1E3VA

Crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Detection of Large Pka Perturbations of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1e3vA00
1NU3A 2GEYA 5IG3A 1ISKA 3FSDA 5AEUB 3MKIA 3VSYA 2RFRA 1GS3A 3Q90A 3NV0B 2QIYA 4PEJA 2RCDA 1TUHA 5CLKA 1QMAA 2GXFA 3KSPA 1OF5B 1O7MB 5G2GA 5AIFA 2Z76A 3EJVA 1IDPA 3MYTA 3G8ZA 1OPYA 1ULJB 4X2OA 3FLJA 1O7WB 3NM2A 3EX9A 1ULIB 3F7SA 4OUQA 3CPOA 1DMMA 2XRXB 3SOAA 2UX0A 2I9WA 4XBYA 4R9LA 5IEPA 3FZWA 5FW5A 3WMDA 1JN5B 4OVMA 3EF8A 4Q53A 1CQSA 3VGNA 5HGRA 2STDA 1NDOB 2IMJA 1Z1SA 1AR0A 2BNGA 3HZPA 5KP4A 3GZXB 3E99A 5IENA 3EQQB 5EVHA 1JKGA 2F86B 3CNMA 1EA2A 1Q40B 3EHCA 1HKXA 4WYKB 3SEDA 4HM8B 5AI1A 3EC9A 3F9SA 2HMJB 2B1XB 3GWRA 3FH1A 5BVBA 3FF0A 4HVNA 1E97A 4L8PA 5JPPA 4IIAA 2HMKB 5IG5A 3NHXA 5DRVA 3ER7A 1NWWA 2INXA 4ORLA 4FCJA 2F98A 4KVHA 5STDA 4HM5B 2OWPA 1DMNA 1JB5A 4XB5A 3BLZA 4N3VA 1OGZA 3T8NA 1QJGA 4K1UA 4WP5A 4WWUC 1SJWA 1OGXA 5AEWB 4I4KA 3RGAA 3FGYA 1DMQA 5IG0A 2R4IA 1E3RA 4H3UA 3K0ZA 3OXAA 4L8OA 5AIGA 4GB5A 3H3HA 3NUVA 1C7HA 3T8UA 3FF2A 4L7KA 1K41A 4J9AA 2PZVA 3F8XA 4MJDA 1ZX2A 5JPUA 3EN8A 1O7HB 1W6YA 3OWSA 4HM6B 3MG1A 3B4PA 3UJMA 3F40A 3B4OA 3A76A 1Q42A 3JUQA 4HM3B 1GYBA 1VZZA 2CKFB 3NV0A 5CXOA 3HX8A 3LYGA 1W02A 3JUMA 4HM7B 5BXQA 5CK6A 5KP3A 4R9KA 2Z77A 4HM0B 3GZRA 1OF5A 2K54A 2XSOB 3G0KA 2YFLB 4XBXA 3KKGA 4X2HA 5AIIA 2RGQA 3K7CA 1UUWB 4HKVB 1BUQA 2W2CA 1O7GB 3F14A 3MHEA 4HM4B 4HM2B 1O7NB 3UNLA 3F8HA 3DZLA 3DXOA 1E3VA 3EBTA 1OCVA 1OH0A 2GBWB 3D9RA 1A2KA 4J8TA 4CDLA 5D81A 2YFIB 3DMCA 1JN5A 3NXJA 2CHCA 4FCMA 3EBYA 1STDA 3JUNA 3I0YA 3OV4A 4XDVA 4R1KA 3JUOA 2F99A 1JB4A 3G16A 3ROBA 1S5AA 2HMOB 2XR8B 5IEOA 1JKGB 3H51A 3RGRA 4LMIA 3KE7A 4LEHA 3DUKA 1Q40A 5DREA 4XDWA 4WYKA 1EG9B 4U13A 3HK4A 7STDA 4HZBB 2A15A 3OWYA 3GRDA 5AIHA 3NBRA 5IERA 2BMQB 2QGUA 4STDA 5IF6A 3MG2A 3KZTA 1UUVB 1U5OA 5KP1A 3BB9A 1TP6A 1ASKA 1WQLB 1GY7A 3F7XA 2BMRB 3STDA 3MSOA 4K1VA 3OX9A 3OWUA 1GY5A 2GEXA 1ZO2A 1OHOA 1OHSA 2B24B 2JQ5A 1W00A 5TGNA 3GZBA 2HMNB 5CF1A 4LGQA 3B7CA 3IPTA 4HM1B 6STDA 3CNXA 3SOYA 3GZYB 3M8CA 3MG3A 1OHPA 3CU3A 2YFJB 4RZMA 3FKAA 3B8LA 3S5CA 2Z7AA 1OUNA 1GY6A 2HMMB 4HZ9B 5IG4A 5D83A 1W01A 3LZAA 3JUPA 2BMOB 4HJLB 4XM4A 2GBXB 2HMLB 8CHOA 3ECFA 4XBTA 5D82A 5CF2A 2XSHB 3EN1B 1JB2A 1O7PB 3DM8A
chains in the Genus database with same CATH superfamily
1NU3A 2GEYA 3SYUA 5IG3A 1ISKA 7GSPA 2OOVC 3FSDA 3BNEA 5AEUB 3MKIA 3VSYA 2RFRA 1GS3A 3N9HA 1IU7A 3Q90A 3NV0B 2QIYA 3NM7A 4PEJA 4MEIA 3U97A 1I2FA 2RCDA 1BNGA 3CCE3 1BU4A 1TUHA 5CLKA 2FNQA 1BOXA 1CEWI 3PGBA 3X3ZA 2ML5A 1QMAA 4FMDA 2GXFA 1PYLA 1UCKA 2CFKA 2Y73A 3LT8A 2CC3A 3KSPA 3LTAA 2MC8A 3WA2X 1LNHA 1WMNA 1IQYA 5M18A 5AYRB 1FUSA 1OF5B 3BNCA 4DKIA 1O7MB 3BNBA 1RCKA 5G2GA 2CG1A 1B20A 1X1XA 5AIFA 3ZG0A 4N6LA 4KFEA 1I2GA 2Z76A 3EJVA 4I5QA 1MWUA 1BRGA 1D6YA 3DGMA 1IDPA 2Y74A 4GHOA 1UGIA 4CPKA 1RGCA 3G6E3 1VQ43 1MWRA 2XEPA 3K63A 3MYTA 2AADA 3WODG 3V99A 1YNVX 3G8ZA 1I3FA 1OPYA 1ULJB 4X2OA 1UW1A 3WHOA 3FLJA 1O7WB 3NM2A 2P09A 4J5GA 4JRFA 3EX9A 3QRDA 1SQWA 2P05A 1ULIB 3F7SA 4OUQA 1WNHA 1RN1A 3UL6A 1A67A 4BU4A 1IT7A 2W0QA 4FCZA 4EBGA 2F4YA 4ILFA 3SLUA 2M7OA 3CPOA 1DMMA 1JRQA 1V58A 4BL3A 3V98A 2BU4A 2W6JH 1LOYA 2XRXB 3SOAA 2W04A 2RBIA 2UX0A 2I9WA 2XH9A 4EW5A 4XBYA 2ZL8A 1IVUA 4R9LA 5IEPA 3FZWA 3ZG5A 2E2UA 1NJI4 3LMLA 4IPBA 4N6UA 5FW5A 3WMDA 1JN5B 4OVMA 4BTWA 2BT3A 3EF8A 4Q53A 1CQSA 1OACA 1RGFA 3MWZA 3VGNA 1LOWA 3DGLA 3KSED 3LXUX 4R4KA 3VF1A 5HGRA 3HOHA 2STDA 2E2VA 1EEJA 1MNLA 2F5WA 1NDOB 2LQVA 4EV2A 3OW22 1LNIA 3UL5A 4BL2A 1RJOA 2IMJA 1Z1SA 3N8BA 5AYSC 3PCSA 3LTCA 1SARA 2ZHXB 4ZM8A 2QEX3 1YJN3 3KFQC 1AR0A 2BNGA 1SPUA 3S27A 4MMYB 3I563 4WHAA 4NREA 1AVKA 3HZPA 5KP4A 1WTHA 3GZXB 1PY3A 2UUGC 3E99A 5IENA 1IQXA 2IY2A 3EQQB 5EVHA 1JKGA 1QAKA 4GL6A 1BUJA 2F86B 2GU3A 3CNMA 1JJ22 1EA2A 1MGRA 1Q40B 1KC84 3EHCA 3PCRA 1Q824 1HKXA 3TDGA 4WYKB 1SIIA 4HM8B 5AI1A 3SEDA 6RNTA 1VQK3 3EC9A 3F9SA 2B1XB 2HMJB 1K9M4 1B27A 2P0XA 3GWRA 3FH1A 5BVBA 3FF0A 4HBRA 4HVNA 2OOVA 1WMPA 1E97A 1BVIA 1FGRA 4CCVA 3HIIA 1QAFA 4O3VA 1RLSA 2BIRA 1MWTA 2C4BA 1VQ73 1YJW3 1VQP3 1G96A 4L8PA 3BIRA 4NHFA 4O2HA 2IUKA 1JZOA 5JPPA 4IIAA 2HMKB 5G1LA 1GMPA 3S67A 5IG5A 3RDEA 1Q7Y4 3NHXA 1TFKA 5DRVA 2CFLA 1RGLA 1HU9A 3X41A 1BNSA 3ER7A 1YVSA 1FGQA 3CCR3 1NWWA 1WMOA 2INXA 3A5EA 4IT7A 1UCJA 3CMA3 3ALAA 1RGEA 1VQQA 4ORLA 4WFOA 2XGNA 2XFSA 4FCJA 1DE3A 2F98A 1EQKA 4KVHA 1YI23 1CYUA 1UUGB 2CK3H 3CXC2 5STDA 4HM5B 1VQ93 5IW9A 2OWPA 1DMNA 2FXTA 2CWUA 3CCV3 3NBBA 1JB5A 4RNZA 4XB5A 3BLZA 3CCQ3 1UI8A 4N3VA 1OGZA 2KF5A 1ROAA 3T8NA 3URPA 6GSPA 1QJGA 1JNQA 4K1UA 1W2ZA 5ELUA 1RN7A 2RSXA 4H61A 4WP5A 1T5YA 4WWUC 1F8NA 1SJWA 1T3BA 3U1WA 1YIT3 1BRSA 1OGXA 5AEWB 1B2MA 2F5MA 4I4KA 1JV2B 3RGAA 2V1LA 4RNTA 3LT9A 2SARA 3SVAA 1VQO3 1TIJA 1IVWA 3FGYA 3EE1A 3CC43 1DMQA 1RKYA 3J7Yd 5IG0A 2R4IA 1E3RA 2CIUA 4H3UA 1Q864 1AQZA 3K0ZA 3BU4A 3OXAA 7RNTA 1FA3A 3NQYA 2D42A 3BNDA 4L8OA 3UB1A 3MPHA 2CX0A 5AIGA 4GB5A 1BSBA 1MOLA 1LQGC 1RHLA 3H3HA 3DGYA 3NUVA 3LTDA 1C7HA 2C10A 1GD3A 3T8UA 2SBLA 1N8R4 2XF3A 2F56A 3DH2A 1B2SA 3WA3A 3FF2A 4L7KA 1K41A 4J9AA 2PZVA 2WO0A 3HIGA 2LYXA 3F8XA 4MJDA 1N5PA 1NNVA 5FGOA 1ZX2A 1LVNA 4RNYA 3ZFZA 4R80A 5JPUA 3EB8A 3L0RA 1DVCA 4KT3B 3AMOB 4HAAA 3EN8A 1O7HB 2FGTA 5BIRA 3N54B 3LH4A 1W6YA 2OTJ3 1FW7A 3CD63 1M1K4 5LC7A 3NBJA 1I70A 2CFGA 3OWSA 3PYJA 4LYLB 3KN4A 1QVF2 4HM6B 3MG1A 5GSPA 3DY5A 2H0GA 1BSEA 4MMXB 3CCU3 1RGKA 4K90B 3B4PA 2KF6A 1X1WA 1JBSA 1I8VA 3UJMA 1LRAA 1D6UA 3KIIA 2J8XB 1NO3A 3F40A 3B4OA 1G02A 3A76A 1Q42A 3JUQA 4TX4A 4HM3B 1V74A 2WOFA 3S28A 3CCL3 1R4CA 5A0OB 1GYBA 2L4VA 1VZZA 2CKFB 1AV4A 2W03A 1VQ53 3CPW2 3NV0A 1W4NA 2Z6BA 4EXRA 1YGEA 3AGNA 5CXOA 3CCS3 3HX8A 3LYGA 1I0VA 1W02A 3JUMA 2CFDA 4HM7B 1YHQ3 5BXQA 3S29A 5CK6A 2W56B 4AKYA 1BSDA 5KP3A 4BTYA 1IT8A 1HYFA 2L1SA 1BNJA 4R9KA 1GD4A 2Z77A 3GZRA 4HM0B 2KRTA 3WR2A 1BRJA 4N6MA 3D79A 3K5TA 1OF5A 2K54A 2XSOB 3G0KA 4N6V0 2YFLB 4XBXA 3KKGA 1VQN3 4O8SA 4FMBA 5I97A 4X2HA 5AIIA 3X3YA 1V57A 2OCTA 2CG0A 2RGQA 3K7CA 1UUWB 1N5HA 4HKVB 3GAXA 1BUQA 2W2CA 2ML6A 5JBSA 1IVXA 1O7GB 3FCSB 1BRIA 3F14A 3MHEA 4HM4B 2BO9B 1GOUA 2YX9A 5M19A 3D4AA 4HM2B 1QALA 1YIJ3 1O7NB 3UNLA 1IVVA 2C11A 2KCDA 1LOXA 4BTXA 2CWVA 1STFI 3F8HA 4KFDA 1DETA 3DZLA 2CW9A 2MF7A 3DXOA 3G713 1E3VA 1AY7A 1A90A 1YJ93 3EBTA 2CX1A 1US1A 1OCVA 1W7CA 1UCIA 1IV9A 1OH0A 1TFOA 1UI7A 2GU1A 1TJDA 2RNTA 2OTL3 1X1UA 2GBWB 2R41A 2P38A 1RCLA 3D9RA 4LZIA 5LC6A 2XGLA 3IJEB 3PS8A 1A2KA 1UDII 4J8TA 4CDLA 3AHWA 1TTOA 1R4YA 3NQZA 2ZA4A 2YFIB 5D81A 2K3DA 1AVLA 3DMCA 1KWIA 3SX1A 2WOHA 4GSPA 1JN5A 3NXJA 2CHCA 4FCMA 3X42A 1BNFA 3D3LA 3EBYA 3JVCA 5EQLA 5M1AA 1STDA 3JUNA 1GOVA 4J5KA 9RNTA 1J2BA 1BRNL 3CCM3 3WOFB 3I0YA 2KF4A 1RGHA 1ZGXA 3OV4A 4XDVA 1IK3A 5ELJA 1W2B2 1BGSA 1I0XA 3WDGB 4FMCA 4G1MB 4R1KA 1DYUA 3JUOA 1TRQA 2F99A 1RMSA 1W5ZA 4AKZA 1JB4A 1LXEA 2WGOA 3DGNA 3G16A 3ROBA 1S5AA 1T2IA 2HMOB 2XR8B 4K61A 5IEOA 1VQ83 1VQL3 1JKGB 3H51A 3RGRA 4NPBA 1KD14 4LMIA 1C54A 1A2PA 1U8CB 2OQEC 3KE7A 1I2EA 3DUKA 3Q2PA 4LEHA 5G1KA 4AEQA 5HOHA 1FGOA 2W56A 2GSPA 4HYZA 1Q40A 3KCHA 3AGOA 3G4S3 1BANA 5DREA 1M9GA 2H0HA 1K734 4XDWA 4WYKA 1EG9B 1BSAA 1LOVA 2AAEA 4U13A 4RBNA 1FUWA 3HK4A 2O3OA 7STDA 4HZBB 2A15A 1CH0A 1VQ63 1BAOA 1BRKA 1BNEA 4BIRA 1LQMB 3HI7A 3OWYA 3GRDA 3QK9A 1RGAA 1RGGA 1EKMA 5AIHA 3CC23 1FYSA 4N6OB 3NBRA 1CYVA 5IERA 2BMQB 1K28A 2QGUA 1RRLA 3LTBA 4STDA 1BIRA 5IF6A 1IQ8A 1BRHA 3MG2A 3KZTA 1BNIA 3CME3 1IV7A 1UUVB 1YGWA 3Q1CA 1U5OA 3SXXA 2QA43 4FMAA 1MGWA 3PZWA 5KP1A 3BB9A 4HOHA 3D5IA 1W6CA 1TP6A 2W9PA 8RNTA 1ASKA 1GOYA 1GSPA 1WQLB 2IYJA 3FG1A 1FGTA 4LSOA 1GY7A 1QVG2 1B3SA 2KAAA 3F7XA 2BMRB 3STDA 1KQS2 3MSOA 4K1VA 3OX9A 2O9UX 2P0MA 2E2TA 3OWUA 3I553 1FGMA 1GY5A 2GEXA 1JBRA 1S723 1Q9EA 1B21A 2ZDJA 3K9MC 1ZO2A 4OK0A 3RNTA 1OHOA 1OHSA 2B24B 1FZUA 1M904 1RNBA 1DVDA 1Q7HA 2KXGA 1PU4A 1W6GA 2JQ5A 1RTUA 1NB5I 3X3XA 1JBTA 2UGIA 3FG4A 3IMAB 3FG3A 1W00A 4KFFA 5TGNA 1JZDA 1N8QA 3GZBA 3X40A 1IYYA 1UCLA 2W9QA 2HMNB 5CF1A 4LGQA 4CJNA 3B7CA 3IPTA 4HM1B 4EV5A 6STDA 3CNXA 3SOYA 1Q814 3V92A 1MWSA 3GZYB 3M8CA 3MG3A 3PXMA 1RDSA 1OHPA 1UGHI 4KZ1A 1X1YA 3CU3A 2YFJB 4N6NB 2KF3A 4QWTA 1G0TA 1I3IA 2H0IA 1BSCA 4N6TA 4RZMA 1B2XA 3CC73 3DGOA 3FKAA 1BNRA 1GMQA 3AHSA 3B8LA 1ROVA 3LOYA 2IUJA 1T2HA 4JF8A 3S5CA 4MMZB 3T0UA 2D1WA 1D6ZA 1TRPA 2CWTA 3WOEB 1FUTA 1B2UA 1TU5A 1RN4A 1HZ1A 1RNTA 2BHMA 1KSIA 2WGQA 3GSPA 2IA7A 2Z7AA 1OUNA 1RRHA 1GY6A 2HMMB 4O02B 4EYCA 1N9JA 2Q07A 4HZ9B 1M1XB 1L5GB 1PFPA 1GMRA 1ZS7A 3AMOA 4FR9A 5IG4A 2JDIH 2CFWA 5D83A 1A2VA 1W01A 2PNCA 1Y4KA 3D5GA 1RSNA 2BMOB 3JUPA 1N9EA 1YVBI 2K0MA 3LZAA 2GBXB 2HMLB 3NX0A 4HJLB 4XM4A 5EEOA 3ECFA 4XBTA 5D82A 2OQEA 5CF2A 2XSHB 8CHOA 3EN1B 5BU4A 3CCJ3 2HOHA 1JB2A 1NB3I 1SIHA 1O7PB 3O8YA 3Q3FA 4EC6A 1B2ZA 1K8A4 2XFTA 2CH9A 1VQM3 1EUIC 5RNTA 3DM8A
chains in the Genus database with same CATH topology
1NU3A 2GEYA 5IG3A 1ISKA 2OOVC 3FSDA 3BNEA 5AEUB 3MKIA 3VSYA 2RFRA 1GS3A 3N9HA 1IU7A 3Q90A 3NV0B 2QIYA 3NM7A 4PEJA 4MEIA 3U97A 2RCDA 3CCE3 1TUHA 5CLKA 2FNQA 1CEWI 3PGBA 3X3ZA 2ML5A 1QMAA 4FMDA 2GXFA 2CFKA 2Y73A 3LT8A 2CC3A 3KSPA 3LTAA 2MC8A 3WA2X 1LNHA 1WMNA 1IQYA 5AYRB 1OF5B 3BNCA 1O7MB 3BNBA 5G2GA 2CG1A 5AIFA 4N6LA 4KFEA 2Z76A 3EJVA 1D6YA 3DGMA 1IDPA 2Y74A 3G6E3 1VQ43 2XEPA 3K63A 3MYTA 3WODG 3V99A 3G8ZA 1OPYA 1ULJB 4X2OA 1UW1A 3FLJA 1O7WB 3NM2A 2P09A 4JRFA 3EX9A 3QRDA 1SQWA 2P05A 1ULIB 3F7SA 4OUQA 1WNHA 3UL6A 1A67A 1IT7A 2W0QA 4FCZA 4EBGA 3SLUA 2M7OA 3CPOA 1DMMA 1JRQA 3V98A 2W6JH 2XRXB 3SOAA 2W04A 2UX0A 2I9WA 2XH9A 4XBYA 2ZL8A 1IVUA 4R9LA 5IEPA 3FZWA 1NJI4 2E2UA 3LMLA 4IPBA 4N6UA 5FW5A 3WMDA 1JN5B 4OVMA 4BTWA 2BT3A 3EF8A 4Q53A 1CQSA 1OACA 3MWZA 3VGNA 3DGLA 3KSED 3LXUX 4R4KA 3VF1A 5HGRA 4EV2A 2STDA 2E2VA 1MNLA 1NDOB 2LQVA 3OW22 3UL5A 1RJOA 2IMJA 1Z1SA 3N8BA 5AYSC 3PCSA 3LTCA 4ZM8A 2QEX3 1YJN3 3KFQC 1AR0A 2BNGA 1SPUA 3S27A 4MMYB 3I563 4WHAA 4NREA 1AVKA 3HZPA 5KP4A 1WTHA 3GZXB 3E99A 5IENA 1IQXA 3EQQB 5EVHA 1JKGA 1QAKA 4GL6A 2F86B 2GU3A 3CNMA 1JJ22 1EA2A 1Q40B 1KC84 3EHCA 3PCRA 1Q824 1HKXA 3TDGA 4WYKB 1SIIA 4HM8B 5AI1A 3SEDA 1VQK3 3EC9A 3F9SA 2HMJB 2B1XB 2P0XA 3GWRA 3FH1A 5BVBA 3FF0A 4HBRA 4HVNA 2OOVA 1WMPA 1E97A 1FGRA 4CCVA 3HIIA 1QAFA 4O3VA 1VQ73 1YJW3 1VQP3 1G96A 4L8PA 4NHFA 4O2HA 2IUKA 5JPPA 4IIAA 2HMKB 5IG5A 3S67A 3RDEA 1Q7Y4 3NHXA 1TFKA 5DRVA 2CFLA 1HU9A 3X41A 3ER7A 1FGQA 3CCR3 1NWWA 1WMOA 2INXA 4IT7A 3CMA3 3ALAA 4ORLA 4WFOA 2XGNA 2XFSA 4FCJA 2F98A 1EQKA 4KVHA 1YI23 1CYUA 2CK3H 3CXC2 5STDA 4HM5B 1VQ93 5IW9A 2OWPA 1DMNA 2FXTA 2CWUA 3CCV3 3NBBA 1JB5A 4RNZA 4XB5A 3BLZA 3CCQ3 1UI8A 4N3VA 1OGZA 1ROAA 3T8NA 1QJGA 1JNQA 4K1UA 1W2ZA 5ELUA 1RN7A 2RSXA 4H61A 4WP5A 1T5YA 4WWUC 1F8NA 1SJWA 3U1WA 1YIT3 1OGXA 5AEWB 4I4KA 1JV2B 3RGAA 2V1LA 3LT9A 3SVAA 1VQO3 1TIJA 1IVWA 3FGYA 3EE1A 3CC43 1DMQA 1RKYA 3J7Yd 5IG0A 2R4IA 1E3RA 2CIUA 4H3UA 1Q864 3K0ZA 1FA3A 3OXAA 3NQYA 2D42A 3BNDA 4L8OA 3UB1A 3MPHA 5AIGA 4GB5A 1MOLA 3H3HA 3NUVA 3LTDA 1C7HA 2C10A 1GD3A 3T8UA 2SBLA 1N8R4 2XF3A 3WA3A 3FF2A 4L7KA 1K41A 4J9AA 2PZVA 2WO0A 3HIGA 2LYXA 3F8XA 4MJDA 1N5PA 5FGOA 1ZX2A 1LVNA 4RNYA 4R80A 5JPUA 3EB8A 3L0RA 1DVCA 3AMOB 3EN8A 1O7HB 2FGTA 3N54B 3LH4A 1W6YA 2OTJ3 3CD63 1M1K4 5LC7A 3NBJA 2CFGA 3OWSA 3PYJA 3KN4A 1QVF2 4HM6B 3MG1A 3DY5A 4MMXB 3CCU3 4K90B 3B4PA 3UJMA 1D6UA 3KIIA 1NO3A 3F40A 3B4OA 3A76A 1Q42A 3JUQA 4TX4A 4HM3B 1V74A 2WOFA 3S28A 3CCL3 1R4CA 5A0OB 1GYBA 2L4VA 1VZZA 2CKFB 1AV4A 2W03A 1VQ53 3CPW2 3NV0A 1W4NA 2Z6BA 4EXRA 1YGEA 5CXOA 3CCS3 3HX8A 3LYGA 1W02A 3JUMA 2CFDA 4HM7B 1YHQ3 5BXQA 3S29A 5CK6A 2W56B 4AKYA 5KP3A 4BTYA 1IT8A 4R9KA 1GD4A 2Z77A 3GZRA 4HM0B 2KRTA 4N6MA 3K5TA 1OF5A 2K54A 2XSOB 3G0KA 4N6V0 2YFLB 4XBXA 3KKGA 1VQN3 4O8SA 4FMBA 5I97A 4X2HA 5AIIA 3X3YA 2OCTA 2RGQA 2CG0A 3K7CA 1UUWB 1N5HA 4HKVB 3GAXA 1BUQA 2W2CA 2ML6A 5JBSA 1IVXA 1O7GB 3FCSB 3F14A 3MHEA 4HM4B 2BO9B 2YX9A 4HM2B 1QALA 1YIJ3 1O7NB 3UNLA 1IVVA 2KCDA 2C11A 1LOXA 4BTXA 2CWVA 1STFI 3F8HA 4KFDA 3DZLA 2CW9A 2MF7A 3DXOA 3G713 1E3VA 1A90A 1YJ93 3EBTA 1US1A 1OCVA 1W7CA 1IV9A 1OH0A 1TFOA 1UI7A 2GU1A 2OTL3 2GBWB 2P38A 3D9RA 4LZIA 5LC6A 2XGLA 3IJEB 3PS8A 1A2KA 4J8TA 4CDLA 5D81A 3NQZA 2YFIB 1AVLA 3DMCA 1KWIA 3SX1A 2WOHA 3X42A 1JN5A 3NXJA 2CHCA 4FCMA 3D3LA 3EBYA 3JVCA 5EQLA 1STDA 3JUNA 1J2BA 3CCM3 3WOFB 3I0YA 3OV4A 4XDVA 1IK3A 5ELJA 1W2B2 3WDGB 4FMCA 4G1MB 4R1KA 1DYUA 3JUOA 2F99A 1W5ZA 4AKZA 1JB4A 2WGOA 1LXEA 3DGNA 3G16A 3ROBA 1S5AA 2HMOB 2XR8B 4K61A 5IEOA 1VQ83 1VQL3 1JKGB 3H51A 3RGRA 1KD14 4LMIA 2OQEC 1U8CB 3KE7A 4LEHA 3DUKA 3Q2PA 4AEQA 1FGOA 2W56A 4HYZA 1Q40A 3G4S3 5DREA 1M9GA 1K734 4XDWA 4WYKA 1EG9B 4U13A 1FUWA 4RBNA 3HK4A 2O3OA 7STDA 4HZBB 2A15A 1VQ63 3HI7A 3OWYA 3GRDA 3QK9A 1EKMA 5AIHA 3CC23 4N6OB 3NBRA 1CYVA 5IERA 2BMQB 1K28A 2QGUA 1RRLA 3LTBA 4STDA 5IF6A 1IQ8A 3MG2A 3KZTA 3CME3 1IV7A 1UUVB 3Q1CA 1U5OA 3SXXA 2QA43 4FMAA 3PZWA 5KP1A 3BB9A 1W6CA 1TP6A 2W9PA 1ASKA 3FG1A 1WQLB 4LSOA 1FGTA 1GY7A 1QVG2 3F7XA 2BMRB 3STDA 1KQS2 3MSOA 4K1VA 3OX9A 2O9UX 2P0MA 2E2TA 3OWUA 3I553 1FGMA 1GY5A 2GEXA 1S723 2ZDJA 3K9MC 1ZO2A 4OK0A 1OHOA 1OHSA 2B24B 1M904 1DVDA 2KXGA 1PU4A 1W6GA 2JQ5A 1NB5I 3X3XA 3FG4A 3IMAB 3FG3A 1W00A 4KFFA 5TGNA 1N8QA 3X40A 3GZBA 2W9QA 2HMNB 5CF1A 4LGQA 3B7CA 3IPTA 4HM1B 4EV5A 6STDA 3CNXA 3SOYA 1Q814 3V92A 3GZYB 3M8CA 3MG3A 3PXMA 1OHPA 4KZ1A 3CU3A 2YFJB 4N6NB 4QWTA 4N6TA 4RZMA 3CC73 3DGOA 3FKAA 3B8LA 1ROVA 3LOYA 2IUJA 3S5CA 4JF8A 4MMZB 3T0UA 2D1WA 1D6ZA 3WOEB 2CWTA 1TU5A 2BHMA 1KSIA 2WGQA 2IA7A 2Z7AA 1OUNA 1RRHA 1GY6A 2HMMB 4O02B 4EYCA 1N9JA 2Q07A 4HZ9B 1M1XB 1L5GB 1PFPA 3AMOA 4FR9A 5IG4A 2JDIH 2CFWA 5D83A 1A2VA 2PNCA 1W01A 1Y4KA 3JUPA 2BMOB 3LZAA 3NX0A 1N9EA 1YVBI 2K0MA 4HJLB 2GBXB 2HMLB 4XM4A 5EEOA 8CHOA 3ECFA 4XBTA 5D82A 2OQEA 5CF2A 2XSHB 3CCJ3 3EN1B 1K9M4 1JB2A 1NB3I 1SIHA 1O7PB 3O8YA 4EC6A 1K8A4 2XFTA 2CH9A 1VQM3 3DM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NU3 A;  2GEY A;  5IG3 A;  1ISK A;  3FSD A;  5AEU B;  3MKI A;  3VSY A;  2RFR A;  1GS3 A;  3Q90 A;  3NV0 B;  2QIY A;  4PEJ A;  2RCD A;  1TUH A;  5CLK A;  1QMA A;  2GXF A;  3KSP A;  1OF5 B;  1O7M B;  5G2G A;  5AIF A;  2Z76 A;  3EJV A;  1IDP A;  3MYT A;  3G8Z A;  1OPY A;  1ULJ B;  4X2O A;  3FLJ A;  1O7W B;  3NM2 A;  3EX9 A;  1ULI B;  3F7S A;  4OUQ A;  3CPO A;  1DMM A;  2XRX B;  3SOA A;  2UX0 A;  2I9W A;  4XBY A;  4R9L A;  5IEP A;  3FZW A;  5FW5 A;  3WMD A;  1JN5 B;  4OVM A;  3EF8 A;  4Q53 A;  1CQS A;  3VGN A;  5HGR A;  2STD A;  1NDO B;  2IMJ A;  1Z1S A;  1AR0 A;  2BNG A;  3HZP A;  5KP4 A;  3GZX B;  3E99 A;  5IEN A;  3EQQ B;  5EVH A;  1JKG A;  2F86 B;  3CNM A;  1EA2 A;  1Q40 B;  3EHC A;  1HKX A;  4WYK B;  3SED A;  4HM8 B;  5AI1 A;  3EC9 A;  3F9S A;  2HMJ B;  2B1X B;  3GWR A;  3FH1 A;  5BVB A;  3FF0 A;  4HVN A;  1E97 A;  4L8P A;  5JPP A;  4IIA A;  2HMK B;  5IG5 A;  3NHX A;  5DRV A;  3ER7 A;  1NWW A;  2INX A;  4ORL A;  4FCJ A;  2F98 A;  4KVH A;  5STD A;  4HM5 B;  2OWP A;  1DMN A;  1JB5 A;  4XB5 A;  3BLZ A;  4N3V A;  1OGZ A;  3T8N A;  1QJG A;  4K1U A;  4WP5 A;  4WWU C;  1SJW A;  1OGX A;  5AEW B;  4I4K A;  3RGA A;  3FGY A;  1DMQ A;  5IG0 A;  2R4I A;  1E3R A;  4H3U A;  3K0Z A;  3OXA A;  4L8O A;  5AIG A;  4GB5 A;  3H3H A;  3NUV A;  1C7H A;  3T8U A;  3FF2 A;  4L7K A;  1K41 A;  4J9A A;  2PZV A;  3F8X A;  4MJD A;  1ZX2 A;  5JPU A;  3EN8 A;  1O7H B;  1W6Y A;  3OWS A;  4HM6 B;  3MG1 A;  3B4P A;  3UJM A;  3F40 A;  3B4O A;  3A76 A;  1Q42 A;  3JUQ A;  4HM3 B;  1GYB A;  1VZZ A;  2CKF B;  3NV0 A;  5CXO A;  3HX8 A;  3LYG A;  1W02 A;  3JUM A;  4HM7 B;  5BXQ A;  5CK6 A;  5KP3 A;  4R9K A;  2Z77 A;  4HM0 B;  3GZR A;  1OF5 A;  2K54 A;  2XSO B;  3G0K A;  2YFL B;  4XBX A;  3KKG A;  4X2H A;  5AII A;  2RGQ A;  3K7C A;  1UUW B;  4HKV B;  1BUQ A;  2W2C A;  1O7G B;  3F14 A;  3MHE A;  4HM4 B;  4HM2 B;  1O7N B;  3UNL A;  3F8H A;  3DZL A;  3DXO A;  1E3V A;  3EBT A;  1OCV A;  1OH0 A;  2GBW B;  3D9R A;  1A2K A;  4J8T A;  4CDL A;  5D81 A;  2YFI B;  3DMC A;  1JN5 A;  3NXJ A;  2CHC A;  4FCM A;  3EBY A;  1STD A;  3JUN A;  3I0Y A;  3OV4 A;  4XDV A;  4R1K A;  3JUO A;  2F99 A;  1JB4 A;  3G16 A;  3ROB A;  1S5A A;  2HMO B;  2XR8 B;  5IEO A;  1JKG B;  3H51 A;  3RGR A;  4LMI A;  3KE7 A;  4LEH A;  3DUK A;  1Q40 A;  5DRE A;  4XDW A;  4WYK A;  1EG9 B;  4U13 A;  3HK4 A;  7STD A;  4HZB B;  2A15 A;  3OWY A;  3GRD A;  5AIH A;  3NBR A;  5IER A;  2BMQ B;  2QGU A;  4STD A;  5IF6 A;  3MG2 A;  3KZT A;  1UUV B;  1U5O A;  5KP1 A;  3BB9 A;  1TP6 A;  1ASK A;  1WQL B;  1GY7 A;  3F7X A;  2BMR B;  3STD A;  3MSO A;  4K1V A;  3OX9 A;  3OWU A;  1GY5 A;  2GEX A;  1ZO2 A;  1OHO A;  1OHS A;  2B24 B;  2JQ5 A;  1W00 A;  5TGN A;  3GZB A;  2HMN B;  5CF1 A;  4LGQ A;  3B7C A;  3IPT A;  4HM1 B;  6STD A;  3CNX A;  3SOY A;  3GZY B;  3M8C A;  3MG3 A;  1OHP A;  3CU3 A;  2YFJ B;  4RZM A;  3FKA A;  3B8L A;  3S5C A;  2Z7A A;  1OUN A;  1GY6 A;  2HMM B;  4HZ9 B;  5IG4 A;  5D83 A;  1W01 A;  3LZA A;  3JUP A;  2BMO B;  4HJL B;  4XM4 A;  2GBX B;  2HML B;  8CHO A;  3ECF A;  4XBT A;  5D82 A;  5CF2 A;  2XSH B;  3EN1 B;  1JB2 A;  1O7P B;  3DM8 A; 
#chains in the Genus database with same CATH topology
 1NU3 A;  2GEY A;  3SYU A;  5IG3 A;  1ISK A;  7GSP A;  2OOV C;  3FSD A;  3BNE A;  5AEU B;  3MKI A;  3VSY A;  2RFR A;  1GS3 A;  3N9H A;  1IU7 A;  3Q90 A;  3NV0 B;  2QIY A;  3NM7 A;  4PEJ A;  4MEI A;  3U97 A;  1I2F A;  2RCD A;  1BNG A;  3CCE 3;  1BU4 A;  1TUH A;  5CLK A;  2FNQ A;  1BOX A;  1CEW I;  3PGB A;  3X3Z A;  2ML5 A;  1QMA A;  4FMD A;  2GXF A;  1PYL A;  1UCK A;  2CFK A;  2Y73 A;  3LT8 A;  2CC3 A;  3KSP A;  3LTA A;  2MC8 A;  3WA2 X;  1LNH A;  1WMN A;  1IQY A;  5M18 A;  5AYR B;  1FUS A;  1OF5 B;  3BNC A;  4DKI A;  1O7M B;  3BNB A;  1RCK A;  5G2G A;  2CG1 A;  1B20 A;  1X1X A;  5AIF A;  3ZG0 A;  4N6L A;  4KFE A;  1I2G A;  2Z76 A;  3EJV A;  4I5Q A;  1MWU A;  1BRG A;  1D6Y A;  3DGM A;  1IDP A;  2Y74 A;  4GHO A;  1UGI A;  4CPK A;  1RGC A;  3G6E 3;  1VQ4 3;  1MWR A;  2XEP A;  3K63 A;  3MYT A;  2AAD A;  3WOD G;  3V99 A;  1YNV X;  3G8Z A;  1I3F A;  1OPY A;  1ULJ B;  4X2O A;  1UW1 A;  3WHO A;  3FLJ A;  1O7W B;  3NM2 A;  2P09 A;  4J5G A;  4JRF A;  3EX9 A;  3QRD A;  1SQW A;  2P05 A;  1ULI B;  3F7S A;  4OUQ A;  1WNH A;  1RN1 A;  3UL6 A;  1A67 A;  4BU4 A;  1IT7 A;  2W0Q A;  4FCZ A;  4EBG A;  2F4Y A;  4ILF A;  3SLU A;  2M7O A;  3CPO A;  1DMM A;  1JRQ A;  1V58 A;  4BL3 A;  3V98 A;  2BU4 A;  2W6J H;  1LOY A;  2XRX B;  3SOA A;  2W04 A;  2RBI A;  2UX0 A;  2I9W A;  2XH9 A;  4EW5 A;  4XBY A;  2ZL8 A;  1IVU A;  4R9L A;  5IEP A;  3FZW A;  3ZG5 A;  2E2U A;  1NJI 4;  3LML A;  4IPB A;  4N6U A;  5FW5 A;  3WMD A;  1JN5 B;  4OVM A;  4BTW A;  2BT3 A;  3EF8 A;  4Q53 A;  1CQS A;  1OAC A;  1RGF A;  3MWZ A;  3VGN A;  1LOW A;  3DGL A;  3KSE D;  3LXU X;  4R4K A;  3VF1 A;  5HGR A;  3HOH A;  2STD A;  2E2V A;  1EEJ A;  1MNL A;  2F5W A;  1NDO B;  2LQV A;  4EV2 A;  3OW2 2;  1LNI A;  3UL5 A;  4BL2 A;  1RJO A;  2IMJ A;  1Z1S A;  3N8B A;  5AYS C;  3PCS A;  3LTC A;  1SAR A;  2ZHX B;  4ZM8 A;  2QEX 3;  1YJN 3;  3KFQ C;  1AR0 A;  2BNG A;  1SPU A;  3S27 A;  4MMY B;  3I56 3;  4WHA A;  4NRE A;  1AVK A;  3HZP A;  5KP4 A;  1WTH A;  3GZX B;  1PY3 A;  2UUG C;  3E99 A;  5IEN A;  1IQX A;  2IY2 A;  3EQQ B;  5EVH A;  1JKG A;  1QAK A;  4GL6 A;  1BUJ A;  2F86 B;  2GU3 A;  3CNM A;  1JJ2 2;  1EA2 A;  1MGR A;  1Q40 B;  1KC8 4;  3EHC A;  3PCR A;  1Q82 4;  1HKX A;  3TDG A;  4WYK B;  1SII A;  4HM8 B;  5AI1 A;  3SED A;  6RNT A;  1VQK 3;  3EC9 A;  3F9S A;  2B1X B;  2HMJ B;  1K9M 4;  1B27 A;  2P0X A;  3GWR A;  3FH1 A;  5BVB A;  3FF0 A;  4HBR A;  4HVN A;  2OOV A;  1WMP A;  1E97 A;  1BVI A;  1FGR A;  4CCV A;  3HII A;  1QAF A;  4O3V A;  1RLS A;  2BIR A;  1MWT A;  2C4B A;  1VQ7 3;  1YJW 3;  1VQP 3;  1G96 A;  4L8P A;  3BIR A;  4NHF A;  4O2H A;  2IUK A;  1JZO A;  5JPP A;  4IIA A;  2HMK B;  5G1L A;  1GMP A;  3S67 A;  5IG5 A;  3RDE A;  1Q7Y 4;  3NHX A;  1TFK A;  5DRV A;  2CFL A;  1RGL A;  1HU9 A;  3X41 A;  1BNS A;  3ER7 A;  1YVS A;  1FGQ A;  3CCR 3;  1NWW A;  1WMO A;  2INX A;  3A5E A;  4IT7 A;  1UCJ A;  3CMA 3;  3ALA A;  1RGE A;  1VQQ A;  4ORL A;  4WFO A;  2XGN A;  2XFS A;  4FCJ A;  1DE3 A;  2F98 A;  1EQK A;  4KVH A;  1YI2 3;  1CYU A;  1UUG B;  2CK3 H;  3CXC 2;  5STD A;  4HM5 B;  1VQ9 3;  5IW9 A;  2OWP A;  1DMN A;  2FXT A;  2CWU A;  3CCV 3;  3NBB A;  1JB5 A;  4RNZ A;  4XB5 A;  3BLZ A;  3CCQ 3;  1UI8 A;  4N3V A;  1OGZ A;  2KF5 A;  1ROA A;  3T8N A;  3URP A;  6GSP A;  1QJG A;  1JNQ A;  4K1U A;  1W2Z A;  5ELU A;  1RN7 A;  2RSX A;  4H61 A;  4WP5 A;  1T5Y A;  4WWU C;  1F8N A;  1SJW A;  1T3B A;  3U1W A;  1YIT 3;  1BRS A;  1OGX A;  5AEW B;  1B2M A;  2F5M A;  4I4K A;  1JV2 B;  3RGA A;  2V1L A;  4RNT A;  3LT9 A;  2SAR A;  3SVA A;  1VQO 3;  1TIJ A;  1IVW A;  3FGY A;  3EE1 A;  3CC4 3;  1DMQ A;  1RKY A;  3J7Y d;  5IG0 A;  2R4I A;  1E3R A;  2CIU A;  4H3U A;  1Q86 4;  1AQZ A;  3K0Z A;  3BU4 A;  3OXA A;  7RNT A;  1FA3 A;  3NQY A;  2D42 A;  3BND A;  4L8O A;  3UB1 A;  3MPH A;  2CX0 A;  5AIG A;  4GB5 A;  1BSB A;  1MOL A;  1LQG C;  1RHL A;  3H3H A;  3DGY A;  3NUV A;  3LTD A;  1C7H A;  2C10 A;  1GD3 A;  3T8U A;  2SBL A;  1N8R 4;  2XF3 A;  2F56 A;  3DH2 A;  1B2S A;  3WA3 A;  3FF2 A;  4L7K A;  1K41 A;  4J9A A;  2PZV A;  2WO0 A;  3HIG A;  2LYX A;  3F8X A;  4MJD A;  1N5P A;  1NNV A;  5FGO A;  1ZX2 A;  1LVN A;  4RNY A;  3ZFZ A;  4R80 A;  5JPU A;  3EB8 A;  3L0R A;  1DVC A;  4KT3 B;  3AMO B;  4HAA A;  3EN8 A;  1O7H B;  2FGT A;  5BIR A;  3N54 B;  3LH4 A;  1W6Y A;  2OTJ 3;  1FW7 A;  3CD6 3;  1M1K 4;  5LC7 A;  3NBJ A;  1I70 A;  2CFG A;  3OWS A;  3PYJ A;  4LYL B;  3KN4 A;  1QVF 2;  4HM6 B;  3MG1 A;  5GSP A;  3DY5 A;  2H0G A;  1BSE A;  4MMX B;  3CCU 3;  1RGK A;  4K90 B;  3B4P A;  2KF6 A;  1X1W A;  1JBS A;  1I8V A;  3UJM A;  1LRA A;  1D6U A;  3KII A;  2J8X B;  1NO3 A;  3F40 A;  3B4O A;  1G02 A;  3A76 A;  1Q42 A;  3JUQ A;  4TX4 A;  4HM3 B;  1V74 A;  2WOF A;  3S28 A;  3CCL 3;  1R4C A;  5A0O B;  1GYB A;  2L4V A;  1VZZ A;  2CKF B;  1AV4 A;  2W03 A;  1VQ5 3;  3CPW 2;  3NV0 A;  1W4N A;  2Z6B A;  4EXR A;  1YGE A;  3AGN A;  5CXO A;  3CCS 3;  3HX8 A;  3LYG A;  1I0V A;  1W02 A;  3JUM A;  2CFD A;  4HM7 B;  1YHQ 3;  5BXQ A;  3S29 A;  5CK6 A;  2W56 B;  4AKY A;  1BSD A;  5KP3 A;  4BTY A;  1IT8 A;  1HYF A;  2L1S A;  1BNJ A;  4R9K A;  1GD4 A;  2Z77 A;  3GZR A;  4HM0 B;  2KRT A;  3WR2 A;  1BRJ A;  4N6M A;  3D79 A;  3K5T A;  1OF5 A;  2K54 A;  2XSO B;  3G0K A;  4N6V 0;  2YFL B;  4XBX A;  3KKG A;  1VQN 3;  4O8S A;  4FMB A;  5I97 A;  4X2H A;  5AII A;  3X3Y A;  1V57 A;  2OCT A;  2CG0 A;  2RGQ A;  3K7C A;  1UUW B;  1N5H A;  4HKV B;  3GAX A;  1BUQ A;  2W2C A;  2ML6 A;  5JBS A;  1IVX A;  1O7G B;  3FCS B;  1BRI A;  3F14 A;  3MHE A;  4HM4 B;  2BO9 B;  1GOU A;  2YX9 A;  5M19 A;  3D4A A;  4HM2 B;  1QAL A;  1YIJ 3;  1O7N B;  3UNL A;  1IVV A;  2C11 A;  2KCD A;  1LOX A;  4BTX A;  2CWV A;  1STF I;  3F8H A;  4KFD A;  1DET A;  3DZL A;  2CW9 A;  2MF7 A;  3DXO A;  3G71 3;  1E3V A;  1AY7 A;  1A90 A;  1YJ9 3;  3EBT A;  2CX1 A;  1US1 A;  1OCV A;  1W7C A;  1UCI A;  1IV9 A;  1OH0 A;  1TFO A;  1UI7 A;  2GU1 A;  1TJD A;  2RNT A;  2OTL 3;  1X1U A;  2GBW B;  2R41 A;  2P38 A;  1RCL A;  3D9R A;  4LZI A;  5LC6 A;  2XGL A;  3IJE B;  3PS8 A;  1A2K A;  1UDI I;  4J8T A;  4CDL A;  3AHW A;  1TTO A;  1R4Y A;  3NQZ A;  2ZA4 A;  2YFI B;  5D81 A;  2K3D A;  1AVL A;  3DMC A;  1KWI A;  3SX1 A;  2WOH A;  4GSP A;  1JN5 A;  3NXJ A;  2CHC A;  4FCM A;  3X42 A;  1BNF A;  3D3L A;  3EBY A;  3JVC A;  5EQL A;  5M1A A;  1STD A;  3JUN A;  1GOV A;  4J5K A;  9RNT A;  1J2B A;  1BRN L;  3CCM 3;  3WOF B;  3I0Y A;  2KF4 A;  1RGH A;  1ZGX A;  3OV4 A;  4XDV A;  1IK3 A;  5ELJ A;  1W2B 2;  1BGS A;  1I0X A;  3WDG B;  4FMC A;  4G1M B;  4R1K A;  1DYU A;  3JUO A;  1TRQ A;  2F99 A;  1RMS A;  1W5Z A;  4AKZ A;  1JB4 A;  1LXE A;  2WGO A;  3DGN A;  3G16 A;  3ROB A;  1S5A A;  1T2I A;  2HMO B;  2XR8 B;  4K61 A;  5IEO A;  1VQ8 3;  1VQL 3;  1JKG B;  3H51 A;  3RGR A;  4NPB A;  1KD1 4;  4LMI A;  1C54 A;  1A2P A;  1U8C B;  2OQE C;  3KE7 A;  1I2E A;  3DUK A;  3Q2P A;  4LEH A;  5G1K A;  4AEQ A;  5HOH A;  1FGO A;  2W56 A;  2GSP A;  4HYZ A;  1Q40 A;  3KCH A;  3AGO A;  3G4S 3;  1BAN A;  5DRE A;  1M9G A;  2H0H A;  1K73 4;  4XDW A;  4WYK A;  1EG9 B;  1BSA A;  1LOV A;  2AAE A;  4U13 A;  4RBN A;  1FUW A;  3HK4 A;  2O3O A;  7STD A;  4HZB B;  2A15 A;  1CH0 A;  1VQ6 3;  1BAO A;  1BRK A;  1BNE A;  4BIR A;  1LQM B;  3HI7 A;  3OWY A;  3GRD A;  3QK9 A;  1RGA A;  1RGG A;  1EKM A;  5AIH A;  3CC2 3;  1FYS A;  4N6O B;  3NBR A;  1CYV A;  5IER A;  2BMQ B;  1K28 A;  2QGU A;  1RRL A;  3LTB A;  4STD A;  1BIR A;  5IF6 A;  1IQ8 A;  1BRH A;  3MG2 A;  3KZT A;  1BNI A;  3CME 3;  1IV7 A;  1UUV B;  1YGW A;  3Q1C A;  1U5O A;  3SXX A;  2QA4 3;  4FMA A;  1MGW A;  3PZW A;  5KP1 A;  3BB9 A;  4HOH A;  3D5I A;  1W6C A;  1TP6 A;  2W9P A;  8RNT A;  1ASK A;  1GOY A;  1GSP A;  1WQL B;  2IYJ A;  3FG1 A;  1FGT A;  4LSO A;  1GY7 A;  1QVG 2;  1B3S A;  2KAA A;  3F7X A;  2BMR B;  3STD A;  1KQS 2;  3MSO A;  4K1V A;  3OX9 A;  2O9U X;  2P0M A;  2E2T A;  3OWU A;  3I55 3;  1FGM A;  1GY5 A;  2GEX A;  1JBR A;  1S72 3;  1Q9E A;  1B21 A;  2ZDJ A;  3K9M C;  1ZO2 A;  4OK0 A;  3RNT A;  1OHO A;  1OHS A;  2B24 B;  1FZU A;  1M90 4;  1RNB A;  1DVD A;  1Q7H A;  2KXG A;  1PU4 A;  1W6G A;  2JQ5 A;  1RTU A;  1NB5 I;  3X3X A;  1JBT A;  2UGI A;  3FG4 A;  3IMA B;  3FG3 A;  1W00 A;  4KFF A;  5TGN A;  1JZD A;  1N8Q A;  3GZB A;  3X40 A;  1IYY A;  1UCL A;  2W9Q A;  2HMN B;  5CF1 A;  4LGQ A;  4CJN A;  3B7C A;  3IPT A;  4HM1 B;  4EV5 A;  6STD A;  3CNX A;  3SOY A;  1Q81 4;  3V92 A;  1MWS A;  3GZY B;  3M8C A;  3MG3 A;  3PXM A;  1RDS A;  1OHP A;  1UGH I;  4KZ1 A;  1X1Y A;  3CU3 A;  2YFJ B;  4N6N B;  2KF3 A;  4QWT A;  1G0T A;  1I3I A;  2H0I A;  1BSC A;  4N6T A;  4RZM A;  1B2X A;  3CC7 3;  3DGO A;  3FKA A;  1BNR A;  1GMQ A;  3AHS A;  3B8L A;  1ROV A;  3LOY A;  2IUJ A;  1T2H A;  4JF8 A;  3S5C A;  4MMZ B;  3T0U A;  2D1W A;  1D6Z A;  1TRP A;  2CWT A;  3WOE B;  1FUT A;  1B2U A;  1TU5 A;  1RN4 A;  1HZ1 A;  1RNT A;  2BHM A;  1KSI A;  2WGQ A;  3GSP A;  2IA7 A;  2Z7A A;  1OUN A;  1RRH A;  1GY6 A;  2HMM B;  4O02 B;  4EYC A;  1N9J A;  2Q07 A;  4HZ9 B;  1M1X B;  1L5G B;  1PFP A;  1GMR A;  1ZS7 A;  3AMO A;  4FR9 A;  5IG4 A;  2JDI H;  2CFW A;  5D83 A;  1A2V A;  1W01 A;  2PNC A;  1Y4K A;  3D5G A;  1RSN A;  2BMO B;  3JUP A;  1N9E A;  1YVB I;  2K0M A;  3LZA A;  2GBX B;  2HML B;  3NX0 A;  4HJL B;  4XM4 A;  5EEO A;  3ECF A;  4XBT A;  5D82 A;  2OQE A;  5CF2 A;  2XSH B;  8CHO A;  3EN1 B;  5BU4 A;  3CCJ 3;  2HOH A;  1JB2 A;  1NB3 I;  1SIH A;  1O7P B;  3O8Y A;  3Q3F A;  4EC6 A;  1B2Z A;  1K8A 4;  2XFT A;  2CH9 A;  1VQM 3;  1EUI C;  5RNT A;  3DM8 A; 
#chains in the Genus database with same CATH homology
 1NU3 A;  2GEY A;  5IG3 A;  1ISK A;  2OOV C;  3FSD A;  3BNE A;  5AEU B;  3MKI A;  3VSY A;  2RFR A;  1GS3 A;  3N9H A;  1IU7 A;  3Q90 A;  3NV0 B;  2QIY A;  3NM7 A;  4PEJ A;  4MEI A;  3U97 A;  2RCD A;  3CCE 3;  1TUH A;  5CLK A;  2FNQ A;  1CEW I;  3PGB A;  3X3Z A;  2ML5 A;  1QMA A;  4FMD A;  2GXF A;  2CFK A;  2Y73 A;  3LT8 A;  2CC3 A;  3KSP A;  3LTA A;  2MC8 A;  3WA2 X;  1LNH A;  1WMN A;  1IQY A;  5AYR B;  1OF5 B;  3BNC A;  1O7M B;  3BNB A;  5G2G A;  2CG1 A;  5AIF A;  4N6L A;  4KFE A;  2Z76 A;  3EJV A;  1D6Y A;  3DGM A;  1IDP A;  2Y74 A;  3G6E 3;  1VQ4 3;  2XEP A;  3K63 A;  3MYT A;  3WOD G;  3V99 A;  3G8Z A;  1OPY A;  1ULJ B;  4X2O A;  1UW1 A;  3FLJ A;  1O7W B;  3NM2 A;  2P09 A;  4JRF A;  3EX9 A;  3QRD A;  1SQW A;  2P05 A;  1ULI B;  3F7S A;  4OUQ A;  1WNH A;  3UL6 A;  1A67 A;  1IT7 A;  2W0Q A;  4FCZ A;  4EBG A;  3SLU A;  2M7O A;  3CPO A;  1DMM A;  1JRQ A;  3V98 A;  2W6J H;  2XRX B;  3SOA A;  2W04 A;  2UX0 A;  2I9W A;  2XH9 A;  4XBY A;  2ZL8 A;  1IVU A;  4R9L A;  5IEP A;  3FZW A;  1NJI 4;  2E2U A;  3LML A;  4IPB A;  4N6U A;  5FW5 A;  3WMD A;  1JN5 B;  4OVM A;  4BTW A;  2BT3 A;  3EF8 A;  4Q53 A;  1CQS A;  1OAC A;  3MWZ A;  3VGN A;  3DGL A;  3KSE D;  3LXU X;  4R4K A;  3VF1 A;  5HGR A;  4EV2 A;  2STD A;  2E2V A;  1MNL A;  1NDO B;  2LQV A;  3OW2 2;  3UL5 A;  1RJO A;  2IMJ A;  1Z1S A;  3N8B A;  5AYS C;  3PCS A;  3LTC A;  4ZM8 A;  2QEX 3;  1YJN 3;  3KFQ C;  1AR0 A;  2BNG A;  1SPU A;  3S27 A;  4MMY B;  3I56 3;  4WHA A;  4NRE A;  1AVK A;  3HZP A;  5KP4 A;  1WTH A;  3GZX B;  3E99 A;  5IEN A;  1IQX A;  3EQQ B;  5EVH A;  1JKG A;  1QAK A;  4GL6 A;  2F86 B;  2GU3 A;  3CNM A;  1JJ2 2;  1EA2 A;  1Q40 B;  1KC8 4;  3EHC A;  3PCR A;  1Q82 4;  1HKX A;  3TDG A;  4WYK B;  1SII A;  4HM8 B;  5AI1 A;  3SED A;  1VQK 3;  3EC9 A;  3F9S A;  2HMJ B;  2B1X B;  2P0X A;  3GWR A;  3FH1 A;  5BVB A;  3FF0 A;  4HBR A;  4HVN A;  2OOV A;  1WMP A;  1E97 A;  1FGR A;  4CCV A;  3HII A;  1QAF A;  4O3V A;  1VQ7 3;  1YJW 3;  1VQP 3;  1G96 A;  4L8P A;  4NHF A;  4O2H A;  2IUK A;  5JPP A;  4IIA A;  2HMK B;  5IG5 A;  3S67 A;  3RDE A;  1Q7Y 4;  3NHX A;  1TFK A;  5DRV A;  2CFL A;  1HU9 A;  3X41 A;  3ER7 A;  1FGQ A;  3CCR 3;  1NWW A;  1WMO A;  2INX A;  4IT7 A;  3CMA 3;  3ALA A;  4ORL A;  4WFO A;  2XGN A;  2XFS A;  4FCJ A;  2F98 A;  1EQK A;  4KVH A;  1YI2 3;  1CYU A;  2CK3 H;  3CXC 2;  5STD A;  4HM5 B;  1VQ9 3;  5IW9 A;  2OWP A;  1DMN A;  2FXT A;  2CWU A;  3CCV 3;  3NBB A;  1JB5 A;  4RNZ A;  4XB5 A;  3BLZ A;  3CCQ 3;  1UI8 A;  4N3V A;  1OGZ A;  1ROA A;  3T8N A;  1QJG A;  1JNQ A;  4K1U A;  1W2Z A;  5ELU A;  1RN7 A;  2RSX A;  4H61 A;  4WP5 A;  1T5Y A;  4WWU C;  1F8N A;  1SJW A;  3U1W A;  1YIT 3;  1OGX A;  5AEW B;  4I4K A;  1JV2 B;  3RGA A;  2V1L A;  3LT9 A;  3SVA A;  1VQO 3;  1TIJ A;  1IVW A;  3FGY A;  3EE1 A;  3CC4 3;  1DMQ A;  1RKY A;  3J7Y d;  5IG0 A;  2R4I A;  1E3R A;  2CIU A;  4H3U A;  1Q86 4;  3K0Z A;  1FA3 A;  3OXA A;  3NQY A;  2D42 A;  3BND A;  4L8O A;  3UB1 A;  3MPH A;  5AIG A;  4GB5 A;  1MOL A;  3H3H A;  3NUV A;  3LTD A;  1C7H A;  2C10 A;  1GD3 A;  3T8U A;  2SBL A;  1N8R 4;  2XF3 A;  3WA3 A;  3FF2 A;  4L7K A;  1K41 A;  4J9A A;  2PZV A;  2WO0 A;  3HIG A;  2LYX A;  3F8X A;  4MJD A;  1N5P A;  5FGO A;  1ZX2 A;  1LVN A;  4RNY A;  4R80 A;  5JPU A;  3EB8 A;  3L0R A;  1DVC A;  3AMO B;  3EN8 A;  1O7H B;  2FGT A;  3N54 B;  3LH4 A;  1W6Y A;  2OTJ 3;  3CD6 3;  1M1K 4;  5LC7 A;  3NBJ A;  2CFG A;  3OWS A;  3PYJ A;  3KN4 A;  1QVF 2;  4HM6 B;  3MG1 A;  3DY5 A;  4MMX B;  3CCU 3;  4K90 B;  3B4P A;  3UJM A;  1D6U A;  3KII A;  1NO3 A;  3F40 A;  3B4O A;  3A76 A;  1Q42 A;  3JUQ A;  4TX4 A;  4HM3 B;  1V74 A;  2WOF A;  3S28 A;  3CCL 3;  1R4C A;  5A0O B;  1GYB A;  2L4V A;  1VZZ A;  2CKF B;  1AV4 A;  2W03 A;  1VQ5 3;  3CPW 2;  3NV0 A;  1W4N A;  2Z6B A;  4EXR A;  1YGE A;  5CXO A;  3CCS 3;  3HX8 A;  3LYG A;  1W02 A;  3JUM A;  2CFD A;  4HM7 B;  1YHQ 3;  5BXQ A;  3S29 A;  5CK6 A;  2W56 B;  4AKY A;  5KP3 A;  4BTY A;  1IT8 A;  4R9K A;  1GD4 A;  2Z77 A;  3GZR A;  4HM0 B;  2KRT A;  4N6M A;  3K5T A;  1OF5 A;  2K54 A;  2XSO B;  3G0K A;  4N6V 0;  2YFL B;  4XBX A;  3KKG A;  1VQN 3;  4O8S A;  4FMB A;  5I97 A;  4X2H A;  5AII A;  3X3Y A;  2OCT A;  2RGQ A;  2CG0 A;  3K7C A;  1UUW B;  1N5H A;  4HKV B;  3GAX A;  1BUQ A;  2W2C A;  2ML6 A;  5JBS A;  1IVX A;  1O7G B;  3FCS B;  3F14 A;  3MHE A;  4HM4 B;  2BO9 B;  2YX9 A;  4HM2 B;  1QAL A;  1YIJ 3;  1O7N B;  3UNL A;  1IVV A;  2KCD A;  2C11 A;  1LOX A;  4BTX A;  2CWV A;  1STF I;  3F8H A;  4KFD A;  3DZL A;  2CW9 A;  2MF7 A;  3DXO A;  3G71 3;  1E3V A;  1A90 A;  1YJ9 3;  3EBT A;  1US1 A;  1OCV A;  1W7C A;  1IV9 A;  1OH0 A;  1TFO A;  1UI7 A;  2GU1 A;  2OTL 3;  2GBW B;  2P38 A;  3D9R A;  4LZI A;  5LC6 A;  2XGL A;  3IJE B;  3PS8 A;  1A2K A;  4J8T A;  4CDL A;  5D81 A;  3NQZ A;  2YFI B;  1AVL A;  3DMC A;  1KWI A;  3SX1 A;  2WOH A;  3X42 A;  1JN5 A;  3NXJ A;  2CHC A;  4FCM A;  3D3L A;  3EBY A;  3JVC A;  5EQL A;  1STD A;  3JUN A;  1J2B A;  3CCM 3;  3WOF B;  3I0Y A;  3OV4 A;  4XDV A;  1IK3 A;  5ELJ A;  1W2B 2;  3WDG B;  4FMC A;  4G1M B;  4R1K A;  1DYU A;  3JUO A;  2F99 A;  1W5Z A;  4AKZ A;  1JB4 A;  2WGO A;  1LXE A;  3DGN A;  3G16 A;  3ROB A;  1S5A A;  2HMO B;  2XR8 B;  4K61 A;  5IEO A;  1VQ8 3;  1VQL 3;  1JKG B;  3H51 A;  3RGR A;  1KD1 4;  4LMI A;  2OQE C;  1U8C B;  3KE7 A;  4LEH A;  3DUK A;  3Q2P A;  4AEQ A;  1FGO A;  2W56 A;  4HYZ A;  1Q40 A;  3G4S 3;  5DRE A;  1M9G A;  1K73 4;  4XDW A;  4WYK A;  1EG9 B;  4U13 A;  1FUW A;  4RBN A;  3HK4 A;  2O3O A;  7STD A;  4HZB B;  2A15 A;  1VQ6 3;  3HI7 A;  3OWY A;  3GRD A;  3QK9 A;  1EKM A;  5AIH A;  3CC2 3;  4N6O B;  3NBR A;  1CYV A;  5IER A;  2BMQ B;  1K28 A;  2QGU A;  1RRL A;  3LTB A;  4STD A;  5IF6 A;  1IQ8 A;  3MG2 A;  3KZT A;  3CME 3;  1IV7 A;  1UUV B;  3Q1C A;  1U5O A;  3SXX A;  2QA4 3;  4FMA A;  3PZW A;  5KP1 A;  3BB9 A;  1W6C A;  1TP6 A;  2W9P A;  1ASK A;  3FG1 A;  1WQL B;  4LSO A;  1FGT A;  1GY7 A;  1QVG 2;  3F7X A;  2BMR B;  3STD A;  1KQS 2;  3MSO A;  4K1V A;  3OX9 A;  2O9U X;  2P0M A;  2E2T A;  3OWU A;  3I55 3;  1FGM A;  1GY5 A;  2GEX A;  1S72 3;  2ZDJ A;  3K9M C;  1ZO2 A;  4OK0 A;  1OHO A;  1OHS A;  2B24 B;  1M90 4;  1DVD A;  2KXG A;  1PU4 A;  1W6G A;  2JQ5 A;  1NB5 I;  3X3X A;  3FG4 A;  3IMA B;  3FG3 A;  1W00 A;  4KFF A;  5TGN A;  1N8Q A;  3X40 A;  3GZB A;  2W9Q A;  2HMN B;  5CF1 A;  4LGQ A;  3B7C A;  3IPT A;  4HM1 B;  4EV5 A;  6STD A;  3CNX A;  3SOY A;  1Q81 4;  3V92 A;  3GZY B;  3M8C A;  3MG3 A;  3PXM A;  1OHP A;  4KZ1 A;  3CU3 A;  2YFJ B;  4N6N B;  4QWT A;  4N6T A;  4RZM A;  3CC7 3;  3DGO A;  3FKA A;  3B8L A;  1ROV A;  3LOY A;  2IUJ A;  3S5C A;  4JF8 A;  4MMZ B;  3T0U A;  2D1W A;  1D6Z A;  3WOE B;  2CWT A;  1TU5 A;  2BHM A;  1KSI A;  2WGQ A;  2IA7 A;  2Z7A A;  1OUN A;  1RRH A;  1GY6 A;  2HMM B;  4O02 B;  4EYC A;  1N9J A;  2Q07 A;  4HZ9 B;  1M1X B;  1L5G B;  1PFP A;  3AMO A;  4FR9 A;  5IG4 A;  2JDI H;  2CFW A;  5D83 A;  1A2V A;  2PNC A;  1W01 A;  1Y4K A;  3JUP A;  2BMO B;  3LZA A;  3NX0 A;  1N9E A;  1YVB I;  2K0M A;  4HJL B;  2GBX B;  2HML B;  4XM4 A;  5EEO A;  8CHO A;  3ECF A;  4XBT A;  5D82 A;  2OQE A;  5CF2 A;  2XSH B;  3CCJ 3;  3EN1 B;  1K9M 4;  1JB2 A;  1NB3 I;  1SIH A;  1O7P B;  3O8Y A;  4EC6 A;  1K8A 4;  2XFT A;  2CH9 A;  1VQM 3;  3DM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...