 2GU3A 3WOFB 4KVHA 1N5HA 3QRDA 1E3RA 3DXOA 1U5OA 3NBBA 5D81A 3WOEB 3BNDA 3NQZA 4WFOA 1FA3A 1OHOA 1M1XB 1O7PB 1WQLB 3F7XA 1VQ93 4XDWA 5I97A 1VQ53 1IQ8A 4O2HA 1Q40B 1OCVA 2O9UX 2C10A 4WWUC 2W03A 5EQLA 3GZXB 5IEPA 2BMRB 5DRVA 2IUKA 3BNEA 3HX8A 4WYKA 3NHXA 1Q40A 1U8CB 1W7CA 3X42A 3N54B 4MMYB 2ML5A 1YVBI 3Q1CA 3SOYA 3MPHA 5CF1A 1DMQA 3IPTA 1YIT3 3NM2A 4K1UA 3MG1A 4FMAA 1Z1SA 3UL5A 3LZAA 2CH9A 2GEXA 3VF1A 5KP3A 3EJVA 2CWVA 5A0OB 1UI7A 2Z7AA 1AVKA 1QAKA 2BO9B 1YIJ3 3MG3A 1SPUA 3I563 3G8ZA 3Q2PA 3NV0A 1SQWA 2P38A 3TDGA 2INXA 2BMOB 1IVVA 1LNHA 3X3YA 1E97A 1F8NA 2RCDA 2OTJ3 4WP5A 3O8YA 1E3VA 3FLJA 3K0ZA 1EG9B 4L8PA 5DREA 3RDEA 2RGQA 1ULIB 4HJLB 3KFQC 1IV9A 3CCU3 1IV7A 3CCJ3 3LT8A 1DVCA 4R4KA 3GWRA 3K63A 6STDA 4R9LA 1LXEA 3H51A 4HM8B 3JUQA 3WA2X 4HM5B 1OH0A 1BUQA 2KRTA 4LSOA 3EBTA 1HU9A 2XRXB 1VQO3 3PS8A 1Y4KA 3T0UA 3OV4A 5IG0A 2BMQB 3G4S3 3PGBA 4FCZA 4RBNA 1N8R4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HML B;  4IIA A;  3EN8 A;  2XR8 B;  3RGA A;  4J9A A;  2R4I A;  5G2G A;  1C7H A;  3I0Y A;  3CNM A;  3HZP A;  3GZY B;  2YFJ B;  5AIF A;  3F9S A;  1DMN A;  4J8T A;  4CDL A;  3OX9 A;  1HKX A;  3NBR A;  3JUP A;  5JPP A;  3CPO A;  4L7K A;  2OWP A;  3D9R A;  3G16 A;  1UUW B;  5IEN A;  2QIY A;  3BB9 A;  1TUH A;  2GBW B;  5IG3 A;  3EQQ B;  1OGX A;  2B24 B;  3F8H A;  1SJW A;  2GEY A;  3BLZ A;  3EBY A;  4WYK B;  3SOA A;  1IDP A;  2Z76 A;  3KZT A;  1ISK A;  4XB5 A;  4HZ9 B;  4H3U A;  1OPY A;  1O7G B;  5EVH A;  1TP6 A;  3S5C A;  3T8U A;  1QJG A;  1GY7 A;  3MSO A;  5IG4 A;  5CLK A;  3NV0 B;  3ROB A;  2B1X B;  1O7H B;  2K54 A;  3JUM A;  4LEH A;  1JKG A;  3EC9 A;  3UJM A;  1OUN A;  1OGZ A;  1GS3 A;  3SED A;  1DMM A;  2XSH B;  4N3V A;  3JUO A;  1O7N B;  3B4P A;  2IMJ A;  1GY5 A;  3UNL A;  2HMO B;  3LYG A;  2YFI B;  4K1V A;  3OXA A;  1ASK A;  4XBY A;  3JUN A;  3DM8 A;  1W6Y A;  1S5A A;  3F7S A;  1VZZ A;  3MYT A;  3FH1 A;  4HZB B;  3GZB A;  4I4K A;  1K41 A;  4HM6 B;  5AII A;  8CHO A;  2BNG A;  3M8C A;  3VSY A;  2GXF A;  5D83 A;  2GBX B;  3F8X A;  3EF8 A;  3DMC A;  2UX0 A;  1UUV B;  5KP4 A;  3VGN A;  4OUQ A;  4XM4 A;  4ORL A;  4HM4 B;  5KP1 A;  2F98 A;  1OHS A;  5AIH A;  5JPU A;  3NUV A;  3DZL A;  3ER7 A;  2YFL B;  5AEU B;  2I9W A;  2HMK B;  3OWU A;  4XDV A;  3MG2 A;  3E99 A;  1W02 A;  2XSO B;  3ECF A;  3RGR A;  1JB5 A;  4X2H A;  3DUK A;  5CK6 A;  4HM7 B;  4X2O A;  4HKV B;  2STD A;  4HM1 B;  3K7C A;  2HMM B;  1EA2 A;  3GZR A;  3H3H A;  1CQS A;  4PEJ A;  2HMJ B;  1GYB A;  3FZW A;  4LGQ A;  2W2C A;  4XBT A;  1ZO2 A;  1A2K A;  1JKG B;  1O7M B;  1QMA A;  3KSP A;  3CU3 A;  3GRD A;  4FCJ A;  1OF5 B;  1JB4 A;  3FGY A;  1STD A;  1JB2 A;  3G0K A;  4HVN A;  1JN5 B;  1OHP A;  3NXJ A;  5IEO A;  5IER A;  1OF5 A;  5CF2 A;  4U13 A;  1NWW A;  3MKI A;  1GY6 A;  1Q42 A;  5IF6 A;  4STD A;  1JN5 A;  2Z77 A;  3KE7 A;  2CHC A;  4R9K A;  7STD A;  3B8L A;  2QGU A;  5BXQ A;  5IG5 A;  3STD A;  1W01 A;  4L8O A;  2HMN B;  1O7W B;  2F99 A;  1NDO B;  3F14 A;  3WMD A;  5TGN A;  4HM2 B;  5D82 A;  3B7C A;  3FF0 A;  4HM3 B;  5STD A;  3A76 A;  3FSD A;  3EHC A;  5BVB A;  2JQ5 A;  5AI1 A;  3EX9 A;  2A15 A;  1ZX2 A;  3HK4 A;  3OWY A;  3MHE A;  4HM0 B;  2RFR A;  4RZM A;  2PZV A;  3F40 A;  4FCM A;  3OWS A;  5CXO A;  3CNX A;  2F86 B;  4Q53 A;  2CKF B;  4OVM A;  4LMI A;  3Q90 A;  3FKA A;  4R1K A;  1AR0 A;  5AEW B;  4MJD A;  1W00 A;  3EN1 B;  3B4O A;  5FW5 A;  4XBX A;  3KKG A;  3FF2 A;  5HGR A;  1ULJ B;  4GB5 A;  3T8N A;  1NU3 A;  5AIG A;  4KVH A;  1E3R A;  3DXO A;  1U5O A;  5D81 A;  1OHO A;  1O7P B;  1WQL B;  3F7X A;  4XDW A;  1Q40 B;  1OCV A;  4WWU C;  3GZX B;  5IEP A;  2BMR B;  5DRV A;  3HX8 A;  4WYK A;  3NHX A;  1Q40 A;  3SOY A;  5CF1 A;  1DMQ A;  3IPT A;  3NM2 A;  4K1U A;  3MG1 A;  1Z1S A;  3LZA A;  2GEX A;  5KP3 A;  3EJV A;  2Z7A A;  3MG3 A;  3G8Z A;  3NV0 A;  2INX A;  2BMO B;  1E97 A;  2RCD A;  4WP5 A;  1E3V A;  3FLJ A;  3K0Z A;  1EG9 B;  4L8P A;  5DRE A;  2RGQ A;  1ULI B;  4HJL B;  3GWR A;  6STD A;  4R9L A;  3H51 A;  4HM8 B;  3JUQ A;  4HM5 B;  1OH0 A;  1BUQ A;  3EBT A;  2XRX B;  3OV4 A;  5IG0 A;  2BMQ B; 
#chains in the Genus database with same CATH topology
 2HML B;  4IIA A;  1MOL A;  2CFW A;  1STF I;  2XR8 B;  3EN8 A;  3RGA A;  3HI7 A;  3KCH A;  4J9A A;  3KSE D;  4N6V 0;  2R4I A;  5G2G A;  4BIR A;  1C7H A;  2CK3 H;  1RN1 A;  2XH9 A;  3I0Y A;  3CNM A;  3K9M C;  1CYV A;  3G71 3;  1BGS A;  3HZP A;  1IT7 A;  1SIH A;  3BNC A;  4AKY A;  3GZY B;  2MC8 A;  3CC2 3;  1JNQ A;  2R41 A;  1RGF A;  2YFJ B;  3GAX A;  4N6T A;  5AIF A;  2P0M A;  3F9S A;  1CYU A;  1WMP A;  1DMN A;  2KF4 A;  2ZL8 A;  4J8T A;  3D3L A;  1KD1 4;  4FMD A;  4CDL A;  2OCT A;  3PZW A;  3OX9 A;  1RN4 A;  1I8V A;  2UGI A;  1NB3 I;  2W0Q A;  4EV2 A;  1HKX A;  1MGR A;  3NBR A;  3UL6 A;  1MNL A;  3JUP A;  1JJ2 2;  5JPP A;  1G0T A;  3CPO A;  4L7K A;  2BHM A;  2OWP A;  1YJW 3;  3D9R A;  4N6O B;  1LNI A;  9RNT A;  4BU4 A;  1LVN A;  1RHL A;  4FMC A;  3G16 A;  1BSD A;  3S28 A;  3ZG5 A;  1UUW B;  1W6G A;  1VQN 3;  1VQ4 3;  5IEN A;  1B21 A;  2QIY A;  5EEO A;  1BRJ A;  1RNB A;  3BB9 A;  4N6L A;  1WMO A;  3LTA A;  1TUH A;  4EW5 A;  3EB8 A;  1FUS A;  3SVA A;  1QVG 2;  1RCL A;  1BAO A;  7GSP A;  2GBW B;  1RRH A;  4G1M B;  5IG3 A;  1PY3 A;  3EQQ B;  1OGX A;  1RGE A;  3N9H A;  1MGW A;  1T5Y A;  2B24 B;  3F8H A;  2CG1 A;  3AGN A;  2XEP A;  5HOH A;  1SJW A;  2GEY A;  1WTH A;  3BLZ A;  1TJD A;  3EBY A;  1W5Z A;  3FG3 A;  4WYK B;  3SOA A;  1V74 A;  1X1X A;  1FUT A;  1EUI C;  4EBG A;  1V58 A;  1IDP A;  2Z76 A;  3KZT A;  3G6E 3;  3PYJ A;  4N6M A;  2OOV A;  1VQP 3;  1BNJ A;  1ISK A;  4XB5 A;  4HZ9 B;  1RGL A;  4H3U A;  3D5I A;  1OPY A;  5M19 A;  2KAA A;  1N8R 4;  1B27 A;  1I3I A;  1O7G B;  2QEX 3;  5EVH A;  1M9G A;  2WO0 A;  2GU1 A;  4O8S A;  4KZ1 A;  4GL6 A;  3CCS 3;  1TP6 A;  1W2Z A;  3S5C A;  8RNT A;  3T8U A;  1QJG A;  4RNZ A;  1GY7 A;  7RNT A;  2LYX A;  3MSO A;  5IG4 A;  4NRE A;  1NB5 I;  5CLK A;  1TIJ A;  3NV0 B;  4JF8 A;  5ELU A;  3ROB A;  3LTD A;  2B1X B;  4IT7 A;  1O7H B;  1A67 A;  2K54 A;  3JUM A;  1RGH A;  1RTU A;  1JKG A;  3FCS B;  4LEH A;  1B2M A;  4J5G A;  2RBI A;  3EC9 A;  3FG4 A;  1GSP A;  1SAR A;  2RSX A;  3CCQ 3;  1KSI A;  1QAL A;  1UW1 A;  2E2V A;  1MWT A;  3UJM A;  1OUN A;  1N5P A;  1OGZ A;  1GS3 A;  3BU4 A;  1IK3 A;  1KC8 4;  3SED A;  3DGN A;  2K0M A;  5IW9 A;  2CWT A;  1DMM A;  2XSH B;  1N9E A;  3ZFZ A;  1BRG A;  3CMA 3;  4N3V A;  3JUO A;  1O7N B;  2Q07 A;  3B4P A;  1JBS A;  2IMJ A;  2CIU A;  3KII A;  1VQ6 3;  1GY5 A;  3UNL A;  2O3O A;  2HMO B;  4HBR A;  3LYG A;  1RGG A;  1W2B 2;  2YFI B;  1IVX A;  1AV4 A;  3MWZ A;  2D42 A;  3GSP A;  1IQX A;  3OXA A;  4K1V A;  1Q82 4;  1ASK A;  4N6N B;  4FMB A;  3URP A;  4XBY A;  3JUN A;  3U97 A;  4AEQ A;  2E2T A;  3DM8 A;  4KFD A;  1W6Y A;  1RGK A;  5FGO A;  1VQ7 3;  1S72 3;  1S5A A;  3F7S A;  2XF3 A;  2IYJ A;  2J8X B;  4CCV A;  1VZZ A;  3MYT A;  1Q9E A;  3I55 3;  3FH1 A;  4HZB B;  3GZB A;  5AYS C;  1BNR A;  1NO3 A;  2F56 A;  4I4K A;  1K41 A;  4HM6 B;  2E2U A;  1RGC A;  5AII A;  3CC7 3;  2Y73 A;  2BNG A;  3M8C A;  3S67 A;  1MWS A;  3VSY A;  8CHO A;  1FUW A;  1TFO A;  2GXF A;  5D83 A;  3CXC 2;  1ROV A;  3CME 3;  2WOH A;  2GBX B;  3F8X A;  5BU4 A;  3EF8 A;  2L1S A;  3X40 A;  3DMC A;  3UB1 A;  2UX0 A;  3WR2 A;  1YJN 3;  1UUV B;  1I2G A;  2MF7 A;  1GMP A;  5KP4 A;  4FR9 A;  4R80 A;  1JV2 B;  1C54 A;  3VGN A;  4OUQ A;  3LTB A;  4XM4 A;  1IU7 A;  1VQQ A;  4ORL A;  1GMQ A;  3S27 A;  1W4N A;  4HM4 B;  5KP1 A;  2F98 A;  1OHS A;  1I0X A;  3V99 A;  4AKZ A;  1LOY A;  5AIH A;  5JPU A;  5JBS A;  2RNT A;  1UCJ A;  2SBL A;  1BNS A;  3NUV A;  3DZL A;  3BIR A;  1EKM A;  3ER7 A;  3IMA B;  3PCR A;  2OQE A;  2OTL 3;  1DET A;  2YFL B;  5AEU B;  3X3Z A;  2I9W A;  5G1K A;  1A90 A;  2BT3 A;  1US1 A;  2HMK B;  1MWR A;  1RJO A;  3OWU A;  3K5T A;  2Y74 A;  4XDV A;  3MG2 A;  1LOV A;  1A2V A;  3D79 A;  1VQL 3;  1Q81 4;  1JBR A;  1OAC A;  3E99 A;  1W02 A;  2IA7 A;  4NHF A;  1BRS A;  1Q7H A;  2XSO B;  3WOD G;  2FXT A;  1I2E A;  3ECF A;  1ZS7 A;  3RGR A;  2WOF A;  1JB5 A;  2ZHX B;  3HIG A;  4X2H A;  1VQK 3;  1I3F A;  1G02 A;  2KF6 A;  2CWU A;  4KT3 B;  5GSP A;  3DUK A;  1EQK A;  2YX9 A;  3N8B A;  1YJ9 3;  1QVF 2;  5CK6 A;  4BTW A;  1K28 A;  4HM7 B;  4X2O A;  4EXR A;  2F4Y A;  2M7O A;  1KWI A;  4HKV B;  1FZU A;  1UI8 A;  2STD A;  3AMO B;  4OK0 A;  1PYL A;  4HM1 B;  3K7C A;  4NPB A;  2HMM B;  1WNH A;  1EA2 A;  3WDG B;  3GZR A;  1FGM A;  1QAF A;  4N6U A;  3IJE B;  4MMZ B;  3D4A A;  3H3H A;  1CQS A;  4PEJ A;  3J7Y d;  3DGM A;  2HMJ B;  3SXX A;  2P09 A;  1GYB A;  2WGO A;  3AMO A;  1BRN L;  1UDI I;  1FGT A;  2OOV C;  2ZDJ A;  2W2C A;  3FZW A;  2CG0 A;  4LGQ A;  4BTX A;  4XBT A;  1PU4 A;  1BU4 A;  1A2K A;  1ZO2 A;  2CFL A;  1UCL A;  1JKG B;  1QMA A;  1O7M B;  2CX0 A;  2FGT A;  3CU3 A;  3KSP A;  4O3V A;  1RCK A;  1YVS A;  3PCS A;  3EE1 A;  3D5G A;  3GRD A;  4FCJ A;  3X3X A;  4ZM8 A;  1OF5 B;  1JB4 A;  1UCI A;  2C11 A;  1BRI A;  3DH2 A;  4CJN A;  3BNB A;  1RDS A;  3FGY A;  4QWT A;  1RGA A;  3RNT A;  2K3D A;  1GD3 A;  1STD A;  1JB2 A;  3AGO A;  1RKY A;  5BIR A;  1K8A 4;  3G0K A;  1BVI A;  2W9P A;  4HVN A;  1JN5 B;  1D6Z A;  1UCK A;  1GOY A;  1OHP A;  3NXJ A;  5IEO A;  5IER A;  1PFP A;  2L4V A;  2KXG A;  4BL2 A;  1OF5 A;  1VQM 3;  5CF2 A;  4U13 A;  1JZO A;  1AY7 A;  1NWW A;  2CFK A;  5M18 A;  1B20 A;  3MKI A;  1GY6 A;  3SLU A;  5LC6 A;  1Q42 A;  3NBJ A;  4TX4 A;  2W9Q A;  5IF6 A;  4STD A;  2D1W A;  1JN5 A;  1TFK A;  2IUJ A;  2Z77 A;  3KE7 A;  1T2H A;  2CHC A;  2UUG C;  1YGE A;  2PNC A;  2IY2 A;  3ZG0 A;  3DGO A;  2ZA4 A;  4EYC A;  3HII A;  2P0X A;  2JDI H;  3NM7 A;  4R9K A;  7STD A;  1D6U A;  1WMN A;  1FW7 A;  3B8L A;  1FGQ A;  4WHA A;  1RSN A;  3CCV 3;  4J5K A;  3CD6 3;  3CPW 2;  1M1K 4;  3JVC A;  3OW2 2;  1AQZ A;  2QGU A;  3X41 A;  3CCR 3;  1DE3 A;  5BXQ A;  1K9M 4;  1LRA A;  5IG5 A;  3LML A;  4HAA A;  4MMX B;  6RNT A;  1IT8 A;  3U1W A;  3STD A;  1L5G B;  2CW9 A;  2F5M A;  2XGN A;  3A5E A;  4EV5 A;  1NJI 4;  2CX1 A;  1RLS A;  1W01 A;  4L8O A;  3V98 A;  2HMN B;  4O02 B;  1O7W B;  2CFG A;  3SX1 A;  2F99 A;  5G1L A;  1NDO B;  2XGL A;  2W04 A;  1IVW A;  1TTO A;  3F14 A;  2LQV A;  2BIR A;  2V1L A;  3WMD A;  5TGN A;  4DKI A;  1M90 4;  2CFD A;  4HM2 B;  1BNE A;  5D82 A;  3B7C A;  3FF0 A;  2FNQ A;  4HM3 B;  1JBT A;  1JRQ A;  5STD A;  3A76 A;  3NX0 A;  4LYL B;  3FSD A;  1V57 A;  3EHC A;  5BVB A;  1N9J A;  2JQ5 A;  1RMS A;  2QA4 3;  3ALA A;  1W6C A;  3CCL 3;  4KFE A;  2W56 B;  1RNT A;  1T3B A;  1BNF A;  3EX9 A;  3LOY A;  4KFF A;  4LZI A;  5AI1 A;  1R4Y A;  2A15 A;  3FG1 A;  4BL3 A;  2W6J H;  1B2S A;  1ZX2 A;  3HK4 A;  3MHE A;  2SAR A;  3OWY A;  4HM0 B;  2RFR A;  2H0G A;  4HYZ A;  4RZM A;  1JZD A;  2PZV A;  1HYF A;  1B2Z A;  1FGR A;  4MEI A;  3DY5 A;  1IVU A;  2ML6 A;  1RN7 A;  3F40 A;  3L0R A;  4GHO A;  3CCM 3;  3LH4 A;  2XFS A;  1VQ8 3;  4FCM A;  3OWS A;  2W56 A;  5CXO A;  1LOX A;  3CNX A;  1R4C A;  1J2B A;  4I5Q A;  2C4B A;  1K73 4;  2OQE C;  2F86 B;  4RNY A;  4H61 A;  2XFT A;  3LXU X;  4Q53 A;  1Q7Y 4;  2F5W A;  2H0I A;  1GD4 A;  3DGL A;  4ILF A;  3S29 A;  1N8Q A;  2CKF B;  1IQY A;  1GMR A;  1BNG A;  3KN4 A;  4OVM A;  5AYR B;  1NNV A;  2Z6B A;  4BTY A;  4IPB A;  4LMI A;  1BOX A;  1YI2 3;  4K90 B;  3LT9 A;  3FKA A;  3Q90 A;  4R1K A;  1IYY A;  3Q3F A;  4JRF A;  1DVD A;  5LC7 A;  4K61 A;  3CCE 3;  2WGQ A;  1AR0 A;  1BSA A;  5AEW B;  4EC6 A;  1SII A;  1G96 A;  2P05 A;  5ELJ A;  1Q86 4;  4MJD A;  3QK9 A;  1W00 A;  1TU5 A;  3EN1 B;  3B4O A;  3DGY A;  1RRL A;  5FW5 A;  3WA3 A;  3AHS A;  4XBX A;  4CPK A;  1CEW I;  1YNV X;  3CC4 3;  1ROA A;  3V92 A;  1FGO A;  3NQY A;  1UGH I;  1GOU A;  1D6Y A;  1YHQ 3;  3KKG A;  1DYU A;  2GSP A;  3FF2 A;  1UGI A;  5HGR A;  1ULJ B;  3PXM A;  1LOW A;  4GB5 A;  2CC3 A;  2KCD A;  5M1A A;  1NU3 A;  3T8N A;  1KQS 2;  1BSC A;  2KF5 A;  5AIG A;  1AVL A;  3LTC A;  2GU3 A;  3WOF B;  4KVH A;  1N5H A;  3QRD A;  1E3R A;  3DXO A;  3WHO A;  6GSP A;  1U5O A;  3NBB A;  3HOH A;  1HZ1 A;  1I2F A;  5D81 A;  3WOE B;  3BND A;  3NQZ A;  4WFO A;  1FA3 A;  1OHO A;  1T2I A;  1M1X B;  1O7P B;  1WQL B;  2HOH A;  3F7X A;  1VQ9 3;  2AAE A;  1GOV A;  4XDW A;  5I97 A;  1VQ5 3;  1BAN A;  1YGW A;  1IQ8 A;  4O2H A;  1UUG B;  1Q40 B;  1OCV A;  2O9U X;  5RNT A;  2C10 A;  1BRK A;  1ZGX A;  4WWU C;  1LQM B;  2W03 A;  1FYS A;  5EQL A;  3GZX B;  5IEP A;  2BMR B;  1B2X A;  5DRV A;  2IUK A;  3BNE A;  3HX8 A;  1LQG C;  4WYK A;  3NHX A;  1Q40 A;  1U8C B;  1W7C A;  3X42 A;  3N54 B;  4MMY B;  2ML5 A;  1YVB I;  1TRQ A;  1I70 A;  3Q1C A;  4RNT A;  3MPH A;  3SOY A;  5CF1 A;  1DMQ A;  3IPT A;  1YIT 3;  3NM2 A;  4K1U A;  2BU4 A;  3MG1 A;  4FMA A;  1Z1S A;  3UL5 A;  3LZA A;  2CH9 A;  2GEX A;  3VF1 A;  5KP3 A;  3EJV A;  2CWV A;  5A0O B;  2AAD A;  1UI7 A;  2Z7A A;  1AVK A;  1QAK A;  2BO9 B;  1X1Y A;  3MG3 A;  1SPU A;  1YIJ 3;  1BUJ A;  3I56 3;  3G8Z A;  3Q2P A;  3NV0 A;  1SQW A;  1CH0 A;  2P38 A;  3TDG A;  2INX A;  1MWU A;  1A2P A;  4HOH A;  2BMO B;  1IVV A;  1LNH A;  2H0H A;  2KF3 A;  1E97 A;  1F8N A;  2RCD A;  3X3Y A;  4WP5 A;  3O8Y A;  2OTJ 3;  1E3V A;  3FLJ A;  3K0Z A;  1EEJ A;  1EG9 B;  4L8P A;  5DRE A;  3RDE A;  2RGQ A;  1BRH A;  1ULI B;  3AHW A;  1TRP A;  4HJL B;  3KFQ C;  1IV9 A;  3CCU 3;  3SYU A;  1IV7 A;  1X1U A;  1X1W A;  1B2U A;  3CCJ 3;  3LT8 A;  1DVC A;  4R4K A;  3GWR A;  1BNI A;  3K63 A;  6STD A;  4R9L A;  1LXE A;  1BIR A;  3H51 A;  4HM8 B;  3JUQ A;  3WA2 X;  4HM5 B;  1OH0 A;  1BUQ A;  2KRT A;  4LSO A;  1BSB A;  1HU9 A;  2XRX B;  3EBT A;  1VQO 3;  3PS8 A;  1Y4K A;  1BSE A;  4GSP A;  3T0U A;  3OV4 A;  5IG0 A;  2BMQ B;  3G4S 3;  3PGB A;  4FCZ A;  4RBN A;  1I0V A;  1B3S A; 
#chains in the Genus database with same CATH homology
 2HML B;  4IIA A;  1MOL A;  2CFW A;  1STF I;  2XR8 B;  3EN8 A;  3RGA A;  3HI7 A;  4J9A A;  3KSE D;  4N6V 0;  2R4I A;  5G2G A;  1C7H A;  2CK3 H;  2XH9 A;  3I0Y A;  3CNM A;  3K9M C;  1CYV A;  3G71 3;  3HZP A;  1IT7 A;  1SIH A;  3BNC A;  4AKY A;  3GZY B;  2MC8 A;  3CC2 3;  1JNQ A;  2YFJ B;  3GAX A;  4N6T A;  5AIF A;  2P0M A;  3F9S A;  1CYU A;  1WMP A;  1DMN A;  2ZL8 A;  4J8T A;  3D3L A;  1KD1 4;  4FMD A;  4CDL A;  2OCT A;  3PZW A;  3OX9 A;  2W0Q A;  1NB3 I;  4EV2 A;  1HKX A;  3NBR A;  3UL6 A;  1JJ2 2;  1MNL A;  3JUP A;  5JPP A;  3CPO A;  4L7K A;  2BHM A;  2OWP A;  1YJW 3;  3D9R A;  4N6O B;  1LVN A;  4FMC A;  3G16 A;  3S28 A;  1UUW B;  1W6G A;  1VQN 3;  1VQ4 3;  5IEN A;  2QIY A;  5EEO A;  3BB9 A;  4N6L A;  1WMO A;  3LTA A;  1TUH A;  3EB8 A;  3SVA A;  1QVG 2;  2GBW B;  1RRH A;  4G1M B;  5IG3 A;  3EQQ B;  1OGX A;  3N9H A;  1T5Y A;  2B24 B;  3F8H A;  2CG1 A;  2XEP A;  1SJW A;  2GEY A;  1WTH A;  3BLZ A;  3EBY A;  1W5Z A;  3FG3 A;  4WYK B;  3SOA A;  1V74 A;  4EBG A;  3G6E 3;  1IDP A;  2Z76 A;  3KZT A;  3PYJ A;  4N6M A;  2OOV A;  1VQP 3;  1ISK A;  4XB5 A;  4HZ9 B;  4H3U A;  1OPY A;  1O7G B;  2QEX 3;  5EVH A;  1M9G A;  2WO0 A;  2GU1 A;  4O8S A;  4KZ1 A;  4GL6 A;  3CCS 3;  1TP6 A;  1W2Z A;  3S5C A;  3T8U A;  1QJG A;  4RNZ A;  1GY7 A;  2LYX A;  3MSO A;  5IG4 A;  4NRE A;  1NB5 I;  5CLK A;  1TIJ A;  3NV0 B;  4JF8 A;  5ELU A;  3ROB A;  3LTD A;  2B1X B;  4IT7 A;  1O7H B;  1A67 A;  2K54 A;  3JUM A;  4LEH A;  3FCS B;  1JKG A;  3EC9 A;  3FG4 A;  2RSX A;  3CCQ 3;  1KSI A;  1QAL A;  1UW1 A;  2E2V A;  3UJM A;  1OUN A;  1N5P A;  1OGZ A;  1GS3 A;  1IK3 A;  1KC8 4;  3SED A;  3DGN A;  2K0M A;  5IW9 A;  2CWT A;  1DMM A;  2XSH B;  1N9E A;  3CMA 3;  4N3V A;  3JUO A;  1O7N B;  2Q07 A;  3B4P A;  2IMJ A;  2CIU A;  3KII A;  1VQ6 3;  1GY5 A;  3UNL A;  2O3O A;  2HMO B;  4HBR A;  3LYG A;  1W2B 2;  2YFI B;  1IVX A;  1AV4 A;  3MWZ A;  2D42 A;  3OXA A;  1IQX A;  4K1V A;  1Q82 4;  1ASK A;  4N6N B;  4FMB A;  4XBY A;  3JUN A;  3U97 A;  4AEQ A;  2E2T A;  3DM8 A;  4KFD A;  1W6Y A;  5FGO A;  1VQ7 3;  1S72 3;  1S5A A;  3F7S A;  2XF3 A;  4CCV A;  1VZZ A;  3MYT A;  3I55 3;  3FH1 A;  4HZB B;  3GZB A;  5AYS C;  1NO3 A;  4I4K A;  1K41 A;  4HM6 B;  2E2U A;  5AII A;  3CC7 3;  2Y73 A;  2BNG A;  3M8C A;  3S67 A;  3VSY A;  8CHO A;  1FUW A;  1TFO A;  2GXF A;  5D83 A;  3CXC 2;  1ROV A;  3CME 3;  2WOH A;  2GBX B;  3F8X A;  3EF8 A;  3X40 A;  3DMC A;  3UB1 A;  2UX0 A;  1YJN 3;  1UUV B;  2MF7 A;  5KP4 A;  4FR9 A;  4R80 A;  1JV2 B;  3VGN A;  4OUQ A;  3LTB A;  4XM4 A;  1IU7 A;  4ORL A;  3S27 A;  1W4N A;  4HM4 B;  5KP1 A;  2F98 A;  1OHS A;  3V99 A;  4AKZ A;  5AIH A;  5JPU A;  5JBS A;  2SBL A;  3NUV A;  3DZL A;  3IMA B;  1EKM A;  3ER7 A;  3PCR A;  2OQE A;  2OTL 3;  2YFL B;  5AEU B;  3X3Z A;  2I9W A;  1A90 A;  2BT3 A;  1US1 A;  2HMK B;  1RJO A;  3OWU A;  3K5T A;  2Y74 A;  4XDV A;  3MG2 A;  1A2V A;  1VQL 3;  1Q81 4;  1OAC A;  3E99 A;  1W02 A;  2IA7 A;  4NHF A;  2XSO B;  3WOD G;  2FXT A;  3ECF A;  3RGR A;  2WOF A;  1JB5 A;  3HIG A;  4X2H A;  1VQK 3;  2CWU A;  3DUK A;  1EQK A;  2YX9 A;  3N8B A;  1YJ9 3;  1QVF 2;  5CK6 A;  4BTW A;  1K28 A;  4HM7 B;  4X2O A;  4EXR A;  2M7O A;  1KWI A;  4HKV B;  1UI8 A;  2STD A;  3AMO B;  4OK0 A;  4HM1 B;  3K7C A;  2HMM B;  1WNH A;  1EA2 A;  3WDG B;  3GZR A;  1FGM A;  1QAF A;  4N6U A;  3IJE B;  4MMZ B;  3H3H A;  1CQS A;  4PEJ A;  3J7Y d;  3DGM A;  2HMJ B;  3SXX A;  2P09 A;  1GYB A;  2WGO A;  3AMO A;  2ZDJ A;  1FGT A;  2OOV C;  3FZW A;  2W2C A;  4LGQ A;  2CG0 A;  4BTX A;  1PU4 A;  4XBT A;  1ZO2 A;  1A2K A;  2CFL A;  1JKG B;  1QMA A;  1O7M B;  2FGT A;  3CU3 A;  3KSP A;  4O3V A;  3PCS A;  3EE1 A;  3GRD A;  4FCJ A;  3X3X A;  4ZM8 A;  1OF5 B;  1JB4 A;  2C11 A;  3BNB A;  3FGY A;  4QWT A;  1GD3 A;  1STD A;  1JB2 A;  1RKY A;  1K8A 4;  3G0K A;  2W9P A;  4HVN A;  1JN5 B;  1D6Z A;  1OHP A;  3NXJ A;  5IEO A;  5IER A;  1PFP A;  2L4V A;  2KXG A;  1OF5 A;  1VQM 3;  5CF2 A;  4U13 A;  1NWW A;  2CFK A;  3MKI A;  1GY6 A;  3SLU A;  5LC6 A;  1Q42 A;  3NBJ A;  4TX4 A;  2W9Q A;  5IF6 A;  4STD A;  2D1W A;  1JN5 A;  1TFK A;  2IUJ A;  2Z77 A;  3KE7 A;  2CHC A;  1YGE A;  2PNC A;  3DGO A;  4EYC A;  3HII A;  2P0X A;  2JDI H;  3NM7 A;  4R9K A;  7STD A;  1D6U A;  1WMN A;  3B8L A;  1FGQ A;  4WHA A;  3CCV 3;  3CD6 3;  3CPW 2;  1M1K 4;  3JVC A;  3OW2 2;  2QGU A;  3X41 A;  3CCR 3;  5BXQ A;  1K9M 4;  5IG5 A;  3LML A;  4MMX B;  1IT8 A;  3U1W A;  3STD A;  1L5G B;  2CW9 A;  2XGN A;  4EV5 A;  1NJI 4;  1W01 A;  4L8O A;  3V98 A;  2HMN B;  4O02 B;  1O7W B;  2CFG A;  3SX1 A;  2F99 A;  1NDO B;  2XGL A;  2W04 A;  1IVW A;  3F14 A;  2LQV A;  2V1L A;  3WMD A;  5TGN A;  1M90 4;  2CFD A;  4HM2 B;  5D82 A;  3B7C A;  3FF0 A;  2FNQ A;  4HM3 B;  1JRQ A;  5STD A;  3A76 A;  3NX0 A;  3FSD A;  3EHC A;  5BVB A;  1N9J A;  2JQ5 A;  2QA4 3;  3ALA A;  1W6C A;  3CCL 3;  4KFE A;  2W56 B;  4KFF A;  3LOY A;  3EX9 A;  4LZI A;  5AI1 A;  2A15 A;  3FG1 A;  2W6J H;  1ZX2 A;  3HK4 A;  3OWY A;  3MHE A;  4HM0 B;  4JRF A;  2RFR A;  4HYZ A;  4RZM A;  2PZV A;  1FGR A;  4MEI A;  3DY5 A;  1IVU A;  2ML6 A;  1RN7 A;  3F40 A;  3L0R A;  3CCM 3;  3LH4 A;  2XFS A;  1VQ8 3;  4FCM A;  3OWS A;  2W56 A;  5CXO A;  1LOX A;  3CNX A;  1R4C A;  1J2B A;  1K73 4;  2OQE C;  2F86 B;  4RNY A;  4H61 A;  2XFT A;  3LXU X;  4Q53 A;  1Q7Y 4;  3DGL A;  1GD4 A;  3S29 A;  1N8Q A;  2CKF B;  1IQY A;  4OVM A;  3KN4 A;  5AYR B;  2Z6B A;  4BTY A;  4IPB A;  4LMI A;  1YI2 3;  4K90 B;  3LT9 A;  3FKA A;  3Q90 A;  4R1K A;  1DVD A;  5LC7 A;  4K61 A;  3CCE 3;  2WGQ A;  1AR0 A;  5AEW B;  4EC6 A;  1SII A;  1G96 A;  2P05 A;  5ELJ A;  1Q86 4;  4MJD A;  3QK9 A;  1W00 A;  1TU5 A;  3EN1 B;  3B4O A;  1RRL A;  5FW5 A;  3WA3 A;  4XBX A;  1CEW I;  3CC4 3;  1ROA A;  3V92 A;  1FGO A;  3NQY A;  1D6Y A;  1YHQ 3;  3KKG A;  1DYU A;  3FF2 A;  5HGR A;  1ULJ B;  3PXM A;  4GB5 A;  2CC3 A;  2KCD A;  3T8N A;  1NU3 A;  1KQS 2;  5AIG A;  1AVL A;  3LTC A;  2GU3 A;  3WOF B;  4KVH A;  1N5H A;  3QRD A;  1E3R A;  3DXO A;  1U5O A;  3NBB A;  5D81 A;  3WOE B;  3BND A;  3NQZ A;  4WFO A;  1FA3 A;  1OHO A;  1M1X B;  1O7P B;  1WQL B;  3F7X A;  1VQ9 3;  4XDW A;  5I97 A;  1VQ5 3;  1IQ8 A;  4O2H A;  1Q40 B;  1OCV A;  2O9U X;  2C10 A;  4WWU C;  2W03 A;  5EQL A;  3GZX B;  5IEP A;  2BMR B;  5DRV A;  2IUK A;  3BNE A;  3HX8 A;  4WYK A;  3NHX A;  1Q40 A;  1U8C B;  1W7C A;  3X42 A;  3N54 B;  4MMY B;  2ML5 A;  1YVB I;  3Q1C A;  3SOY A;  3MPH A;  5CF1 A;  1DMQ A;  3IPT A;  1YIT 3;  3NM2 A;  4K1U A;  3MG1 A;  4FMA A;  1Z1S A;  3UL5 A;  3LZA A;  2CH9 A;  2GEX A;  3VF1 A;  5KP3 A;  3EJV A;  2CWV A;  5A0O B;  1UI7 A;  2Z7A A;  1AVK A;  1QAK A;  2BO9 B;  1YIJ 3;  3MG3 A;  1SPU A;  3I56 3;  3G8Z A;  3Q2P A;  3NV0 A;  1SQW A;  2P38 A;  3TDG A;  2INX A;  2BMO B;  1IVV A;  1LNH A;  3X3Y A;  1E97 A;  1F8N A;  2RCD A;  2OTJ 3;  4WP5 A;  3O8Y A;  1E3V A;  3FLJ A;  3K0Z A;  1EG9 B;  4L8P A;  5DRE A;  3RDE A;  2RGQ A;  1ULI B;  4HJL B;  3KFQ C;  1IV9 A;  3CCU 3;  1IV7 A;  3CCJ 3;  3LT8 A;  1DVC A;  4R4K A;  3GWR A;  3K63 A;  6STD A;  4R9L A;  1LXE A;  3H51 A;  4HM8 B;  3JUQ A;  3WA2 X;  4HM5 B;  1OH0 A;  1BUQ A;  2KRT A;  4LSO A;  3EBT A;  1HU9 A;  2XRX B;  1VQO 3;  3PS8 A;  1Y4K A;  3T0U A;  3OV4 A;  5IG0 A;  2BMQ B;  3G4S 3;  3PGB A;  4FCZ A;  4RBN A;  1N8R 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...