1GMQA

Complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
96
structure length
96
Chain Sequence
DVSGTVCLSALPPEATDTLNLIASDGPFPYSQDGVVFQNRESVLPTQSYGYYHEYTVITPGARTRGTRRIICGEATQEDYYTGDHYATFSLIDQTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE SA
publication title Complex of ribonuclease from Streptomyces aureofaciens with 2'-GMP at 1.7 A resolution.
pubmed doi rcsb
source organism Streptomyces aureofaciens
molecule tags Hydrolase
total genus 27
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1992-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1gmqA00
1UCLA 1RHLA 1B2XA 1JBTA 1RNBA 2BIRA 1B21A 1I2GA 3D4AA 1RMSA 3AGOA 1BAOA 1G02A 1B2SA 1RGAA 3AGNA 1R4YA 1TTOA 1YVSA 2F5WA 1PY3A 1B3SA 4HAAA 2GSPA 4J5KA 5RNTA 1IYYA 1BNSA 1LOYA 3DH2A 1RTUA 1I2FA 1SARA 2KAAA 3HOHA 1RGHA 1GMPA 1UCKA 1X1UA 1GMRA 1GSPA 4J5GA 1RDSA 1FW7A 2AAEA 3URPA 3BIRA 1ZGXA 1I8VA 1BNGA 3GSPA 3D5IA 1RN4A 1TRQA 1BSBA 6RNTA 1RGFA 5HOHA 1LNIA 1B20A 1B2UA 1MGRA 1X1XA 1FYSA 2ZA4A 2F4YA 1BRHA 1I3IA 1Q9EA 1BUJA 1RCKA 1RGKA 4GSPA 1JBSA 1BRGA 1BRIA 1X1WA 3WR2A 1GMQA 2AADA 1BNIA 1BANA 1GOYA 1T2IA 4GHOA 1YNVX 1C54A 1PYLA 1RGCA 5GSPA 1AQZA 3WHOA 1HYFA 1BIRA 1B2ZA 8RNTA 1BRKA 1TRPA 1UCJA 1RN1A 1CH0A 1B2MA 1RNTA 1YGWA 3A5EA 1RGEA 1I0VA 1RGGA 1AY7A 1BRSA 1BSCA 1BVIA 1RSNA 2KF6A 1GOUA 1HZ1A 1I2EA 2HOHA 1BNRA 1BNFA 2KF3A 9RNTA 3Q3FA 1MGWA 4BIRA 3D5GA 3KCHA 1T2HA 3RNTA 1BOXA 1BGSA 1BNJA 1JBRA 1GOVA 3BU4A 3AHWA 1BRNL 1BU4A 7RNTA 2F5MA 2KF4A 4HOHA 7GSPA 1X1YA 1RLSA 4BU4A 1DETA 1I0XA 3AHSA 1BSDA 1BSEA 1FUTA 1I70A 2RBIA 1FZUA 1RGLA 1LRAA 1A2PA 1DE3A 1B27A 3DGYA 1LOWA 2C4BA 1I3FA 2RNTA 1LOVA 5BIRA 4RNTA 5BU4A 2SARA 1BNEA 1FUSA 2F56A 2BU4A 6GSPA 1UCIA 1RCLA 2KF5A 1BRJA 3SYUA 1BSAA
chains in the Genus database with same CATH superfamily
1OH0A 4IT7A 1M1XB 3DY5A 1JBTA 3D3LA 1D6YA 1DVCA 2R4IA 2BIRA 3K7CA 1I2GA 4HZ9B 1B2SA 1N8R4 3FH1A 1WQLB 5LC6A 4H61A 1VQL3 1JZDA 2J8XB 1O7WB 2F98A 4HAAA 4K1VA 3N54B 1KWIA 3CU3A 4N6OB 3V99A 3H3HA 5AIFA 1GD3A 2PZVA 3DUKA 1GS3A 3OX9A 2WGQA 2KAAA 2XRXB 1QMAA 3HOHA 1RGHA 4CJNA 2HMMB 1K9M4 2K3DA 4FCMA 1OCVA 2IUKA 3G0KA 4J5GA 1N5HA 1W01A 4HM2B 2W56A 5EVHA 1FW7A 3CCR3 3T8UA 1TJDA 1V57A 1VQK3 1BNGA 2OWPA 1UGHI 5IG4A 3GSPA 3CCV3 1AVKA 1GY7A 4HVNA 1AVLA 1O7HB 3IJEB 2OCTA 5HOHA 5IEPA 3Q1CA 3K0ZA 4XDWA 8CHOA 5FW5A 1FYSA 3EQQB 2C11A 2WOFA 2Y74A 3NM2A 4LMIA 3ECFA 2QGUA 2OQEA 3LTBA 1JNQA 3RDEA 1KC84 4GSPA 3CD63 3GZYB 4KFEA 4RBNA 4BL2A 5JPPA 2OOVA 1GMQA 2Z6BA 1S723 3BLZA 1O7MB 4K61A 1J2BA 3U1WA 1MWSA 3AMOA 3EBTA 3PXMA 3EBYA 1NNVA 2CG0A 1QALA 1EQKA 5BVBA 1N9EA 3B4PA 3N9HA 3CCU3 3NXJA 1QAKA 2Z77A 5IENA 4ILFA 3CCQ3 3MKIA 4KZ1A 1ZO2A 4L8PA 1RNTA 3ZG0A 3SX1A 3D9RA 1RGEA 3WA2X 3LH4A 1I0VA 1BRSA 2GBXB 3CC73 3HZPA 4IIAA 2Z76A 1MWUA 1RSNA 3LMLA 1WTHA 1GOUA 1D6UA 1HZ1A 1I2EA 1ULJB 2KF6A 4FMBA 3ALAA 3JUMA 3KIIA 4XBXA 3HX8A 5AYRB 3CME3 2HOHA 5ELJA 1OF5A 1S5AA 2Z7AA 3NV0B 3GZRA 3LT8A 2W56B 3B7CA 4BIRA 3D5GA 4DKIA 1T2HA 4EV5A 2CW9A 3WOFB 1Q40A 3O8YA 3VF1A 2LQVA 2CIUA 1Y4KA 2CH9A 1BU4A 2JDIH 2IUJA 4HOHA 2ZHXB 3DZLA 3FG3A 4WYKB 3NQZA 4N6NB 7STDA 4NPBA 3DXOA 3FZWA 3LTAA 3OXAA 1YJN3 5EQLA 2Y73A 4FMCA 4KFDA 1BSEA 1JZOA 4XBTA 1K734 5M19A 5KP1A 1AV4A 2BHMA 5AIGA 5G1KA 1K8A4 1A2PA 1DE3A 2CKFB 1MOLA 3CPOA 4CPKA 4WWUC 1K41A 2CWVA 2QEX3 1GY6A 1ASKA 3U97A 2YFLB 1Q824 2F86B 3TDGA 2F56A 6GSPA 1UCIA 3WODG 2KF5A 3FSDA 1RHLA 1BSAA 2RCDA 4HBRA 2B1XB 1IV9A 1VQ63 4EBGA 1STDA 3EX9A 3SOAA 1BAOA 2GU1A 4X2HA 3AGNA 1GYBA 5CK6A 1YVSA 3SVAA 1FUWA 2GSPA 1Q864 1Q40B 3EN8A 1STFI 2CC3A 3FLJA 3FG1A 4NHFA 1BNSA 3DH2A 3OW22 5LC7A 1I2FA 1V74A 3MHEA 3EF8A 4XM4A 4FMDA 3S29A 2FGTA 3RGAA 1GMRA 1GSPA 4BTXA 3PS8A 2AAEA 3URPA 1RJOA 1JKGA 1I8VA 2Q07A 3JUQA 1MWTA 3HK4A 2P05A 1ZS7A 2IA7A 3D5IA 5IF6A 3G6E3 3T8NA 3M8CA 5BXQA 1AR0A 2E2UA 5AI1A 1TUHA 3B8LA 1LNIA 3OWSA 1B2UA 3MYTA 1MWRA 1W02A 4Q53A 3STDA 2FNQA 2ZA4A 1DMMA 2GEXA 3HI7A 1UI8A 1EEJA 1RGKA 3LT9A 1O7NB 4BL3A 3JUOA 3NBRA 1DVDA 1BANA 1G0TA 3I0YA 3ROBA 1T2IA 3NHXA 4GHOA 4HM3B 3FG4A 3QK9A 1RGCA 5GSPA 1AQZA 1SIIA 3NQYA 2XFTA 4O02B 1JN5A 1HYFA 2XF3A 1LNHA 1US1A 5CF1A 2BO9B 1LQGC 3DGMA 1YHQ3 1LQMB 1CYUA 3S5CA 2WO0A 1ROVA 4KT3B 1C7HA 3QRDA 5AYSC 1PU4A 1F8NA 3NM7A 2XGNA 4EXRA 1WNHA 1OACA 3S67A 3PGBA 3DGLA 3SEDA 5CLKA 4N6LA 4HKVB 9RNTA 3F40A 3H51A 4OK0A 1FGOA 1NB3I 2CFGA 4J9AA 3CNXA 1BGSA 5JPUA 2H0IA 2W9QA 1JBRA 2R41A 4O8SA 3BU4A 2P09A 1OGXA 1IQ8A 3B4OA 3MG3A 3K63A 4N6TA 4WHAA 1BRNL 1MNLA 3PYJA 2KF4A 2INXA 3UJMA 1WMOA 3MG2A 4K1UA 5STDA 2W0QA 3AHSA 2IY2A 3JUPA 2BT3A 1IQYA 1JB5A 2L1SA 1N8QA 1ROAA 3X41A 4ZM8A 4J8TA 4MEIA 1R4CA 2RBIA 3A76A 1RGLA 3DMCA 3PCSA 1WMNA 5AEWB 1LVNA 1KD14 4O2HA 4X2OA 1LRAA 4R4KA 3X3YA 4RZMA 1UUGB 1VQO3 2RNTA 1SQWA 3NBBA 5AIIA 3ER7A 1DMNA 1GY5A 3ZG5A 4O3VA 1IU7A 2SARA 1EG9B 2CWTA 2D1WA 1BNEA 1FUSA 3MG1A 5EEOA 2CHCA 3HIGA 3JUNA 1UCLA 4LEHA 1QJGA 1VQ73 3EE1A 2XFSA 3T0UA 1B21A 3MSOA 3GWRA 4L8OA 3VGNA 3AGOA 2K54A 2HMJB 1TTOA 1UUVB 3KZTA 5CXOA 3SXXA 2ML5A 4N6MA 1PY3A 3SOYA 1IVXA 1NWWA 3FKAA 4K90B 1IT7A 1A2VA 3G4S3 5RNTA 5KP3A 1BUQA 4IPBA 1IYYA 1CYVA 1EKMA 1UW1A 3AMOB 1VQP3 1W4NA 1E3RA 4L7KA 3KSED 1SARA 1A90A 1OGZA 1LOXA 2MF7A 1DMQA 3WMDA 1GMPA 4WP5A 4N3VA 4CDLA 3G713 1UCKA 1JB4A 1IVWA 4STDA 1RDSA 4MMZB 1ULIB 3K9MC 4GL6A 4BTYA 2F99A 1WMPA 1V58A 2ZDJA 2XH9A 2HMOB 3Q2PA 5TGNA 3G16A 4OVMA 4U13A 4PEJA 3BNEA 1UUWB 3EHCA 1TRQA 3EJVA 4R1KA 5M18A 3LYGA 5AEUB 1W00A 1OUNA 3OWUA 1OF5B 3CCM3 1X1XA 3EB8A 2CFKA 2HMLB 3X3XA 1JJ22 1BRHA 1I3IA 2UGIA 3BNCA 5D83A 5D81A 2CK3H 4MMYB 2L4VA 1W6CA 1YIT3 2P0MA 2CFDA 1X1WA 3WR2A 2YFJB 2GEYA 5IG5A 1M904 2IYJA 1VQ43 1GOYA 1A67A 4HZBB 2XSHB 2JQ5A 3FF2A 2MC8A 2K0MA 2CG1A 2BNGA 1PYLA 1TU5A 1C54A 2W03A 3S27A 3UB1A 1YGEA 2RGQA 1BIRA 5IG3A 1B2ZA 3J7Yd 3CCS3 3BB9A 2CFWA 3Q90A 3ZFZA 1Q42A 2CWUA 5ELUA 1TRPA 1UCJA 1RN1A 2B24B 3I563 4EV2A 1YGWA 1SIHA 3A5EA 4LYLB 4NREA 3NBJA 1VQN3 1Q814 1RGGA 1AY7A 3EC9A 3IPTA 4LZIA 4G1MB 1IT8A 4FMAA 1BVIA 3GZXB 4OUQA 4HM0B 1JV2B 2E2VA 1QVG2 1BNRA 1TIJA 2KF3A 3Q3FA 3UL6A 1MGWA 2ML6A 4FR9A 4HYZA 4GB5A 3KCHA 3RNTA 4R9KA 1BNJA 1GOVA 1QAFA 2W6JH 1NB5I 1HU9A 1W6GA 3X42A 1EUIC 2FXTA 1GD4A 1FGRA 1O7PB 2CFLA 2KXGA 4RNZA 4QWTA 5D82A 4WFOA 7GSPA 6STDA 3CMA3 4KFFA 3KSPA 4I5QA 5CF2A 5A0OB 1DETA 5IG0A 1I0XA 3WA3A 1LXEA 3MWZA 3PZWA 1IVUA 3CCL3 3JVCA 1E3VA 3F8XA 1Z1SA 2C10A 3VSYA 2OTL3 1FZUA 1PFPA 1Q7HA 2A15A 5IERA 1VZZA 2BMQB 2RSXA 1VQM3 1M1K4 2RFRA 2STDA 2H0GA 3D79A 4HM4B 1FGMA 2C4BA 1I3FA 2UX0A 1QVF2 2XGLA 3NUVA 1JKGB 3NV0A 2W04A 4RNTA 2OQEC 1SPUA 4BTWA 4R80A 1KQS2 1O7GB 2OOVC 4LGQA 3RGRA 3FF0A 1B2XA 1U8CB 3E99A 4H3UA 5KP4A 1RNBA 1OHSA 2W2CA 3D4AA 1RMSA 2CX0A 3HIIA 1G02A 3F8HA 1RGAA 4JF8A 1R4YA 2F5WA 3CCE3 4WYKA 1RRHA 1B3SA 1YVBI 1NJI4 2O3OA 1NU3A 4J5KA 1ZX2A 4EC6A 1LOYA 2IMJA 5HGRA 1RTUA 1G96A 1JN5B 2KRTA 4AKZA 3LXUX 4XB5A 1K28A 1TFKA 3V98A 4AEQA 4TX4A 1FA3A 2O9UX 1X1UA 3PCRA 3KE7A 1FGQA 2ZL8A 1W2B2 3DM8A 2YX9A 3BIRA 1ZGXA 3NX0A 1VQ93 2QA43 4MMXB 1RRLA 2H0HA 3UL5A 3V92A 3CNMA 1CEWI 5IEOA 3FGYA 2V1LA 1RN4A 4HM8B 1IDPA 1OPYA 5DREA 1BSBA 1UDII 1RGFA 1RN7A 4ORLA 6RNTA 1MGRA 1B20A 1E97A 3CC43 4N6V0 2F4YA 4HM7B 2D42A 2E2TA 4LSOA 1T5YA 1Q9EA 4MJDA 1YIJ3 3CXC2 5I97A 1BUJA 1RCKA 5AIHA 3LTCA 1JBSA 1BRGA 1BRIA 3KFQC 4FCJA 4XBYA 2AADA 1BNIA 3LZAA 3CCJ3 3F7SA 4HM1B 3X40A 1YNVX 1VQQA 1JB2A 1IV7A 2GXFA 2XEPA 2BMOB 3IMAB 4KVHA 5DRVA 3LTDA 3WHOA 1RKYA 1N5PA 4XDVA 2WGOA 1TFOA 1OHOA 4HJLB 8RNTA 1HKXA 1BRKA 3K5TA 1SJWA 1B2MA 1CH0A 1D6ZA 1L5GB 1N9JA 4JRFA 3GRDA 1W7CA 1ISKA 3SLUA 2GU3A 3OWYA 3EN1B 1Q7Y4 3UNLA 1YJ93 2YFIB 1BSCA 3BNBA 1T3BA 2PNCA 3MPHA 1KSIA 3FCSB 1BNFA 2OTJ3 4FCZA 3BNDA 1M9GA 1NO3A 2LYXA 1IVVA 1CQSA 1UI7A 1BOXA 1DYUA 3F14A 1YJW3 1JRQA 1U5OA 4HM6B 4N6UA 2M7OA 5G2GA 3AHWA 5FGOA 2SBLA 3X3ZA 7RNTA 1W2ZA 3WDGB 2F5MA 3F7XA 2BMRB 5JBSA 2GBWB 1X1YA 3DGNA 1RLSA 5G1LA 3CPW2 1UGIA 4BU4A 1TP6A 3CC23 2KCDA 3LOYA 4R9LA 2HMNB 1OHPA 3WOEB 1IK3A 4HM5B 1BSDA 1FGTA 1NDOB 2XR8B 3GAXA 2XSOB 1EA2A 2UUGC 2P0XA 3N8BA 4EYCA 2HMKB 3I553 3G8ZA 3DGOA 1FUTA 4RNYA 1I70A 5M1AA 3KN4A 3S28A 1IQXA 2WOHA 1YI23 1A2KA 4I4KA 1B27A 3DGYA 4AKYA 5IW9A 1LOWA 4CCVA 1VQ83 3KKGA 1W5ZA 1LOVA 3GZBA 2I9WA 3F9SA 5BIRA 2P38A 3OV4A 2W9PA 1VQ53 5BU4A 2CX1A 2BU4A 4EW5A 1RCLA 1W6YA 1BRJA 2QIYA 3SYUA 3L0RA
chains in the Genus database with same CATH topology
1UCLA 1RHLA 1B2XA 1JBTA 1RNBA 2BIRA 1B21A 1I2GA 3D4AA 1RMSA 3AGOA 1BAOA 1G02A 1B2SA 1RGAA 3AGNA 1R4YA 1TTOA 1YVSA 2F5WA 1PY3A 1B3SA 4HAAA 2GSPA 4J5KA 5RNTA 1IYYA 1BNSA 1LOYA 3DH2A 1RTUA 1I2FA 1SARA 2KAAA 3HOHA 1RGHA 1GMPA 1UCKA 1X1UA 1GMRA 1GSPA 4J5GA 1RDSA 1FW7A 2AAEA 3URPA 3BIRA 1ZGXA 1I8VA 1BNGA 3GSPA 3D5IA 1RN4A 1TRQA 1BSBA 6RNTA 1RGFA 5HOHA 1LNIA 1B20A 1B2UA 1MGRA 1X1XA 1FYSA 2ZA4A 2F4YA 1BRHA 1I3IA 1Q9EA 1BUJA 1RCKA 1RGKA 4GSPA 1JBSA 1BRGA 1BRIA 1X1WA 3WR2A 1GMQA 2AADA 1BNIA 1BANA 1GOYA 1T2IA 4GHOA 1YNVX 1C54A 1PYLA 1RGCA 5GSPA 1AQZA 3WHOA 1HYFA 1BIRA 1B2ZA 8RNTA 1BRKA 1TRPA 1UCJA 1RN1A 1CH0A 1B2MA 1RNTA 1YGWA 3A5EA 1RGEA 1I0VA 1RGGA 1AY7A 1BRSA 1BSCA 1BVIA 1RSNA 2KF6A 1GOUA 1HZ1A 1I2EA 2HOHA 1BNRA 1BNFA 2KF3A 9RNTA 3Q3FA 1MGWA 4BIRA 3D5GA 3KCHA 1T2HA 3RNTA 1BOXA 1BGSA 1BNJA 1JBRA 1GOVA 3BU4A 3AHWA 1BRNL 1BU4A 7RNTA 2F5MA 2KF4A 4HOHA 7GSPA 1X1YA 1RLSA 4BU4A 1DETA 1I0XA 3AHSA 1BSDA 1BSEA 1FUTA 1I70A 2RBIA 1FZUA 1RGLA 1LRAA 1A2PA 1DE3A 1B27A 3DGYA 1LOWA 2C4BA 1I3FA 2RNTA 1LOVA 5BIRA 4RNTA 5BU4A 2SARA 1BNEA 1FUSA 2F56A 2BU4A 6GSPA 1UCIA 1RCLA 2KF5A 1BRJA 3SYUA 1BSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCL A;  1RHL A;  1B2X A;  1JBT A;  1RNB A;  2BIR A;  1B21 A;  1I2G A;  3D4A A;  1RMS A;  3AGO A;  1BAO A;  1G02 A;  1B2S A;  1RGA A;  3AGN A;  1R4Y A;  1TTO A;  1YVS A;  2F5W A;  1PY3 A;  1B3S A;  4HAA A;  2GSP A;  4J5K A;  5RNT A;  1IYY A;  1BNS A;  1LOY A;  3DH2 A;  1RTU A;  1I2F A;  1SAR A;  2KAA A;  3HOH A;  1RGH A;  1GMP A;  1UCK A;  1X1U A;  1GMR A;  1GSP A;  4J5G A;  1RDS A;  1FW7 A;  2AAE A;  3URP A;  3BIR A;  1ZGX A;  1I8V A;  1BNG A;  3GSP A;  3D5I A;  1RN4 A;  1TRQ A;  1BSB A;  6RNT A;  1RGF A;  5HOH A;  1LNI A;  1B20 A;  1B2U A;  1MGR A;  1X1X A;  1FYS A;  2ZA4 A;  2F4Y A;  1BRH A;  1I3I A;  1Q9E A;  1BUJ A;  1RCK A;  1RGK A;  4GSP A;  1JBS A;  1BRG A;  1BRI A;  1X1W A;  3WR2 A;  1GMQ A;  2AAD A;  1BNI A;  1BAN A;  1GOY A;  1T2I A;  4GHO A;  1YNV X;  1C54 A;  1PYL A;  1RGC A;  5GSP A;  1AQZ A;  3WHO A;  1HYF A;  1BIR A;  1B2Z A;  8RNT A;  1BRK A;  1TRP A;  1UCJ A;  1RN1 A;  1CH0 A;  1B2M A;  1RNT A;  1YGW A;  3A5E A;  1RGE A;  1I0V A;  1RGG A;  1AY7 A;  1BRS A;  1BSC A;  1BVI A;  1RSN A;  2KF6 A;  1GOU A;  1HZ1 A;  1I2E A;  2HOH A;  1BNR A;  1BNF A;  2KF3 A;  9RNT A;  3Q3F A;  1MGW A;  4BIR A;  3D5G A;  3KCH A;  1T2H A;  3RNT A;  1BOX A;  1BGS A;  1BNJ A;  1JBR A;  1GOV A;  3BU4 A;  3AHW A;  1BRN L;  1BU4 A;  7RNT A;  2F5M A;  2KF4 A;  4HOH A;  7GSP A;  1X1Y A;  1RLS A;  4BU4 A;  1DET A;  1I0X A;  3AHS A;  1BSD A;  1BSE A;  1FUT A;  1I70 A;  2RBI A;  1FZU A;  1RGL A;  1LRA A;  1A2P A;  1DE3 A;  1B27 A;  3DGY A;  1LOW A;  2C4B A;  1I3F A;  2RNT A;  1LOV A;  5BIR A;  4RNT A;  5BU4 A;  2SAR A;  1BNE A;  1FUS A;  2F56 A;  2BU4 A;  6GSP A;  1UCI A;  1RCL A;  2KF5 A;  1BRJ A;  3SYU A;  1BSA A; 
#chains in the Genus database with same CATH topology
 1OH0 A;  4IT7 A;  1M1X B;  3DY5 A;  1JBT A;  3D3L A;  1D6Y A;  1DVC A;  2R4I A;  2BIR A;  3K7C A;  1I2G A;  4HZ9 B;  1B2S A;  1N8R 4;  3FH1 A;  1WQL B;  5LC6 A;  4H61 A;  1VQL 3;  1JZD A;  2J8X B;  1O7W B;  2F98 A;  4HAA A;  4K1V A;  3N54 B;  1KWI A;  3CU3 A;  4N6O B;  3V99 A;  3H3H A;  5AIF A;  1GD3 A;  2PZV A;  3DUK A;  1GS3 A;  3OX9 A;  2WGQ A;  2KAA A;  2XRX B;  1QMA A;  3HOH A;  1RGH A;  4CJN A;  2HMM B;  1K9M 4;  2K3D A;  4FCM A;  1OCV A;  2IUK A;  3G0K A;  4J5G A;  1N5H A;  1W01 A;  4HM2 B;  2W56 A;  5EVH A;  1FW7 A;  3CCR 3;  3T8U A;  1TJD A;  1V57 A;  1VQK 3;  1BNG A;  2OWP A;  1UGH I;  5IG4 A;  3GSP A;  3CCV 3;  1AVK A;  1GY7 A;  4HVN A;  1AVL A;  1O7H B;  3IJE B;  2OCT A;  5HOH A;  5IEP A;  3Q1C A;  3K0Z A;  4XDW A;  8CHO A;  5FW5 A;  1FYS A;  3EQQ B;  2C11 A;  2WOF A;  2Y74 A;  3NM2 A;  4LMI A;  3ECF A;  2QGU A;  2OQE A;  3LTB A;  1JNQ A;  3RDE A;  1KC8 4;  4GSP A;  3CD6 3;  3GZY B;  4KFE A;  4RBN A;  4BL2 A;  5JPP A;  2OOV A;  1GMQ A;  2Z6B A;  1S72 3;  3BLZ A;  1O7M B;  4K61 A;  1J2B A;  3U1W A;  1MWS A;  3AMO A;  3EBT A;  3PXM A;  3EBY A;  1NNV A;  2CG0 A;  1QAL A;  1EQK A;  5BVB A;  1N9E A;  3B4P A;  3N9H A;  3CCU 3;  3NXJ A;  1QAK A;  2Z77 A;  5IEN A;  4ILF A;  3CCQ 3;  3MKI A;  4KZ1 A;  1ZO2 A;  4L8P A;  1RNT A;  3ZG0 A;  3SX1 A;  3D9R A;  1RGE A;  3WA2 X;  3LH4 A;  1I0V A;  1BRS A;  2GBX B;  3CC7 3;  3HZP A;  4IIA A;  2Z76 A;  1MWU A;  1RSN A;  3LML A;  1WTH A;  1GOU A;  1D6U A;  1HZ1 A;  1I2E A;  1ULJ B;  2KF6 A;  4FMB A;  3ALA A;  3JUM A;  3KII A;  4XBX A;  3HX8 A;  5AYR B;  3CME 3;  2HOH A;  5ELJ A;  1OF5 A;  1S5A A;  2Z7A A;  3NV0 B;  3GZR A;  3LT8 A;  2W56 B;  3B7C A;  4BIR A;  3D5G A;  4DKI A;  1T2H A;  4EV5 A;  2CW9 A;  3WOF B;  1Q40 A;  3O8Y A;  3VF1 A;  2LQV A;  2CIU A;  1Y4K A;  2CH9 A;  1BU4 A;  2JDI H;  2IUJ A;  4HOH A;  2ZHX B;  3DZL A;  3FG3 A;  4WYK B;  3NQZ A;  4N6N B;  7STD A;  4NPB A;  3DXO A;  3FZW A;  3LTA A;  3OXA A;  1YJN 3;  5EQL A;  2Y73 A;  4FMC A;  4KFD A;  1BSE A;  1JZO A;  4XBT A;  1K73 4;  5M19 A;  5KP1 A;  1AV4 A;  2BHM A;  5AIG A;  5G1K A;  1K8A 4;  1A2P A;  1DE3 A;  2CKF B;  1MOL A;  3CPO A;  4CPK A;  4WWU C;  1K41 A;  2CWV A;  2QEX 3;  1GY6 A;  1ASK A;  3U97 A;  2YFL B;  1Q82 4;  2F86 B;  3TDG A;  2F56 A;  6GSP A;  1UCI A;  3WOD G;  2KF5 A;  3FSD A;  1RHL A;  1BSA A;  2RCD A;  4HBR A;  2B1X B;  1IV9 A;  1VQ6 3;  4EBG A;  1STD A;  3EX9 A;  3SOA A;  1BAO A;  2GU1 A;  4X2H A;  3AGN A;  1GYB A;  5CK6 A;  1YVS A;  3SVA A;  1FUW A;  2GSP A;  1Q86 4;  1Q40 B;  3EN8 A;  1STF I;  2CC3 A;  3FLJ A;  3FG1 A;  4NHF A;  1BNS A;  3DH2 A;  3OW2 2;  5LC7 A;  1I2F A;  1V74 A;  3MHE A;  3EF8 A;  4XM4 A;  4FMD A;  3S29 A;  2FGT A;  3RGA A;  1GMR A;  1GSP A;  4BTX A;  3PS8 A;  2AAE A;  3URP A;  1RJO A;  1JKG A;  1I8V A;  2Q07 A;  3JUQ A;  1MWT A;  3HK4 A;  2P05 A;  1ZS7 A;  2IA7 A;  3D5I A;  5IF6 A;  3G6E 3;  3T8N A;  3M8C A;  5BXQ A;  1AR0 A;  2E2U A;  5AI1 A;  1TUH A;  3B8L A;  1LNI A;  3OWS A;  1B2U A;  3MYT A;  1MWR A;  1W02 A;  4Q53 A;  3STD A;  2FNQ A;  2ZA4 A;  1DMM A;  2GEX A;  3HI7 A;  1UI8 A;  1EEJ A;  1RGK A;  3LT9 A;  1O7N B;  4BL3 A;  3JUO A;  3NBR A;  1DVD A;  1BAN A;  1G0T A;  3I0Y A;  3ROB A;  1T2I A;  3NHX A;  4GHO A;  4HM3 B;  3FG4 A;  3QK9 A;  1RGC A;  5GSP A;  1AQZ A;  1SII A;  3NQY A;  2XFT A;  4O02 B;  1JN5 A;  1HYF A;  2XF3 A;  1LNH A;  1US1 A;  5CF1 A;  2BO9 B;  1LQG C;  3DGM A;  1YHQ 3;  1LQM B;  1CYU A;  3S5C A;  2WO0 A;  1ROV A;  4KT3 B;  1C7H A;  3QRD A;  5AYS C;  1PU4 A;  1F8N A;  3NM7 A;  2XGN A;  4EXR A;  1WNH A;  1OAC A;  3S67 A;  3PGB A;  3DGL A;  3SED A;  5CLK A;  4N6L A;  4HKV B;  9RNT A;  3F40 A;  3H51 A;  4OK0 A;  1FGO A;  1NB3 I;  2CFG A;  4J9A A;  3CNX A;  1BGS A;  5JPU A;  2H0I A;  2W9Q A;  1JBR A;  2R41 A;  4O8S A;  3BU4 A;  2P09 A;  1OGX A;  1IQ8 A;  3B4O A;  3MG3 A;  3K63 A;  4N6T A;  4WHA A;  1BRN L;  1MNL A;  3PYJ A;  2KF4 A;  2INX A;  3UJM A;  1WMO A;  3MG2 A;  4K1U A;  5STD A;  2W0Q A;  3AHS A;  2IY2 A;  3JUP A;  2BT3 A;  1IQY A;  1JB5 A;  2L1S A;  1N8Q A;  1ROA A;  3X41 A;  4ZM8 A;  4J8T A;  4MEI A;  1R4C A;  2RBI A;  3A76 A;  1RGL A;  3DMC A;  3PCS A;  1WMN A;  5AEW B;  1LVN A;  1KD1 4;  4O2H A;  4X2O A;  1LRA A;  4R4K A;  3X3Y A;  4RZM A;  1UUG B;  1VQO 3;  2RNT A;  1SQW A;  3NBB A;  5AII A;  3ER7 A;  1DMN A;  1GY5 A;  3ZG5 A;  4O3V A;  1IU7 A;  2SAR A;  1EG9 B;  2CWT A;  2D1W A;  1BNE A;  1FUS A;  3MG1 A;  5EEO A;  2CHC A;  3HIG A;  3JUN A;  1UCL A;  4LEH A;  1QJG A;  1VQ7 3;  3EE1 A;  2XFS A;  3T0U A;  1B21 A;  3MSO A;  3GWR A;  4L8O A;  3VGN A;  3AGO A;  2K54 A;  2HMJ B;  1TTO A;  1UUV B;  3KZT A;  5CXO A;  3SXX A;  2ML5 A;  4N6M A;  1PY3 A;  3SOY A;  1IVX A;  1NWW A;  3FKA A;  4K90 B;  1IT7 A;  1A2V A;  3G4S 3;  5RNT A;  5KP3 A;  1BUQ A;  4IPB A;  1IYY A;  1CYV A;  1EKM A;  1UW1 A;  3AMO B;  1VQP 3;  1W4N A;  1E3R A;  4L7K A;  3KSE D;  1SAR A;  1A90 A;  1OGZ A;  1LOX A;  2MF7 A;  1DMQ A;  3WMD A;  1GMP A;  4WP5 A;  4N3V A;  4CDL A;  3G71 3;  1UCK A;  1JB4 A;  1IVW A;  4STD A;  1RDS A;  4MMZ B;  1ULI B;  3K9M C;  4GL6 A;  4BTY A;  2F99 A;  1WMP A;  1V58 A;  2ZDJ A;  2XH9 A;  2HMO B;  3Q2P A;  5TGN A;  3G16 A;  4OVM A;  4U13 A;  4PEJ A;  3BNE A;  1UUW B;  3EHC A;  1TRQ A;  3EJV A;  4R1K A;  5M18 A;  3LYG A;  5AEU B;  1W00 A;  1OUN A;  3OWU A;  1OF5 B;  3CCM 3;  1X1X A;  3EB8 A;  2CFK A;  2HML B;  3X3X A;  1JJ2 2;  1BRH A;  1I3I A;  2UGI A;  3BNC A;  5D83 A;  5D81 A;  2CK3 H;  4MMY B;  2L4V A;  1W6C A;  1YIT 3;  2P0M A;  2CFD A;  1X1W A;  3WR2 A;  2YFJ B;  2GEY A;  5IG5 A;  1M90 4;  2IYJ A;  1VQ4 3;  1GOY A;  1A67 A;  4HZB B;  2XSH B;  2JQ5 A;  3FF2 A;  2MC8 A;  2K0M A;  2CG1 A;  2BNG A;  1PYL A;  1TU5 A;  1C54 A;  2W03 A;  3S27 A;  3UB1 A;  1YGE A;  2RGQ A;  1BIR A;  5IG3 A;  1B2Z A;  3J7Y d;  3CCS 3;  3BB9 A;  2CFW A;  3Q90 A;  3ZFZ A;  1Q42 A;  2CWU A;  5ELU A;  1TRP A;  1UCJ A;  1RN1 A;  2B24 B;  3I56 3;  4EV2 A;  1YGW A;  1SIH A;  3A5E A;  4LYL B;  4NRE A;  3NBJ A;  1VQN 3;  1Q81 4;  1RGG A;  1AY7 A;  3EC9 A;  3IPT A;  4LZI A;  4G1M B;  1IT8 A;  4FMA A;  1BVI A;  3GZX B;  4OUQ A;  4HM0 B;  1JV2 B;  2E2V A;  1QVG 2;  1BNR A;  1TIJ A;  2KF3 A;  3Q3F A;  3UL6 A;  1MGW A;  2ML6 A;  4FR9 A;  4HYZ A;  4GB5 A;  3KCH A;  3RNT A;  4R9K A;  1BNJ A;  1GOV A;  1QAF A;  2W6J H;  1NB5 I;  1HU9 A;  1W6G A;  3X42 A;  1EUI C;  2FXT A;  1GD4 A;  1FGR A;  1O7P B;  2CFL A;  2KXG A;  4RNZ A;  4QWT A;  5D82 A;  4WFO A;  7GSP A;  6STD A;  3CMA 3;  4KFF A;  3KSP A;  4I5Q A;  5CF2 A;  5A0O B;  1DET A;  5IG0 A;  1I0X A;  3WA3 A;  1LXE A;  3MWZ A;  3PZW A;  1IVU A;  3CCL 3;  3JVC A;  1E3V A;  3F8X A;  1Z1S A;  2C10 A;  3VSY A;  2OTL 3;  1FZU A;  1PFP A;  1Q7H A;  2A15 A;  5IER A;  1VZZ A;  2BMQ B;  2RSX A;  1VQM 3;  1M1K 4;  2RFR A;  2STD A;  2H0G A;  3D79 A;  4HM4 B;  1FGM A;  2C4B A;  1I3F A;  2UX0 A;  1QVF 2;  2XGL A;  3NUV A;  1JKG B;  3NV0 A;  2W04 A;  4RNT A;  2OQE C;  1SPU A;  4BTW A;  4R80 A;  1KQS 2;  1O7G B;  2OOV C;  4LGQ A;  3RGR A;  3FF0 A;  1B2X A;  1U8C B;  3E99 A;  4H3U A;  5KP4 A;  1RNB A;  1OHS A;  2W2C A;  3D4A A;  1RMS A;  2CX0 A;  3HII A;  1G02 A;  3F8H A;  1RGA A;  4JF8 A;  1R4Y A;  2F5W A;  3CCE 3;  4WYK A;  1RRH A;  1B3S A;  1YVB I;  1NJI 4;  2O3O A;  1NU3 A;  4J5K A;  1ZX2 A;  4EC6 A;  1LOY A;  2IMJ A;  5HGR A;  1RTU A;  1G96 A;  1JN5 B;  2KRT A;  4AKZ A;  3LXU X;  4XB5 A;  1K28 A;  1TFK A;  3V98 A;  4AEQ A;  4TX4 A;  1FA3 A;  2O9U X;  1X1U A;  3PCR A;  3KE7 A;  1FGQ A;  2ZL8 A;  1W2B 2;  3DM8 A;  2YX9 A;  3BIR A;  1ZGX A;  3NX0 A;  1VQ9 3;  2QA4 3;  4MMX B;  1RRL A;  2H0H A;  3UL5 A;  3V92 A;  3CNM A;  1CEW I;  5IEO A;  3FGY A;  2V1L A;  1RN4 A;  4HM8 B;  1IDP A;  1OPY A;  5DRE A;  1BSB A;  1UDI I;  1RGF A;  1RN7 A;  4ORL A;  6RNT A;  1MGR A;  1B20 A;  1E97 A;  3CC4 3;  4N6V 0;  2F4Y A;  4HM7 B;  2D42 A;  2E2T A;  4LSO A;  1T5Y A;  1Q9E A;  4MJD A;  1YIJ 3;  3CXC 2;  5I97 A;  1BUJ A;  1RCK A;  5AIH A;  3LTC A;  1JBS A;  1BRG A;  1BRI A;  3KFQ C;  4FCJ A;  4XBY A;  2AAD A;  1BNI A;  3LZA A;  3CCJ 3;  3F7S A;  4HM1 B;  3X40 A;  1YNV X;  1VQQ A;  1JB2 A;  1IV7 A;  2GXF A;  2XEP A;  2BMO B;  3IMA B;  4KVH A;  5DRV A;  3LTD A;  3WHO A;  1RKY A;  1N5P A;  4XDV A;  2WGO A;  1TFO A;  1OHO A;  4HJL B;  8RNT A;  1HKX A;  1BRK A;  3K5T A;  1SJW A;  1B2M A;  1CH0 A;  1D6Z A;  1L5G B;  1N9J A;  4JRF A;  3GRD A;  1W7C A;  1ISK A;  3SLU A;  2GU3 A;  3OWY A;  3EN1 B;  1Q7Y 4;  3UNL A;  1YJ9 3;  2YFI B;  1BSC A;  3BNB A;  1T3B A;  2PNC A;  3MPH A;  1KSI A;  3FCS B;  1BNF A;  2OTJ 3;  4FCZ A;  3BND A;  1M9G A;  1NO3 A;  2LYX A;  1IVV A;  1CQS A;  1UI7 A;  1BOX A;  1DYU A;  3F14 A;  1YJW 3;  1JRQ A;  1U5O A;  4HM6 B;  4N6U A;  2M7O A;  5G2G A;  3AHW A;  5FGO A;  2SBL A;  3X3Z A;  7RNT A;  1W2Z A;  3WDG B;  2F5M A;  3F7X A;  2BMR B;  5JBS A;  2GBW B;  1X1Y A;  3DGN A;  1RLS A;  5G1L A;  3CPW 2;  1UGI A;  4BU4 A;  1TP6 A;  3CC2 3;  2KCD A;  3LOY A;  4R9L A;  2HMN B;  1OHP A;  3WOE B;  1IK3 A;  4HM5 B;  1BSD A;  1FGT A;  1NDO B;  2XR8 B;  3GAX A;  2XSO B;  1EA2 A;  2UUG C;  2P0X A;  3N8B A;  4EYC A;  2HMK B;  3I55 3;  3G8Z A;  3DGO A;  1FUT A;  4RNY A;  1I70 A;  5M1A A;  3KN4 A;  3S28 A;  1IQX A;  2WOH A;  1YI2 3;  1A2K A;  4I4K A;  1B27 A;  3DGY A;  4AKY A;  5IW9 A;  1LOW A;  4CCV A;  1VQ8 3;  3KKG A;  1W5Z A;  1LOV A;  3GZB A;  2I9W A;  3F9S A;  5BIR A;  2P38 A;  3OV4 A;  2W9P A;  1VQ5 3;  5BU4 A;  2CX1 A;  2BU4 A;  4EW5 A;  1RCL A;  1W6Y A;  1BRJ A;  2QIY A;  3SYU A;  3L0R A; 
#chains in the Genus database with same CATH homology
 1UCL A;  1RHL A;  1B2X A;  1JBT A;  1RNB A;  2BIR A;  1B21 A;  1I2G A;  3D4A A;  1RMS A;  3AGO A;  1BAO A;  1G02 A;  1B2S A;  1RGA A;  3AGN A;  1R4Y A;  1TTO A;  1YVS A;  2F5W A;  1PY3 A;  1B3S A;  4HAA A;  2GSP A;  4J5K A;  5RNT A;  1IYY A;  1BNS A;  1LOY A;  3DH2 A;  1RTU A;  1I2F A;  1SAR A;  2KAA A;  3HOH A;  1RGH A;  1GMP A;  1UCK A;  1X1U A;  1GMR A;  1GSP A;  4J5G A;  1RDS A;  1FW7 A;  2AAE A;  3URP A;  3BIR A;  1ZGX A;  1I8V A;  1BNG A;  3GSP A;  3D5I A;  1RN4 A;  1TRQ A;  1BSB A;  6RNT A;  1RGF A;  5HOH A;  1LNI A;  1B20 A;  1B2U A;  1MGR A;  1X1X A;  1FYS A;  2ZA4 A;  2F4Y A;  1BRH A;  1I3I A;  1Q9E A;  1BUJ A;  1RCK A;  1RGK A;  4GSP A;  1JBS A;  1BRG A;  1BRI A;  1X1W A;  3WR2 A;  1GMQ A;  2AAD A;  1BNI A;  1BAN A;  1GOY A;  1T2I A;  4GHO A;  1YNV X;  1C54 A;  1PYL A;  1RGC A;  5GSP A;  1AQZ A;  3WHO A;  1HYF A;  1BIR A;  1B2Z A;  8RNT A;  1BRK A;  1TRP A;  1UCJ A;  1RN1 A;  1CH0 A;  1B2M A;  1RNT A;  1YGW A;  3A5E A;  1RGE A;  1I0V A;  1RGG A;  1AY7 A;  1BRS A;  1BSC A;  1BVI A;  1RSN A;  2KF6 A;  1GOU A;  1HZ1 A;  1I2E A;  2HOH A;  1BNR A;  1BNF A;  2KF3 A;  9RNT A;  3Q3F A;  1MGW A;  4BIR A;  3D5G A;  3KCH A;  1T2H A;  3RNT A;  1BOX A;  1BGS A;  1BNJ A;  1JBR A;  1GOV A;  3BU4 A;  3AHW A;  1BRN L;  1BU4 A;  7RNT A;  2F5M A;  2KF4 A;  4HOH A;  7GSP A;  1X1Y A;  1RLS A;  4BU4 A;  1DET A;  1I0X A;  3AHS A;  1BSD A;  1BSE A;  1FUT A;  1I70 A;  2RBI A;  1FZU A;  1RGL A;  1LRA A;  1A2P A;  1DE3 A;  1B27 A;  3DGY A;  1LOW A;  2C4B A;  1I3F A;  2RNT A;  1LOV A;  5BIR A;  4RNT A;  5BU4 A;  2SAR A;  1BNE A;  1FUS A;  2F56 A;  2BU4 A;  6GSP A;  1UCI A;  1RCL A;  2KF5 A;  1BRJ A;  3SYU A;  1BSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...