1E3VA

Crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbations of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
total genus 33
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1e3vA00
5D83A 1A2KA 5CXOA 3EX9A 4X2OA 2PZVA 2BMOB 4HM8B 5IG4A 1TP6A 2QGUA 4XBYA 4WWUC 3OV4A 2F98A 4MJDA 4XB5A 3Q90A 3I0YA 2GEXA 1Q40A 4H3UA 1OHPA 3K7CA 3LZAA 2HMMB 4R1KA 2STDA 3B4PA 2HMKB 2HMNB 2R4IA 4GB5A 3CU3A 1E3VA 4XDVA 2F99A 1Q40B 5KP1A 5D82A 5AIFA 5EVHA 4K1UA 3FSDA 1ISKA 1OHSA 4HM3B 1OH0A 4L8OA 4STDA 2INXA 3MYTA 2RFRA 3DXOA 3KE7A 3NV0A 5IEOA 4L7KA 2Z77A 5IG5A 3KZTA 1GY6A 3D9RA 2UX0A 3NV0B 4Q53A 1IDPA 3H51A 3B8LA 3T8UA 4LGQA 2RGQA 1EA2A 1GY5A 5IEPA 2JQ5A 3DZLA 4CDLA 3OWYA 2YFLB 2Z76A 3ROBA 4WYKA 4XBTA 1C7HA 3EC9A 1ASKA 3T8NA 3MG3A 3BLZA 4RZMA 5DREA 3JUOA 3E99A 4WYKB 2Z7AA 3JUQA 3HK4A 5DRVA 4X2HA 3GZBA 4HM7B 4U13A 4HKVB 3NM2A 3HX8A 5CF2A 2YFIB 3JUPA 5JPUA 3RGAA 1UUWB 3G8ZA 3JUMA 2HMOB 3A76A 3FLJA 1S5AA 3VSYA 5IENA 1STDA 4J8TA 1EG9B 5BVBA 3MKIA 5TGNA 4HM2B 3EJVA 5IF6A 3HZPA 5JPPA 3FF0A 3B7CA 2BNGA 5CK6A 4XDWA 3CNMA 5AIHA 5KP3A 3FF2A 3NXJA 1O7HB 4ORLA 3M8CA 3RGRA 4IIAA 2W2CA 1OPYA 5G2GA 1OCVA 3UJMA 3EHCA 1ULIB 6STDA 1JB5A 3B4OA 3IPTA 4K1VA 1ZX2A 5D81A 4J9AA 1OUNA 4OVMA 3GWRA 7STDA 3EN8A 2B24B 1NU3A 4I4KA 2QIYA 1NDOB 2YFJB 1JB2A 3K0ZA 1K41A 3NBRA 4HM1B 3KKGA 4N3VA 2GEYA 3H3HA 1E3RA 4FCJA 2XRXB 3DUKA 3BB9A 3EBTA 3F9SA 3FZWA 4FCMA 3F8XA 1TUHA 1O7NB 1UUVB 4R9KA 5STDA 5CLKA 3OWSA 5AEWB 2GBWB 5CF1A 1GYBA 3NHXA 1O7WB 3G0KA 5IG3A 8CHOA 4LMIA 2B1XB 2XSHB 4L8PA 1E97A 1O7MB 1SJWA 2BMRB 2GXFA 3CNXA 3CPOA 4XM4A 2GBXB 4WP5A 3GZRA 1HKXA 3SEDA 3UNLA 1DMNA 4HZ9B 5IG0A 3GRDA 4HM4B 3KSPA 1DMQA 1BUQA 3DMCA 1W00A 1JN5A 1ULJB 4PEJA 1AR0A 4HZBB 2HMLB 5KP4A 4LEHA 3ECFA 1O7PB 1JN5B 1DMMA 1W6YA 1QMAA 4XBXA 1O7GB 4HM0B 3STDA 3MSOA 1OGZA 3GZYB 2A15A 3MHEA 1VZZA 3WMDA 1Z1SA 2XSOB 3F8HA 2CHCA 2I9WA 1QJGA 3SOAA 3FKAA 3MG2A 4HM5B 4OUQA 5AIIA 2OWPA 1NWWA 1JKGA 1WQLB 3LYGA 2XR8B 3DM8A 3F14A 5AEUB 3EQQB 3JUNA 5BXQA 1JKGB 4HVNA 4KVHA 3NUVA 1W01A 3OWUA 1JB4A 3SOYA 5AIGA 2CKFB 1Q42A 3F40A 5AI1A 3F7SA 2IMJA 3OXAA 3OX9A 2HMJB 3ER7A 3MG1A 3FH1A 4R9LA 3FGYA 4HJLB 2BMQB 1CQSA 5FW5A 1U5OA 3EF8A 1GY7A 1OF5A 1OHOA 3EBYA 3VGNA 2K54A 1ZO2A 3F7XA 4HM6B 1OGXA 1GS3A 5HGRA 3EN1B 1W02A 5IERA 2RCDA 1OF5B 2F86B 3GZXB 3S5CA 3G16A
chains in the Genus database with same CATH superfamily
5D83A 1A2KA 5CXOA 1C54A 3EX9A 2GU1A 4KZ1A 4X2OA 3WA3A 2R41A 1B3SA 2PZVA 2BMOB 4N6UA 4HM8B 4LYLB 2MC8A 5IG4A 3G713 3AHSA 2KXGA 3LH4A 1TP6A 2QGUA 4XBYA 3X42A 4OK0A 4WWUC 3OV4A 2F56A 2OTL3 2CFWA 2W9PA 1IQXA 2F98A 1N9EA 4MJDA 4XB5A 1B27A 1GSPA 3FG4A 3Q90A 2CK3H 3I0YA 2GEXA 3LTAA 3V98A 2Z6BA 3HIGA 3X3XA 1Q40A 4H3UA 1OHPA 3K7CA 3LZAA 1JBRA 2HMMB 4R1KA 1BSBA 2CWVA 2STDA 3B4PA 3UB1A 1TRQA 2HMKB 2HMNB 1N5HA 2R4IA 2D42A 3I553 4EXRA 1I2EA 2E2UA 1TU5A 2UUGC 4KFDA 3DGNA 1X1WA 3CU3A 1E3VA 3PXMA 2IUKA 4GB5A 3KN4A 2F99A 4XDVA 1JZDA 3WDGB 2CW9A 3NQZA 3CC23 1DETA 1CYUA 1Q40B 3PGBA 2ZDJA 1FUTA 1AQZA 1IU7A 2YX9A 5KP1A 5D82A 5AIFA 1EUIC 4K1UA 4LZIA 5EVHA 3V92A 4RNYA 1VQ93 3FSDA 1UI8A 1ISKA 2WOHA 3EB8A 1OHSA 1QAFA 1T5YA 4HM3B 1OH0A 4L8OA 2OCTA 1N8R4 1LXEA 1YGEA 3CD63 4STDA 4HAAA 2INXA 1BRIA 3MYTA 1MOLA 2RFRA 3DXOA 3KE7A 1PYLA 1TJDA 3NV0A 4N6TA 5IEOA 1RN1A 4L7KA 5AYRB 5G1LA 2ML6A 1IK3A 1GD4A 2GSPA 2Z77A 2E2TA 1UDII 3GAXA 3KSED 1D6YA 4O2HA 5IG5A 3KZTA 1UCKA 1U8CB 2RSXA 4LSOA 5BU4A 5AYSC 1T3BA 3CCU3 1BNJA 1GY6A 3D9RA 1IVXA 1QAKA 4IPBA 1QVG2 2BHMA 2UX0A 3NV0B 1N8QA 2CWUA 4J5GA 4Q53A 1HYFA 1IDPA 1W4NA 2BU4A 1KQS2 1I0XA 3H51A 1YJW3 3B8LA 4FMCA 3T8UA 1N5PA 2RGQA 4LGQA 1EA2A 1LOVA 3LTCA 4FMDA 1GY5A 5IEPA 1JBSA 9RNTA 2JQ5A 3BNBA 3DZLA 2OQEC 1I70A 3FG1A 3HIIA 3WOFB 5EEOA 4CDLA 6RNTA 1PU4A 3OWYA 2YFLB 4FCZA 3U97A 2F4YA 1W2ZA 1X1UA 2Z76A 1BNGA 1WNHA 3CCL3 3ROBA 1VQ73 4KFFA 1LVNA 4WYKA 3LXUX 4XBTA 1Y4KA 2FGTA 1UCJA 3UL5A 1BIRA 1IVVA 1C7HA 3EC9A 1ASKA 3T8NA 3MG3A 2Y73A 1M9GA 1IT8A 2UGIA 3BLZA 3HOHA 1FUWA 1EEJA 4RZMA 1VQ63 5DREA 2OTJ3 1DYUA 3JUOA 3LTBA 4O3VA 1BRGA 2BT3A 1RTUA 3K5TA 3E99A 4MMXB 4WHAA 2ML5A 4WYKB 4CPKA 3CME3 1IYYA 1SIIA 3SYUA 2XFSA 1GD3A 2Z7AA 1YJN3 1IVUA 1BNEA 1LOYA 1LOXA 1V57A 2KF6A 3JUQA 3CCM3 3RDEA 2L1SA 3HK4A 1RGGA 2OOVC 5DRVA 4H61A 3SX1A 3AMOB 3EE1A 3KFQC 2XGNA 1D6ZA 1RSNA 4X2HA 3I563 3KIIA 3OW22 2CFLA 2FNQA 1BNSA 2KF4A 3GZBA 1RRHA 1TRPA 3S27A 4HM7B 4U13A 4HKVB 1KD14 3NM2A 5IW9A 1TFOA 3HX8A 3CC73 4HYZA 5CF2A 2SARA 2YFIB 3JUPA 1MNLA 3ALAA 4FMAA 1JV2B 1MWSA 5JPUA 3RGAA 1UUWB 3CCV3 1I2FA 3QRDA 1LRAA 1BNIA 1X1YA 3G8ZA 3JUMA 2HMOB 3A5EA 3A76A 3D5IA 3FLJA 3DH2A 3V99A 1LOWA 1RRLA 1S5AA 3Q2PA 1DVCA 1Q864 4O8SA 1FGTA 3NBBA 4HBRA 3S28A 3VSYA 1RGCA 5IENA 1SQWA 1STDA 4J8TA 4NPBA 7GSPA 1EG9B 1UCIA 1AV4A 4TX4A 1Q7Y4 1RN7A 1V58A 3JVCA 5BVBA 1RCLA 3MKIA 3SVAA 2P0XA 2QA43 1VQ83 2BIRA 5TGNA 2MF7A 1AVLA 4GL6A 4BTXA 1RN4A 4HM2B 2J8XB 2XFTA 1US1A 3EJVA 1BRKA 3RNTA 5IF6A 1BRJA 3HZPA 4N6OB 2C4BA 5JPPA 3G4S3 3FF0A 1M1XB 3B7CA 2V1LA 3X40A 5HOHA 1IT7A 3WHOA 1YNVX 2HOHA 3D5GA 2CX0A 4J5KA 1VQK3 1GMRA 2BNGA 4EBGA 1Q824 1RGAA 1YIJ3 1FW7A 1YVSA 1JRQA 5CK6A 3ZG0A 2CFGA 1R4CA 1FGQA 1B2UA 4BTYA 4XDWA 3CNMA 5AIHA 2D1WA 2CC3A 1GOYA 5KP3A 2H0GA 3FF2A 3WOEB 3X41A 3CC43 5EQLA 3NXJA 3TDGA 4AKZA 1UGIA 5LC6A 2LQVA 3CCS3 1O7HB 4ORLA 3M8CA 3RGRA 1BSEA 1UGHI 3BNDA 4IIAA 3LMLA 2W2CA 1OPYA 3DY5A 1OCVA 5G2GA 3UJMA 1RHLA 2CX1A 1ULIB 3EHCA 6STDA 1JB5A 2O3OA 1LQGC 3AGNA 1FGRA 3B4OA 3IPTA 2CH9A 1BNRA 3SXXA 1BSCA 4K1VA 8RNTA 1A67A 1ZX2A 1KC84 1TFKA 3PCRA 5D81A 2C10A 4J9AA 3WR2A 1AY7A 4ZM8A 1RMSA 1GMQA 1OUNA 4OVMA 1W5ZA 4JRFA 1SPUA 3BU4A 3L0RA 3GWRA 7STDA 3PS8A 3EN8A 4EC6A 2H0HA 1FGOA 1TTOA 1NU3A 1PFPA 2B24B 3AHWA 3T0UA 4GHOA 4RNZA 3VF1A 1RGFA 4N6MA 2QIYA 2RBIA 4I4KA 3QK9A 1W2B2 3LOYA 2GU3A 1UCLA 1NDOB 2YFJB 1JB2A 3K0ZA 1K41A 1T2IA 1IV7A 1RGKA 2W56A 3HI7A 3NBRA 1YHQ3 4HM1B 3KKGA 3Q3FA 4N3VA 3BNCA 2KAAA 4EV2A 2GEYA 3H3HA 1E3RA 4FCJA 2XRXB 3DUKA 1F8NA 3U1WA 1ROVA 6GSPA 1A90A 3DGLA 3BB9A 3EBTA 3F9SA 3FZWA 3IMAB 1RJOA 2IA7A 4ILFA 1VQO3 4MEIA 3CCR3 1YI23 4AEQA 4FCMA 4BU4A 1K9M4 2WGOA 1JJ22 3NBJA 2W56B 2E2VA 1B2SA 3AMOA 2W6JH 2OQEA 3F8XA 4CJNA 1YGWA 3S67A 4EYCA 1TUHA 1O7NB 1VQP3 1UUVB 1D6UA 2H0IA 1BANA 1PY3A 4R9KA 5STDA 3URPA 4BTWA 1KSIA 5CLKA 2W04A 2KRTA 3OWSA 4WFOA 5AEWB 3J7Yd 2Q07A 1BSAA 3N8BA 4RBNA 2GBWB 3CCJ3 5CF1A 1QVF2 1YVBI 3SLUA 1GYBA 4HOHA 3CXC2 3NHXA 1FA3A 1J2BA 1O7WB 4BIRA 1FUSA 1M904 3G0KA 1VQQA 2RNTA 1NNVA 5IG3A 1RNBA 1A2PA 1IQYA 1BAOA 3D3LA 4LMIA 2B1XB 8CHOA 1JNQA 2XSHB 4L8PA 2L4VA 3BNEA 3CMA3 3PYJA 1GOVA 2W0QA 1E97A 1CH0A 1LNIA 1O7MB 1S723 3DGOA 3CCQ3 1MWTA 5BIRA 1NB5I 2KCDA 1GMPA 1SJWA 3K63A 2BMRB 2GXFA 3CNXA 3CPOA 3O8YA 2OOVA 5RNTA 1G0TA 2CWTA 4XM4A 1SIHA 3KCHA 1IVWA 1FYSA 2GBXB 1BRSA 1I2GA 1NB3I 3GZRA 1A2VA 4WP5A 4NHFA 1HKXA 2AADA 3SEDA 3UNLA 1DMNA 4BL3A 4HZ9B 5IG0A 1X1XA 3CCE3 3LTDA 1FZUA 1I0VA 1WMNA 4KT3B 4RNTA 3GRDA 4HM4B 4AKYA 3KSPA 3UL6A 1DMQA 1R4YA 3PCSA 2O9UX 1Q814 4K90B 1B21A 1BUQA 1VQ53 1LQMB 1G96A 3DMCA 1W00A 1SARA 1JN5A 2W03A 1RLSA 1RDSA 2Y74A 3MPHA 1ULJB 4PEJA 1K28A 2FXTA 1AR0A 1BRNL 1HU9A 2CG0A 5GSPA 4HZBB 2HMLB 4MMYB 5KP4A 4LEHA 1RGHA 1BOXA 3IJEB 3ZFZA 1NO3A 1BRHA 1JBTA 1N9JA 3ECFA 1O7PB 2XF3A 3NM7A 2IYJA 1EKMA 4N6V0 3Q1CA 1JN5B 3DGYA 1DMMA 3NQYA 1W6YA 1QMAA 1W7CA 2W9QA 4XBXA 1O7GB 1VQN3 4HM0B 3STDA 1LNHA 3MSOA 1OGZA 3GZYB 1ZS7A 2A15A 3MHEA 1MWRA 1VZZA 4BL2A 3WMDA 2K3DA 3WA2X 4DKIA 4QWTA 1VQ43 5M1AA 3CPW2 2CIUA 1B2MA 2ZA4A 1Z1SA 4JF8A 2SBLA 2XSOB 1V74A 3F8HA 2F5WA 1UUGB 2CHCA 3D4AA 7RNTA 2P38A 1I8VA 2CFDA 4N6LA 1KWIA 1UW1A 2I9WA 3X3YA 1WTHA 1B2XA 2F5MA 1QJGA 3N54B 5I97A 3SOAA 3FKAA 1ROAA 2WGQA 3MG2A 1I3FA 2JDIH 4HM5B 4KFEA 3PZWA 1EQKA 3G6E3 3GSPA 4OUQA 5AIIA 1MGWA 1FGMA 2OWPA 5A0OB 3LT8A 3D79A 4G1MB 1NWWA 1JKGA 1RGLA 1WQLB 3LYGA 1L5GB 3X3ZA 1CYVA 4CCVA 1NJI4 1I3IA 1G02A 2K0MA 2P09A 1VQM3 1IQ8A 2XR8B 3DGMA 2KF5A 2XGLA 1Q7HA 2XH9A 1T2HA 3DM8A 2IY2A 4K61A 1CEWI 3F14A 1BSDA 5ELUA 3WODG 5AEUB 1HZ1A 1BVIA 4R4KA 3EQQB 3JUNA 5LC7A 1AVKA 1JKGB 4HVNA 4KVHA 5BXQA 1M1K4 2C11A 3NUVA 2LYXA 5FGOA 1UI7A 2XEPA 2WOFA 2QEX3 1W01A 3OWUA 1JB4A 2WO0A 5G1KA 4EV5A 2CFKA 3SOYA 1MGRA 1JZOA 4EW5A 3BIRA 1B20A 1VQL3 5AIGA 5JBSA 1GOUA 2CKFB 1Q42A 2KF3A 3F40A 1K734 3FG3A 4NREA 5M18A 5M19A 5AI1A 3F7SA 2AAEA 2IMJA 1OACA 3OX9A 3OXAA 1RGEA 2HMJB 3S29A 1RCKA 1Q9EA 1YJ93 3NX0A 3ER7A 3MG1A 2CG1A 1DVDA 3FH1A 1IV9A 3FCSB 4I5QA 4R9LA 2ZHXB 1K8A4 3ZG5A 4IT7A 3FGYA 4HJLB 1WMOA 2BMQB 1CQSA 1RNTA 2M7OA 1ZGXA 5FW5A 2P05A 1U5OA 3MWZA 3EF8A 1YIT3 2ZL8A 1W6GA 1GY7A 5ELJA 1BNFA 1RKYA 1OF5A 1WMPA 3AGOA 1W6CA 1BUJA 1OHOA 3K9MC 1BU4A 2IUJA 1TIJA 4MMZB 4R80A 3EBYA 1MWUA 3VGNA 1DE3A 4FMBA 2K54A 3N9HA 4FR9A 1ZO2A 4GSPA 3F7XA 4HM6B 3LT9A 1OGXA 1BGSA 4O02B 1B2ZA 1GS3A 1QALA 3EN1B 1W02A 5HGRA 5IERA 2RCDA 1OF5B 2F86B 2BO9B 2PNCA 3GZXB 2P0MA 1STFI 3S5CA 4N6NB 3G16A
chains in the Genus database with same CATH topology
5D83A 1A2KA 5CXOA 3EX9A 2GU1A 4KZ1A 4X2OA 3WA3A 2PZVA 2BMOB 4N6UA 4HM8B 2MC8A 5IG4A 3G713 2KXGA 3LH4A 1TP6A 2QGUA 4XBYA 3X42A 4OK0A 4WWUC 3OV4A 2OTL3 2CFWA 2W9PA 1IQXA 2F98A 1N9EA 4MJDA 4XB5A 3FG4A 3Q90A 2CK3H 3I0YA 2GEXA 3LTAA 3V98A 2Z6BA 3HIGA 3X3XA 1Q40A 4H3UA 1OHPA 3K7CA 3LZAA 2HMMB 4R1KA 3UB1A 2CWVA 2STDA 3B4PA 2HMKB 2HMNB 1N5HA 2R4IA 2D42A 3I553 4EXRA 2E2UA 1TU5A 4KFDA 3DGNA 3CU3A 4GB5A 1E3VA 3PXMA 2IUKA 4XDVA 3KN4A 2F99A 3CXC2 3WDGB 2CW9A 3NQZA 3CC23 1CYUA 1Q40B 3PGBA 2ZDJA 1IU7A 2YX9A 5KP1A 5D82A 5AIFA 5EVHA 4K1UA 4LZIA 1VQ93 3V92A 4RNYA 3FSDA 1UI8A 1ISKA 2WOHA 3EB8A 1OHSA 1QAFA 1T5YA 4HM3B 1OH0A 4L8OA 2OCTA 1N8R4 1LXEA 1YGEA 3CD63 4STDA 2INXA 3MYTA 1MOLA 2RFRA 3DXOA 3KE7A 3NV0A 4N6TA 5IEOA 3G4S3 4L7KA 5AYRB 2ML6A 1IK3A 1GD4A 2Z77A 3GAXA 2E2TA 3KSED 1D6YA 4O2HA 5IG5A 3KZTA 1U8CB 2RSXA 4LSOA 5AYSC 3CCU3 1GY6A 3D9RA 1IVXA 1QAKA 4IPBA 1QVG2 2BHMA 2UX0A 3NV0B 1N8QA 2CWUA 4Q53A 1IDPA 1W4NA 1KQS2 3H51A 1YJW3 3B8LA 4FMCA 3T8UA 1N5PA 2RGQA 4LGQA 1EA2A 3LTCA 4FMDA 1GY5A 5IEPA 2JQ5A 3BNBA 3DZLA 2OQEC 3FG1A 3HIIA 3WOFB 5EEOA 4CDLA 1PU4A 3OWYA 2YFLB 4FCZA 3U97A 1W2ZA 2Z76A 1WNHA 3CCL3 3ROBA 1VQ73 4KFFA 1LVNA 4WYKA 3LXUX 4XBTA 1Y4KA 2FGTA 3UL5A 1IVVA 1C7HA 3EC9A 1ASKA 3T8NA 3MG3A 2Y73A 1M9GA 1IT8A 3BLZA 1FUWA 4RZMA 1VQ63 5DREA 2OTJ3 1DYUA 3JUOA 3LTBA 4O3VA 2BT3A 3K5TA 3E99A 4MMXB 4WHAA 2ML5A 4WYKB 3CME3 1SIIA 2XFSA 1GD3A 2Z7AA 1YJN3 1IVUA 3JUQA 1LOXA 3CCM3 3RDEA 3HK4A 2OOVC 5DRVA 4H61A 3SX1A 3AMOB 3EE1A 3KFQC 2XGNA 1D6ZA 4X2HA 3I563 3KIIA 3OW22 2CFLA 2FNQA 3GZBA 1RRHA 3S27A 4HM7B 4U13A 4HKVB 1KD14 3NM2A 5IW9A 1TFOA 3HX8A 3CC73 4HYZA 5CF2A 2YFIB 3JUPA 1MNLA 3ALAA 4FMAA 1JV2B 5JPUA 3RGAA 1UUWB 3CCV3 3QRDA 3G8ZA 3JUMA 2HMOB 3A76A 3FLJA 3V99A 1Q864 1RRLA 3Q2PA 1S5AA 1DVCA 4O8SA 1FGTA 3NBBA 4HBRA 3S28A 3VSYA 5IENA 1SQWA 1STDA 4J8TA 1EG9B 1AV4A 4TX4A 1Q7Y4 1RN7A 3JVCA 5BVBA 1VQ83 3MKIA 3SVAA 2P0XA 2QA43 5TGNA 2MF7A 1AVLA 4GL6A 4BTXA 4HM2B 2XFTA 1US1A 3EJVA 5IF6A 3HZPA 4N6OB 5JPPA 3FF0A 1M1XB 3B7CA 2V1LA 3X40A 1IT7A 1VQK3 2BNGA 4EBGA 1Q824 1YIJ3 1JRQA 5CK6A 2CFGA 1R4CA 1FGQA 4BTYA 4XDWA 3CNMA 5AIHA 2D1WA 2CC3A 5KP3A 3WOEB 3FF2A 3X41A 3CC43 5EQLA 3NXJA 3TDGA 4AKZA 5LC6A 2LQVA 3CCS3 1O7HB 4ORLA 3M8CA 3RGRA 3BNDA 4IIAA 3LMLA 2W2CA 1OPYA 3DY5A 1OCVA 5G2GA 3UJMA 3EHCA 1ULIB 6STDA 1JB5A 2O3OA 3B4OA 1FGRA 3IPTA 2CH9A 3SXXA 4K1VA 1A67A 1ZX2A 1KC84 1TFKA 3PCRA 5D81A 2C10A 4J9AA 4ZM8A 1OUNA 4OVMA 1W5ZA 4JRFA 1SPUA 3L0RA 3GWRA 7STDA 3PS8A 3EN8A 4EC6A 1FGOA 2B24B 1NU3A 1PFPA 3T0UA 4RNZA 3VF1A 4N6MA 2QIYA 4I4KA 3QK9A 1W2B2 3LOYA 2GU3A 1NDOB 2YFJB 1JB2A 3K0ZA 1K41A 1IV7A 3NBRA 2W56A 3HI7A 1YHQ3 4HM1B 3KKGA 4N3VA 3BNCA 4EV2A 2GEYA 3H3HA 1E3RA 4FCJA 2XRXB 3DUKA 1F8NA 3U1WA 1ROVA 1A90A 3DGLA 3BB9A 3EBTA 3F9SA 3FZWA 3IMAB 1RJOA 2IA7A 1VQO3 1YI23 4MEIA 3CCR3 4AEQA 4FCMA 1K9M4 1JJ22 2WGOA 3NBJA 2W56B 2E2VA 3AMOA 2W6JH 2OQEA 3F8XA 4EYCA 3S67A 1TUHA 1O7NB 1VQP3 1UUVB 1D6UA 4R9KA 5STDA 4BTWA 1KSIA 5CLKA 2W04A 2KRTA 3OWSA 4WFOA 5AEWB 3J7Yd 2Q07A 3N8BA 4RBNA 2GBWB 3CCJ3 5CF1A 1QVF2 1YVBI 3SLUA 1GYBA 3NHXA 1FA3A 1J2BA 1O7WB 1M904 3G0KA 5IG3A 1IQYA 3D3LA 8CHOA 4LMIA 2B1XB 1JNQA 2XSHB 4L8PA 2L4VA 3BNEA 3CMA3 3PYJA 2W0QA 1E97A 1O7MB 1S723 3DGOA 3CCQ3 1NB5I 2KCDA 1SJWA 3K63A 2BMRB 2GXFA 3CNXA 3CPOA 3O8YA 2OOVA 2CWTA 4XM4A 1SIHA 1IVWA 2GBXB 1NB3I 3GZRA 4WP5A 1A2VA 4NHFA 1HKXA 3SEDA 3UNLA 1DMNA 4HZ9B 5IG0A 3CCE3 3LTDA 1WMNA 3GRDA 4HM4B 4AKYA 3KSPA 3UL6A 1DMQA 3PCSA 1Q814 2O9UX 4K90B 1BUQA 1VQ53 1G96A 3DMCA 1W00A 1JN5A 2W03A 2Y74A 3MPHA 1ULJB 4PEJA 2FXTA 1K28A 1AR0A 1HU9A 2CG0A 4HZBB 2HMLB 4MMYB 5KP4A 4LEHA 3IJEB 1NO3A 1N9JA 3ECFA 1O7PB 2XF3A 3NM7A 1EKMA 4N6V0 3Q1CA 1JN5B 1DMMA 3NQYA 1W6YA 1QMAA 1W7CA 2W9QA 4XBXA 1O7GB 1VQN3 4HM0B 3STDA 1LNHA 3MSOA 1OGZA 3GZYB 2A15A 3MHEA 1VZZA 3WMDA 3WA2X 1VQ43 4QWTA 3CPW2 2CIUA 1Z1SA 4JF8A 2SBLA 2XSOB 1V74A 3F8HA 2CHCA 2P38A 2CFDA 4N6LA 1KWIA 1UW1A 2I9WA 3X3YA 1WTHA 1QJGA 3N54B 5I97A 3SOAA 3FKAA 1ROAA 2WGQA 3MG2A 2JDIH 4HM5B 4KFEA 3PZWA 1EQKA 3G6E3 4OUQA 5AIIA 1FGMA 2OWPA 5A0OB 3LT8A 4G1MB 1NWWA 1JKGA 1L5GB 1WQLB 3LYGA 3X3ZA 4CCVA 1CYVA 1NJI4 2K0MA 2P09A 1VQM3 1IQ8A 2XR8B 3DGMA 2XGLA 2XH9A 3DM8A 4K61A 1CEWI 3F14A 5ELUA 3WODG 5AEUB 4R4KA 3EQQB 3JUNA 5LC7A 1AVKA 1JKGB 4HVNA 4KVHA 5BXQA 1M1K4 2C11A 3NUVA 2LYXA 5FGOA 1UI7A 2XEPA 2WOFA 2QEX3 1W01A 3OWUA 1JB4A 2WO0A 4EV5A 2CFKA 3SOYA 1VQL3 5AIGA 5JBSA 2CKFB 1Q42A 3F40A 1K734 3FG3A 4NREA 5AI1A 3F7SA 2IMJA 1OACA 3OX9A 3OXAA 2HMJB 3S29A 1YJ93 3NX0A 3ER7A 3MG1A 2CG1A 1DVDA 3FH1A 1IV9A 3FCSB 4R9LA 1K8A4 4IT7A 3FGYA 4HJLB 1WMOA 2BMQB 1CQSA 2M7OA 5FW5A 2P05A 1U5OA 3MWZA 3EF8A 1YIT3 2ZL8A 1W6GA 1GY7A 5ELJA 1RKYA 1OF5A 1WMPA 1W6CA 1OHOA 3K9MC 2IUJA 1TIJA 4MMZB 4R80A 3EBYA 3VGNA 4FMBA 2K54A 3N9HA 4FR9A 1ZO2A 3F7XA 4HM6B 3LT9A 1OGXA 4O02B 1GS3A 1QALA 3EN1B 1W02A 5HGRA 5IERA 2RCDA 1OF5B 2F86B 2BO9B 2PNCA 3GZXB 2P0MA 1STFI 3S5CA 4N6NB 3G16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D83 A;  1A2K A;  5CXO A;  3EX9 A;  4X2O A;  2PZV A;  2BMO B;  4HM8 B;  5IG4 A;  1TP6 A;  2QGU A;  4XBY A;  4WWU C;  3OV4 A;  2F98 A;  4MJD A;  4XB5 A;  3Q90 A;  3I0Y A;  2GEX A;  1Q40 A;  4H3U A;  1OHP A;  3K7C A;  3LZA A;  2HMM B;  4R1K A;  2STD A;  3B4P A;  2HMK B;  2HMN B;  2R4I A;  4GB5 A;  3CU3 A;  1E3V A;  4XDV A;  2F99 A;  1Q40 B;  5KP1 A;  5D82 A;  5AIF A;  5EVH A;  4K1U A;  3FSD A;  1ISK A;  1OHS A;  4HM3 B;  1OH0 A;  4L8O A;  4STD A;  2INX A;  3MYT A;  2RFR A;  3DXO A;  3KE7 A;  3NV0 A;  5IEO A;  4L7K A;  2Z77 A;  5IG5 A;  3KZT A;  1GY6 A;  3D9R A;  2UX0 A;  3NV0 B;  4Q53 A;  1IDP A;  3H51 A;  3B8L A;  3T8U A;  4LGQ A;  2RGQ A;  1EA2 A;  1GY5 A;  5IEP A;  2JQ5 A;  3DZL A;  4CDL A;  3OWY A;  2YFL B;  2Z76 A;  3ROB A;  4WYK A;  4XBT A;  1C7H A;  3EC9 A;  1ASK A;  3T8N A;  3MG3 A;  3BLZ A;  4RZM A;  5DRE A;  3JUO A;  3E99 A;  4WYK B;  2Z7A A;  3JUQ A;  3HK4 A;  5DRV A;  4X2H A;  3GZB A;  4HM7 B;  4U13 A;  4HKV B;  3NM2 A;  3HX8 A;  5CF2 A;  2YFI B;  3JUP A;  5JPU A;  3RGA A;  1UUW B;  3G8Z A;  3JUM A;  2HMO B;  3A76 A;  3FLJ A;  1S5A A;  3VSY A;  5IEN A;  1STD A;  4J8T A;  1EG9 B;  5BVB A;  3MKI A;  5TGN A;  4HM2 B;  3EJV A;  5IF6 A;  3HZP A;  5JPP A;  3FF0 A;  3B7C A;  2BNG A;  5CK6 A;  4XDW A;  3CNM A;  5AIH A;  5KP3 A;  3FF2 A;  3NXJ A;  1O7H B;  4ORL A;  3M8C A;  3RGR A;  4IIA A;  2W2C A;  1OPY A;  5G2G A;  1OCV A;  3UJM A;  3EHC A;  1ULI B;  6STD A;  1JB5 A;  3B4O A;  3IPT A;  4K1V A;  1ZX2 A;  5D81 A;  4J9A A;  1OUN A;  4OVM A;  3GWR A;  7STD A;  3EN8 A;  2B24 B;  1NU3 A;  4I4K A;  2QIY A;  1NDO B;  2YFJ B;  1JB2 A;  3K0Z A;  1K41 A;  3NBR A;  4HM1 B;  3KKG A;  4N3V A;  2GEY A;  3H3H A;  1E3R A;  4FCJ A;  2XRX B;  3DUK A;  3BB9 A;  3EBT A;  3F9S A;  3FZW A;  4FCM A;  3F8X A;  1TUH A;  1O7N B;  1UUV B;  4R9K A;  5STD A;  5CLK A;  3OWS A;  5AEW B;  2GBW B;  5CF1 A;  1GYB A;  3NHX A;  1O7W B;  3G0K A;  5IG3 A;  8CHO A;  4LMI A;  2B1X B;  2XSH B;  4L8P A;  1E97 A;  1O7M B;  1SJW A;  2BMR B;  2GXF A;  3CNX A;  3CPO A;  4XM4 A;  2GBX B;  4WP5 A;  3GZR A;  1HKX A;  3SED A;  3UNL A;  1DMN A;  4HZ9 B;  5IG0 A;  3GRD A;  4HM4 B;  3KSP A;  1DMQ A;  1BUQ A;  3DMC A;  1W00 A;  1JN5 A;  1ULJ B;  4PEJ A;  1AR0 A;  4HZB B;  2HML B;  5KP4 A;  4LEH A;  3ECF A;  1O7P B;  1JN5 B;  1DMM A;  1W6Y A;  1QMA A;  4XBX A;  1O7G B;  4HM0 B;  3STD A;  3MSO A;  1OGZ A;  3GZY B;  2A15 A;  3MHE A;  1VZZ A;  3WMD A;  1Z1S A;  2XSO B;  3F8H A;  2CHC A;  2I9W A;  1QJG A;  3SOA A;  3FKA A;  3MG2 A;  4HM5 B;  4OUQ A;  5AII A;  2OWP A;  1NWW A;  1JKG A;  1WQL B;  3LYG A;  2XR8 B;  3DM8 A;  3F14 A;  5AEU B;  3EQQ B;  3JUN A;  5BXQ A;  1JKG B;  4HVN A;  4KVH A;  3NUV A;  1W01 A;  3OWU A;  1JB4 A;  3SOY A;  5AIG A;  2CKF B;  1Q42 A;  3F40 A;  5AI1 A;  3F7S A;  2IMJ A;  3OXA A;  3OX9 A;  2HMJ B;  3ER7 A;  3MG1 A;  3FH1 A;  4R9L A;  3FGY A;  4HJL B;  2BMQ B;  1CQS A;  5FW5 A;  1U5O A;  3EF8 A;  1GY7 A;  1OF5 A;  1OHO A;  3EBY A;  3VGN A;  2K54 A;  1ZO2 A;  3F7X A;  4HM6 B;  1OGX A;  1GS3 A;  5HGR A;  3EN1 B;  1W02 A;  5IER A;  2RCD A;  1OF5 B;  2F86 B;  3GZX B;  3S5C A;  3G16 A; 
#chains in the Genus database with same CATH topology
 5D83 A;  1A2K A;  5CXO A;  1C54 A;  3EX9 A;  2GU1 A;  4KZ1 A;  4X2O A;  3WA3 A;  2R41 A;  1B3S A;  2PZV A;  2BMO B;  4N6U A;  4HM8 B;  4LYL B;  2MC8 A;  5IG4 A;  3G71 3;  3AHS A;  2KXG A;  3LH4 A;  1TP6 A;  2QGU A;  4XBY A;  3X42 A;  4OK0 A;  4WWU C;  3OV4 A;  2F56 A;  2OTL 3;  2CFW A;  2W9P A;  1IQX A;  2F98 A;  1N9E A;  4MJD A;  4XB5 A;  1B27 A;  1GSP A;  3FG4 A;  3Q90 A;  2CK3 H;  3I0Y A;  2GEX A;  3LTA A;  3V98 A;  2Z6B A;  3HIG A;  3X3X A;  1Q40 A;  4H3U A;  1OHP A;  3K7C A;  3LZA A;  1JBR A;  2HMM B;  4R1K A;  1BSB A;  2CWV A;  2STD A;  3B4P A;  3UB1 A;  1TRQ A;  2HMK B;  2HMN B;  1N5H A;  2R4I A;  2D42 A;  3I55 3;  4EXR A;  1I2E A;  2E2U A;  1TU5 A;  2UUG C;  4KFD A;  3DGN A;  1X1W A;  3CU3 A;  1E3V A;  3PXM A;  2IUK A;  4GB5 A;  3KN4 A;  2F99 A;  4XDV A;  1JZD A;  3WDG B;  2CW9 A;  3NQZ A;  3CC2 3;  1DET A;  1CYU A;  1Q40 B;  3PGB A;  2ZDJ A;  1FUT A;  1AQZ A;  1IU7 A;  2YX9 A;  5KP1 A;  5D82 A;  5AIF A;  1EUI C;  4K1U A;  4LZI A;  5EVH A;  3V92 A;  4RNY A;  1VQ9 3;  3FSD A;  1UI8 A;  1ISK A;  2WOH A;  3EB8 A;  1OHS A;  1QAF A;  1T5Y A;  4HM3 B;  1OH0 A;  4L8O A;  2OCT A;  1N8R 4;  1LXE A;  1YGE A;  3CD6 3;  4STD A;  4HAA A;  2INX A;  1BRI A;  3MYT A;  1MOL A;  2RFR A;  3DXO A;  3KE7 A;  1PYL A;  1TJD A;  3NV0 A;  4N6T A;  5IEO A;  1RN1 A;  4L7K A;  5AYR B;  5G1L A;  2ML6 A;  1IK3 A;  1GD4 A;  2GSP A;  2Z77 A;  2E2T A;  1UDI I;  3GAX A;  3KSE D;  1D6Y A;  4O2H A;  5IG5 A;  3KZT A;  1UCK A;  1U8C B;  2RSX A;  4LSO A;  5BU4 A;  5AYS C;  1T3B A;  3CCU 3;  1BNJ A;  1GY6 A;  3D9R A;  1IVX A;  1QAK A;  4IPB A;  1QVG 2;  2BHM A;  2UX0 A;  3NV0 B;  1N8Q A;  2CWU A;  4J5G A;  4Q53 A;  1HYF A;  1IDP A;  1W4N A;  2BU4 A;  1KQS 2;  1I0X A;  3H51 A;  1YJW 3;  3B8L A;  4FMC A;  3T8U A;  1N5P A;  2RGQ A;  4LGQ A;  1EA2 A;  1LOV A;  3LTC A;  4FMD A;  1GY5 A;  5IEP A;  1JBS A;  9RNT A;  2JQ5 A;  3BNB A;  3DZL A;  2OQE C;  1I70 A;  3FG1 A;  3HII A;  3WOF B;  5EEO A;  4CDL A;  6RNT A;  1PU4 A;  3OWY A;  2YFL B;  4FCZ A;  3U97 A;  2F4Y A;  1W2Z A;  1X1U A;  2Z76 A;  1BNG A;  1WNH A;  3CCL 3;  3ROB A;  1VQ7 3;  4KFF A;  1LVN A;  4WYK A;  3LXU X;  4XBT A;  1Y4K A;  2FGT A;  1UCJ A;  3UL5 A;  1BIR A;  1IVV A;  1C7H A;  3EC9 A;  1ASK A;  3T8N A;  3MG3 A;  2Y73 A;  1M9G A;  1IT8 A;  2UGI A;  3BLZ A;  3HOH A;  1FUW A;  1EEJ A;  4RZM A;  1VQ6 3;  5DRE A;  2OTJ 3;  1DYU A;  3JUO A;  3LTB A;  4O3V A;  1BRG A;  2BT3 A;  1RTU A;  3K5T A;  3E99 A;  4MMX B;  4WHA A;  2ML5 A;  4WYK B;  4CPK A;  3CME 3;  1IYY A;  1SII A;  3SYU A;  2XFS A;  1GD3 A;  2Z7A A;  1YJN 3;  1IVU A;  1BNE A;  1LOY A;  1LOX A;  1V57 A;  2KF6 A;  3JUQ A;  3CCM 3;  3RDE A;  2L1S A;  3HK4 A;  1RGG A;  2OOV C;  5DRV A;  4H61 A;  3SX1 A;  3AMO B;  3EE1 A;  3KFQ C;  2XGN A;  1D6Z A;  1RSN A;  4X2H A;  3I56 3;  3KII A;  3OW2 2;  2CFL A;  2FNQ A;  1BNS A;  2KF4 A;  3GZB A;  1RRH A;  1TRP A;  3S27 A;  4HM7 B;  4U13 A;  4HKV B;  1KD1 4;  3NM2 A;  5IW9 A;  1TFO A;  3HX8 A;  3CC7 3;  4HYZ A;  5CF2 A;  2SAR A;  2YFI B;  3JUP A;  1MNL A;  3ALA A;  4FMA A;  1JV2 B;  1MWS A;  5JPU A;  3RGA A;  1UUW B;  3CCV 3;  1I2F A;  3QRD A;  1LRA A;  1BNI A;  1X1Y A;  3G8Z A;  3JUM A;  2HMO B;  3A5E A;  3A76 A;  3D5I A;  3FLJ A;  3DH2 A;  3V99 A;  1LOW A;  1RRL A;  1S5A A;  3Q2P A;  1DVC A;  1Q86 4;  4O8S A;  1FGT A;  3NBB A;  4HBR A;  3S28 A;  3VSY A;  1RGC A;  5IEN A;  1SQW A;  1STD A;  4J8T A;  4NPB A;  7GSP A;  1EG9 B;  1UCI A;  1AV4 A;  4TX4 A;  1Q7Y 4;  1RN7 A;  1V58 A;  3JVC A;  5BVB A;  1RCL A;  3MKI A;  3SVA A;  2P0X A;  2QA4 3;  1VQ8 3;  2BIR A;  5TGN A;  2MF7 A;  1AVL A;  4GL6 A;  4BTX A;  1RN4 A;  4HM2 B;  2J8X B;  2XFT A;  1US1 A;  3EJV A;  1BRK A;  3RNT A;  5IF6 A;  1BRJ A;  3HZP A;  4N6O B;  2C4B A;  5JPP A;  3G4S 3;  3FF0 A;  1M1X B;  3B7C A;  2V1L A;  3X40 A;  5HOH A;  1IT7 A;  3WHO A;  1YNV X;  2HOH A;  3D5G A;  2CX0 A;  4J5K A;  1VQK 3;  1GMR A;  2BNG A;  4EBG A;  1Q82 4;  1RGA A;  1YIJ 3;  1FW7 A;  1YVS A;  1JRQ A;  5CK6 A;  3ZG0 A;  2CFG A;  1R4C A;  1FGQ A;  1B2U A;  4BTY A;  4XDW A;  3CNM A;  5AIH A;  2D1W A;  2CC3 A;  1GOY A;  5KP3 A;  2H0G A;  3FF2 A;  3WOE B;  3X41 A;  3CC4 3;  5EQL A;  3NXJ A;  3TDG A;  4AKZ A;  1UGI A;  5LC6 A;  2LQV A;  3CCS 3;  1O7H B;  4ORL A;  3M8C A;  3RGR A;  1BSE A;  1UGH I;  3BND A;  4IIA A;  3LML A;  2W2C A;  1OPY A;  3DY5 A;  1OCV A;  5G2G A;  3UJM A;  1RHL A;  2CX1 A;  1ULI B;  3EHC A;  6STD A;  1JB5 A;  2O3O A;  1LQG C;  3AGN A;  1FGR A;  3B4O A;  3IPT A;  2CH9 A;  1BNR A;  3SXX A;  1BSC A;  4K1V A;  8RNT A;  1A67 A;  1ZX2 A;  1KC8 4;  1TFK A;  3PCR A;  5D81 A;  2C10 A;  4J9A A;  3WR2 A;  1AY7 A;  4ZM8 A;  1RMS A;  1GMQ A;  1OUN A;  4OVM A;  1W5Z A;  4JRF A;  1SPU A;  3BU4 A;  3L0R A;  3GWR A;  7STD A;  3PS8 A;  3EN8 A;  4EC6 A;  2H0H A;  1FGO A;  1TTO A;  1NU3 A;  1PFP A;  2B24 B;  3AHW A;  3T0U A;  4GHO A;  4RNZ A;  3VF1 A;  1RGF A;  4N6M A;  2QIY A;  2RBI A;  4I4K A;  3QK9 A;  1W2B 2;  3LOY A;  2GU3 A;  1UCL A;  1NDO B;  2YFJ B;  1JB2 A;  3K0Z A;  1K41 A;  1T2I A;  1IV7 A;  1RGK A;  2W56 A;  3HI7 A;  3NBR A;  1YHQ 3;  4HM1 B;  3KKG A;  3Q3F A;  4N3V A;  3BNC A;  2KAA A;  4EV2 A;  2GEY A;  3H3H A;  1E3R A;  4FCJ A;  2XRX B;  3DUK A;  1F8N A;  3U1W A;  1ROV A;  6GSP A;  1A90 A;  3DGL A;  3BB9 A;  3EBT A;  3F9S A;  3FZW A;  3IMA B;  1RJO A;  2IA7 A;  4ILF A;  1VQO 3;  4MEI A;  3CCR 3;  1YI2 3;  4AEQ A;  4FCM A;  4BU4 A;  1K9M 4;  2WGO A;  1JJ2 2;  3NBJ A;  2W56 B;  2E2V A;  1B2S A;  3AMO A;  2W6J H;  2OQE A;  3F8X A;  4CJN A;  1YGW A;  3S67 A;  4EYC A;  1TUH A;  1O7N B;  1VQP 3;  1UUV B;  1D6U A;  2H0I A;  1BAN A;  1PY3 A;  4R9K A;  5STD A;  3URP A;  4BTW A;  1KSI A;  5CLK A;  2W04 A;  2KRT A;  3OWS A;  4WFO A;  5AEW B;  3J7Y d;  2Q07 A;  1BSA A;  3N8B A;  4RBN A;  2GBW B;  3CCJ 3;  5CF1 A;  1QVF 2;  1YVB I;  3SLU A;  1GYB A;  4HOH A;  3CXC 2;  3NHX A;  1FA3 A;  1J2B A;  1O7W B;  4BIR A;  1FUS A;  1M90 4;  3G0K A;  1VQQ A;  2RNT A;  1NNV A;  5IG3 A;  1RNB A;  1A2P A;  1IQY A;  1BAO A;  3D3L A;  4LMI A;  2B1X B;  8CHO A;  1JNQ A;  2XSH B;  4L8P A;  2L4V A;  3BNE A;  3CMA 3;  3PYJ A;  1GOV A;  2W0Q A;  1E97 A;  1CH0 A;  1LNI A;  1O7M B;  1S72 3;  3DGO A;  3CCQ 3;  1MWT A;  5BIR A;  1NB5 I;  2KCD A;  1GMP A;  1SJW A;  3K63 A;  2BMR B;  2GXF A;  3CNX A;  3CPO A;  3O8Y A;  2OOV A;  5RNT A;  1G0T A;  2CWT A;  4XM4 A;  1SIH A;  3KCH A;  1IVW A;  1FYS A;  2GBX B;  1BRS A;  1I2G A;  1NB3 I;  3GZR A;  1A2V A;  4WP5 A;  4NHF A;  1HKX A;  2AAD A;  3SED A;  3UNL A;  1DMN A;  4BL3 A;  4HZ9 B;  5IG0 A;  1X1X A;  3CCE 3;  3LTD A;  1FZU A;  1I0V A;  1WMN A;  4KT3 B;  4RNT A;  3GRD A;  4HM4 B;  4AKY A;  3KSP A;  3UL6 A;  1DMQ A;  1R4Y A;  3PCS A;  2O9U X;  1Q81 4;  4K90 B;  1B21 A;  1BUQ A;  1VQ5 3;  1LQM B;  1G96 A;  3DMC A;  1W00 A;  1SAR A;  1JN5 A;  2W03 A;  1RLS A;  1RDS A;  2Y74 A;  3MPH A;  1ULJ B;  4PEJ A;  1K28 A;  2FXT A;  1AR0 A;  1BRN L;  1HU9 A;  2CG0 A;  5GSP A;  4HZB B;  2HML B;  4MMY B;  5KP4 A;  4LEH A;  1RGH A;  1BOX A;  3IJE B;  3ZFZ A;  1NO3 A;  1BRH A;  1JBT A;  1N9J A;  3ECF A;  1O7P B;  2XF3 A;  3NM7 A;  2IYJ A;  1EKM A;  4N6V 0;  3Q1C A;  1JN5 B;  3DGY A;  1DMM A;  3NQY A;  1W6Y A;  1QMA A;  1W7C A;  2W9Q A;  4XBX A;  1O7G B;  1VQN 3;  4HM0 B;  3STD A;  1LNH A;  3MSO A;  1OGZ A;  3GZY B;  1ZS7 A;  2A15 A;  3MHE A;  1MWR A;  1VZZ A;  4BL2 A;  3WMD A;  2K3D A;  3WA2 X;  4DKI A;  4QWT A;  1VQ4 3;  5M1A A;  3CPW 2;  2CIU A;  1B2M A;  2ZA4 A;  1Z1S A;  4JF8 A;  2SBL A;  2XSO B;  1V74 A;  3F8H A;  2F5W A;  1UUG B;  2CHC A;  3D4A A;  7RNT A;  2P38 A;  1I8V A;  2CFD A;  4N6L A;  1KWI A;  1UW1 A;  2I9W A;  3X3Y A;  1WTH A;  1B2X A;  2F5M A;  1QJG A;  3N54 B;  5I97 A;  3SOA A;  3FKA A;  1ROA A;  2WGQ A;  3MG2 A;  1I3F A;  2JDI H;  4HM5 B;  4KFE A;  3PZW A;  1EQK A;  3G6E 3;  3GSP A;  4OUQ A;  5AII A;  1MGW A;  1FGM A;  2OWP A;  5A0O B;  3LT8 A;  3D79 A;  4G1M B;  1NWW A;  1JKG A;  1RGL A;  1WQL B;  3LYG A;  1L5G B;  3X3Z A;  1CYV A;  4CCV A;  1NJI 4;  1I3I A;  1G02 A;  2K0M A;  2P09 A;  1VQM 3;  1IQ8 A;  2XR8 B;  3DGM A;  2KF5 A;  2XGL A;  1Q7H A;  2XH9 A;  1T2H A;  3DM8 A;  2IY2 A;  4K61 A;  1CEW I;  3F14 A;  1BSD A;  5ELU A;  3WOD G;  5AEU B;  1HZ1 A;  1BVI A;  4R4K A;  3EQQ B;  3JUN A;  5LC7 A;  1AVK A;  1JKG B;  4HVN A;  4KVH A;  5BXQ A;  1M1K 4;  2C11 A;  3NUV A;  2LYX A;  5FGO A;  1UI7 A;  2XEP A;  2WOF A;  2QEX 3;  1W01 A;  3OWU A;  1JB4 A;  2WO0 A;  5G1K A;  4EV5 A;  2CFK A;  3SOY A;  1MGR A;  1JZO A;  4EW5 A;  3BIR A;  1B20 A;  1VQL 3;  5AIG A;  5JBS A;  1GOU A;  2CKF B;  1Q42 A;  2KF3 A;  3F40 A;  1K73 4;  3FG3 A;  4NRE A;  5M18 A;  5M19 A;  5AI1 A;  3F7S A;  2AAE A;  2IMJ A;  1OAC A;  3OX9 A;  3OXA A;  1RGE A;  2HMJ B;  3S29 A;  1RCK A;  1Q9E A;  1YJ9 3;  3NX0 A;  3ER7 A;  3MG1 A;  2CG1 A;  1DVD A;  3FH1 A;  1IV9 A;  3FCS B;  4I5Q A;  4R9L A;  2ZHX B;  1K8A 4;  3ZG5 A;  4IT7 A;  3FGY A;  4HJL B;  1WMO A;  2BMQ B;  1CQS A;  1RNT A;  2M7O A;  1ZGX A;  5FW5 A;  2P05 A;  1U5O A;  3MWZ A;  3EF8 A;  1YIT 3;  2ZL8 A;  1W6G A;  1GY7 A;  5ELJ A;  1BNF A;  1RKY A;  1OF5 A;  1WMP A;  3AGO A;  1W6C A;  1BUJ A;  1OHO A;  3K9M C;  1BU4 A;  2IUJ A;  1TIJ A;  4MMZ B;  4R80 A;  3EBY A;  1MWU A;  3VGN A;  1DE3 A;  4FMB A;  2K54 A;  3N9H A;  4FR9 A;  1ZO2 A;  4GSP A;  3F7X A;  4HM6 B;  3LT9 A;  1OGX A;  1BGS A;  4O02 B;  1B2Z A;  1GS3 A;  1QAL A;  3EN1 B;  1W02 A;  5HGR A;  5IER A;  2RCD A;  1OF5 B;  2F86 B;  2BO9 B;  2PNC A;  3GZX B;  2P0M A;  1STF I;  3S5C A;  4N6N B;  3G16 A; 
#chains in the Genus database with same CATH homology
 5D83 A;  1A2K A;  5CXO A;  3EX9 A;  2GU1 A;  4KZ1 A;  4X2O A;  3WA3 A;  2PZV A;  2BMO B;  4N6U A;  4HM8 B;  2MC8 A;  5IG4 A;  3G71 3;  2KXG A;  3LH4 A;  1TP6 A;  2QGU A;  4XBY A;  3X42 A;  4OK0 A;  4WWU C;  3OV4 A;  2OTL 3;  2CFW A;  2W9P A;  1IQX A;  2F98 A;  1N9E A;  4MJD A;  4XB5 A;  3FG4 A;  3Q90 A;  2CK3 H;  3I0Y A;  2GEX A;  3LTA A;  3V98 A;  2Z6B A;  3HIG A;  3X3X A;  1Q40 A;  4H3U A;  1OHP A;  3K7C A;  3LZA A;  2HMM B;  4R1K A;  3UB1 A;  2CWV A;  2STD A;  3B4P A;  2HMK B;  2HMN B;  1N5H A;  2R4I A;  2D42 A;  3I55 3;  4EXR A;  2E2U A;  1TU5 A;  4KFD A;  3DGN A;  3CU3 A;  4GB5 A;  1E3V A;  3PXM A;  2IUK A;  4XDV A;  3KN4 A;  2F99 A;  3CXC 2;  3WDG B;  2CW9 A;  3NQZ A;  3CC2 3;  1CYU A;  1Q40 B;  3PGB A;  2ZDJ A;  1IU7 A;  2YX9 A;  5KP1 A;  5D82 A;  5AIF A;  5EVH A;  4K1U A;  4LZI A;  1VQ9 3;  3V92 A;  4RNY A;  3FSD A;  1UI8 A;  1ISK A;  2WOH A;  3EB8 A;  1OHS A;  1QAF A;  1T5Y A;  4HM3 B;  1OH0 A;  4L8O A;  2OCT A;  1N8R 4;  1LXE A;  1YGE A;  3CD6 3;  4STD A;  2INX A;  3MYT A;  1MOL A;  2RFR A;  3DXO A;  3KE7 A;  3NV0 A;  4N6T A;  5IEO A;  3G4S 3;  4L7K A;  5AYR B;  2ML6 A;  1IK3 A;  1GD4 A;  2Z77 A;  3GAX A;  2E2T A;  3KSE D;  1D6Y A;  4O2H A;  5IG5 A;  3KZT A;  1U8C B;  2RSX A;  4LSO A;  5AYS C;  3CCU 3;  1GY6 A;  3D9R A;  1IVX A;  1QAK A;  4IPB A;  1QVG 2;  2BHM A;  2UX0 A;  3NV0 B;  1N8Q A;  2CWU A;  4Q53 A;  1IDP A;  1W4N A;  1KQS 2;  3H51 A;  1YJW 3;  3B8L A;  4FMC A;  3T8U A;  1N5P A;  2RGQ A;  4LGQ A;  1EA2 A;  3LTC A;  4FMD A;  1GY5 A;  5IEP A;  2JQ5 A;  3BNB A;  3DZL A;  2OQE C;  3FG1 A;  3HII A;  3WOF B;  5EEO A;  4CDL A;  1PU4 A;  3OWY A;  2YFL B;  4FCZ A;  3U97 A;  1W2Z A;  2Z76 A;  1WNH A;  3CCL 3;  3ROB A;  1VQ7 3;  4KFF A;  1LVN A;  4WYK A;  3LXU X;  4XBT A;  1Y4K A;  2FGT A;  3UL5 A;  1IVV A;  1C7H A;  3EC9 A;  1ASK A;  3T8N A;  3MG3 A;  2Y73 A;  1M9G A;  1IT8 A;  3BLZ A;  1FUW A;  4RZM A;  1VQ6 3;  5DRE A;  2OTJ 3;  1DYU A;  3JUO A;  3LTB A;  4O3V A;  2BT3 A;  3K5T A;  3E99 A;  4MMX B;  4WHA A;  2ML5 A;  4WYK B;  3CME 3;  1SII A;  2XFS A;  1GD3 A;  2Z7A A;  1YJN 3;  1IVU A;  3JUQ A;  1LOX A;  3CCM 3;  3RDE A;  3HK4 A;  2OOV C;  5DRV A;  4H61 A;  3SX1 A;  3AMO B;  3EE1 A;  3KFQ C;  2XGN A;  1D6Z A;  4X2H A;  3I56 3;  3KII A;  3OW2 2;  2CFL A;  2FNQ A;  3GZB A;  1RRH A;  3S27 A;  4HM7 B;  4U13 A;  4HKV B;  1KD1 4;  3NM2 A;  5IW9 A;  1TFO A;  3HX8 A;  3CC7 3;  4HYZ A;  5CF2 A;  2YFI B;  3JUP A;  1MNL A;  3ALA A;  4FMA A;  1JV2 B;  5JPU A;  3RGA A;  1UUW B;  3CCV 3;  3QRD A;  3G8Z A;  3JUM A;  2HMO B;  3A76 A;  3FLJ A;  3V99 A;  1Q86 4;  1RRL A;  3Q2P A;  1S5A A;  1DVC A;  4O8S A;  1FGT A;  3NBB A;  4HBR A;  3S28 A;  3VSY A;  5IEN A;  1SQW A;  1STD A;  4J8T A;  1EG9 B;  1AV4 A;  4TX4 A;  1Q7Y 4;  1RN7 A;  3JVC A;  5BVB A;  1VQ8 3;  3MKI A;  3SVA A;  2P0X A;  2QA4 3;  5TGN A;  2MF7 A;  1AVL A;  4GL6 A;  4BTX A;  4HM2 B;  2XFT A;  1US1 A;  3EJV A;  5IF6 A;  3HZP A;  4N6O B;  5JPP A;  3FF0 A;  1M1X B;  3B7C A;  2V1L A;  3X40 A;  1IT7 A;  1VQK 3;  2BNG A;  4EBG A;  1Q82 4;  1YIJ 3;  1JRQ A;  5CK6 A;  2CFG A;  1R4C A;  1FGQ A;  4BTY A;  4XDW A;  3CNM A;  5AIH A;  2D1W A;  2CC3 A;  5KP3 A;  3WOE B;  3FF2 A;  3X41 A;  3CC4 3;  5EQL A;  3NXJ A;  3TDG A;  4AKZ A;  5LC6 A;  2LQV A;  3CCS 3;  1O7H B;  4ORL A;  3M8C A;  3RGR A;  3BND A;  4IIA A;  3LML A;  2W2C A;  1OPY A;  3DY5 A;  1OCV A;  5G2G A;  3UJM A;  3EHC A;  1ULI B;  6STD A;  1JB5 A;  2O3O A;  3B4O A;  1FGR A;  3IPT A;  2CH9 A;  3SXX A;  4K1V A;  1A67 A;  1ZX2 A;  1KC8 4;  1TFK A;  3PCR A;  5D81 A;  2C10 A;  4J9A A;  4ZM8 A;  1OUN A;  4OVM A;  1W5Z A;  4JRF A;  1SPU A;  3L0R A;  3GWR A;  7STD A;  3PS8 A;  3EN8 A;  4EC6 A;  1FGO A;  2B24 B;  1NU3 A;  1PFP A;  3T0U A;  4RNZ A;  3VF1 A;  4N6M A;  2QIY A;  4I4K A;  3QK9 A;  1W2B 2;  3LOY A;  2GU3 A;  1NDO B;  2YFJ B;  1JB2 A;  3K0Z A;  1K41 A;  1IV7 A;  3NBR A;  2W56 A;  3HI7 A;  1YHQ 3;  4HM1 B;  3KKG A;  4N3V A;  3BNC A;  4EV2 A;  2GEY A;  3H3H A;  1E3R A;  4FCJ A;  2XRX B;  3DUK A;  1F8N A;  3U1W A;  1ROV A;  1A90 A;  3DGL A;  3BB9 A;  3EBT A;  3F9S A;  3FZW A;  3IMA B;  1RJO A;  2IA7 A;  1VQO 3;  1YI2 3;  4MEI A;  3CCR 3;  4AEQ A;  4FCM A;  1K9M 4;  1JJ2 2;  2WGO A;  3NBJ A;  2W56 B;  2E2V A;  3AMO A;  2W6J H;  2OQE A;  3F8X A;  4EYC A;  3S67 A;  1TUH A;  1O7N B;  1VQP 3;  1UUV B;  1D6U A;  4R9K A;  5STD A;  4BTW A;  1KSI A;  5CLK A;  2W04 A;  2KRT A;  3OWS A;  4WFO A;  5AEW B;  3J7Y d;  2Q07 A;  3N8B A;  4RBN A;  2GBW B;  3CCJ 3;  5CF1 A;  1QVF 2;  1YVB I;  3SLU A;  1GYB A;  3NHX A;  1FA3 A;  1J2B A;  1O7W B;  1M90 4;  3G0K A;  5IG3 A;  1IQY A;  3D3L A;  8CHO A;  4LMI A;  2B1X B;  1JNQ A;  2XSH B;  4L8P A;  2L4V A;  3BNE A;  3CMA 3;  3PYJ A;  2W0Q A;  1E97 A;  1O7M B;  1S72 3;  3DGO A;  3CCQ 3;  1NB5 I;  2KCD A;  1SJW A;  3K63 A;  2BMR B;  2GXF A;  3CNX A;  3CPO A;  3O8Y A;  2OOV A;  2CWT A;  4XM4 A;  1SIH A;  1IVW A;  2GBX B;  1NB3 I;  3GZR A;  4WP5 A;  1A2V A;  4NHF A;  1HKX A;  3SED A;  3UNL A;  1DMN A;  4HZ9 B;  5IG0 A;  3CCE 3;  3LTD A;  1WMN A;  3GRD A;  4HM4 B;  4AKY A;  3KSP A;  3UL6 A;  1DMQ A;  3PCS A;  1Q81 4;  2O9U X;  4K90 B;  1BUQ A;  1VQ5 3;  1G96 A;  3DMC A;  1W00 A;  1JN5 A;  2W03 A;  2Y74 A;  3MPH A;  1ULJ B;  4PEJ A;  2FXT A;  1K28 A;  1AR0 A;  1HU9 A;  2CG0 A;  4HZB B;  2HML B;  4MMY B;  5KP4 A;  4LEH A;  3IJE B;  1NO3 A;  1N9J A;  3ECF A;  1O7P B;  2XF3 A;  3NM7 A;  1EKM A;  4N6V 0;  3Q1C A;  1JN5 B;  1DMM A;  3NQY A;  1W6Y A;  1QMA A;  1W7C A;  2W9Q A;  4XBX A;  1O7G B;  1VQN 3;  4HM0 B;  3STD A;  1LNH A;  3MSO A;  1OGZ A;  3GZY B;  2A15 A;  3MHE A;  1VZZ A;  3WMD A;  3WA2 X;  1VQ4 3;  4QWT A;  3CPW 2;  2CIU A;  1Z1S A;  4JF8 A;  2SBL A;  2XSO B;  1V74 A;  3F8H A;  2CHC A;  2P38 A;  2CFD A;  4N6L A;  1KWI A;  1UW1 A;  2I9W A;  3X3Y A;  1WTH A;  1QJG A;  3N54 B;  5I97 A;  3SOA A;  3FKA A;  1ROA A;  2WGQ A;  3MG2 A;  2JDI H;  4HM5 B;  4KFE A;  3PZW A;  1EQK A;  3G6E 3;  4OUQ A;  5AII A;  1FGM A;  2OWP A;  5A0O B;  3LT8 A;  4G1M B;  1NWW A;  1JKG A;  1L5G B;  1WQL B;  3LYG A;  3X3Z A;  4CCV A;  1CYV A;  1NJI 4;  2K0M A;  2P09 A;  1VQM 3;  1IQ8 A;  2XR8 B;  3DGM A;  2XGL A;  2XH9 A;  3DM8 A;  4K61 A;  1CEW I;  3F14 A;  5ELU A;  3WOD G;  5AEU B;  4R4K A;  3EQQ B;  3JUN A;  5LC7 A;  1AVK A;  1JKG B;  4HVN A;  4KVH A;  5BXQ A;  1M1K 4;  2C11 A;  3NUV A;  2LYX A;  5FGO A;  1UI7 A;  2XEP A;  2WOF A;  2QEX 3;  1W01 A;  3OWU A;  1JB4 A;  2WO0 A;  4EV5 A;  2CFK A;  3SOY A;  1VQL 3;  5AIG A;  5JBS A;  2CKF B;  1Q42 A;  3F40 A;  1K73 4;  3FG3 A;  4NRE A;  5AI1 A;  3F7S A;  2IMJ A;  1OAC A;  3OX9 A;  3OXA A;  2HMJ B;  3S29 A;  1YJ9 3;  3NX0 A;  3ER7 A;  3MG1 A;  2CG1 A;  1DVD A;  3FH1 A;  1IV9 A;  3FCS B;  4R9L A;  1K8A 4;  4IT7 A;  3FGY A;  4HJL B;  1WMO A;  2BMQ B;  1CQS A;  2M7O A;  5FW5 A;  2P05 A;  1U5O A;  3MWZ A;  3EF8 A;  1YIT 3;  2ZL8 A;  1W6G A;  1GY7 A;  5ELJ A;  1RKY A;  1OF5 A;  1WMP A;  1W6C A;  1OHO A;  3K9M C;  2IUJ A;  1TIJ A;  4MMZ B;  4R80 A;  3EBY A;  3VGN A;  4FMB A;  2K54 A;  3N9H A;  4FR9 A;  1ZO2 A;  3F7X A;  4HM6 B;  3LT9 A;  1OGX A;  4O02 B;  1GS3 A;  1QAL A;  3EN1 B;  1W02 A;  5HGR A;  5IER A;  2RCD A;  1OF5 B;  2F86 B;  2BO9 B;  2PNC A;  3GZX B;  2P0M A;  1STF I;  3S5C A;  4N6N B;  3G16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...