1GMQA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
b'DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 27
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmqA00
1BNEA 1AY7A 1BRIA 1B21A 1UCJA 1FYSA 2SARA 1GMPA 1LOWA 1RNTA 3DGYA 1BANA 3A5EA 1B2XA 1BAOA 1RMSA 1T2HA 1BRKA 2C4BA 6GSPA 1G02A 1GMQA 1B3SA 1BSEA 2KF3A 1AQZA 1I0XA 1R4YA 2KF6A 5BU4A 1RN1A 1MGWA 1B2ZA 3BU4A 1BNSA 1B2UA 1PYLA 1RHLA 3D4AA 1BU4A 1RNBA 1TRPA 1ZGXA 1DETA 3HOHA 1RGGA 1IYYA 1I3FA 1BNRA 5GSPA 1RSNA 1I3IA 1X1WA 3RNTA 3SYUA 4J5GA 4HAAA 2HOHA 7GSPA 1C54A 2BIRA 4BU4A 1BNFA 1UCKA 1BRGA 1BNIA 4HOHA 1RCLA 1BNGA 3AGOA 6RNTA 1I8VA 1GMRA 1FUSA 3KCHA 1BSBA 1BGSA 1LNIA 1UCLA 1RGEA 1DE3A 1A2PA 1RTUA 1Q9EA 1SARA 2KF5A 3D5GA 1RGCA 3AGNA 1LOVA 3WR2A 4RNTA 5HOHA 1BRJA 1BOXA 1BSAA 1GOVA 3URPA 1RN4A 1RGHA 1X1UA 1HYFA 1JBTA 1FW7A 1GOUA 1RCKA 5BIRA 1RGAA 1I2GA 1RGLA 1FZUA 1GOYA 1B27A 1HZ1A 1I70A 1GSPA 3BIRA 1BNJA 1T2IA 2KF4A 1YGWA 8RNTA 1TTOA 3GSPA 3AHWA 1BRNL 2BU4A 1LRAA 1TRQA 1BSDA 1BIRA 1LOYA 2F5MA 3Q3FA 1JBRA 1I2EA 2GSPA 1BUJA 2F5WA 3D5IA 1UCIA 4GSPA 1X1YA 1B2MA 1RDSA 2RNTA 2AAEA 1RLSA 4GHOA 9RNTA 4BIRA 1MGRA 2ZA4A 1RGKA 1YVSA 1PY3A 2KAAA 1I0VA 2F56A 1B20A 1BSCA 1YNVX 7RNTA 1RGFA 2F4YA 1BRSA 1BVIA 1FUTA 3WHOA 3DH2A 5RNTA 1JBSA 1CH0A 1X1XA 2AADA 1I2FA 1B2SA 3AHSA 2RBIA 4J5KA 1BRHA
chains in the Genus database with same CATH superfamily
1JB4A 1AY7A 3GAXA 2ZL8A 4IT7A 5IEOA 3MG2A 8CHOA 4CDLA 4AEQA 1OACA 4R80A 3CCS3 3DGYA 5JBSA 1YJN3 5IF6A 4J8TA 1J2BA 1STDA 1ROVA 4R9KA 1B2XA 3G16A 3FSDA 2GU3A 2XEPA 4MJDA 1BRKA 5BVBA 1A90A 3AMOB 5IENA 2CHCA 4KFEA 3SEDA 3KFQC 5IW9A 1S723 4L7KA 3EF8A 1JB2A 2KF6A 1OHSA 1MGWA 1VQL3 1Q7Y4 4CPKA 5STDA 1ULIB 1F8NA 1RHLA 3CC43 4XB5A 3OWSA 1HU9A 1ZGXA 2HMLB 1ISKA 4JRFA 2K3DA 5IG4A 4N6LA 3DMCA 1RSNA 4XDWA 5GSPA 2QIYA 2IYJA 3D79A 2O3OA 4KT3B 3RNTA 1M904 3NQZA 2HOHA 5TGNA 2OOVA 2HMOB 2FXTA 3K7CA 3LZAA 5AI1A 1QAFA 3CMA3 3VF1A 3NV0B 4O2HA 1VQ43 4ILFA 3CNMA 1BNGA 3AGOA 3KE7A 3N8BA 4CCVA 1I8VA 1MWUA 1YHQ3 3G713 1K8A4 3PS8A 1RGEA 2P38A 4EW5A 2OCTA 1RTUA 1JB5A 1Q9EA 4N6MA 2CX0A 2QGUA 2KRTA 3D5GA 3AGNA 3WOEB 4RNTA 1W5ZA 5G1LA 4N3VA 2K0MA 1FGMA 1OH0A 1QAKA 3FH1A 1X1UA 1A67A 2JDIH 3PCRA 1UDII 3BNBA 3FG1A 3FZWA 3NBRA 1GY7A 5BIRA 3T0UA 3ZG5A 1GS3A 1UGHI 2XR8B 1STFI 5LC6A 2CG1A 4AKYA 1VQP3 2W2CA 2D42A 1VQ93 1HZ1A 1SIHA 3FG3A 3ER7A 1QALA 1Q864 3MG1A 8RNTA 2KF4A 1YGWA 3CCM3 1OF5B 3BB9A 1L5GB 1UI8A 4BL2A 1BRNL 3HIIA 1LRAA 1V58A 5I97A 1YJ93 2HMKB 1BSDA 1BIRA 1LOYA 2F5MA 3FLJA 1KC84 1KQS2 2V1LA 4WYKB 5KP3A 3CCV3 1Q40B 1A2VA 3OWYA 1X1YA 3DY5A 4EXRA 1Y4KA 2W56B 3NUVA 2R41A 2SBLA 3T8NA 9RNTA 1EQKA 4X2HA 4RNZA 4HZ9B 2OWPA 1NWWA 1W2ZA 1EG9B 2XGNA 1KD14 1FGOA 1RGKA 1YVSA 1PY3A 2F99A 2W9QA 3F9SA 5IG5A 2CWTA 3CCQ3 4ZM8A 4K1VA 2L4VA 2E2TA 1IDPA 2WO0A 5RNTA 1RN7A 1M9GA 3DH2A 2LQVA 4EV5A 4KFFA 2CW9A 4WWUC 1O7NB 1MWSA 2AADA 2BHMA 4MMXB 1WQLB 1BRHA 1NO3A 4HM0B 4K1UA 3G8ZA 2Z7AA 1UCJA 1JN5A 4H61A 4HM5B 3CME3 1W01A 1IT7A 3V98A 3WOFB 2CH9A 1HKXA 1RMSA 4G1MB 3N54B 4HM3B 1M1K4 3KSPA 2RFRA 2E2UA 1BSEA 4FMBA 4LZIA 1JKGA 3HZPA 2OQEC 1Q814 2KF3A 1IV7A 1AQZA 1I0XA 1R4YA 3HI7A 5BU4A 1RN1A 1CYVA 1YVBI 2L1SA 1B2ZA 1IVUA 3WODG 1MWRA 1BNSA 4ORLA 3JUQA 1YJW3 1D6UA 3IPTA 5FW5A 4PEJA 4K61A 1N9JA 1BU4A 4FR9A 1ROAA 1RNBA 2KCDA 2YFJB 1W02A 4KZ1A 4NHFA 1YIT3 4OUQA 3LTBA 5G2GA 1V57A 3BNEA 3ROBA 3UL6A 2ML6A 3G6E3 1VQM3 1X1WA 1BUQA 1U8CB 1Z1SA 2INXA 1D6YA 3DM8A 1CEWI 1W6YA 1UUGB 1DMNA 4KFDA 2OQEA 1KWIA 4HKVB 3K63A 1BNFA 3ALAA 3CCR3 4HBRA 1DVDA 1NB3I 2IMJA 1AVLA 1EUIC 1UCKA 1VQQA 2CX1A 2Y73A 3EJVA 4HM1B 3X3ZA 4HOHA 2R4IA 3CXC2 1E3RA 2B1XB 3VSYA 4FCMA 6RNTA 2RCDA 1FUSA 1K28A 4XBTA 3SLUA 1K734 3KCHA 2OTL3 1BSBA 1BGSA 1OUNA 1IVWA 1ZS7A 1DE3A 4HM7B 1TJDA 3I553 2XFTA 1SARA 2GEYA 4HZBB 2FNQA 3TDGA 1V74A 2WOHA 2CFGA 1BSAA 1N5PA 3URPA 3EC9A 3LTCA 3BNDA 1RGHA 1HYFA 1FW7A 1UUWB 1GOUA 1M1XB 5A0OB 5KP1A 3G4S3 1VQO3 5D82A 2XH9A 4QWTA 3NM7A 1RGLA 1FZUA 3OWUA 4LSOA 1LXEA 1LVNA 1GOYA 1W6CA 4XM4A 3ZFZA 1I70A 2QA43 2H0GA 5IERA 2IY2A 1T2IA 3FG4A 3KIIA 3KN4A 3GSPA 3F8HA 2BMOB 3FKAA 1TRQA 4OK0A 3PYJA 1JBRA 1A2KA 2CFLA 4X2OA 1VQ53 1CQSA 5AYRB 3GZBA 5AEWB 4MEIA 1JZOA 1UCIA 5G1KA 3NBBA 1JV2B 3H3HA 3FF2A 3I0YA 1E3VA 1W6GA 3GWRA 4BTWA 1MWTA 1OCVA 1CYUA 2ZA4A 3DGMA 2BMRB 5KP4A 1SJWA 3FF0A 5EVHA 1N5HA 3BNCA 2HMJB 1NU3A 1VZZA 1B20A 3WHOA 5FGOA 3S67A 1JBSA 4EC6A 1X1XA 2BO9B 2UUGC 4XDVA 3SX1A 1I2FA 3AHSA 3CU3A 2CC3A 2WGOA 1BNEA 3GZXB 1BRIA 1FYSA 1DVCA 5AIHA 1GMPA 1LOWA 5AIGA 1RNTA 4RZMA 3B4OA 3RGAA 4O8SA 4R1KA 4U13A 3CPW2 5ELJA 1OHPA 1JKGB 3B7CA 2C4BA 2LYXA 2XGLA 6GSPA 1G02A 5EEOA 1LQMB 1O7MB 2BT3A 1DMQA 3G0KA 4BTYA 1SPUA 3RDEA 1B3SA 3UNLA 5CF2A 3CCL3 1O7HB 2P09A 2JQ5A 2UX0A 3H51A 1U5OA 4R9LA 4BL3A 3NV0A 3ZG0A 1YGEA 4FMDA 2IA7A 5LC7A 2YFIB 5IG0A 5D83A 1B2UA 4O02B 3LTDA 1NB5I 3D3LA 3DGOA 2MF7A 1C7HA 3D4AA 3DXOA 3NBJA 1TRPA 2ML5A 1RGGA 3NQYA 1WMPA 1RKYA 3DZLA 2GEXA 3HIGA 1BNRA 3LMLA 2IUJA 1I3IA 2F86B 3FCSB 3S5CA 3OV4A 3SYUA 1OHOA 3DGLA 4HAAA 3X42A 4FMAA 3KZTA 3CNXA 5M19A 1IK3A 5AYSC 4BU4A 1O7GB 6STDA 1PFPA 3UB1A 2HMNB 2Q07A 2W0QA 3UJMA 3SOYA 1BRGA 2WGQA 4FMCA 4WP5A 3WMDA 5BXQA 1QMAA 3KSED 1WTHA 3L0RA 4L8OA 1RCLA 1IVVA 1EA2A 4HVNA 1YI23 3IMAB 4NPBA 3LTAA 1GMRA 4N6OB 3F8XA 1UCLA 2YFLB 4BTXA 1NJI4 3NXJA 1JJ22 1EKMA 4GL6A 2MC8A 1LOVA 1US1A 3EN1B 1FA3A 2XRXB 1UI7A 2CIUA 4O3VA 3CC73 3F40A 5DRVA 3EHCA 2W56A 4N6TA 2XSOB 2J8XB 1FGQA 3JUNA 3S29A 1VQN3 1I2GA 4LMIA 5JPUA 1FUWA 1E97A 3U1WA 4K90B 3EE1A 3K9MC 1VQ73 1AR0A 2A15A 2O9UX 3SOAA 1ULJB 3LT9A 1BNJA 3CC23 3EB8A 3LH4A 4J9AA 1YIJ3 1Q7HA 4MMZB 3AHWA 2BU4A 2C10A 2CWUA 4MMYB 3EBTA 4I5QA 1TUHA 1I2EA 4N6UA 1N8QA 1T5YA 5ELUA 2ZHXB 3T8UA 3D5IA 5DREA 4XBXA 1B2MA 2RNTA 5CLKA 2AAEA 1RLSA 4GHOA 4OVMA 2CFKA 2XFSA 1MOLA 3EQQB 1MGRA 1SIIA 1UW1A 2Y74A 5IG3A 1NNVA 1UUVB 1ZX2A 4CJNA 1N9EA 2CFWA 1I0VA 2HMMB 2OOVC 3N9HA 4DKIA 4LYLB 3OW22 1JZDA 2F56A 2P0XA 1WMOA 3MG3A 1BSCA 2GBWB 2GBXB 4JF8A 1RGFA 2F4YA 1BRSA 1BVIA 1FUTA 1GY5A 4LEHA 5CK6A 2UGIA 2F98A 3LXUX 4HYZA 1B2SA 1ASKA 1IQYA 2RBIA 3Q90A 4HM2B 1TU5A 3BLZA 1MNLA 3K0ZA 3EN8A 1B21A 4EV2A 1VQ63 3X40A 3PCSA 3B8LA 2SARA 3OXAA 2B24B 1G96A 2W9PA 2KXGA 2Z77A 1RRLA 1BANA 3A5EA 3F14A 2RSXA 4FCJA 1BAOA 1G0TA 1T2HA 1GY6A 3GZRA 3Q1CA 1GMQA 4AKZA 1OGXA 3GZYB 1RRHA 3WDGB 3J7Yd 1OPYA 1KSIA 1TFKA 2BMQB 3MYTA 1QVF2 2OTJ3 3AMOA 3UL5A 3CD63 1IU7A 2E2VA 3LOYA 3SVAA 2W03A 3BU4A 3S27A 2K54A 4TX4A 3X3XA 1W2B2 1PYLA 1GYBA 7STDA 1DMMA 4RNYA 5AIIA 2YX9A 3NHXA 1DETA 1JN5B 1LOXA 3B4PA 3HOHA 1IYYA 2GU1A 3RGRA 1ZO2A 1TFOA 5M18A 1I3FA 1NDOB 4HM8B 4LGQA 2H0HA 4FCZA 4HM6B 4J5GA 7GSPA 3V92A 1FGRA 2Z76A 2BIRA 1DYUA 2XF3A 2CK3H 1C54A 3A76A 2C11A 4IIAA 2PZVA 4L8PA 3S28A 2CKFB 3HK4A 5D81A 3Q2PA 1BNIA 5JPPA 5HGRA 1O7WB 3NM2A 3WA3A 2I9WA 4Q53A 2CFDA 2IUKA 1VQ83 2BNGA 2Z6BA 2WOFA 1IQXA 3QRDA 3V99A 3DUKA 3F7XA 1LNIA 1W7CA 3MKIA 1LNHA 3VGNA 1A2PA 1PU4A 2CG0A 3EX9A 2XSHB 3X41A 1IV9A 3SXXA 3K5TA 2KF5A 2P05A 1RGCA 1LQGC 3WR2A 3CCJ3 4N6V0 5EQLA 1EEJA 1QJGA 3GRDA 3JUPA 1BRJA 1GD4A 1BOXA 1GOVA 3PZWA 3IJEB 5HOHA 1RN4A 2STDA 2QEX3 1QVG2 1JBTA 3DGNA 3MPHA 1RCKA 2W6JH 1N8R4 1VQK3 1RGAA 2RGQA 4NREA 1TP6A 4EBGA 4R4KA 1JNQA 1SQWA 3EBYA 3KKGA 1B27A 1GD3A 3F7SA 5CF1A 3MWZA 4H3UA 4I4KA 1GSPA 3BIRA 3JUOA 5CXOA 3MHEA 1W00A 1K41A 1Q824 1TTOA 2P0MA 5M1AA 4STDA 2W04A 2PNCA 3O8YA 1JRQA 3Q3FA 3LT8A 1OF5A 4IPBA 3OX9A 3JUMA 5AEUB 1S5AA 2GSPA 1FGTA 2H0IA 1BUJA 1D6ZA 2FGTA 3ECFA 3U97A 1W4NA 1O7PB 2F5WA 1AVKA 2M7OA 3M8CA 2GXFA 1IQ8A 1RDSA 3LYGA 4GSPA 3STDA 3MSOA 4HJLB 4WYKA 3PXMA 2CWVA 1Q40A 3FGYA 3JVCA 1IVXA 4BIRA 3CCE3 1TIJA 4WHAA 5IEPA 1T3BA 1WNHA 4KVHA 3X3YA 1Q42A 2KAAA 1OGZA 5AIFA 3WA2X 4WFOA 3E99A 3D9RA 2ZDJA 1IT8A 3CCU3 1RJOA 1YNVX 4N6NB 4RBNA 7RNTA 2D1WA 1R4CA 1WMNA 3I563 1CH0A 4HM4B 1UGIA 3NX0A 4EYCA 1K9M4 3HX8A 3PGBA 3CPOA 3QK9A 4GB5A 4J5KA 4XBYA 1AV4A
chains in the Genus database with same CATH topology
1BNEA 1AY7A 1BRIA 1B21A 1UCJA 1FYSA 2SARA 1GMPA 1LOWA 1RNTA 3DGYA 1BANA 3A5EA 1B2XA 1BAOA 1RMSA 1T2HA 1BRKA 2C4BA 6GSPA 1G02A 1GMQA 1B3SA 1BSEA 2KF3A 1AQZA 1I0XA 1R4YA 2KF6A 5BU4A 1RN1A 1MGWA 1B2ZA 3BU4A 1BNSA 1B2UA 1PYLA 1RHLA 3D4AA 1BU4A 1RNBA 1TRPA 1ZGXA 1DETA 3HOHA 1RGGA 1IYYA 1I3FA 1BNRA 5GSPA 1RSNA 1I3IA 1X1WA 3RNTA 3SYUA 4J5GA 4HAAA 2HOHA 7GSPA 1C54A 2BIRA 4BU4A 1BNFA 1UCKA 1BRGA 1BNIA 4HOHA 1RCLA 1BNGA 3AGOA 6RNTA 1I8VA 1GMRA 1FUSA 3KCHA 1BSBA 1BGSA 1LNIA 1UCLA 1RGEA 1DE3A 1A2PA 1RTUA 1Q9EA 1SARA 2KF5A 3D5GA 1RGCA 3AGNA 1LOVA 3WR2A 4RNTA 5HOHA 1BRJA 1BOXA 1BSAA 1GOVA 3URPA 1RN4A 1RGHA 1X1UA 1HYFA 1JBTA 1FW7A 1GOUA 1RCKA 5BIRA 1RGAA 1I2GA 1RGLA 1FZUA 1GOYA 1B27A 1HZ1A 1I70A 1GSPA 3BIRA 1BNJA 1T2IA 2KF4A 1YGWA 8RNTA 1TTOA 3GSPA 3AHWA 1BRNL 2BU4A 1LRAA 1TRQA 1BSDA 1BIRA 1LOYA 2F5MA 3Q3FA 1JBRA 1I2EA 2GSPA 1BUJA 2F5WA 3D5IA 1UCIA 4GSPA 1X1YA 1B2MA 1RDSA 2RNTA 2AAEA 1RLSA 4GHOA 9RNTA 4BIRA 1MGRA 2ZA4A 1RGKA 1YVSA 1PY3A 2KAAA 1I0VA 2F56A 1B20A 1BSCA 1YNVX 7RNTA 1RGFA 2F4YA 1BRSA 1BVIA 1FUTA 3WHOA 3DH2A 5RNTA 1JBSA 1CH0A 1X1XA 2AADA 1I2FA 1B2SA 3AHSA 2RBIA 4J5KA 1BRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNE A;  1AY7 A;  1BRI A;  1B21 A;  1UCJ A;  1FYS A;  2SAR A;  1GMP A;  1LOW A;  1RNT A;  3DGY A;  1BAN A;  3A5E A;  1B2X A;  1BAO A;  1RMS A;  1T2H A;  1BRK A;  2C4B A;  6GSP A;  1G02 A;  1GMQ A;  1B3S A;  1BSE A;  2KF3 A;  1AQZ A;  1I0X A;  1R4Y A;  2KF6 A;  5BU4 A;  1RN1 A;  1MGW A;  1B2Z A;  3BU4 A;  1BNS A;  1B2U A;  1PYL A;  1RHL A;  3D4A A;  1BU4 A;  1RNB A;  1TRP A;  1ZGX A;  1DET A;  3HOH A;  1RGG A;  1IYY A;  1I3F A;  1BNR A;  5GSP A;  1RSN A;  1I3I A;  1X1W A;  3RNT A;  3SYU A;  4J5G A;  4HAA A;  2HOH A;  7GSP A;  1C54 A;  2BIR A;  4BU4 A;  1BNF A;  1UCK A;  1BRG A;  1BNI A;  4HOH A;  1RCL A;  1BNG A;  3AGO A;  6RNT A;  1I8V A;  1GMR A;  1FUS A;  3KCH A;  1BSB A;  1BGS A;  1LNI A;  1UCL A;  1RGE A;  1DE3 A;  1A2P A;  1RTU A;  1Q9E A;  1SAR A;  2KF5 A;  3D5G A;  1RGC A;  3AGN A;  1LOV A;  3WR2 A;  4RNT A;  5HOH A;  1BRJ A;  1BOX A;  1BSA A;  1GOV A;  3URP A;  1RN4 A;  1RGH A;  1X1U A;  1HYF A;  1JBT A;  1FW7 A;  1GOU A;  1RCK A;  5BIR A;  1RGA A;  1I2G A;  1RGL A;  1FZU A;  1GOY A;  1B27 A;  1HZ1 A;  1I70 A;  1GSP A;  3BIR A;  1BNJ A;  1T2I A;  2KF4 A;  1YGW A;  8RNT A;  1TTO A;  3GSP A;  3AHW A;  1BRN L;  2BU4 A;  1LRA A;  1TRQ A;  1BSD A;  1BIR A;  1LOY A;  2F5M A;  3Q3F A;  1JBR A;  1I2E A;  2GSP A;  1BUJ A;  2F5W A;  3D5I A;  1UCI A;  4GSP A;  1X1Y A;  1B2M A;  1RDS A;  2RNT A;  2AAE A;  1RLS A;  4GHO A;  9RNT A;  4BIR A;  1MGR A;  2ZA4 A;  1RGK A;  1YVS A;  1PY3 A;  2KAA A;  1I0V A;  2F56 A;  1B20 A;  1BSC A;  1YNV X;  7RNT A;  1RGF A;  2F4Y A;  1BRS A;  1BVI A;  1FUT A;  3WHO A;  3DH2 A;  5RNT A;  1JBS A;  1CH0 A;  1X1X A;  2AAD A;  1I2F A;  1B2S A;  3AHS A;  2RBI A;  4J5K A;  1BRH A; 
#chains in the Genus database with same CATH topology
 1JB4 A;  1AY7 A;  3GAX A;  2ZL8 A;  4IT7 A;  5IEO A;  3MG2 A;  8CHO A;  4CDL A;  4AEQ A;  1OAC A;  4R80 A;  3CCS 3;  3DGY A;  5JBS A;  1YJN 3;  5IF6 A;  4J8T A;  1J2B A;  1STD A;  1ROV A;  4R9K A;  1B2X A;  3G16 A;  3FSD A;  2GU3 A;  2XEP A;  4MJD A;  1BRK A;  5BVB A;  1A90 A;  3AMO B;  5IEN A;  2CHC A;  4KFE A;  3SED A;  3KFQ C;  5IW9 A;  1S72 3;  4L7K A;  3EF8 A;  1JB2 A;  2KF6 A;  1OHS A;  1MGW A;  1VQL 3;  1Q7Y 4;  4CPK A;  5STD A;  1ULI B;  1F8N A;  1RHL A;  3CC4 3;  4XB5 A;  3OWS A;  1HU9 A;  1ZGX A;  2HML B;  1ISK A;  4JRF A;  2K3D A;  5IG4 A;  4N6L A;  3DMC A;  1RSN A;  4XDW A;  5GSP A;  2QIY A;  2IYJ A;  3D79 A;  2O3O A;  4KT3 B;  3RNT A;  1M90 4;  3NQZ A;  2HOH A;  5TGN A;  2OOV A;  2HMO B;  2FXT A;  3K7C A;  3LZA A;  5AI1 A;  1QAF A;  3CMA 3;  3VF1 A;  3NV0 B;  4O2H A;  1VQ4 3;  4ILF A;  3CNM A;  1BNG A;  3AGO A;  3KE7 A;  3N8B A;  4CCV A;  1I8V A;  1MWU A;  1YHQ 3;  3G71 3;  1K8A 4;  3PS8 A;  1RGE A;  2P38 A;  4EW5 A;  2OCT A;  1RTU A;  1JB5 A;  1Q9E A;  4N6M A;  2CX0 A;  2QGU A;  2KRT A;  3D5G A;  3AGN A;  3WOE B;  4RNT A;  1W5Z A;  5G1L A;  4N3V A;  2K0M A;  1FGM A;  1OH0 A;  1QAK A;  3FH1 A;  1X1U A;  1A67 A;  2JDI H;  3PCR A;  1UDI I;  3BNB A;  3FG1 A;  3FZW A;  3NBR A;  1GY7 A;  5BIR A;  3T0U A;  3ZG5 A;  1GS3 A;  1UGH I;  2XR8 B;  1STF I;  5LC6 A;  2CG1 A;  4AKY A;  1VQP 3;  2W2C A;  2D42 A;  1VQ9 3;  1HZ1 A;  1SIH A;  3FG3 A;  3ER7 A;  1QAL A;  1Q86 4;  3MG1 A;  8RNT A;  2KF4 A;  1YGW A;  3CCM 3;  1OF5 B;  3BB9 A;  1L5G B;  1UI8 A;  4BL2 A;  1BRN L;  3HII A;  1LRA A;  1V58 A;  5I97 A;  1YJ9 3;  2HMK B;  1BSD A;  1BIR A;  1LOY A;  2F5M A;  3FLJ A;  1KC8 4;  1KQS 2;  2V1L A;  4WYK B;  5KP3 A;  3CCV 3;  1Q40 B;  1A2V A;  3OWY A;  1X1Y A;  3DY5 A;  4EXR A;  1Y4K A;  2W56 B;  3NUV A;  2R41 A;  2SBL A;  3T8N A;  9RNT A;  1EQK A;  4X2H A;  4RNZ A;  4HZ9 B;  2OWP A;  1NWW A;  1W2Z A;  1EG9 B;  2XGN A;  1KD1 4;  1FGO A;  1RGK A;  1YVS A;  1PY3 A;  2F99 A;  2W9Q A;  3F9S A;  5IG5 A;  2CWT A;  3CCQ 3;  4ZM8 A;  4K1V A;  2L4V A;  2E2T A;  1IDP A;  2WO0 A;  5RNT A;  1RN7 A;  1M9G A;  3DH2 A;  2LQV A;  4EV5 A;  4KFF A;  2CW9 A;  4WWU C;  1O7N B;  1MWS A;  2AAD A;  2BHM A;  4MMX B;  1WQL B;  1BRH A;  1NO3 A;  4HM0 B;  4K1U A;  3G8Z A;  2Z7A A;  1UCJ A;  1JN5 A;  4H61 A;  4HM5 B;  3CME 3;  1W01 A;  1IT7 A;  3V98 A;  3WOF B;  2CH9 A;  1HKX A;  1RMS A;  4G1M B;  3N54 B;  4HM3 B;  1M1K 4;  3KSP A;  2RFR A;  2E2U A;  1BSE A;  4FMB A;  4LZI A;  1JKG A;  3HZP A;  2OQE C;  1Q81 4;  2KF3 A;  1IV7 A;  1AQZ A;  1I0X A;  1R4Y A;  3HI7 A;  5BU4 A;  1RN1 A;  1CYV A;  1YVB I;  2L1S A;  1B2Z A;  1IVU A;  3WOD G;  1MWR A;  1BNS A;  4ORL A;  3JUQ A;  1YJW 3;  1D6U A;  3IPT A;  5FW5 A;  4PEJ A;  4K61 A;  1N9J A;  1BU4 A;  4FR9 A;  1ROA A;  1RNB A;  2KCD A;  2YFJ B;  1W02 A;  4KZ1 A;  4NHF A;  1YIT 3;  4OUQ A;  3LTB A;  5G2G A;  1V57 A;  3BNE A;  3ROB A;  3UL6 A;  2ML6 A;  3G6E 3;  1VQM 3;  1X1W A;  1BUQ A;  1U8C B;  1Z1S A;  2INX A;  1D6Y A;  3DM8 A;  1CEW I;  1W6Y A;  1UUG B;  1DMN A;  4KFD A;  2OQE A;  1KWI A;  4HKV B;  3K63 A;  1BNF A;  3ALA A;  3CCR 3;  4HBR A;  1DVD A;  1NB3 I;  2IMJ A;  1AVL A;  1EUI C;  1UCK A;  1VQQ A;  2CX1 A;  2Y73 A;  3EJV A;  4HM1 B;  3X3Z A;  4HOH A;  2R4I A;  3CXC 2;  1E3R A;  2B1X B;  3VSY A;  4FCM A;  6RNT A;  2RCD A;  1FUS A;  1K28 A;  4XBT A;  3SLU A;  1K73 4;  3KCH A;  2OTL 3;  1BSB A;  1BGS A;  1OUN A;  1IVW A;  1ZS7 A;  1DE3 A;  4HM7 B;  1TJD A;  3I55 3;  2XFT A;  1SAR A;  2GEY A;  4HZB B;  2FNQ A;  3TDG A;  1V74 A;  2WOH A;  2CFG A;  1BSA A;  1N5P A;  3URP A;  3EC9 A;  3LTC A;  3BND A;  1RGH A;  1HYF A;  1FW7 A;  1UUW B;  1GOU A;  1M1X B;  5A0O B;  5KP1 A;  3G4S 3;  1VQO 3;  5D82 A;  2XH9 A;  4QWT A;  3NM7 A;  1RGL A;  1FZU A;  3OWU A;  4LSO A;  1LXE A;  1LVN A;  1GOY A;  1W6C A;  4XM4 A;  3ZFZ A;  1I70 A;  2QA4 3;  2H0G A;  5IER A;  2IY2 A;  1T2I A;  3FG4 A;  3KII A;  3KN4 A;  3GSP A;  3F8H A;  2BMO B;  3FKA A;  1TRQ A;  4OK0 A;  3PYJ A;  1JBR A;  1A2K A;  2CFL A;  4X2O A;  1VQ5 3;  1CQS A;  5AYR B;  3GZB A;  5AEW B;  4MEI A;  1JZO A;  1UCI A;  5G1K A;  3NBB A;  1JV2 B;  3H3H A;  3FF2 A;  3I0Y A;  1E3V A;  1W6G A;  3GWR A;  4BTW A;  1MWT A;  1OCV A;  1CYU A;  2ZA4 A;  3DGM A;  2BMR B;  5KP4 A;  1SJW A;  3FF0 A;  5EVH A;  1N5H A;  3BNC A;  2HMJ B;  1NU3 A;  1VZZ A;  1B20 A;  3WHO A;  5FGO A;  3S67 A;  1JBS A;  4EC6 A;  1X1X A;  2BO9 B;  2UUG C;  4XDV A;  3SX1 A;  1I2F A;  3AHS A;  3CU3 A;  2CC3 A;  2WGO A;  1BNE A;  3GZX B;  1BRI A;  1FYS A;  1DVC A;  5AIH A;  1GMP A;  1LOW A;  5AIG A;  1RNT A;  4RZM A;  3B4O A;  3RGA A;  4O8S A;  4R1K A;  4U13 A;  3CPW 2;  5ELJ A;  1OHP A;  1JKG B;  3B7C A;  2C4B A;  2LYX A;  2XGL A;  6GSP A;  1G02 A;  5EEO A;  1LQM B;  1O7M B;  2BT3 A;  1DMQ A;  3G0K A;  4BTY A;  1SPU A;  3RDE A;  1B3S A;  3UNL A;  5CF2 A;  3CCL 3;  1O7H B;  2P09 A;  2JQ5 A;  2UX0 A;  3H51 A;  1U5O A;  4R9L A;  4BL3 A;  3NV0 A;  3ZG0 A;  1YGE A;  4FMD A;  2IA7 A;  5LC7 A;  2YFI B;  5IG0 A;  5D83 A;  1B2U A;  4O02 B;  3LTD A;  1NB5 I;  3D3L A;  3DGO A;  2MF7 A;  1C7H A;  3D4A A;  3DXO A;  3NBJ A;  1TRP A;  2ML5 A;  1RGG A;  3NQY A;  1WMP A;  1RKY A;  3DZL A;  2GEX A;  3HIG A;  1BNR A;  3LML A;  2IUJ A;  1I3I A;  2F86 B;  3FCS B;  3S5C A;  3OV4 A;  3SYU A;  1OHO A;  3DGL A;  4HAA A;  3X42 A;  4FMA A;  3KZT A;  3CNX A;  5M19 A;  1IK3 A;  5AYS C;  4BU4 A;  1O7G B;  6STD A;  1PFP A;  3UB1 A;  2HMN B;  2Q07 A;  2W0Q A;  3UJM A;  3SOY A;  1BRG A;  2WGQ A;  4FMC A;  4WP5 A;  3WMD A;  5BXQ A;  1QMA A;  3KSE D;  1WTH A;  3L0R A;  4L8O A;  1RCL A;  1IVV A;  1EA2 A;  4HVN A;  1YI2 3;  3IMA B;  4NPB A;  3LTA A;  1GMR A;  4N6O B;  3F8X A;  1UCL A;  2YFL B;  4BTX A;  1NJI 4;  3NXJ A;  1JJ2 2;  1EKM A;  4GL6 A;  2MC8 A;  1LOV A;  1US1 A;  3EN1 B;  1FA3 A;  2XRX B;  1UI7 A;  2CIU A;  4O3V A;  3CC7 3;  3F40 A;  5DRV A;  3EHC A;  2W56 A;  4N6T A;  2XSO B;  2J8X B;  1FGQ A;  3JUN A;  3S29 A;  1VQN 3;  1I2G A;  4LMI A;  5JPU A;  1FUW A;  1E97 A;  3U1W A;  4K90 B;  3EE1 A;  3K9M C;  1VQ7 3;  1AR0 A;  2A15 A;  2O9U X;  3SOA A;  1ULJ B;  3LT9 A;  1BNJ A;  3CC2 3;  3EB8 A;  3LH4 A;  4J9A A;  1YIJ 3;  1Q7H A;  4MMZ B;  3AHW A;  2BU4 A;  2C10 A;  2CWU A;  4MMY B;  3EBT A;  4I5Q A;  1TUH A;  1I2E A;  4N6U A;  1N8Q A;  1T5Y A;  5ELU A;  2ZHX B;  3T8U A;  3D5I A;  5DRE A;  4XBX A;  1B2M A;  2RNT A;  5CLK A;  2AAE A;  1RLS A;  4GHO A;  4OVM A;  2CFK A;  2XFS A;  1MOL A;  3EQQ B;  1MGR A;  1SII A;  1UW1 A;  2Y74 A;  5IG3 A;  1NNV A;  1UUV B;  1ZX2 A;  4CJN A;  1N9E A;  2CFW A;  1I0V A;  2HMM B;  2OOV C;  3N9H A;  4DKI A;  4LYL B;  3OW2 2;  1JZD A;  2F56 A;  2P0X A;  1WMO A;  3MG3 A;  1BSC A;  2GBW B;  2GBX B;  4JF8 A;  1RGF A;  2F4Y A;  1BRS A;  1BVI A;  1FUT A;  1GY5 A;  4LEH A;  5CK6 A;  2UGI A;  2F98 A;  3LXU X;  4HYZ A;  1B2S A;  1ASK A;  1IQY A;  2RBI A;  3Q90 A;  4HM2 B;  1TU5 A;  3BLZ A;  1MNL A;  3K0Z A;  3EN8 A;  1B21 A;  4EV2 A;  1VQ6 3;  3X40 A;  3PCS A;  3B8L A;  2SAR A;  3OXA A;  2B24 B;  1G96 A;  2W9P A;  2KXG A;  2Z77 A;  1RRL A;  1BAN A;  3A5E A;  3F14 A;  2RSX A;  4FCJ A;  1BAO A;  1G0T A;  1T2H A;  1GY6 A;  3GZR A;  3Q1C A;  1GMQ A;  4AKZ A;  1OGX A;  3GZY B;  1RRH A;  3WDG B;  3J7Y d;  1OPY A;  1KSI A;  1TFK A;  2BMQ B;  3MYT A;  1QVF 2;  2OTJ 3;  3AMO A;  3UL5 A;  3CD6 3;  1IU7 A;  2E2V A;  3LOY A;  3SVA A;  2W03 A;  3BU4 A;  3S27 A;  2K54 A;  4TX4 A;  3X3X A;  1W2B 2;  1PYL A;  1GYB A;  7STD A;  1DMM A;  4RNY A;  5AII A;  2YX9 A;  3NHX A;  1DET A;  1JN5 B;  1LOX A;  3B4P A;  3HOH A;  1IYY A;  2GU1 A;  3RGR A;  1ZO2 A;  1TFO A;  5M18 A;  1I3F A;  1NDO B;  4HM8 B;  4LGQ A;  2H0H A;  4FCZ A;  4HM6 B;  4J5G A;  7GSP A;  3V92 A;  1FGR A;  2Z76 A;  2BIR A;  1DYU A;  2XF3 A;  2CK3 H;  1C54 A;  3A76 A;  2C11 A;  4IIA A;  2PZV A;  4L8P A;  3S28 A;  2CKF B;  3HK4 A;  5D81 A;  3Q2P A;  1BNI A;  5JPP A;  5HGR A;  1O7W B;  3NM2 A;  3WA3 A;  2I9W A;  4Q53 A;  2CFD A;  2IUK A;  1VQ8 3;  2BNG A;  2Z6B A;  2WOF A;  1IQX A;  3QRD A;  3V99 A;  3DUK A;  3F7X A;  1LNI A;  1W7C A;  3MKI A;  1LNH A;  3VGN A;  1A2P A;  1PU4 A;  2CG0 A;  3EX9 A;  2XSH B;  3X41 A;  1IV9 A;  3SXX A;  3K5T A;  2KF5 A;  2P05 A;  1RGC A;  1LQG C;  3WR2 A;  3CCJ 3;  4N6V 0;  5EQL A;  1EEJ A;  1QJG A;  3GRD A;  3JUP A;  1BRJ A;  1GD4 A;  1BOX A;  1GOV A;  3PZW A;  3IJE B;  5HOH A;  1RN4 A;  2STD A;  2QEX 3;  1QVG 2;  1JBT A;  3DGN A;  3MPH A;  1RCK A;  2W6J H;  1N8R 4;  1VQK 3;  1RGA A;  2RGQ A;  4NRE A;  1TP6 A;  4EBG A;  4R4K A;  1JNQ A;  1SQW A;  3EBY A;  3KKG A;  1B27 A;  1GD3 A;  3F7S A;  5CF1 A;  3MWZ A;  4H3U A;  4I4K A;  1GSP A;  3BIR A;  3JUO A;  5CXO A;  3MHE A;  1W00 A;  1K41 A;  1Q82 4;  1TTO A;  2P0M A;  5M1A A;  4STD A;  2W04 A;  2PNC A;  3O8Y A;  1JRQ A;  3Q3F A;  3LT8 A;  1OF5 A;  4IPB A;  3OX9 A;  3JUM A;  5AEU B;  1S5A A;  2GSP A;  1FGT A;  2H0I A;  1BUJ A;  1D6Z A;  2FGT A;  3ECF A;  3U97 A;  1W4N A;  1O7P B;  2F5W A;  1AVK A;  2M7O A;  3M8C A;  2GXF A;  1IQ8 A;  1RDS A;  3LYG A;  4GSP A;  3STD A;  3MSO A;  4HJL B;  4WYK A;  3PXM A;  2CWV A;  1Q40 A;  3FGY A;  3JVC A;  1IVX A;  4BIR A;  3CCE 3;  1TIJ A;  4WHA A;  5IEP A;  1T3B A;  1WNH A;  4KVH A;  3X3Y A;  1Q42 A;  2KAA A;  1OGZ A;  5AIF A;  3WA2 X;  4WFO A;  3E99 A;  3D9R A;  2ZDJ A;  1IT8 A;  3CCU 3;  1RJO A;  1YNV X;  4N6N B;  4RBN A;  7RNT A;  2D1W A;  1R4C A;  1WMN A;  3I56 3;  1CH0 A;  4HM4 B;  1UGI A;  3NX0 A;  4EYC A;  1K9M 4;  3HX8 A;  3PGB A;  3CPO A;  3QK9 A;  4GB5 A;  4J5K A;  4XBY A;  1AV4 A; 
#chains in the Genus database with same CATH homology
 1BNE A;  1AY7 A;  1BRI A;  1B21 A;  1UCJ A;  1FYS A;  2SAR A;  1GMP A;  1LOW A;  1RNT A;  3DGY A;  1BAN A;  3A5E A;  1B2X A;  1BAO A;  1RMS A;  1T2H A;  1BRK A;  2C4B A;  6GSP A;  1G02 A;  1GMQ A;  1B3S A;  1BSE A;  2KF3 A;  1AQZ A;  1I0X A;  1R4Y A;  2KF6 A;  5BU4 A;  1RN1 A;  1MGW A;  1B2Z A;  3BU4 A;  1BNS A;  1B2U A;  1PYL A;  1RHL A;  3D4A A;  1BU4 A;  1RNB A;  1TRP A;  1ZGX A;  1DET A;  3HOH A;  1RGG A;  1IYY A;  1I3F A;  1BNR A;  5GSP A;  1RSN A;  1I3I A;  1X1W A;  3RNT A;  3SYU A;  4J5G A;  4HAA A;  2HOH A;  7GSP A;  1C54 A;  2BIR A;  4BU4 A;  1BNF A;  1UCK A;  1BRG A;  1BNI A;  4HOH A;  1RCL A;  1BNG A;  3AGO A;  6RNT A;  1I8V A;  1GMR A;  1FUS A;  3KCH A;  1BSB A;  1BGS A;  1LNI A;  1UCL A;  1RGE A;  1DE3 A;  1A2P A;  1RTU A;  1Q9E A;  1SAR A;  2KF5 A;  3D5G A;  1RGC A;  3AGN A;  1LOV A;  3WR2 A;  4RNT A;  5HOH A;  1BRJ A;  1BOX A;  1BSA A;  1GOV A;  3URP A;  1RN4 A;  1RGH A;  1X1U A;  1HYF A;  1JBT A;  1FW7 A;  1GOU A;  1RCK A;  5BIR A;  1RGA A;  1I2G A;  1RGL A;  1FZU A;  1GOY A;  1B27 A;  1HZ1 A;  1I70 A;  1GSP A;  3BIR A;  1BNJ A;  1T2I A;  2KF4 A;  1YGW A;  8RNT A;  1TTO A;  3GSP A;  3AHW A;  1BRN L;  2BU4 A;  1LRA A;  1TRQ A;  1BSD A;  1BIR A;  1LOY A;  2F5M A;  3Q3F A;  1JBR A;  1I2E A;  2GSP A;  1BUJ A;  2F5W A;  3D5I A;  1UCI A;  4GSP A;  1X1Y A;  1B2M A;  1RDS A;  2RNT A;  2AAE A;  1RLS A;  4GHO A;  9RNT A;  4BIR A;  1MGR A;  2ZA4 A;  1RGK A;  1YVS A;  1PY3 A;  2KAA A;  1I0V A;  2F56 A;  1B20 A;  1BSC A;  1YNV X;  7RNT A;  1RGF A;  2F4Y A;  1BRS A;  1BVI A;  1FUT A;  3WHO A;  3DH2 A;  5RNT A;  1JBS A;  1CH0 A;  1X1X A;  2AAD A;  1I2F A;  1B2S A;  3AHS A;  2RBI A;  4J5K A;  1BRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...