1GMQA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
total genus 27
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmqA00
1BRIA 6RNTA 1BRHA 2F56A 1HZ1A 1RGLA 1TRPA 1B21A 1X1UA 1BNEA 8RNTA 1RGHA 1MGWA 1TTOA 1GMQA 2RNTA 1GMRA 2GSPA 1DE3A 1AQZA 2BU4A 1LRAA 1RMSA 1GOYA 1A2PA 1RLSA 1BRNL 1BNGA 1BSCA 1FZUA 1FUSA 1Q9EA 2ZA4A 1T2IA 1GOUA 3A5EA 2AADA 3D5IA 1RN1A 1BRJA 1RN4A 1BGSA 1I2EA 1FW7A 5BIRA 1RCLA 2AAEA 1BNIA 5BU4A 1B2ZA 1TRQA 1RTUA 2F4YA 3BIRA 1X1WA 3WHOA 2KAAA 1ZGXA 1UCJA 1UCIA 4J5KA 1CH0A 1RNBA 1JBRA 1C54A 1IYYA 7GSPA 1DETA 1B27A 3D5GA 1I0VA 2KF3A 1I3FA 1SARA 1B2MA 4HAAA 3GSPA 9RNTA 1BU4A 1I3IA 1BIRA 4RNTA 1I70A 1BSDA 2BIRA 1T2HA 1GMPA 3AHSA 1JBTA 1BOXA 1FUTA 1RNTA 1B2UA 1BSEA 1G02A 3AGNA 1PY3A 1BUJA 1RGAA 1BANA 1B20A 2F5WA 2KF5A 1I8VA 5HOHA 1PYLA 3HOHA 2KF4A 4BIRA 1RSNA 1LOWA 4J5GA 2HOHA 2C4BA 3WR2A 1RGGA 1LOYA 1MGRA 4HOHA 1FYSA 1UCKA 3AGOA 1R4YA 1B2SA 1HYFA 2KF6A 1BAOA 3BU4A 1YNVX 1I2FA 1RCKA 3Q3FA 3URPA 1I2GA 1AY7A 3KCHA 5GSPA 1GSPA 1BNSA 1BRGA 5RNTA 1B3SA 1RHLA 1BVIA 2RBIA 4BU4A 3RNTA 2F5MA 2SARA 6GSPA 1YGWA 1YVSA 4GHOA 1BNFA 1RDSA 1RGCA 1LNIA 1BSAA 7RNTA 1B2XA 1RGEA 1X1XA 1UCLA 1LOVA 3AHWA 1BRKA 3DH2A 3DGYA 1BRSA 1RGFA 4GSPA 1I0XA 3D4AA 1RGKA 1BSBA 1BNRA 1BNJA 1X1YA 1GOVA 3SYUA 1JBSA
chains in the Genus database with same CATH superfamily
4XM4A 1BRIA 1V57A 1W7CA 1Q814 2OOVC 2CG0A 3JUQA 1C7HA 1T3BA 1TRPA 3MG1A 2P38A 1EA2A 1LQMB 2IUKA 3SXXA 3PXMA 3WDGB 4N6TA 1NB5I 1TTOA 1Q864 2RNTA 1CQSA 3MKIA 2B24B 2W0QA 1DE3A 3DY5A 3OX9A 2OTJ3 1RMSA 3G0KA 2OOVA 2UUGC 1SJWA 1Q9EA 2ZA4A 1JRQA 1SQWA 3FF0A 5FW5A 4OUQA 5BXQA 3MG3A 3FGYA 4HM4B 3T8NA 2F99A 1RCLA 2AAEA 2GBWB 5IW9A 2BMOB 1TRQA 1ZO2A 2OQEC 4WFOA 5EEOA 1US1A 1N9EA 5IF6A 4L8PA 1RTUA 3T0UA 1RN7A 4EC6A 1O7GB 1DVCA 1PFPA 3ER7A 1RRLA 3WHOA 1K734 4R9LA 1RJOA 3L0RA 2KAAA 1ZGXA 4DKIA 1UCJA 2E2TA 3NV0B 1RKYA 1OF5A 1UW1A 2RSXA 1IYYA 2YFIB 1IVUA 1B27A 2C10A 1OUNA 3NBJA 3X3ZA 2Z76A 2KF3A 1I3FA 2CX1A 1EUIC 3GSPA 3K63A 1VQP3 1N8QA 1WNHA 2FXTA 1BIRA 1LNHA 3B8LA 5M18A 2CFKA 2K54A 3Q90A 4AEQA 1GMPA 3QK9A 4KZ1A 1RNTA 2XR8B 1N5PA 1BSEA 3F7SA 4MJDA 3LTBA 3LTAA 1PY3A 2CWVA 4CJNA 4HM8B 1RGAA 4HZ9B 3DGMA 1B20A 3MPHA 3U97A 1A90A 4MMXB 3RDEA 1YHQ3 1N9JA 3HI7A 4HZBB 1O7HB 4BTWA 3CC73 4BIRA 2D1WA 1G96A 3DGOA 3FKAA 3NQZA 1RSNA 3IMAB 4J5GA 2HOHA 3EN1B 2IUJA 3V99A 1N8R4 1ZS7A 5IG3A 2WGOA 1YI23 4WP5A 3CCV3 3I0YA 3NHXA 1DVDA 3FCSB 1UCKA 3WA2X 1STDA 1UUVB 2P05A 1BAOA 4KFFA 4N6LA 1YNVX 3BNCA 2F86B 5G1KA 1ASKA 1D6UA 3GZYB 3KCHA 3STDA 1AVKA 5GSPA 1FGRA 1W2ZA 3CCS3 3CCL3 1IU7A 5STDA 1BNSA 1L5GB 2C11A 1IV7A 2GEXA 5M19A 2GU1A 3EQQB 1MWTA 3PZWA 3SOAA 2CKFB 1RHLA 2RBIA 1IK3A 3N9HA 1QAFA 4KFDA 4XBYA 3CD63 3GZXB 2OCTA 3G16A 3ZG5A 2CWTA 2Y74A 1WMOA 1RGCA 3MG2A 5IERA 3WA3A 3AMOA 3B4OA 3EJVA 3D9RA 3D79A 3CCJ3 3VF1A 1S723 3E99A 1ROVA 2P09A 1X1XA 1AV4A 1LOVA 4K1UA 1BRKA 1M1XB 1QVF2 4J8TA 1MWSA 2M7OA 1BSBA 4I4KA 1FGTA 5FGOA 3ECFA 2E2UA 4HM2B 3SYUA 1VQ93 1JBSA 2IY2A 1TIJA 1JKGA 1BRHA 2F56A 4IPBA 3UL5A 5AEUB 2FGTA 1RGLA 3BB9A 3KSPA 3F9SA 1W01A 2KCDA 4FCZA 1Y4KA 4HM5B 4ILFA 4WYKA 1A67A 1FGQA 1RGHA 2H0HA 1IVVA 5D82A 3KSED 3F40A 2CHCA 3A76A 4K61A 2GSPA 4HYZA 1IQ8A 4GL6A 1AQZA 3CU3A 4N6MA 1LRAA 5IEOA 5AYSC 1GOYA 1A2PA 2CIUA 3EX9A 1OH0A 1BNGA 1GY6A 4JRFA 3GAXA 1FUSA 1JB2A 1T2IA 4AKYA 1CEWI 1NNVA 3CC43 3F14A 1OHSA 1EKMA 4ZM8A 3I563 1JB5A 4N6NB 3CNXA 5IG5A 3EBTA 4R1KA 3UL6A 3LZAA 2OTL3 2D42A 4G1MB 1O7NB 3DZLA 2WO0A 4FMCA 4RBNA 3SOYA 5IEPA 3SEDA 1GD3A 3BIRA 1YJN3 2CG1A 1YGEA 5AIFA 1E97A 4FMAA 1S5AA 1K41A 1W6GA 4EW5A 2W9QA 2B1XB 2BHMA 1KD14 3D5GA 1JJ22 2W56A 2XRXB 4X2HA 4FR9A 4L7KA 5AIGA 1YIJ3 1OHPA 3F7XA 2BMQB 4HAAA 4NHFA 3HIGA 2QA43 4KFEA 1B2MA 3BNBA 2GXFA 1J2BA 1BU4A 3EE1A 7STDA 1I3IA 2H0IA 1W5ZA 1I70A 1W6YA 4FMBA 1BSDA 3AHSA 1BUQA 3FG1A 3NQYA 3AMOB 1G02A 4LYLB 1EG9B 3NM7A 1UUWB 3FSDA 5G1LA 1NJI4 3FH1A 5CXOA 1CYUA 1PYLA 3HOHA 3CCQ3 1IVXA 2O9UX 3LYGA 1OGZA 3X41A 2C4BA 4FMDA 1WMNA 3WR2A 1KWIA 1RGGA 1JN5A 1MGRA 2HMNB 5I97A 1FYSA 1B2SA 1HYFA 3HK4A 2GEYA 2KF6A 3BU4A 3ZG0A 4LGQA 1I2FA 1Q40A 3TDGA 3OXAA 3B4PA 3OV4A 5DRVA 1NWWA 3LTCA 4HKVB 2BMRB 2IYJA 2INXA 4WWUC 3S67A 3IPTA 3OWSA 4RNYA 3D3LA 3GZBA 4XDVA 1F8NA 3Q1CA 3BNEA 1Q824 5RNTA 1B3SA 4BU4A 2L1SA 2YX9A 2UX0A 5D81A 5AYRB 1QAKA 2SARA 5AIIA 1K9M4 1YGWA 1YVBI 2XF3A 1BNFA 5KP4A 4BTYA 1YIT3 1BSAA 5EQLA 1W6CA 7RNTA 5IG0A 3K0ZA 2STDA 4EV5A 4LZIA 3KIIA 5AI1A 1IQXA 1GD4A 3ALAA 1O7MB 3M8CA 4TX4A 3DH2A 3F8HA 2R4IA 3FZWA 3Q2PA 3SX1A 3LTDA 4EYCA 1RGKA 4L8OA 2WGQA 1BNRA 1GOVA 1OACA 2O3OA 4XB5A 3JVCA 2ML6A 6RNTA 1UI8A 1HZ1A 2HMOB 3S5CA 1O7PB 2W56B 3QRDA 1UGIA 3OW22 2HMKB 3N54B 1G0TA 3MSOA 4HM6B 1DMMA 1QVG2 5D83A 3F8XA 1GMRA 2BNGA 1CYVA 3OWYA 3VSYA 1VQL3 2BU4A 2MF7A 3KE7A 1TJDA 4I5QA 3S27A 2XFTA 1DYUA 1FZUA 5CF2A 3EC9A 2W9PA 3A5EA 5G2GA 3LH4A 3SVAA 4WHAA 2MC8A 3ROBA 3S28A 1RN1A 1BRJA 1VQ73 2QEX3 1BGSA 1OHOA 3CPOA 1FW7A 3H3HA 5BIRA 4BL3A 3RGAA 1BNIA 2BO9B 2R41A 1M904 2JQ5A 1VQ83 1VZZA 3N8BA 3EF8A 1W02A 1GY7A 1OF5B 1ISKA 4N6OB 4CPKA 1ROAA 1VQ63 1T5YA 1QALA 1JN5B 4U13A 3X42A 3FLJA 2RGQA 1SPUA 4PEJA 1MNLA 4CCVA 5LC6A 1VQQA 2XGNA 1N5HA 3LOYA 3PS8A 3ZFZA 3G713 7GSPA 1DETA 1Q40B 4H3UA 2ZL8A 1LXEA 1VQM3 1QJGA 4ORLA 1I0VA 4HM3B 4KVHA 3DXOA 3X3YA 9RNTA 3VGNA 4RNZA 3B7CA 4Q53A 4MMZB 3DGLA 3DMCA 2XSOB 3WOEB 4LMIA 3GRDA 1T2HA 3LT9A 3HX8A 1BOXA 3IJEB 1JBTA 4K1VA 3FG4A 2WOFA 3CXC2 1U5OA 1BANA 4R80A 1NB3I 2ML5A 3PGBA 2RCDA 2F5WA 4HM1B 4NREA 3CCM3 4O3VA 1I8VA 5HOHA 1KC84 2QGUA 3KKGA 1IQYA 4STDA 1W2B2 2UGIA 4EV2A 2PZVA 3NUVA 3DGNA 2CFDA 1NDOB 2JDIH 3K7CA 1OGXA 1Q42A 2KRTA 4HOHA 1LVNA 1W4NA 3BNDA 3LMLA 1RRHA 2K0MA 4X2OA 3H51A 1RCKA 1ULIB 1EEJA 2GU3A 1I2GA 1MWRA 3PYJA 4FCJA 1AY7A 4R9KA 3J7Yd 1GSPA 1UDII 1BRGA 3MYTA 3NBRA 4OK0A 2CK3H 1A2VA 1EQKA 2BT3A 4BTXA 5JPPA 1BVIA 5JBSA 2RFRA 1ZX2A 1UUGB 2F5MA 5EVHA 2P0MA 3EN8A 1Q7HA 1YVSA 1K28A 3WMDA 3DUKA 2CFWA 2QIYA 4GHOA 2CFGA 1LNIA 1VQO3 1B2XA 2CH9A 3LXUX 1JNQA 1WTHA 1RGEA 3NBBA 4N6V0 5DREA 3OWUA 1UCLA 3GWRA 3AHWA 2Z77A 1KQS2 1R4CA 4KT3B 1D6ZA 1JKGB 1BRSA 2LQVA 1RGFA 3FG3A 3HIIA 3LT8A 2CW9A 3D4AA 4O2HA 1VQK3 1YJ93 1VQN3 1SIIA 1BNJA 1UI7A 1X1YA 4WYKB 1FGOA 3UJMA 2ZHXB 5AIHA 3PCRA 1JV2B 2XH9A 3MHEA 4IT7A 2YFLB 1B21A 1FGMA 1X1UA 3RGRA 1YJW3 1BNEA 2CWUA 2E2VA 3SLUA 2W6JH 8RNTA 1MGWA 1FA3A 1LQGC 1GMQA 1GY5A 4O8SA 3EB8A 3V92A 2I9WA 5KP1A 2OQEA 1QMAA 2IMJA 2Q07A 4K90B 1E3VA 1TUHA 2FNQA 4XBTA 1GS3A 4HVNA 1RLSA 1BRNL 1ULJB 1BSCA 1SIHA 1W00A 4XBXA 3NM2A 3PCSA 3D5IA 1NO3A 1GOUA 2AADA 2LYXA 2SBLA 1UGHI 2CX0A 1M9GA 1TP6A 2KXGA 5JPUA 1DMNA 1HU9A 1RN4A 4RZMA 3GZRA 5ELJA 5ELUA 5M1AA 3CMA3 1I2EA 5KP3A 2H0GA 3CPW2 2F98A 4AKZA 5BU4A 1B2ZA 8CHOA 5IG4A 2F4YA 1A2KA 2Y73A 4MEIA 4EBGA 1K8A4 4FCMA 1X1WA 1MWUA 2K3DA 3V98A 1LOXA 2YFJB 1TU5A 1UCIA 4J5KA 1CH0A 1RNBA 3KFQC 1JBRA 3JUNA 1C54A 1TFKA 3EHCA 3UNLA 3S29A 3JUPA 5CK6A 1WMPA 3CCE3 1M1K4 4NPBA 5LC7A 1PU4A 1V58A 1SARA 4HJLB 3DM8A 2Z7AA 1JZDA 5AEWB 3O8YA 3WOFB 3MWZA 4RNTA 3JUOA 1TFOA 1IVWA 5IENA 2V1LA 2BIRA 3KZTA 1Z1SA 5BVBA 3BLZA 3HZPA 1FUTA 4HM0B 4QWTA 4HBRA 1B2UA 4LEHA 3U1WA 1GYBA 2HMJB 3AGNA 1IV9A 4H61A 6STDA 1BUJA 2GBXB 2WOHA 4J9AA 5A0OB 1HKXA 2XFSA 1AR0A 2KF5A 4MMYB 2PNCA 1VQ43 2KF4A 2OWPA 1AVLA 4O02B 1O7WB 5CF1A 2IA7A 4GB5A 4R4KA 3JUMA 1LOWA 2XSHB 1FUWA 3WODG 4N6UA 2ZDJA 1LOYA 3CNMA 4HM7B 3EBYA 3CCR3 1JB4A 3NV0A 3AGOA 2HMLB 1R4YA 4IIAA 3I553 4EXRA 2Z6BA 2CC3A 3G8ZA 3FF2A 3Q3FA 3G6E3 3URPA 3CME3 3NXJA 1VQ53 1D6YA 1STFI 3X3XA 1JZOA 4OVMA 1MOLA 3UB1A 1OPYA 3G4S3 3CC23 4BL2A 1IT8A 2W04A 5HGRA 4JF8A 1WQLB 4N3VA 1IT7A 2L4VA 2A15A 2CFLA 2P0XA 2XGLA 3RNTA 5TGNA 4CDLA 3T8UA 1KSIA 1IDPA 6GSPA 2XEPA 1E3RA 1RDSA 1U8CB 1V74A 3K5TA 3CCU3 2W03A 1DMQA 2W2CA 3DGYA 4LSOA 3KN4A 4GSPA 1Q7Y4 1NU3A 1I0XA 2J8XB 5CLKA 4XDWA 3K9MC 1OCVA 3NX0A 3X40A 2HMMB
chains in the Genus database with same CATH topology
1BRIA 6RNTA 1BRHA 2F56A 1HZ1A 1RGLA 1TRPA 1B21A 1X1UA 1BNEA 8RNTA 1RGHA 1MGWA 1TTOA 1GMQA 2RNTA 1GMRA 2GSPA 1DE3A 1AQZA 2BU4A 1LRAA 1RMSA 1GOYA 1A2PA 1RLSA 1BRNL 1BNGA 1BSCA 1FZUA 1FUSA 1Q9EA 2ZA4A 1T2IA 1GOUA 3A5EA 2AADA 3D5IA 1RN1A 1BRJA 1RN4A 1BGSA 1I2EA 1FW7A 5BIRA 1RCLA 2AAEA 1BNIA 5BU4A 1B2ZA 1TRQA 1RTUA 2F4YA 3BIRA 1X1WA 3WHOA 2KAAA 1ZGXA 1UCJA 1UCIA 4J5KA 1CH0A 1RNBA 1JBRA 1C54A 1IYYA 7GSPA 1DETA 1B27A 3D5GA 1I0VA 2KF3A 1I3FA 1SARA 1B2MA 4HAAA 3GSPA 9RNTA 1BU4A 1I3IA 1BIRA 4RNTA 1I70A 1BSDA 2BIRA 1T2HA 1GMPA 3AHSA 1JBTA 1BOXA 1FUTA 1RNTA 1B2UA 1BSEA 1G02A 3AGNA 1PY3A 1BUJA 1RGAA 1BANA 1B20A 2F5WA 2KF5A 1I8VA 5HOHA 1PYLA 3HOHA 2KF4A 4BIRA 1RSNA 1LOWA 4J5GA 2HOHA 2C4BA 3WR2A 1RGGA 1LOYA 1MGRA 4HOHA 1FYSA 1UCKA 3AGOA 1R4YA 1B2SA 1HYFA 2KF6A 1BAOA 3BU4A 1YNVX 1I2FA 1RCKA 3Q3FA 3URPA 1I2GA 1AY7A 3KCHA 5GSPA 1GSPA 1BNSA 1BRGA 5RNTA 1B3SA 1RHLA 1BVIA 2RBIA 4BU4A 3RNTA 2F5MA 2SARA 6GSPA 1YGWA 1YVSA 4GHOA 1BNFA 1RDSA 1RGCA 1LNIA 1BSAA 7RNTA 1B2XA 1RGEA 1X1XA 1UCLA 1LOVA 3AHWA 1BRKA 3DH2A 3DGYA 1BRSA 1RGFA 4GSPA 1I0XA 3D4AA 1RGKA 1BSBA 1BNRA 1BNJA 1X1YA 1GOVA 3SYUA 1JBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BRI A;  6RNT A;  1BRH A;  2F56 A;  1HZ1 A;  1RGL A;  1TRP A;  1B21 A;  1X1U A;  1BNE A;  8RNT A;  1RGH A;  1MGW A;  1TTO A;  1GMQ A;  2RNT A;  1GMR A;  2GSP A;  1DE3 A;  1AQZ A;  2BU4 A;  1LRA A;  1RMS A;  1GOY A;  1A2P A;  1RLS A;  1BRN L;  1BNG A;  1BSC A;  1FZU A;  1FUS A;  1Q9E A;  2ZA4 A;  1T2I A;  1GOU A;  3A5E A;  2AAD A;  3D5I A;  1RN1 A;  1BRJ A;  1RN4 A;  1BGS A;  1I2E A;  1FW7 A;  5BIR A;  1RCL A;  2AAE A;  1BNI A;  5BU4 A;  1B2Z A;  1TRQ A;  1RTU A;  2F4Y A;  3BIR A;  1X1W A;  3WHO A;  2KAA A;  1ZGX A;  1UCJ A;  1UCI A;  4J5K A;  1CH0 A;  1RNB A;  1JBR A;  1C54 A;  1IYY A;  7GSP A;  1DET A;  1B27 A;  3D5G A;  1I0V A;  2KF3 A;  1I3F A;  1SAR A;  1B2M A;  4HAA A;  3GSP A;  9RNT A;  1BU4 A;  1I3I A;  1BIR A;  4RNT A;  1I70 A;  1BSD A;  2BIR A;  1T2H A;  1GMP A;  3AHS A;  1JBT A;  1BOX A;  1FUT A;  1RNT A;  1B2U A;  1BSE A;  1G02 A;  3AGN A;  1PY3 A;  1BUJ A;  1RGA A;  1BAN A;  1B20 A;  2F5W A;  2KF5 A;  1I8V A;  5HOH A;  1PYL A;  3HOH A;  2KF4 A;  4BIR A;  1RSN A;  1LOW A;  4J5G A;  2HOH A;  2C4B A;  3WR2 A;  1RGG A;  1LOY A;  1MGR A;  4HOH A;  1FYS A;  1UCK A;  3AGO A;  1R4Y A;  1B2S A;  1HYF A;  2KF6 A;  1BAO A;  3BU4 A;  1YNV X;  1I2F A;  1RCK A;  3Q3F A;  3URP A;  1I2G A;  1AY7 A;  3KCH A;  5GSP A;  1GSP A;  1BNS A;  1BRG A;  5RNT A;  1B3S A;  1RHL A;  1BVI A;  2RBI A;  4BU4 A;  3RNT A;  2F5M A;  2SAR A;  6GSP A;  1YGW A;  1YVS A;  4GHO A;  1BNF A;  1RDS A;  1RGC A;  1LNI A;  1BSA A;  7RNT A;  1B2X A;  1RGE A;  1X1X A;  1UCL A;  1LOV A;  3AHW A;  1BRK A;  3DH2 A;  3DGY A;  1BRS A;  1RGF A;  4GSP A;  1I0X A;  3D4A A;  1RGK A;  1BSB A;  1BNR A;  1BNJ A;  1X1Y A;  1GOV A;  3SYU A;  1JBS A; 
#chains in the Genus database with same CATH topology
 4XM4 A;  1BRI A;  1V57 A;  1W7C A;  1Q81 4;  2OOV C;  2CG0 A;  3JUQ A;  1C7H A;  1T3B A;  1TRP A;  3MG1 A;  2P38 A;  1EA2 A;  1LQM B;  2IUK A;  3SXX A;  3PXM A;  3WDG B;  4N6T A;  1NB5 I;  1TTO A;  1Q86 4;  2RNT A;  1CQS A;  3MKI A;  2B24 B;  2W0Q A;  1DE3 A;  3DY5 A;  3OX9 A;  2OTJ 3;  1RMS A;  3G0K A;  2OOV A;  2UUG C;  1SJW A;  1Q9E A;  2ZA4 A;  1JRQ A;  1SQW A;  3FF0 A;  5FW5 A;  4OUQ A;  5BXQ A;  3MG3 A;  3FGY A;  4HM4 B;  3T8N A;  2F99 A;  1RCL A;  2AAE A;  2GBW B;  5IW9 A;  2BMO B;  1TRQ A;  1ZO2 A;  2OQE C;  4WFO A;  5EEO A;  1US1 A;  1N9E A;  5IF6 A;  4L8P A;  1RTU A;  3T0U A;  1RN7 A;  4EC6 A;  1O7G B;  1DVC A;  1PFP A;  3ER7 A;  1RRL A;  3WHO A;  1K73 4;  4R9L A;  1RJO A;  3L0R A;  2KAA A;  1ZGX A;  4DKI A;  1UCJ A;  2E2T A;  3NV0 B;  1RKY A;  1OF5 A;  1UW1 A;  2RSX A;  1IYY A;  2YFI B;  1IVU A;  1B27 A;  2C10 A;  1OUN A;  3NBJ A;  3X3Z A;  2Z76 A;  2KF3 A;  1I3F A;  2CX1 A;  1EUI C;  3GSP A;  3K63 A;  1VQP 3;  1N8Q A;  1WNH A;  2FXT A;  1BIR A;  1LNH A;  3B8L A;  5M18 A;  2CFK A;  2K54 A;  3Q90 A;  4AEQ A;  1GMP A;  3QK9 A;  4KZ1 A;  1RNT A;  2XR8 B;  1N5P A;  1BSE A;  3F7S A;  4MJD A;  3LTB A;  3LTA A;  1PY3 A;  2CWV A;  4CJN A;  4HM8 B;  1RGA A;  4HZ9 B;  3DGM A;  1B20 A;  3MPH A;  3U97 A;  1A90 A;  4MMX B;  3RDE A;  1YHQ 3;  1N9J A;  3HI7 A;  4HZB B;  1O7H B;  4BTW A;  3CC7 3;  4BIR A;  2D1W A;  1G96 A;  3DGO A;  3FKA A;  3NQZ A;  1RSN A;  3IMA B;  4J5G A;  2HOH A;  3EN1 B;  2IUJ A;  3V99 A;  1N8R 4;  1ZS7 A;  5IG3 A;  2WGO A;  1YI2 3;  4WP5 A;  3CCV 3;  3I0Y A;  3NHX A;  1DVD A;  3FCS B;  1UCK A;  3WA2 X;  1STD A;  1UUV B;  2P05 A;  1BAO A;  4KFF A;  4N6L A;  1YNV X;  3BNC A;  2F86 B;  5G1K A;  1ASK A;  1D6U A;  3GZY B;  3KCH A;  3STD A;  1AVK A;  5GSP A;  1FGR A;  1W2Z A;  3CCS 3;  3CCL 3;  1IU7 A;  5STD A;  1BNS A;  1L5G B;  2C11 A;  1IV7 A;  2GEX A;  5M19 A;  2GU1 A;  3EQQ B;  1MWT A;  3PZW A;  3SOA A;  2CKF B;  1RHL A;  2RBI A;  1IK3 A;  3N9H A;  1QAF A;  4KFD A;  4XBY A;  3CD6 3;  3GZX B;  2OCT A;  3G16 A;  3ZG5 A;  2CWT A;  2Y74 A;  1WMO A;  1RGC A;  3MG2 A;  5IER A;  3WA3 A;  3AMO A;  3B4O A;  3EJV A;  3D9R A;  3D79 A;  3CCJ 3;  3VF1 A;  1S72 3;  3E99 A;  1ROV A;  2P09 A;  1X1X A;  1AV4 A;  1LOV A;  4K1U A;  1BRK A;  1M1X B;  1QVF 2;  4J8T A;  1MWS A;  2M7O A;  1BSB A;  4I4K A;  1FGT A;  5FGO A;  3ECF A;  2E2U A;  4HM2 B;  3SYU A;  1VQ9 3;  1JBS A;  2IY2 A;  1TIJ A;  1JKG A;  1BRH A;  2F56 A;  4IPB A;  3UL5 A;  5AEU B;  2FGT A;  1RGL A;  3BB9 A;  3KSP A;  3F9S A;  1W01 A;  2KCD A;  4FCZ A;  1Y4K A;  4HM5 B;  4ILF A;  4WYK A;  1A67 A;  1FGQ A;  1RGH A;  2H0H A;  1IVV A;  5D82 A;  3KSE D;  3F40 A;  2CHC A;  3A76 A;  4K61 A;  2GSP A;  4HYZ A;  1IQ8 A;  4GL6 A;  1AQZ A;  3CU3 A;  4N6M A;  1LRA A;  5IEO A;  5AYS C;  1GOY A;  1A2P A;  2CIU A;  3EX9 A;  1OH0 A;  1BNG A;  1GY6 A;  4JRF A;  3GAX A;  1FUS A;  1JB2 A;  1T2I A;  4AKY A;  1CEW I;  1NNV A;  3CC4 3;  3F14 A;  1OHS A;  1EKM A;  4ZM8 A;  3I56 3;  1JB5 A;  4N6N B;  3CNX A;  5IG5 A;  3EBT A;  4R1K A;  3UL6 A;  3LZA A;  2OTL 3;  2D42 A;  4G1M B;  1O7N B;  3DZL A;  2WO0 A;  4FMC A;  4RBN A;  3SOY A;  5IEP A;  3SED A;  1GD3 A;  3BIR A;  1YJN 3;  2CG1 A;  1YGE A;  5AIF A;  1E97 A;  4FMA A;  1S5A A;  1K41 A;  1W6G A;  4EW5 A;  2W9Q A;  2B1X B;  2BHM A;  1KD1 4;  3D5G A;  1JJ2 2;  2W56 A;  2XRX B;  4X2H A;  4FR9 A;  4L7K A;  5AIG A;  1YIJ 3;  1OHP A;  3F7X A;  2BMQ B;  4HAA A;  4NHF A;  3HIG A;  2QA4 3;  4KFE A;  1B2M A;  3BNB A;  2GXF A;  1J2B A;  1BU4 A;  3EE1 A;  7STD A;  1I3I A;  2H0I A;  1W5Z A;  1I70 A;  1W6Y A;  4FMB A;  1BSD A;  3AHS A;  1BUQ A;  3FG1 A;  3NQY A;  3AMO B;  1G02 A;  4LYL B;  1EG9 B;  3NM7 A;  1UUW B;  3FSD A;  5G1L A;  1NJI 4;  3FH1 A;  5CXO A;  1CYU A;  1PYL A;  3HOH A;  3CCQ 3;  1IVX A;  2O9U X;  3LYG A;  1OGZ A;  3X41 A;  2C4B A;  4FMD A;  1WMN A;  3WR2 A;  1KWI A;  1RGG A;  1JN5 A;  1MGR A;  2HMN B;  5I97 A;  1FYS A;  1B2S A;  1HYF A;  3HK4 A;  2GEY A;  2KF6 A;  3BU4 A;  3ZG0 A;  4LGQ A;  1I2F A;  1Q40 A;  3TDG A;  3OXA A;  3B4P A;  3OV4 A;  5DRV A;  1NWW A;  3LTC A;  4HKV B;  2BMR B;  2IYJ A;  2INX A;  4WWU C;  3S67 A;  3IPT A;  3OWS A;  4RNY A;  3D3L A;  3GZB A;  4XDV A;  1F8N A;  3Q1C A;  3BNE A;  1Q82 4;  5RNT A;  1B3S A;  4BU4 A;  2L1S A;  2YX9 A;  2UX0 A;  5D81 A;  5AYR B;  1QAK A;  2SAR A;  5AII A;  1K9M 4;  1YGW A;  1YVB I;  2XF3 A;  1BNF A;  5KP4 A;  4BTY A;  1YIT 3;  1BSA A;  5EQL A;  1W6C A;  7RNT A;  5IG0 A;  3K0Z A;  2STD A;  4EV5 A;  4LZI A;  3KII A;  5AI1 A;  1IQX A;  1GD4 A;  3ALA A;  1O7M B;  3M8C A;  4TX4 A;  3DH2 A;  3F8H A;  2R4I A;  3FZW A;  3Q2P A;  3SX1 A;  3LTD A;  4EYC A;  1RGK A;  4L8O A;  2WGQ A;  1BNR A;  1GOV A;  1OAC A;  2O3O A;  4XB5 A;  3JVC A;  2ML6 A;  6RNT A;  1UI8 A;  1HZ1 A;  2HMO B;  3S5C A;  1O7P B;  2W56 B;  3QRD A;  1UGI A;  3OW2 2;  2HMK B;  3N54 B;  1G0T A;  3MSO A;  4HM6 B;  1DMM A;  1QVG 2;  5D83 A;  3F8X A;  1GMR A;  2BNG A;  1CYV A;  3OWY A;  3VSY A;  1VQL 3;  2BU4 A;  2MF7 A;  3KE7 A;  1TJD A;  4I5Q A;  3S27 A;  2XFT A;  1DYU A;  1FZU A;  5CF2 A;  3EC9 A;  2W9P A;  3A5E A;  5G2G A;  3LH4 A;  3SVA A;  4WHA A;  2MC8 A;  3ROB A;  3S28 A;  1RN1 A;  1BRJ A;  1VQ7 3;  2QEX 3;  1BGS A;  1OHO A;  3CPO A;  1FW7 A;  3H3H A;  5BIR A;  4BL3 A;  3RGA A;  1BNI A;  2BO9 B;  2R41 A;  1M90 4;  2JQ5 A;  1VQ8 3;  1VZZ A;  3N8B A;  3EF8 A;  1W02 A;  1GY7 A;  1OF5 B;  1ISK A;  4N6O B;  4CPK A;  1ROA A;  1VQ6 3;  1T5Y A;  1QAL A;  1JN5 B;  4U13 A;  3X42 A;  3FLJ A;  2RGQ A;  1SPU A;  4PEJ A;  1MNL A;  4CCV A;  5LC6 A;  1VQQ A;  2XGN A;  1N5H A;  3LOY A;  3PS8 A;  3ZFZ A;  3G71 3;  7GSP A;  1DET A;  1Q40 B;  4H3U A;  2ZL8 A;  1LXE A;  1VQM 3;  1QJG A;  4ORL A;  1I0V A;  4HM3 B;  4KVH A;  3DXO A;  3X3Y A;  9RNT A;  3VGN A;  4RNZ A;  3B7C A;  4Q53 A;  4MMZ B;  3DGL A;  3DMC A;  2XSO B;  3WOE B;  4LMI A;  3GRD A;  1T2H A;  3LT9 A;  3HX8 A;  1BOX A;  3IJE B;  1JBT A;  4K1V A;  3FG4 A;  2WOF A;  3CXC 2;  1U5O A;  1BAN A;  4R80 A;  1NB3 I;  2ML5 A;  3PGB A;  2RCD A;  2F5W A;  4HM1 B;  4NRE A;  3CCM 3;  4O3V A;  1I8V A;  5HOH A;  1KC8 4;  2QGU A;  3KKG A;  1IQY A;  4STD A;  1W2B 2;  2UGI A;  4EV2 A;  2PZV A;  3NUV A;  3DGN A;  2CFD A;  1NDO B;  2JDI H;  3K7C A;  1OGX A;  1Q42 A;  2KRT A;  4HOH A;  1LVN A;  1W4N A;  3BND A;  3LML A;  1RRH A;  2K0M A;  4X2O A;  3H51 A;  1RCK A;  1ULI B;  1EEJ A;  2GU3 A;  1I2G A;  1MWR A;  3PYJ A;  4FCJ A;  1AY7 A;  4R9K A;  3J7Y d;  1GSP A;  1UDI I;  1BRG A;  3MYT A;  3NBR A;  4OK0 A;  2CK3 H;  1A2V A;  1EQK A;  2BT3 A;  4BTX A;  5JPP A;  1BVI A;  5JBS A;  2RFR A;  1ZX2 A;  1UUG B;  2F5M A;  5EVH A;  2P0M A;  3EN8 A;  1Q7H A;  1YVS A;  1K28 A;  3WMD A;  3DUK A;  2CFW A;  2QIY A;  4GHO A;  2CFG A;  1LNI A;  1VQO 3;  1B2X A;  2CH9 A;  3LXU X;  1JNQ A;  1WTH A;  1RGE A;  3NBB A;  4N6V 0;  5DRE A;  3OWU A;  1UCL A;  3GWR A;  3AHW A;  2Z77 A;  1KQS 2;  1R4C A;  4KT3 B;  1D6Z A;  1JKG B;  1BRS A;  2LQV A;  1RGF A;  3FG3 A;  3HII A;  3LT8 A;  2CW9 A;  3D4A A;  4O2H A;  1VQK 3;  1YJ9 3;  1VQN 3;  1SII A;  1BNJ A;  1UI7 A;  1X1Y A;  4WYK B;  1FGO A;  3UJM A;  2ZHX B;  5AIH A;  3PCR A;  1JV2 B;  2XH9 A;  3MHE A;  4IT7 A;  2YFL B;  1B21 A;  1FGM A;  1X1U A;  3RGR A;  1YJW 3;  1BNE A;  2CWU A;  2E2V A;  3SLU A;  2W6J H;  8RNT A;  1MGW A;  1FA3 A;  1LQG C;  1GMQ A;  1GY5 A;  4O8S A;  3EB8 A;  3V92 A;  2I9W A;  5KP1 A;  2OQE A;  1QMA A;  2IMJ A;  2Q07 A;  4K90 B;  1E3V A;  1TUH A;  2FNQ A;  4XBT A;  1GS3 A;  4HVN A;  1RLS A;  1BRN L;  1ULJ B;  1BSC A;  1SIH A;  1W00 A;  4XBX A;  3NM2 A;  3PCS A;  3D5I A;  1NO3 A;  1GOU A;  2AAD A;  2LYX A;  2SBL A;  1UGH I;  2CX0 A;  1M9G A;  1TP6 A;  2KXG A;  5JPU A;  1DMN A;  1HU9 A;  1RN4 A;  4RZM A;  3GZR A;  5ELJ A;  5ELU A;  5M1A A;  3CMA 3;  1I2E A;  5KP3 A;  2H0G A;  3CPW 2;  2F98 A;  4AKZ A;  5BU4 A;  1B2Z A;  8CHO A;  5IG4 A;  2F4Y A;  1A2K A;  2Y73 A;  4MEI A;  4EBG A;  1K8A 4;  4FCM A;  1X1W A;  1MWU A;  2K3D A;  3V98 A;  1LOX A;  2YFJ B;  1TU5 A;  1UCI A;  4J5K A;  1CH0 A;  1RNB A;  3KFQ C;  1JBR A;  3JUN A;  1C54 A;  1TFK A;  3EHC A;  3UNL A;  3S29 A;  3JUP A;  5CK6 A;  1WMP A;  3CCE 3;  1M1K 4;  4NPB A;  5LC7 A;  1PU4 A;  1V58 A;  1SAR A;  4HJL B;  3DM8 A;  2Z7A A;  1JZD A;  5AEW B;  3O8Y A;  3WOF B;  3MWZ A;  4RNT A;  3JUO A;  1TFO A;  1IVW A;  5IEN A;  2V1L A;  2BIR A;  3KZT A;  1Z1S A;  5BVB A;  3BLZ A;  3HZP A;  1FUT A;  4HM0 B;  4QWT A;  4HBR A;  1B2U A;  4LEH A;  3U1W A;  1GYB A;  2HMJ B;  3AGN A;  1IV9 A;  4H61 A;  6STD A;  1BUJ A;  2GBX B;  2WOH A;  4J9A A;  5A0O B;  1HKX A;  2XFS A;  1AR0 A;  2KF5 A;  4MMY B;  2PNC A;  1VQ4 3;  2KF4 A;  2OWP A;  1AVL A;  4O02 B;  1O7W B;  5CF1 A;  2IA7 A;  4GB5 A;  4R4K A;  3JUM A;  1LOW A;  2XSH B;  1FUW A;  3WOD G;  4N6U A;  2ZDJ A;  1LOY A;  3CNM A;  4HM7 B;  3EBY A;  3CCR 3;  1JB4 A;  3NV0 A;  3AGO A;  2HML B;  1R4Y A;  4IIA A;  3I55 3;  4EXR A;  2Z6B A;  2CC3 A;  3G8Z A;  3FF2 A;  3Q3F A;  3G6E 3;  3URP A;  3CME 3;  3NXJ A;  1VQ5 3;  1D6Y A;  1STF I;  3X3X A;  1JZO A;  4OVM A;  1MOL A;  3UB1 A;  1OPY A;  3G4S 3;  3CC2 3;  4BL2 A;  1IT8 A;  2W04 A;  5HGR A;  4JF8 A;  1WQL B;  4N3V A;  1IT7 A;  2L4V A;  2A15 A;  2CFL A;  2P0X A;  2XGL A;  3RNT A;  5TGN A;  4CDL A;  3T8U A;  1KSI A;  1IDP A;  6GSP A;  2XEP A;  1E3R A;  1RDS A;  1U8C B;  1V74 A;  3K5T A;  3CCU 3;  2W03 A;  1DMQ A;  2W2C A;  3DGY A;  4LSO A;  3KN4 A;  4GSP A;  1Q7Y 4;  1NU3 A;  1I0X A;  2J8X B;  5CLK A;  4XDW A;  3K9M C;  1OCV A;  3NX0 A;  3X40 A;  2HMM B; 
#chains in the Genus database with same CATH homology
 1BRI A;  6RNT A;  1BRH A;  2F56 A;  1HZ1 A;  1RGL A;  1TRP A;  1B21 A;  1X1U A;  1BNE A;  8RNT A;  1RGH A;  1MGW A;  1TTO A;  1GMQ A;  2RNT A;  1GMR A;  2GSP A;  1DE3 A;  1AQZ A;  2BU4 A;  1LRA A;  1RMS A;  1GOY A;  1A2P A;  1RLS A;  1BRN L;  1BNG A;  1BSC A;  1FZU A;  1FUS A;  1Q9E A;  2ZA4 A;  1T2I A;  1GOU A;  3A5E A;  2AAD A;  3D5I A;  1RN1 A;  1BRJ A;  1RN4 A;  1BGS A;  1I2E A;  1FW7 A;  5BIR A;  1RCL A;  2AAE A;  1BNI A;  5BU4 A;  1B2Z A;  1TRQ A;  1RTU A;  2F4Y A;  3BIR A;  1X1W A;  3WHO A;  2KAA A;  1ZGX A;  1UCJ A;  1UCI A;  4J5K A;  1CH0 A;  1RNB A;  1JBR A;  1C54 A;  1IYY A;  7GSP A;  1DET A;  1B27 A;  3D5G A;  1I0V A;  2KF3 A;  1I3F A;  1SAR A;  1B2M A;  4HAA A;  3GSP A;  9RNT A;  1BU4 A;  1I3I A;  1BIR A;  4RNT A;  1I70 A;  1BSD A;  2BIR A;  1T2H A;  1GMP A;  3AHS A;  1JBT A;  1BOX A;  1FUT A;  1RNT A;  1B2U A;  1BSE A;  1G02 A;  3AGN A;  1PY3 A;  1BUJ A;  1RGA A;  1BAN A;  1B20 A;  2F5W A;  2KF5 A;  1I8V A;  5HOH A;  1PYL A;  3HOH A;  2KF4 A;  4BIR A;  1RSN A;  1LOW A;  4J5G A;  2HOH A;  2C4B A;  3WR2 A;  1RGG A;  1LOY A;  1MGR A;  4HOH A;  1FYS A;  1UCK A;  3AGO A;  1R4Y A;  1B2S A;  1HYF A;  2KF6 A;  1BAO A;  3BU4 A;  1YNV X;  1I2F A;  1RCK A;  3Q3F A;  3URP A;  1I2G A;  1AY7 A;  3KCH A;  5GSP A;  1GSP A;  1BNS A;  1BRG A;  5RNT A;  1B3S A;  1RHL A;  1BVI A;  2RBI A;  4BU4 A;  3RNT A;  2F5M A;  2SAR A;  6GSP A;  1YGW A;  1YVS A;  4GHO A;  1BNF A;  1RDS A;  1RGC A;  1LNI A;  1BSA A;  7RNT A;  1B2X A;  1RGE A;  1X1X A;  1UCL A;  1LOV A;  3AHW A;  1BRK A;  3DH2 A;  3DGY A;  1BRS A;  1RGF A;  4GSP A;  1I0X A;  3D4A A;  1RGK A;  1BSB A;  1BNR A;  1BNJ A;  1X1Y A;  1GOV A;  3SYU A;  1JBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...