3OX9A

Crystal structure of ketosteroid isomerase d40n/c69s/c81s/c97s/f86c-cn from p. putida
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFYRQGLGGGKVRASLTGPVRASHNGSGAMPRVEMVWNGQPSALDVIDVMRFDEHGRIQTMQAYWSEVNLSVREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Quantitative, directional measurement of electric field heterogeneity in the active site of ketosteroid isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 35
structure length 128
sequence length 129
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ox9A00
3MSOA 3D9RA 4OUQA 5AIHA 1ASKA 1UUWB 1CQSA 3LZAA 4OVMA 4MJDA 2XR8B 3JUQA 1E3VA 2XSHB 4WP5A 2RCDA 7STDA 2R4IA 3GZXB 5IG3A 3B4OA 5FW5A 5CF1A 1Q42A 4HVNA 3NUVA 1DMQA 3JUOA 3EQQB 2GBXB 3CNXA 1E97A 3FKAA 2F99A 4HM2B 1GY6A 1OF5A 2Z76A 8CHOA 3F14A 1AR0A 1O7MB 3K7CA 5KP3A 3IPTA 3GRDA 3EF8A 5CF2A 2YFLB 3KSPA 4I4KA 5EVHA 1OHSA 4WYKB 4K1UA 4GB5A 3K0ZA 5BVBA 3RGRA 1JB5A 3ECFA 3KKGA 1GY5A 2W2CA 4HM1B 5HGRA 3OWYA 1OGXA 3FF0A 2I9WA 1ISKA 3BLZA 5D83A 3NHXA 4HM4B 2CHCA 3OWUA 2HMLB 4R9LA 3MKIA 1JN5B 3WMDA 1ULIB 2IMJA 3DM8A 3HX8A 5KP1A 3EN8A 3B4PA 1NDOB 3F40A 5IEPA 3NV0B 4LMIA 3ROBA 2BMRB 5DRVA 2BMOB 1U5OA 2HMNB 2HMKB 1O7HB 1JB2A 2GXFA 1O7PB 4H3UA 1ZO2A 6STDA 4U13A 1JKGB 3JUMA 3NBRA 3HZPA 1GS3A 2HMOB 5TGNA 4HM5B 3GWRA 2K54A 3UJMA 1DMMA 5STDA 3FH1A 1W6YA 2OWPA 2F98A 2GBWB 4XM4A 1OH0A 2B1XB 4N3VA 3H3HA 5IEOA 4J9AA 2Z7AA 5AEUB 3EX9A 2QIYA 4FCMA 1IDPA 1O7WB 4K1VA 1A2KA 3T8UA 3OV4A 4HJLB 2BNGA 4IIAA 3E99A 3A76A 3OXAA 3G8ZA 4FCJA 1GYBA 1EG9B 5CK6A 2RGQA 3FLJA 3FSDA 1O7NB 4HM0B 4X2HA 1JKGA 3SOAA 1OUNA 3T8NA 3VGNA 2GEYA 3JUPA 3FGYA 3G0KA 3HK4A 1TUHA 4PEJA 3BB9A 1NWWA 4XBYA 3EC9A 3MG3A 1UUVB 4HM8B 4R9KA 1K41A 3Q90A 4HZ9B 4WWUC 2XRXB 1Q40B 5JPPA 3DZLA 5IG4A 3FF2A 1TP6A 1OHPA 3RGAA 1GY7A 4CDLA 3M8CA 2Z77A 3NM2A 4XBXA 3H51A 1ZX2A 3EBTA 2F86B 4WYKA 1WQLB 3SOYA 3F9SA 4ORLA 3G16A 5BXQA 1HKXA 2XSOB 4L8PA 4L7KA 1S5AA 3CPOA 5IG0A 1W00A 5AIGA 4Q53A 3GZYB 4STDA 4XDWA 3EJVA 4X2OA 3F7XA 4RZMA 2A15A 1STDA 1Q40A 5G2GA 1O7GB 3FZWA 4KVHA 5IG5A 4HKVB 3ER7A 3GZBA 3SEDA 2RFRA 4J8TA 1JN5A 3EBYA 5AIIA 5AIFA 2INXA 1OCVA 5D82A 1VZZA 3NV0A 5CLKA 2STDA 3MHEA 3JUNA 1Z1SA 5KP4A 4XDVA 3B7CA 2BMQB 3OWSA 4R1KA 4XB5A 1OPYA 3UNLA 3LYGA 1BUQA 5AI1A 2CKFB 2JQ5A 3DMCA 5IENA 1ULJB 5IERA 3VSYA 1E3RA 3F8XA 4HM6B 1W01A 3STDA 3S5CA 4LGQA 4HM3B 3F8HA 1OGZA 5IF6A 1OHOA 1QJGA 1W02A 3CNMA 5D81A 3KZTA 5DREA 3OX9A 2HMMB 3MG2A 1QMAA 1EA2A 3I0YA 5JPUA 2YFJB 3DXOA 3EN1B 4LEHA 1DMNA 5AEWB 3EHCA 4HM7B 2GEXA 2B24B 1SJWA 3CU3A 3KE7A 1NU3A 2UX0A 3MG1A 1C7HA 5CXOA 4L8OA 4XBTA 4HZBB 3MYTA 1JB4A 3F7SA 3GZRA 2HMJB 2QGUA 2PZVA 3NXJA 3DUKA 1OF5B 3B8LA 2YFIB
chains in the Genus database with same CATH superfamily
3MSOA 2XGLA 3D9RA 1BRGA 4IPBA 1QVF2 4LYLB 1TTOA 1N5HA 1WNHA 1SQWA 3D5GA 1TIJA 4OUQA 1ASKA 2CK3H 5AIHA 4BL2A 1RN7A 2CWTA 3CCR3 2FGTA 1UUWB 1BRNL 1U8CB 3CCQ3 1CQSA 3LZAA 1VQQA 2XH9A 1NB3I 3N9HA 1J2BA 4OVMA 1RGHA 3D5IA 3LT8A 1NJI4 4MJDA 1IV7A 4DKIA 2QA43 1K28A 1YGEA 1CEWI 3BNCA 2W56A 3VF1A 4EXRA 3PCSA 2ZHXB 1Q7Y4 2XR8B 1YJ93 4AEQA 3I553 1GOYA 2F56A 1A67A 4FMBA 3JUQA 1IK3A 4BU4A 1BRIA 1E3VA 3D4AA 2XSHB 2W9PA 4WP5A 2CC3A 2WO0A 1VQO3 1RNBA 2WOHA 3SLUA 2RCDA 5M19A 7STDA 3WA3A 2R4IA 3GSPA 3L0RA 1IQ8A 4BL3A 4J5GA 1VQL3 3GZXB 5IG3A 1BNIA 1GD3A 1MGRA 3B4OA 5FW5A 1JV2B 3ZG5A 1Q42A 5CF1A 1YHQ3 4HVNA 2OTL3 3NUVA 1DMQA 3UL5A 3JUOA 3EQQB 2GBXB 3HI7A 5I97A 1B2MA 1DVDA 5GSPA 4O3VA 4ILFA 2BU4A 2UGIA 3CNXA 3LTCA 1VQ63 1E97A 3X42A 2BHMA 3D3LA 3FKAA 2F99A 4HM2B 1R4CA 1GY6A 4LZIA 4O02B 3J7Yd 3CD63 1LNHA 1OF5A 1ROVA 4KFEA 4RNYA 1VQ83 1EKMA 3CCE3 2Z76A 8CHOA 1BGSA 3X41A 5HOHA 4KZ1A 2LYXA 3F14A 1AR0A 4BTYA 1KD14 1MWRA 1N9JA 1O7MB 3K7CA 5KP3A 1MWUA 4FMCA 3IPTA 3GRDA 2Q07A 1ZS7A 1RN1A 3EF8A 1RHLA 5CF2A 3PZWA 3HOHA 1BSAA 1YIJ3 1RRHA 2YFLB 1C54A 1BUJA 3KSPA 4I4KA 1NB5I 1IV9A 2R41A 5EVHA 3WDGB 2H0IA 1OHSA 3BNBA 6RNTA 4WYKB 4K1UA 3LTDA 3WR2A 1I3IA 2F4YA 5ELUA 4AKYA 2O9UX 1FW7A 1DETA 1GSPA 4GB5A 3K0ZA 3MWZA 5BVBA 4CCVA 3K9MC 4I5QA 1RLSA 3NBBA 2ZA4A 2KF5A 3RGRA 2OTJ3 1JB5A 3AHWA 1M9GA 3PGBA 2GU3A 3ECFA 3KKGA 3LT9A 1GY5A 4HOHA 3NQYA 1TFKA 2W2CA 4HM1B 5HGRA 1LQGC 1A2PA 1BSBA 1AVLA 1NNVA 4IT7A 3SYUA 2XFSA 3OWYA 5BU4A 1I8VA 1OGXA 3FF0A 1RSNA 1UCJA 2I9WA 1VQ53 1SARA 3I563 1ISKA 1X1YA 3BLZA 4EW5A 1T3BA 2P0XA 2CFDA 5D83A 2W6JH 3NHXA 1IQXA 3UL6A 3OW22 4HM4B 2CHCA 3OWUA 5EEOA 4N6LA 1SIHA 4AKZA 1K734 2WGOA 3HIGA 2K0MA 2HMLB 3DY5A 1G02A 4R9LA 5LC6A 3MKIA 1AY7A 1DVCA 1JN5B 4ZM8A 3WMDA 5A0OB 1ULIB 2IMJA 2ZDJA 3AMOB 3DM8A 2P09A 3HX8A 5KP1A 1W6CA 3EN8A 3B4PA 1MGWA 1NDOB 1UW1A 3F40A 5IEPA 3NV0B 4LMIA 3ROBA 2BMRB 3AHSA 5DRVA 3EE1A 1YVBI 1TFOA 2BMOB 4R80A 1RGAA 4GL6A 1U5OA 2FXTA 1BIRA 2HMNB 2HMKB 2KF3A 4FCZA 1O7HB 1N5PA 1JB2A 2GXFA 3IJEB 3JVCA 1B2ZA 1RRLA 1QVG2 1WMOA 4HBRA 1RTUA 1STFI 1FUTA 1B20A 3DH2A 1O7PB 3K63A 4H3UA 1ZO2A 1GMPA 6STDA 3QRDA 3O8YA 1JKGB 2SBLA 4HYZA 1R4YA 4U13A 3JUMA 1LOXA 3CCM3 5ELJA 4EV2A 1OACA 3NBRA 3HZPA 2JDIH 1GS3A 2YX9A 3URPA 3BU4A 2HMOB 1BAOA 5TGNA 1I0VA 1IT7A 2IYJA 4RNZA 3DGYA 4HM5B 1W2B2 1ROAA 1CYVA 3LTBA 1RN4A 3CC43 3GWRA 2K54A 6GSPA 3UJMA 1DMMA 5STDA 1FGTA 3FH1A 3G713 1W6YA 1EUIC 3GAXA 2OWPA 2AADA 4MMYB 1RGKA 2F98A 2IA7A 3PXMA 4OK0A 3FG4A 4N6V0 4WHAA 2GBWB 3AGNA 4MMXB 4R4KA 4TX4A 1JBRA 4XM4A 3U1WA 1OH0A 1EQKA 1W2ZA 2B1XB 4N3VA 2BT3A 3H3HA 1HU9A 5IEOA 4J9AA 3ZG0A 4O8SA 2Z7AA 2OQEC 1W4NA 5AEUB 3EX9A 2QIYA 4JF8A 4FCMA 1JZOA 1IU7A 4J5KA 1IDPA 1O7WB 5IW9A 1IYYA 4K1VA 1A2KA 3N8BA 3BIRA 3T8UA 3OV4A 2C10A 3S67A 4HJLB 1IVUA 2CWUA 4MEIA 3LOYA 4N6TA 5AYRB 2BNGA 3WODG 4IIAA 1FUSA 2KXGA 3E99A 3SXXA 1AV4A 1BNEA 1FYSA 2XEPA 2GSPA 3CME3 1B2SA 3A76A 3OXAA 3G8ZA 4FCJA 9RNTA 1UI8A 2MF7A 1GYBA 1EG9B 1GOUA 2K3DA 2GU1A 5CK6A 4EYCA 1M1XB 2CX0A 1MNLA 2RGQA 3FLJA 3FSDA 2O3OA 1IVVA 1O7NB 3KIIA 4HM0B 3WA2X 1DE3A 2UUGC 1T2HA 4X2HA 1BSDA 1JKGA 2CG1A 3SOAA 1BSEA 3NQZA 4EC6A 1IVXA 1LOVA 1OUNA 3T8NA 3BNEA 3VGNA 5BIRA 2GEYA 3FCSB 4GSPA 5FGOA 3JUPA 1KC84 1JBTA 1Q814 3RDEA 3V98A 3DGLA 1T2IA 3FGYA 3V92A 1YGWA 1JBSA 3G0KA 5JBSA 3HK4A 3Q3FA 1TUHA 4NREA 5AYSC 1N9EA 4PEJA 4JRFA 3KFQC 3CPW2 1RDSA 1VQP3 3BB9A 1NWWA 2ML5A 3DGMA 1LOWA 2CFKA 4XBYA 2RNTA 1HZ1A 1BNJA 4RNTA 3V99A 7GSPA 3EC9A 4K90B 2ZL8A 1F8NA 2SARA 3MG3A 1UUVB 4HM8B 1KQS2 2W03A 4R9KA 2OOVA 1Q9EA 2Z6BA 1TRPA 3SX1A 1D6UA 1K41A 3Q90A 4CJNA 1PFPA 4HZ9B 4WWUC 3S27A 3UB1A 4EV5A 3CCS3 1NO3A 1HYFA 1BNSA 1LVNA 1RGFA 2XRXB 4KFDA 1Q40B 3CCU3 1UUGB 1QAFA 3KCHA 3KSED 5JPPA 3DZLA 2CIUA 3ALAA 1FGQA 5IG4A 2HOHA 2OQEA 3FF2A 1EEJA 1TP6A 3MPHA 3BNDA 1OHPA 3HIIA 1RGLA 2H0HA 2V1LA 3RGAA 4K61A 1GY7A 2P05A 1FA3A 1QAKA 1UCIA 4HAAA 1LNIA 4BTWA 3M8CA 4CDLA 5EQLA 2BO9B 2Z77A 1ZGXA 3NM2A 4XBXA 3H51A 1ZX2A 3IMAB 3EBTA 2F86B 1PYLA 4WYKA 2KAAA 1WQLB 1LOYA 1BRSA 1I2EA 2C4BA 3G4S3 3SOYA 2PNCA 1UDII 3F9SA 4BIRA 3CXC2 4ORLA 1YNVX 3G16A 5BXQA 1HKXA 1V58A 3X3ZA 1G0TA 1RGEA 2XSOB 3WOFB 4GHOA 4LSOA 3FG1A 4CPKA 3X3YA 2CH9A 2WOFA 8RNTA 4N6MA 4L8PA 1W6GA 1RKYA 3PYJA 4L7KA 1B2UA 4QWTA 3PCRA 2IUKA 1S5AA 3CPOA 1B3SA 1N8R4 5IG0A 1A90A 1BRJA 3S29A 5G1KA 3RNTA 5RNTA 2OOVC 1W00A 5AIGA 1K9M4 1JZDA 2H0GA 1FGOA 3GZYB 3FG3A 4N6OB 4N6UA 3EJVA 4Q53A 4STDA 4XDWA 1TRQA 1MWTA 1FUWA 4X2OA 3F7XA 3CC73 4RZMA 1X1XA 1BNFA 2A15A 5LC7A 2IUJA 2M7OA 1STDA 2KCDA 1Q40A 3EB8A 3ZFZA 1PU4A 5G2GA 1O7GB 3FZWA 4KVHA 5IG5A 4HKVB 3ER7A 3GZBA 2P38A 1YJN3 3NX0A 1UGIA 2RFRA 4J8TA 4WFOA 3SEDA 3CCJ3 4KFFA 2W9QA 1JN5A 1GOVA 3EBYA 1M1K4 1B21A 3PS8A 5AIIA 2OCTA 1UCKA 3AMOA 5AIFA 3S28A 1IQYA 1CH0A 2INXA 2J8XB 5M18A 1OCVA 1Q7HA 2KF4A 3CCV3 3DGNA 1V74A 4O2HA 1WMNA 3LXUX 1VZZA 3NV0A 5CLKA 4G1MB 2STDA 3MHEA 3JUNA 5D82A 1Z1SA 2CFLA 5KP4A 3LMLA 4XDVA 1D6YA 1RMSA 3TDGA 3LH4A 1VQN3 1VQ43 1TJDA 1GD4A 3B7CA 3CC23 2BMQB 1UCLA 2W0QA 3KN4A 2D1WA 3OWSA 4R1KA 2D42A 4XB5A 1OPYA 2L4VA 3QK9A 1LXEA 2KF6A 1RJOA 3UNLA 3LYGA 3AGOA 4KT3B 1BUQA 1FGRA 5AI1A 1JRQA 3T0UA 3K5TA 2CKFB 4H61A 1Y4KA 1S723 2JQ5A 1RNTA 3DMCA 3N54B 2AAEA 5IENA 4NPBA 1A2VA 1ULJB 4N6NB 1V57A 5G1LA 1FZUA 1GMQA 1I2FA 2RBIA 5IERA 1I0XA 1L5GB 1BRHA 3VSYA 1E3RA 1TU5A 3F8XA 1CYUA 4HM6B 1W01A 2FNQA 3STDA 3S5CA 4LGQA 4HM3B 2XFTA 3NM7A 3F8HA 1Q864 1OGZA 1LQMB 3NBJA 5IF6A 1KSIA 1PY3A 4FMDA 1OHOA 1WTHA 1WMPA 1BNRA 1B2XA 1QJGA 2WGQA 1W02A 7RNTA 1JJ22 2XF3A 3Q2PA 1KWIA 2F5WA 1BSCA 3LTAA 1N8QA 3CNMA 5D81A 3KZTA 1M904 5DREA 3OX9A 1X1UA 3SVAA 4RBNA 1RCKA 1D6ZA 1I70A 2HMMB 3MG2A 1Q824 2CWVA 3A5EA 2F5MA 3X40A 1FGMA 2E2TA 1QMAA 1US1A 4EBGA 3G6E3 3CCL3 2IY2A 1EA2A 1RCLA 3I0YA 5JPUA 1W7CA 1BVIA 1QALA 2BIRA 1IVWA 1BNGA 2CW9A 2P0MA 2YFJB 1UGHI 3DXOA 3EN1B 4LEHA 4BTXA 2QEX3 1DMNA 5AEWB 3EHCA 2W56B 4MMZB 4HM7B 2LQVA 1MWSA 2RSXA 5M1AA 2GEXA 1MOLA 3X3XA 2B24B 1AQZA 1I2GA 2W04A 1RGCA 1SJWA 2E2VA 3CU3A 2CG0A 3KE7A 1YVSA 2CFGA 1NU3A 1VQM3 2UX0A 1I3FA 3WHOA 1T5YA 1GMRA 3MG1A 1C7HA 1LRAA 1JNQA 1X1WA 5CXOA 1IT8A 1RGGA 4L8OA 1AVKA 1DYUA 4XBTA 1VQ73 1BRKA 4FMAA 4HZBB 3MYTA 2C11A 1G96A 2CX1A 3WOEB 1JB4A 2Y73A 3F7SA 3GZRA 2KRTA 3Q1CA 1VQ93 1SIIA 3CMA3 3U97A 2Y74A 2HMJB 1BOXA 3DGOA 2E2UA 1YIT3 1SPUA 2CFWA 2MC8A 2ML6A 2XGNA 2QGUA 1YJW3 1BANA 2PZVA 3NXJA 3DUKA 4NHFA 3D79A 1OF5B 2L1SA 1K8A4 1B27A 1YI23 1UI7A 1BU4A 1W5ZA 4FR9A 3B8LA 2YFIB 1VQK3
chains in the Genus database with same CATH topology
3MSOA 2XGLA 3D9RA 4IPBA 1QVF2 1WNHA 1N5HA 4OUQA 1SQWA 5AIHA 1TIJA 1ASKA 2CK3H 1RN7A 2CWTA 3CCR3 2FGTA 1UUWB 1U8CB 3CCQ3 1CQSA 3LZAA 2XH9A 1NB3I 3N9HA 1J2BA 4OVMA 3LT8A 1NJI4 4MJDA 1IV7A 2QA43 1K28A 1YGEA 1CEWI 3BNCA 2W56A 3VF1A 4EXRA 3PCSA 1Q7Y4 2XR8B 1YJ93 4AEQA 3I553 1A67A 4FMBA 3JUQA 1IK3A 1E3VA 2XSHB 2W9PA 4WP5A 2CC3A 2WO0A 1VQO3 2WOHA 3SLUA 2RCDA 7STDA 3WA3A 2R4IA 3L0RA 1IQ8A 1VQL3 3GZXB 5IG3A 1GD3A 3B4OA 5FW5A 1JV2B 5CF1A 1Q42A 1YHQ3 4HVNA 2OTL3 3NUVA 1DMQA 3UL5A 3JUOA 3EQQB 2GBXB 3HI7A 5I97A 1DVDA 4O3VA 3CNXA 3LTCA 1VQ63 1E97A 3X42A 2BHMA 3D3LA 3FKAA 2F99A 4HM2B 1R4CA 1GY6A 4LZIA 4O02B 3J7Yd 3CD63 1LNHA 1OF5A 1ROVA 4KFEA 4RNYA 1VQ83 1EKMA 3CCE3 2Z76A 8CHOA 3X41A 4KZ1A 2LYXA 3F14A 1AR0A 4BTYA 1KD14 1N9JA 1O7MB 3K7CA 5KP3A 4FMCA 3IPTA 3GRDA 2Q07A 3EF8A 5CF2A 3PZWA 1YIJ3 1RRHA 2YFLB 3KSPA 4I4KA 1IV9A 5EVHA 3WDGB 1OHSA 3BNBA 4WYKB 4K1UA 3LTDA 5ELUA 4AKYA 2O9UX 4GB5A 3K0ZA 3MWZA 5BVBA 4CCVA 3K9MC 3NBBA 3RGRA 2OTJ3 1JB5A 1M9GA 3PGBA 2GU3A 3ECFA 3KKGA 3LT9A 1GY5A 3NQYA 1TFKA 2W2CA 4HM1B 5HGRA 1AVLA 4IT7A 2XFSA 3OWYA 1VQ53 1OGXA 3FF0A 2I9WA 3I563 1ISKA 3BLZA 2P0XA 2CFDA 5D83A 2W6JH 3NHXA 1IQXA 3UL6A 3OW22 4HM4B 2CHCA 3OWUA 5EEOA 4N6LA 1SIHA 4AKZA 1K734 2WGOA 3HIGA 2K0MA 2HMLB 3DY5A 4R9LA 5LC6A 3MKIA 1DVCA 1JN5B 4ZM8A 3WMDA 5A0OB 1ULIB 2IMJA 2ZDJA 3AMOB 3DM8A 2P09A 3HX8A 5KP1A 1W6CA 3EN8A 3B4PA 1NDOB 1UW1A 3F40A 5IEPA 3NV0B 4LMIA 3ROBA 2BMRB 5DRVA 3EE1A 1YVBI 1TFOA 2BMOB 4R80A 4GL6A 1U5OA 2FXTA 2HMNB 2HMKB 4FCZA 1O7HB 1N5PA 1JB2A 2GXFA 3IJEB 3JVCA 1QVG2 1RRLA 1WMOA 4HBRA 1STFI 1O7PB 3K63A 4H3UA 1ZO2A 6STDA 3QRDA 3O8YA 1JKGB 2SBLA 4HYZA 4U13A 3JUMA 1LOXA 3CCM3 5ELJA 4EV2A 1OACA 3NBRA 3HZPA 2JDIH 1GS3A 2YX9A 2HMOB 5TGNA 1IT7A 4RNZA 4HM5B 1W2B2 1ROAA 1CYVA 3LTBA 3CC43 3GWRA 2K54A 3UJMA 1DMMA 5STDA 1FGTA 3FH1A 3G713 1W6YA 3GAXA 2OWPA 4MMYB 2F98A 2IA7A 3PXMA 4OK0A 3FG4A 4N6V0 4WHAA 2GBWB 4MMXB 4R4KA 4TX4A 4XM4A 3U1WA 1OH0A 1EQKA 1W2ZA 2B1XB 4N3VA 2BT3A 3H3HA 1HU9A 5IEOA 4J9AA 4O8SA 2Z7AA 2OQEC 1W4NA 5AEUB 3EX9A 2QIYA 4JF8A 4FCMA 1IU7A 1IDPA 1O7WB 5IW9A 4K1VA 1A2KA 3N8BA 3T8UA 3OV4A 2C10A 3S67A 4HJLB 1IVUA 2CWUA 4MEIA 3LOYA 4N6TA 5AYRB 2BNGA 3WODG 4IIAA 2KXGA 3E99A 3SXXA 1AV4A 3CME3 2XEPA 3A76A 3OXAA 3G8ZA 4FCJA 1UI8A 2MF7A 1GYBA 1EG9B 2GU1A 5CK6A 4EYCA 1M1XB 1MNLA 2RGQA 3FLJA 3FSDA 2O3OA 1IVVA 1O7NB 3KIIA 4HM0B 3WA2X 4X2HA 1JKGA 2CG1A 3SOAA 4EC6A 3NQZA 1IVXA 1OUNA 3T8NA 3BNEA 3VGNA 2GEYA 3FCSB 5FGOA 3JUPA 1KC84 1Q814 3RDEA 3V98A 3DGLA 3FGYA 3V92A 3G0KA 5JBSA 3HK4A 4NREA 1TUHA 5AYSC 1N9EA 4PEJA 4JRFA 3KFQC 3CPW2 1VQP3 3BB9A 1NWWA 2ML5A 3DGMA 2CFKA 4XBYA 3V99A 3EC9A 4K90B 2ZL8A 1F8NA 3MG3A 1UUVB 4HM8B 1KQS2 2W03A 4R9KA 2OOVA 2Z6BA 3SX1A 1D6UA 1K41A 3Q90A 1PFPA 4HZ9B 4WWUC 3S27A 3UB1A 4EV5A 3CCS3 1NO3A 1LVNA 2XRXB 4KFDA 1Q40B 3CCU3 1QAFA 3KSED 5JPPA 3DZLA 2CIUA 3ALAA 1FGQA 5IG4A 2OQEA 3FF2A 1TP6A 3MPHA 3BNDA 1OHPA 3HIIA 2V1LA 3RGAA 4K61A 1GY7A 2P05A 1FA3A 1QAKA 4CDLA 4BTWA 3M8CA 5EQLA 2BO9B 2Z77A 3NM2A 4XBXA 3H51A 1ZX2A 3IMAB 3EBTA 2F86B 4WYKA 1WQLB 3G4S3 3SOYA 2PNCA 3F9SA 3CXC2 4ORLA 3G16A 5BXQA 1HKXA 3X3ZA 2XSOB 3WOFB 4LSOA 3FG1A 3X3YA 2CH9A 2WOFA 4N6MA 4L8PA 1W6GA 1RKYA 3PYJA 4L7KA 4QWTA 3PCRA 2IUKA 1S5AA 3CPOA 1N8R4 5IG0A 1A90A 3S29A 2OOVC 1W00A 5AIGA 1K9M4 4N6OB 1FGOA 3GZYB 3FG3A 4N6UA 4Q53A 3EJVA 4STDA 4XDWA 1FUWA 4X2OA 3F7XA 3CC73 4RZMA 5LC7A 2A15A 2IUJA 1NB5I 2M7OA 1STDA 2KCDA 1Q40A 3EB8A 1PU4A 1M1K4 5G2GA 1O7GB 3FZWA 4KVHA 5IG5A 4HKVB 3ER7A 3GZBA 2P38A 1YJN3 3NX0A 2RFRA 4J8TA 3SEDA 4WFOA 3CCJ3 4KFFA 2W9QA 1JN5A 3EBYA 3PS8A 5AIIA 2OCTA 3AMOA 5AIFA 3S28A 1IQYA 2INXA 1OCVA 3CCV3 3DGNA 1V74A 4O2HA 1WMNA 3LXUX 1VZZA 3NV0A 5CLKA 4G1MB 2STDA 3MHEA 3JUNA 5D82A 1Z1SA 2CFLA 5KP4A 3LMLA 4XDVA 1D6YA 3TDGA 3LH4A 1VQN3 1VQ43 1GD4A 3B7CA 3CC23 2BMQB 2W0QA 3KN4A 2D1WA 3OWSA 4R1KA 2D42A 4XB5A 1OPYA 2L4VA 3QK9A 1LXEA 1RJOA 3UNLA 3LYGA 1BUQA 1FGRA 5AI1A 1JRQA 3T0UA 3K5TA 2CKFB 4H61A 1Y4KA 1S723 2JQ5A 3DMCA 3N54B 5IENA 1A2VA 1ULJB 4N6NB 5IERA 1L5GB 3VSYA 1TU5A 1E3RA 1CYUA 3F8XA 4HM6B 1W01A 2FNQA 3STDA 3S5CA 4LGQA 4HM3B 2XFTA 3NM7A 3F8HA 1Q864 1OGZA 3NBJA 5IF6A 1KSIA 4FMDA 1OHOA 1WTHA 1WMPA 1QJGA 2WGQA 1W02A 1JJ22 2XF3A 3Q2PA 1KWIA 3LTAA 1N8QA 3CNMA 5D81A 3KZTA 1M904 5DREA 3OX9A 3SVAA 4RBNA 1D6ZA 2HMMB 3MG2A 1Q824 2CWVA 3X40A 1FGMA 2E2TA 1QMAA 1US1A 4EBGA 3G6E3 3CCL3 1EA2A 3I0YA 5JPUA 1W7CA 1QALA 1IVWA 2CW9A 2P0MA 2YFJB 3DXOA 3EN1B 4LEHA 4BTXA 2QEX3 1DMNA 5AEWB 3EHCA 2W56B 4MMZB 4HM7B 2LQVA 2RSXA 2GEXA 1MOLA 3X3XA 2B24B 2W04A 1SJWA 2E2VA 3CU3A 2CG0A 3KE7A 2CFGA 1NU3A 1VQM3 2UX0A 1T5YA 3MG1A 1C7HA 1JNQA 5CXOA 1IT8A 4L8OA 1AVKA 1DYUA 4XBTA 1VQ73 4FMAA 4HZBB 3MYTA 2C11A 1G96A 3WOEB 1JB4A 2Y73A 3F7SA 3GZRA 2KRTA 3Q1CA 1VQ93 1SIIA 3CMA3 3U97A 2Y74A 2HMJB 3DGOA 2E2UA 1YIT3 1SPUA 2CFWA 2MC8A 2ML6A 2XGNA 2QGUA 1YJW3 2PZVA 3NXJA 3DUKA 4NHFA 1OF5B 1K8A4 1YI23 1UI7A 1W5ZA 4FR9A 3B8LA 2YFIB 1VQK3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSO A;  3D9R A;  4OUQ A;  5AIH A;  1ASK A;  1UUW B;  1CQS A;  3LZA A;  4OVM A;  4MJD A;  2XR8 B;  3JUQ A;  1E3V A;  2XSH B;  4WP5 A;  2RCD A;  7STD A;  2R4I A;  3GZX B;  5IG3 A;  3B4O A;  5FW5 A;  5CF1 A;  1Q42 A;  4HVN A;  3NUV A;  1DMQ A;  3JUO A;  3EQQ B;  2GBX B;  3CNX A;  1E97 A;  3FKA A;  2F99 A;  4HM2 B;  1GY6 A;  1OF5 A;  2Z76 A;  8CHO A;  3F14 A;  1AR0 A;  1O7M B;  3K7C A;  5KP3 A;  3IPT A;  3GRD A;  3EF8 A;  5CF2 A;  2YFL B;  3KSP A;  4I4K A;  5EVH A;  1OHS A;  4WYK B;  4K1U A;  4GB5 A;  3K0Z A;  5BVB A;  3RGR A;  1JB5 A;  3ECF A;  3KKG A;  1GY5 A;  2W2C A;  4HM1 B;  5HGR A;  3OWY A;  1OGX A;  3FF0 A;  2I9W A;  1ISK A;  3BLZ A;  5D83 A;  3NHX A;  4HM4 B;  2CHC A;  3OWU A;  2HML B;  4R9L A;  3MKI A;  1JN5 B;  3WMD A;  1ULI B;  2IMJ A;  3DM8 A;  3HX8 A;  5KP1 A;  3EN8 A;  3B4P A;  1NDO B;  3F40 A;  5IEP A;  3NV0 B;  4LMI A;  3ROB A;  2BMR B;  5DRV A;  2BMO B;  1U5O A;  2HMN B;  2HMK B;  1O7H B;  1JB2 A;  2GXF A;  1O7P B;  4H3U A;  1ZO2 A;  6STD A;  4U13 A;  1JKG B;  3JUM A;  3NBR A;  3HZP A;  1GS3 A;  2HMO B;  5TGN A;  4HM5 B;  3GWR A;  2K54 A;  3UJM A;  1DMM A;  5STD A;  3FH1 A;  1W6Y A;  2OWP A;  2F98 A;  2GBW B;  4XM4 A;  1OH0 A;  2B1X B;  4N3V A;  3H3H A;  5IEO A;  4J9A A;  2Z7A A;  5AEU B;  3EX9 A;  2QIY A;  4FCM A;  1IDP A;  1O7W B;  4K1V A;  1A2K A;  3T8U A;  3OV4 A;  4HJL B;  2BNG A;  4IIA A;  3E99 A;  3A76 A;  3OXA A;  3G8Z A;  4FCJ A;  1GYB A;  1EG9 B;  5CK6 A;  2RGQ A;  3FLJ A;  3FSD A;  1O7N B;  4HM0 B;  4X2H A;  1JKG A;  3SOA A;  1OUN A;  3T8N A;  3VGN A;  2GEY A;  3JUP A;  3FGY A;  3G0K A;  3HK4 A;  1TUH A;  4PEJ A;  3BB9 A;  1NWW A;  4XBY A;  3EC9 A;  3MG3 A;  1UUV B;  4HM8 B;  4R9K A;  1K41 A;  3Q90 A;  4HZ9 B;  4WWU C;  2XRX B;  1Q40 B;  5JPP A;  3DZL A;  5IG4 A;  3FF2 A;  1TP6 A;  1OHP A;  3RGA A;  1GY7 A;  4CDL A;  3M8C A;  2Z77 A;  3NM2 A;  4XBX A;  3H51 A;  1ZX2 A;  3EBT A;  2F86 B;  4WYK A;  1WQL B;  3SOY A;  3F9S A;  4ORL A;  3G16 A;  5BXQ A;  1HKX A;  2XSO B;  4L8P A;  4L7K A;  1S5A A;  3CPO A;  5IG0 A;  1W00 A;  5AIG A;  4Q53 A;  3GZY B;  4STD A;  4XDW A;  3EJV A;  4X2O A;  3F7X A;  4RZM A;  2A15 A;  1STD A;  1Q40 A;  5G2G A;  1O7G B;  3FZW A;  4KVH A;  5IG5 A;  4HKV B;  3ER7 A;  3GZB A;  3SED A;  2RFR A;  4J8T A;  1JN5 A;  3EBY A;  5AII A;  5AIF A;  2INX A;  1OCV A;  5D82 A;  1VZZ A;  3NV0 A;  5CLK A;  2STD A;  3MHE A;  3JUN A;  1Z1S A;  5KP4 A;  4XDV A;  3B7C A;  2BMQ B;  3OWS A;  4R1K A;  4XB5 A;  1OPY A;  3UNL A;  3LYG A;  1BUQ A;  5AI1 A;  2CKF B;  2JQ5 A;  3DMC A;  5IEN A;  1ULJ B;  5IER A;  3VSY A;  1E3R A;  3F8X A;  4HM6 B;  1W01 A;  3STD A;  3S5C A;  4LGQ A;  4HM3 B;  3F8H A;  1OGZ A;  5IF6 A;  1OHO A;  1QJG A;  1W02 A;  3CNM A;  5D81 A;  3KZT A;  5DRE A;  3OX9 A;  2HMM B;  3MG2 A;  1QMA A;  1EA2 A;  3I0Y A;  5JPU A;  2YFJ B;  3DXO A;  3EN1 B;  4LEH A;  1DMN A;  5AEW B;  3EHC A;  4HM7 B;  2GEX A;  2B24 B;  1SJW A;  3CU3 A;  3KE7 A;  1NU3 A;  2UX0 A;  3MG1 A;  1C7H A;  5CXO A;  4L8O A;  4XBT A;  4HZB B;  3MYT A;  1JB4 A;  3F7S A;  3GZR A;  2HMJ B;  2QGU A;  2PZV A;  3NXJ A;  3DUK A;  1OF5 B;  3B8L A;  2YFI B; 
#chains in the Genus database with same CATH topology
 3MSO A;  2XGL A;  3D9R A;  1BRG A;  4IPB A;  1QVF 2;  4LYL B;  1TTO A;  1N5H A;  1WNH A;  1SQW A;  3D5G A;  1TIJ A;  4OUQ A;  1ASK A;  2CK3 H;  5AIH A;  4BL2 A;  1RN7 A;  2CWT A;  3CCR 3;  2FGT A;  1UUW B;  1BRN L;  1U8C B;  3CCQ 3;  1CQS A;  3LZA A;  1VQQ A;  2XH9 A;  1NB3 I;  3N9H A;  1J2B A;  4OVM A;  1RGH A;  3D5I A;  3LT8 A;  1NJI 4;  4MJD A;  1IV7 A;  4DKI A;  2QA4 3;  1K28 A;  1YGE A;  1CEW I;  3BNC A;  2W56 A;  3VF1 A;  4EXR A;  3PCS A;  2ZHX B;  1Q7Y 4;  2XR8 B;  1YJ9 3;  4AEQ A;  3I55 3;  1GOY A;  2F56 A;  1A67 A;  4FMB A;  3JUQ A;  1IK3 A;  4BU4 A;  1BRI A;  1E3V A;  3D4A A;  2XSH B;  2W9P A;  4WP5 A;  2CC3 A;  2WO0 A;  1VQO 3;  1RNB A;  2WOH A;  3SLU A;  2RCD A;  5M19 A;  7STD A;  3WA3 A;  2R4I A;  3GSP A;  3L0R A;  1IQ8 A;  4BL3 A;  4J5G A;  1VQL 3;  3GZX B;  5IG3 A;  1BNI A;  1GD3 A;  1MGR A;  3B4O A;  5FW5 A;  1JV2 B;  3ZG5 A;  1Q42 A;  5CF1 A;  1YHQ 3;  4HVN A;  2OTL 3;  3NUV A;  1DMQ A;  3UL5 A;  3JUO A;  3EQQ B;  2GBX B;  3HI7 A;  5I97 A;  1B2M A;  1DVD A;  5GSP A;  4O3V A;  4ILF A;  2BU4 A;  2UGI A;  3CNX A;  3LTC A;  1VQ6 3;  1E97 A;  3X42 A;  2BHM A;  3D3L A;  3FKA A;  2F99 A;  4HM2 B;  1R4C A;  1GY6 A;  4LZI A;  4O02 B;  3J7Y d;  3CD6 3;  1LNH A;  1OF5 A;  1ROV A;  4KFE A;  4RNY A;  1VQ8 3;  1EKM A;  3CCE 3;  2Z76 A;  8CHO A;  1BGS A;  3X41 A;  5HOH A;  4KZ1 A;  2LYX A;  3F14 A;  1AR0 A;  4BTY A;  1KD1 4;  1MWR A;  1N9J A;  1O7M B;  3K7C A;  5KP3 A;  1MWU A;  4FMC A;  3IPT A;  3GRD A;  2Q07 A;  1ZS7 A;  1RN1 A;  3EF8 A;  1RHL A;  5CF2 A;  3PZW A;  3HOH A;  1BSA A;  1YIJ 3;  1RRH A;  2YFL B;  1C54 A;  1BUJ A;  3KSP A;  4I4K A;  1NB5 I;  1IV9 A;  2R41 A;  5EVH A;  3WDG B;  2H0I A;  1OHS A;  3BNB A;  6RNT A;  4WYK B;  4K1U A;  3LTD A;  3WR2 A;  1I3I A;  2F4Y A;  5ELU A;  4AKY A;  2O9U X;  1FW7 A;  1DET A;  1GSP A;  4GB5 A;  3K0Z A;  3MWZ A;  5BVB A;  4CCV A;  3K9M C;  4I5Q A;  1RLS A;  3NBB A;  2ZA4 A;  2KF5 A;  3RGR A;  2OTJ 3;  1JB5 A;  3AHW A;  1M9G A;  3PGB A;  2GU3 A;  3ECF A;  3KKG A;  3LT9 A;  1GY5 A;  4HOH A;  3NQY A;  1TFK A;  2W2C A;  4HM1 B;  5HGR A;  1LQG C;  1A2P A;  1BSB A;  1AVL A;  1NNV A;  4IT7 A;  3SYU A;  2XFS A;  3OWY A;  5BU4 A;  1I8V A;  1OGX A;  3FF0 A;  1RSN A;  1UCJ A;  2I9W A;  1VQ5 3;  1SAR A;  3I56 3;  1ISK A;  1X1Y A;  3BLZ A;  4EW5 A;  1T3B A;  2P0X A;  2CFD A;  5D83 A;  2W6J H;  3NHX A;  1IQX A;  3UL6 A;  3OW2 2;  4HM4 B;  2CHC A;  3OWU A;  5EEO A;  4N6L A;  1SIH A;  4AKZ A;  1K73 4;  2WGO A;  3HIG A;  2K0M A;  2HML B;  3DY5 A;  1G02 A;  4R9L A;  5LC6 A;  3MKI A;  1AY7 A;  1DVC A;  1JN5 B;  4ZM8 A;  3WMD A;  5A0O B;  1ULI B;  2IMJ A;  2ZDJ A;  3AMO B;  3DM8 A;  2P09 A;  3HX8 A;  5KP1 A;  1W6C A;  3EN8 A;  3B4P A;  1MGW A;  1NDO B;  1UW1 A;  3F40 A;  5IEP A;  3NV0 B;  4LMI A;  3ROB A;  2BMR B;  3AHS A;  5DRV A;  3EE1 A;  1YVB I;  1TFO A;  2BMO B;  4R80 A;  1RGA A;  4GL6 A;  1U5O A;  2FXT A;  1BIR A;  2HMN B;  2HMK B;  2KF3 A;  4FCZ A;  1O7H B;  1N5P A;  1JB2 A;  2GXF A;  3IJE B;  3JVC A;  1B2Z A;  1RRL A;  1QVG 2;  1WMO A;  4HBR A;  1RTU A;  1STF I;  1FUT A;  1B20 A;  3DH2 A;  1O7P B;  3K63 A;  4H3U A;  1ZO2 A;  1GMP A;  6STD A;  3QRD A;  3O8Y A;  1JKG B;  2SBL A;  4HYZ A;  1R4Y A;  4U13 A;  3JUM A;  1LOX A;  3CCM 3;  5ELJ A;  4EV2 A;  1OAC A;  3NBR A;  3HZP A;  2JDI H;  1GS3 A;  2YX9 A;  3URP A;  3BU4 A;  2HMO B;  1BAO A;  5TGN A;  1I0V A;  1IT7 A;  2IYJ A;  4RNZ A;  3DGY A;  4HM5 B;  1W2B 2;  1ROA A;  1CYV A;  3LTB A;  1RN4 A;  3CC4 3;  3GWR A;  2K54 A;  6GSP A;  3UJM A;  1DMM A;  5STD A;  1FGT A;  3FH1 A;  3G71 3;  1W6Y A;  1EUI C;  3GAX A;  2OWP A;  2AAD A;  4MMY B;  1RGK A;  2F98 A;  2IA7 A;  3PXM A;  4OK0 A;  3FG4 A;  4N6V 0;  4WHA A;  2GBW B;  3AGN A;  4MMX B;  4R4K A;  4TX4 A;  1JBR A;  4XM4 A;  3U1W A;  1OH0 A;  1EQK A;  1W2Z A;  2B1X B;  4N3V A;  2BT3 A;  3H3H A;  1HU9 A;  5IEO A;  4J9A A;  3ZG0 A;  4O8S A;  2Z7A A;  2OQE C;  1W4N A;  5AEU B;  3EX9 A;  2QIY A;  4JF8 A;  4FCM A;  1JZO A;  1IU7 A;  4J5K A;  1IDP A;  1O7W B;  5IW9 A;  1IYY A;  4K1V A;  1A2K A;  3N8B A;  3BIR A;  3T8U A;  3OV4 A;  2C10 A;  3S67 A;  4HJL B;  1IVU A;  2CWU A;  4MEI A;  3LOY A;  4N6T A;  5AYR B;  2BNG A;  3WOD G;  4IIA A;  1FUS A;  2KXG A;  3E99 A;  3SXX A;  1AV4 A;  1BNE A;  1FYS A;  2XEP A;  2GSP A;  3CME 3;  1B2S A;  3A76 A;  3OXA A;  3G8Z A;  4FCJ A;  9RNT A;  1UI8 A;  2MF7 A;  1GYB A;  1EG9 B;  1GOU A;  2K3D A;  2GU1 A;  5CK6 A;  4EYC A;  1M1X B;  2CX0 A;  1MNL A;  2RGQ A;  3FLJ A;  3FSD A;  2O3O A;  1IVV A;  1O7N B;  3KII A;  4HM0 B;  3WA2 X;  1DE3 A;  2UUG C;  1T2H A;  4X2H A;  1BSD A;  1JKG A;  2CG1 A;  3SOA A;  1BSE A;  3NQZ A;  4EC6 A;  1IVX A;  1LOV A;  1OUN A;  3T8N A;  3BNE A;  3VGN A;  5BIR A;  2GEY A;  3FCS B;  4GSP A;  5FGO A;  3JUP A;  1KC8 4;  1JBT A;  1Q81 4;  3RDE A;  3V98 A;  3DGL A;  1T2I A;  3FGY A;  3V92 A;  1YGW A;  1JBS A;  3G0K A;  5JBS A;  3HK4 A;  3Q3F A;  1TUH A;  4NRE A;  5AYS C;  1N9E A;  4PEJ A;  4JRF A;  3KFQ C;  3CPW 2;  1RDS A;  1VQP 3;  3BB9 A;  1NWW A;  2ML5 A;  3DGM A;  1LOW A;  2CFK A;  4XBY A;  2RNT A;  1HZ1 A;  1BNJ A;  4RNT A;  3V99 A;  7GSP A;  3EC9 A;  4K90 B;  2ZL8 A;  1F8N A;  2SAR A;  3MG3 A;  1UUV B;  4HM8 B;  1KQS 2;  2W03 A;  4R9K A;  2OOV A;  1Q9E A;  2Z6B A;  1TRP A;  3SX1 A;  1D6U A;  1K41 A;  3Q90 A;  4CJN A;  1PFP A;  4HZ9 B;  4WWU C;  3S27 A;  3UB1 A;  4EV5 A;  3CCS 3;  1NO3 A;  1HYF A;  1BNS A;  1LVN A;  1RGF A;  2XRX B;  4KFD A;  1Q40 B;  3CCU 3;  1UUG B;  1QAF A;  3KCH A;  3KSE D;  5JPP A;  3DZL A;  2CIU A;  3ALA A;  1FGQ A;  5IG4 A;  2HOH A;  2OQE A;  3FF2 A;  1EEJ A;  1TP6 A;  3MPH A;  3BND A;  1OHP A;  3HII A;  1RGL A;  2H0H A;  2V1L A;  3RGA A;  4K61 A;  1GY7 A;  2P05 A;  1FA3 A;  1QAK A;  1UCI A;  4HAA A;  1LNI A;  4BTW A;  3M8C A;  4CDL A;  5EQL A;  2BO9 B;  2Z77 A;  1ZGX A;  3NM2 A;  4XBX A;  3H51 A;  1ZX2 A;  3IMA B;  3EBT A;  2F86 B;  1PYL A;  4WYK A;  2KAA A;  1WQL B;  1LOY A;  1BRS A;  1I2E A;  2C4B A;  3G4S 3;  3SOY A;  2PNC A;  1UDI I;  3F9S A;  4BIR A;  3CXC 2;  4ORL A;  1YNV X;  3G16 A;  5BXQ A;  1HKX A;  1V58 A;  3X3Z A;  1G0T A;  1RGE A;  2XSO B;  3WOF B;  4GHO A;  4LSO A;  3FG1 A;  4CPK A;  3X3Y A;  2CH9 A;  2WOF A;  8RNT A;  4N6M A;  4L8P A;  1W6G A;  1RKY A;  3PYJ A;  4L7K A;  1B2U A;  4QWT A;  3PCR A;  2IUK A;  1S5A A;  3CPO A;  1B3S A;  1N8R 4;  5IG0 A;  1A90 A;  1BRJ A;  3S29 A;  5G1K A;  3RNT A;  5RNT A;  2OOV C;  1W00 A;  5AIG A;  1K9M 4;  1JZD A;  2H0G A;  1FGO A;  3GZY B;  3FG3 A;  4N6O B;  4N6U A;  3EJV A;  4Q53 A;  4STD A;  4XDW A;  1TRQ A;  1MWT A;  1FUW A;  4X2O A;  3F7X A;  3CC7 3;  4RZM A;  1X1X A;  1BNF A;  2A15 A;  5LC7 A;  2IUJ A;  2M7O A;  1STD A;  2KCD A;  1Q40 A;  3EB8 A;  3ZFZ A;  1PU4 A;  5G2G A;  1O7G B;  3FZW A;  4KVH A;  5IG5 A;  4HKV B;  3ER7 A;  3GZB A;  2P38 A;  1YJN 3;  3NX0 A;  1UGI A;  2RFR A;  4J8T A;  4WFO A;  3SED A;  3CCJ 3;  4KFF A;  2W9Q A;  1JN5 A;  1GOV A;  3EBY A;  1M1K 4;  1B21 A;  3PS8 A;  5AII A;  2OCT A;  1UCK A;  3AMO A;  5AIF A;  3S28 A;  1IQY A;  1CH0 A;  2INX A;  2J8X B;  5M18 A;  1OCV A;  1Q7H A;  2KF4 A;  3CCV 3;  3DGN A;  1V74 A;  4O2H A;  1WMN A;  3LXU X;  1VZZ A;  3NV0 A;  5CLK A;  4G1M B;  2STD A;  3MHE A;  3JUN A;  5D82 A;  1Z1S A;  2CFL A;  5KP4 A;  3LML A;  4XDV A;  1D6Y A;  1RMS A;  3TDG A;  3LH4 A;  1VQN 3;  1VQ4 3;  1TJD A;  1GD4 A;  3B7C A;  3CC2 3;  2BMQ B;  1UCL A;  2W0Q A;  3KN4 A;  2D1W A;  3OWS A;  4R1K A;  2D42 A;  4XB5 A;  1OPY A;  2L4V A;  3QK9 A;  1LXE A;  2KF6 A;  1RJO A;  3UNL A;  3LYG A;  3AGO A;  4KT3 B;  1BUQ A;  1FGR A;  5AI1 A;  1JRQ A;  3T0U A;  3K5T A;  2CKF B;  4H61 A;  1Y4K A;  1S72 3;  2JQ5 A;  1RNT A;  3DMC A;  3N54 B;  2AAE A;  5IEN A;  4NPB A;  1A2V A;  1ULJ B;  4N6N B;  1V57 A;  5G1L A;  1FZU A;  1GMQ A;  1I2F A;  2RBI A;  5IER A;  1I0X A;  1L5G B;  1BRH A;  3VSY A;  1E3R A;  1TU5 A;  3F8X A;  1CYU A;  4HM6 B;  1W01 A;  2FNQ A;  3STD A;  3S5C A;  4LGQ A;  4HM3 B;  2XFT A;  3NM7 A;  3F8H A;  1Q86 4;  1OGZ A;  1LQM B;  3NBJ A;  5IF6 A;  1KSI A;  1PY3 A;  4FMD A;  1OHO A;  1WTH A;  1WMP A;  1BNR A;  1B2X A;  1QJG A;  2WGQ A;  1W02 A;  7RNT A;  1JJ2 2;  2XF3 A;  3Q2P A;  1KWI A;  2F5W A;  1BSC A;  3LTA A;  1N8Q A;  3CNM A;  5D81 A;  3KZT A;  1M90 4;  5DRE A;  3OX9 A;  1X1U A;  3SVA A;  4RBN A;  1RCK A;  1D6Z A;  1I70 A;  2HMM B;  3MG2 A;  1Q82 4;  2CWV A;  3A5E A;  2F5M A;  3X40 A;  1FGM A;  2E2T A;  1QMA A;  1US1 A;  4EBG A;  3G6E 3;  3CCL 3;  2IY2 A;  1EA2 A;  1RCL A;  3I0Y A;  5JPU A;  1W7C A;  1BVI A;  1QAL A;  2BIR A;  1IVW A;  1BNG A;  2CW9 A;  2P0M A;  2YFJ B;  1UGH I;  3DXO A;  3EN1 B;  4LEH A;  4BTX A;  2QEX 3;  1DMN A;  5AEW B;  3EHC A;  2W56 B;  4MMZ B;  4HM7 B;  2LQV A;  1MWS A;  2RSX A;  5M1A A;  2GEX A;  1MOL A;  3X3X A;  2B24 B;  1AQZ A;  1I2G A;  2W04 A;  1RGC A;  1SJW A;  2E2V A;  3CU3 A;  2CG0 A;  3KE7 A;  1YVS A;  2CFG A;  1NU3 A;  1VQM 3;  2UX0 A;  1I3F A;  3WHO A;  1T5Y A;  1GMR A;  3MG1 A;  1C7H A;  1LRA A;  1JNQ A;  1X1W A;  5CXO A;  1IT8 A;  1RGG A;  4L8O A;  1AVK A;  1DYU A;  4XBT A;  1VQ7 3;  1BRK A;  4FMA A;  4HZB B;  3MYT A;  2C11 A;  1G96 A;  2CX1 A;  3WOE B;  1JB4 A;  2Y73 A;  3F7S A;  3GZR A;  2KRT A;  3Q1C A;  1VQ9 3;  1SII A;  3CMA 3;  3U97 A;  2Y74 A;  2HMJ B;  1BOX A;  3DGO A;  2E2U A;  1YIT 3;  1SPU A;  2CFW A;  2MC8 A;  2ML6 A;  2XGN A;  2QGU A;  1YJW 3;  1BAN A;  2PZV A;  3NXJ A;  3DUK A;  4NHF A;  3D79 A;  1OF5 B;  2L1S A;  1K8A 4;  1B27 A;  1YI2 3;  1UI7 A;  1BU4 A;  1W5Z A;  4FR9 A;  3B8L A;  2YFI B;  1VQK 3; 
#chains in the Genus database with same CATH homology
 3MSO A;  2XGL A;  3D9R A;  4IPB A;  1QVF 2;  1WNH A;  1N5H A;  4OUQ A;  1SQW A;  5AIH A;  1TIJ A;  1ASK A;  2CK3 H;  1RN7 A;  2CWT A;  3CCR 3;  2FGT A;  1UUW B;  1U8C B;  3CCQ 3;  1CQS A;  3LZA A;  2XH9 A;  1NB3 I;  3N9H A;  1J2B A;  4OVM A;  3LT8 A;  1NJI 4;  4MJD A;  1IV7 A;  2QA4 3;  1K28 A;  1YGE A;  1CEW I;  3BNC A;  2W56 A;  3VF1 A;  4EXR A;  3PCS A;  1Q7Y 4;  2XR8 B;  1YJ9 3;  4AEQ A;  3I55 3;  1A67 A;  4FMB A;  3JUQ A;  1IK3 A;  1E3V A;  2XSH B;  2W9P A;  4WP5 A;  2CC3 A;  2WO0 A;  1VQO 3;  2WOH A;  3SLU A;  2RCD A;  7STD A;  3WA3 A;  2R4I A;  3L0R A;  1IQ8 A;  1VQL 3;  3GZX B;  5IG3 A;  1GD3 A;  3B4O A;  5FW5 A;  1JV2 B;  5CF1 A;  1Q42 A;  1YHQ 3;  4HVN A;  2OTL 3;  3NUV A;  1DMQ A;  3UL5 A;  3JUO A;  3EQQ B;  2GBX B;  3HI7 A;  5I97 A;  1DVD A;  4O3V A;  3CNX A;  3LTC A;  1VQ6 3;  1E97 A;  3X42 A;  2BHM A;  3D3L A;  3FKA A;  2F99 A;  4HM2 B;  1R4C A;  1GY6 A;  4LZI A;  4O02 B;  3J7Y d;  3CD6 3;  1LNH A;  1OF5 A;  1ROV A;  4KFE A;  4RNY A;  1VQ8 3;  1EKM A;  3CCE 3;  2Z76 A;  8CHO A;  3X41 A;  4KZ1 A;  2LYX A;  3F14 A;  1AR0 A;  4BTY A;  1KD1 4;  1N9J A;  1O7M B;  3K7C A;  5KP3 A;  4FMC A;  3IPT A;  3GRD A;  2Q07 A;  3EF8 A;  5CF2 A;  3PZW A;  1YIJ 3;  1RRH A;  2YFL B;  3KSP A;  4I4K A;  1IV9 A;  5EVH A;  3WDG B;  1OHS A;  3BNB A;  4WYK B;  4K1U A;  3LTD A;  5ELU A;  4AKY A;  2O9U X;  4GB5 A;  3K0Z A;  3MWZ A;  5BVB A;  4CCV A;  3K9M C;  3NBB A;  3RGR A;  2OTJ 3;  1JB5 A;  1M9G A;  3PGB A;  2GU3 A;  3ECF A;  3KKG A;  3LT9 A;  1GY5 A;  3NQY A;  1TFK A;  2W2C A;  4HM1 B;  5HGR A;  1AVL A;  4IT7 A;  2XFS A;  3OWY A;  1VQ5 3;  1OGX A;  3FF0 A;  2I9W A;  3I56 3;  1ISK A;  3BLZ A;  2P0X A;  2CFD A;  5D83 A;  2W6J H;  3NHX A;  1IQX A;  3UL6 A;  3OW2 2;  4HM4 B;  2CHC A;  3OWU A;  5EEO A;  4N6L A;  1SIH A;  4AKZ A;  1K73 4;  2WGO A;  3HIG A;  2K0M A;  2HML B;  3DY5 A;  4R9L A;  5LC6 A;  3MKI A;  1DVC A;  1JN5 B;  4ZM8 A;  3WMD A;  5A0O B;  1ULI B;  2IMJ A;  2ZDJ A;  3AMO B;  3DM8 A;  2P09 A;  3HX8 A;  5KP1 A;  1W6C A;  3EN8 A;  3B4P A;  1NDO B;  1UW1 A;  3F40 A;  5IEP A;  3NV0 B;  4LMI A;  3ROB A;  2BMR B;  5DRV A;  3EE1 A;  1YVB I;  1TFO A;  2BMO B;  4R80 A;  4GL6 A;  1U5O A;  2FXT A;  2HMN B;  2HMK B;  4FCZ A;  1O7H B;  1N5P A;  1JB2 A;  2GXF A;  3IJE B;  3JVC A;  1QVG 2;  1RRL A;  1WMO A;  4HBR A;  1STF I;  1O7P B;  3K63 A;  4H3U A;  1ZO2 A;  6STD A;  3QRD A;  3O8Y A;  1JKG B;  2SBL A;  4HYZ A;  4U13 A;  3JUM A;  1LOX A;  3CCM 3;  5ELJ A;  4EV2 A;  1OAC A;  3NBR A;  3HZP A;  2JDI H;  1GS3 A;  2YX9 A;  2HMO B;  5TGN A;  1IT7 A;  4RNZ A;  4HM5 B;  1W2B 2;  1ROA A;  1CYV A;  3LTB A;  3CC4 3;  3GWR A;  2K54 A;  3UJM A;  1DMM A;  5STD A;  1FGT A;  3FH1 A;  3G71 3;  1W6Y A;  3GAX A;  2OWP A;  4MMY B;  2F98 A;  2IA7 A;  3PXM A;  4OK0 A;  3FG4 A;  4N6V 0;  4WHA A;  2GBW B;  4MMX B;  4R4K A;  4TX4 A;  4XM4 A;  3U1W A;  1OH0 A;  1EQK A;  1W2Z A;  2B1X B;  4N3V A;  2BT3 A;  3H3H A;  1HU9 A;  5IEO A;  4J9A A;  4O8S A;  2Z7A A;  2OQE C;  1W4N A;  5AEU B;  3EX9 A;  2QIY A;  4JF8 A;  4FCM A;  1IU7 A;  1IDP A;  1O7W B;  5IW9 A;  4K1V A;  1A2K A;  3N8B A;  3T8U A;  3OV4 A;  2C10 A;  3S67 A;  4HJL B;  1IVU A;  2CWU A;  4MEI A;  3LOY A;  4N6T A;  5AYR B;  2BNG A;  3WOD G;  4IIA A;  2KXG A;  3E99 A;  3SXX A;  1AV4 A;  3CME 3;  2XEP A;  3A76 A;  3OXA A;  3G8Z A;  4FCJ A;  1UI8 A;  2MF7 A;  1GYB A;  1EG9 B;  2GU1 A;  5CK6 A;  4EYC A;  1M1X B;  1MNL A;  2RGQ A;  3FLJ A;  3FSD A;  2O3O A;  1IVV A;  1O7N B;  3KII A;  4HM0 B;  3WA2 X;  4X2H A;  1JKG A;  2CG1 A;  3SOA A;  4EC6 A;  3NQZ A;  1IVX A;  1OUN A;  3T8N A;  3BNE A;  3VGN A;  2GEY A;  3FCS B;  5FGO A;  3JUP A;  1KC8 4;  1Q81 4;  3RDE A;  3V98 A;  3DGL A;  3FGY A;  3V92 A;  3G0K A;  5JBS A;  3HK4 A;  4NRE A;  1TUH A;  5AYS C;  1N9E A;  4PEJ A;  4JRF A;  3KFQ C;  3CPW 2;  1VQP 3;  3BB9 A;  1NWW A;  2ML5 A;  3DGM A;  2CFK A;  4XBY A;  3V99 A;  3EC9 A;  4K90 B;  2ZL8 A;  1F8N A;  3MG3 A;  1UUV B;  4HM8 B;  1KQS 2;  2W03 A;  4R9K A;  2OOV A;  2Z6B A;  3SX1 A;  1D6U A;  1K41 A;  3Q90 A;  1PFP A;  4HZ9 B;  4WWU C;  3S27 A;  3UB1 A;  4EV5 A;  3CCS 3;  1NO3 A;  1LVN A;  2XRX B;  4KFD A;  1Q40 B;  3CCU 3;  1QAF A;  3KSE D;  5JPP A;  3DZL A;  2CIU A;  3ALA A;  1FGQ A;  5IG4 A;  2OQE A;  3FF2 A;  1TP6 A;  3MPH A;  3BND A;  1OHP A;  3HII A;  2V1L A;  3RGA A;  4K61 A;  1GY7 A;  2P05 A;  1FA3 A;  1QAK A;  4CDL A;  4BTW A;  3M8C A;  5EQL A;  2BO9 B;  2Z77 A;  3NM2 A;  4XBX A;  3H51 A;  1ZX2 A;  3IMA B;  3EBT A;  2F86 B;  4WYK A;  1WQL B;  3G4S 3;  3SOY A;  2PNC A;  3F9S A;  3CXC 2;  4ORL A;  3G16 A;  5BXQ A;  1HKX A;  3X3Z A;  2XSO B;  3WOF B;  4LSO A;  3FG1 A;  3X3Y A;  2CH9 A;  2WOF A;  4N6M A;  4L8P A;  1W6G A;  1RKY A;  3PYJ A;  4L7K A;  4QWT A;  3PCR A;  2IUK A;  1S5A A;  3CPO A;  1N8R 4;  5IG0 A;  1A90 A;  3S29 A;  2OOV C;  1W00 A;  5AIG A;  1K9M 4;  4N6O B;  1FGO A;  3GZY B;  3FG3 A;  4N6U A;  4Q53 A;  3EJV A;  4STD A;  4XDW A;  1FUW A;  4X2O A;  3F7X A;  3CC7 3;  4RZM A;  5LC7 A;  2A15 A;  2IUJ A;  1NB5 I;  2M7O A;  1STD A;  2KCD A;  1Q40 A;  3EB8 A;  1PU4 A;  1M1K 4;  5G2G A;  1O7G B;  3FZW A;  4KVH A;  5IG5 A;  4HKV B;  3ER7 A;  3GZB A;  2P38 A;  1YJN 3;  3NX0 A;  2RFR A;  4J8T A;  3SED A;  4WFO A;  3CCJ 3;  4KFF A;  2W9Q A;  1JN5 A;  3EBY A;  3PS8 A;  5AII A;  2OCT A;  3AMO A;  5AIF A;  3S28 A;  1IQY A;  2INX A;  1OCV A;  3CCV 3;  3DGN A;  1V74 A;  4O2H A;  1WMN A;  3LXU X;  1VZZ A;  3NV0 A;  5CLK A;  4G1M B;  2STD A;  3MHE A;  3JUN A;  5D82 A;  1Z1S A;  2CFL A;  5KP4 A;  3LML A;  4XDV A;  1D6Y A;  3TDG A;  3LH4 A;  1VQN 3;  1VQ4 3;  1GD4 A;  3B7C A;  3CC2 3;  2BMQ B;  2W0Q A;  3KN4 A;  2D1W A;  3OWS A;  4R1K A;  2D42 A;  4XB5 A;  1OPY A;  2L4V A;  3QK9 A;  1LXE A;  1RJO A;  3UNL A;  3LYG A;  1BUQ A;  1FGR A;  5AI1 A;  1JRQ A;  3T0U A;  3K5T A;  2CKF B;  4H61 A;  1Y4K A;  1S72 3;  2JQ5 A;  3DMC A;  3N54 B;  5IEN A;  1A2V A;  1ULJ B;  4N6N B;  5IER A;  1L5G B;  3VSY A;  1TU5 A;  1E3R A;  1CYU A;  3F8X A;  4HM6 B;  1W01 A;  2FNQ A;  3STD A;  3S5C A;  4LGQ A;  4HM3 B;  2XFT A;  3NM7 A;  3F8H A;  1Q86 4;  1OGZ A;  3NBJ A;  5IF6 A;  1KSI A;  4FMD A;  1OHO A;  1WTH A;  1WMP A;  1QJG A;  2WGQ A;  1W02 A;  1JJ2 2;  2XF3 A;  3Q2P A;  1KWI A;  3LTA A;  1N8Q A;  3CNM A;  5D81 A;  3KZT A;  1M90 4;  5DRE A;  3OX9 A;  3SVA A;  4RBN A;  1D6Z A;  2HMM B;  3MG2 A;  1Q82 4;  2CWV A;  3X40 A;  1FGM A;  2E2T A;  1QMA A;  1US1 A;  4EBG A;  3G6E 3;  3CCL 3;  1EA2 A;  3I0Y A;  5JPU A;  1W7C A;  1QAL A;  1IVW A;  2CW9 A;  2P0M A;  2YFJ B;  3DXO A;  3EN1 B;  4LEH A;  4BTX A;  2QEX 3;  1DMN A;  5AEW B;  3EHC A;  2W56 B;  4MMZ B;  4HM7 B;  2LQV A;  2RSX A;  2GEX A;  1MOL A;  3X3X A;  2B24 B;  2W04 A;  1SJW A;  2E2V A;  3CU3 A;  2CG0 A;  3KE7 A;  2CFG A;  1NU3 A;  1VQM 3;  2UX0 A;  1T5Y A;  3MG1 A;  1C7H A;  1JNQ A;  5CXO A;  1IT8 A;  4L8O A;  1AVK A;  1DYU A;  4XBT A;  1VQ7 3;  4FMA A;  4HZB B;  3MYT A;  2C11 A;  1G96 A;  3WOE B;  1JB4 A;  2Y73 A;  3F7S A;  3GZR A;  2KRT A;  3Q1C A;  1VQ9 3;  1SII A;  3CMA 3;  3U97 A;  2Y74 A;  2HMJ B;  3DGO A;  2E2U A;  1YIT 3;  1SPU A;  2CFW A;  2MC8 A;  2ML6 A;  2XGN A;  2QGU A;  1YJW 3;  2PZV A;  3NXJ A;  3DUK A;  4NHF A;  1OF5 B;  1K8A 4;  1YI2 3;  1UI7 A;  1W5Z A;  4FR9 A;  3B8L A;  2YFI B;  1VQK 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...