1E3VA

Crystal structure of ketosteroid isomerase from psedomonas putida complexed with deoxycholate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
molecule tags Isomerase
source organism Pseudomonas putida
publication title Detection of Large Pka Perturbations of an Inhibitor and a Catalytic Group at an Enzyme Active Site, a Mechanistic Basis for Catalytic Power of Many Enzymes
pubmed doi rcsb
total genus 33
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2000-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1e3vA00
1SJWA 2XRXB 1DMQA 3A76A 3FZWA 1QMAA 6STDA 3G16A 1JB2A 1E3VA 1UUVB 3ER7A 2XSHB 3K0ZA 3HZPA 2HMJB 3UJMA 3UNLA 4OUQA 4LMIA 3NHXA 1E97A 1TP6A 2GEXA 2HMLB 2YFIB 3B4PA 3B4OA 3E99A 3GZYB 2BMQB 3HK4A 3K7CA 5D81A 5DRVA 1O7NB 1IDPA 1OPYA 3ECFA 2YFJB 1E3RA 3FLJA 2INXA 5HGRA 1STDA 1W6YA 4HKVB 5FW5A 3VSYA 1C7HA 1GY6A 1JN5B 1Q40B 2HMMB 4J8TA 2GBWB 3EF8A 4I4KA 2HMKB 3GZBA 5EVHA 4L8PA 3JUQA 5AIHA 1W02A 1OHSA 3B7CA 3F40A 3SEDA 4XBTA 1ZX2A 3H3HA 1W00A 4XBXA 4X2OA 5D83A 4OVMA 3Q90A 3EBTA 1OHOA 1GYBA 1JKGB 3JUMA 2BMOB 7STDA 3D9RA 3KKGA 1ULJB 3MHEA 3NUVA 3SOAA 3G0KA 3OWSA 1ZO2A 3F8XA 5AEUB 2BMRB 5IEOA 4HM6B 1BUQA 2Z76A 4X2HA 3MYTA 2RFRA 1O7GB 3OX9A 1ASKA 4ORLA 4R9LA 3CNXA 4J9AA 4XB5A 5BVBA 2F98A 4HVNA 5AI1A 8CHOA 4U13A 5KP3A 3MKIA 4PEJA 1S5AA 3M8CA 4N3VA 1OGXA 3OWUA 5AIIA 3GWRA 3KZTA 4XDVA 2CHCA 1UUWB 2XSOB 3FF0A 1NU3A 2A15A 3B8LA 2HMOB 3EC9A 3KSPA 4KVHA 1JB4A 5CK6A 2I9WA 4HM2B 2UX0A 1O7WB 1OUNA 4L7KA 1K41A 4XBYA 5AIFA 3FF2A 1O7MB 1WQLB 4R9KA 3RGRA 2JQ5A 3JUOA 1JB5A 2B1XB 4K1UA 3IPTA 4FCMA 1HKXA 3FH1A 3F7XA 5AEWB 5IG5A 5CLKA 5CXOA 2W2CA 2YFLB 3F7SA 4HM0B 3S5CA 2OWPA 4LGQA 4WP5A 1NWWA 1JN5A 1DMMA 1OHPA 1Q40A 3BB9A 3RGAA 5CF2A 2RCDA 3EBYA 3WMDA 1O7HB 5IG0A 3ROBA 3EN8A 3NV0A 3OV4A 5DREA 5G2GA 1VZZA 4RZMA 4STDA 2GEYA 5IG4A 4CDLA 3NXJA 4R1KA 1ISKA 1GY7A 5JPPA 3GRDA 3NM2A 3EN1B 5TGNA 3DMCA 2PZVA 3CU3A 3LYGA 4HM7B 2BNGA 4HM8B 3HX8A 1U5OA 3GZXB 2QGUA 4WYKA 1O7PB 4IIAA 3SOYA 3MG1A 3T8UA 5BXQA 4GB5A 5KP1A 3FKAA 1CQSA 3EX9A 1Z1SA 3F8HA 3MSOA 3NV0B 4L8OA 3EJVA 2RGQA 2CKFB 2GXFA 1DMNA 5IF6A 4HM5B 2GBXB 2IMJA 4MJDA 1OF5B 3H51A 4XDWA 4XM4A 2STDA 3DM8A 3BLZA 3FGYA 1EG9B 3OXAA 1OGZA 5KP4A 1A2KA 1W01A 3CNMA 3MG3A 4Q53A 3EHCA 3NBRA 2XR8B 3LZAA 4HZ9B 5IEPA 5CF1A 5AIGA 1JKGA 5D82A 3CPOA 1NDOB 2F99A 5IERA 2F86B 3T8NA 1TUHA 4HM4B 1OCVA 3FSDA 1EA2A 2QIYA 1AR0A 3F9SA 3GZRA 3JUPA 5STDA 4HZBB 5JPUA 3EQQB 3OWYA 4HM1B 3DZLA 4K1VA 3STDA 4WYKB 5IG3A 2K54A 5IENA 4HJLB 1GS3A 4HM3B 4H3UA 4LEHA 3DXOA 4FCJA 3VGNA 1ULIB 2Z7AA 2Z77A 2HMNB 2R4IA 1QJGA 3F14A 1Q42A 3DUKA 3I0YA 3MG2A 4WWUC 2B24B 3JUNA 1GY5A 1OH0A 1OF5A 3G8ZA 3KE7A
chains in the Genus database with same CATH superfamily
3PYJA 4EV5A 1I70A 2P05A 3LTBA 2Y74A 3K0ZA 1SIHA 1BSDA 3UJMA 1VQ83 1MWTA 1E97A 1TP6A 2HMLB 3ALAA 4MMZB 2HOHA 3B4OA 4NPBA 2XFTA 2BMQB 4O3VA 5DRVA 2CFWA 2P0MA 1BAOA 4N6MA 1IDPA 2KF6A 3CCQ3 1EUIC 2KF3A 2YFJB 1J2BA 3FG4A 2GSPA 2W04A 2W9QA 1GD4A 1C7HA 2XGNA 1GY6A 4O8SA 1Q40B 2HMMB 2F4YA 2W0QA 1LNHA 2V1LA 4I4KA 5M18A 3JUQA 1UCJA 1OHSA 1HYFA 1BVIA 1BNFA 4IPBA 4OVMA 2L1SA 1K9M4 4WHAA 7STDA 3LTDA 1HU9A 3Q2PA 3SXXA 1ULJB 1FA3A 1W7CA 3OWSA 3DGYA 2ZHXB 2ML5A 1DE3A 4OK0A 2XH9A 5M1AA 4X2HA 1IT8A 3X41A 1B3SA 4EBGA 1IT7A 1RGFA 3D3LA 4EYCA 4J9AA 1PYLA 3EB8A 4XB5A 5BVBA 1STFI 1JNQA 3AMOA 8CHOA 1MWSA 4R80A 1GOYA 1FYSA 4PEJA 1A2PA 3CME3 1IVXA 1B21A 1Q7HA 4N6LA 1WTHA 3IMAB 3O8YA 4EC6A 3EC9A 1TFKA 5ELUA 1US1A 2I9WA 2UX0A 1O7WB 1YGEA 2SBLA 1K41A 5AIFA 3TDGA 3FF2A 1O7MB 1WQLB 3CCU3 1Q814 1JBTA 2D42A 1FZUA 1RNTA 5LC7A 4O02B 1BU4A 5AEWB 1K28A 1BNJA 5FGOA 1B27A 2W2CA 2YFLB 3F7SA 1JZOA 3S5CA 2XEPA 2IUJA 1DMMA 1OHPA 1Q40A 1VQN3 3N8BA 3IJEB 2RCDA 4HYZA 3WMDA 5CF2A 1O7HB 1B20A 3ROBA 3OV4A 1L5GB 1CEWI 2MF7A 4STDA 2GEYA 1IU7A 2M7OA 3LOYA 3CCS3 2LQVA 4R1KA 2J8XB 4LSOA 5G1KA 2KXGA 3EN1B 1UUGB 3DMCA 2PZVA 4HM7B 4FMDA 1C54A 3SOYA 4BU4A 3HOHA 3T8UA 3WODG 5KP1A 3PXMA 1B2MA 4KT3B 3EX9A 1Z1SA 1ROVA 1YHQ3 4QWTA 1AVKA 3EJVA 4KZ1A 5GSPA 3X40A 4H61A 1YIJ3 2KAAA 1SARA 3KCHA 4XM4A 3DM8A 3GSPA 1PY3A 1EG9B 3OW22 4DKIA 1BANA 3NBJA 4K90B 2OQEA 3RDEA 3URPA 5IEPA 4HZ9B 2YX9A 1V58A 1RDSA 5AIGA 4EXRA 1LQMB 3T8NA 2P0XA 1TUHA 4FMBA 1X1UA 1UI7A 1EA2A 3N54B 2CC3A 3F9SA 3JUPA 1RN4A 3OWYA 1UW1A 1KQS2 1B2ZA 4WYKB 5IG3A 2K54A 1G96A 2OQEC 2LYXA 3DXOA 4FCJA 3VSYA 3DY5A 3I0YA 5IW9A 1TRPA 3F14A 1Q42A 3KN4A 4AEQA 1GOUA 3JUNA 3UL5A 4AKZA 1GY5A 4G1MB 1D6UA 1JZDA 5BU4A 3KE7A 3MKIA 1I2EA 1I3FA 3WDGB 4N6NB 1JB2A 1E3VA 2QA43 3DGMA 2HMJB 2KRTA 2WOFA 3UNLA 4OUQA 3NHXA 2GEXA 2YFIB 1RKYA 1UGHI 3K7CA 1B2UA 5D81A 2ML6A 1O7NB 4FR9A 2WO0A 3FLJA 2INXA 1STDA 4HKVB 1AVLA 5FW5A 7RNTA 3WR2A 1YIT3 1FUWA 4J5KA 1KC84 3DGNA 2GBWB 1NJI4 3BU4A 1TTOA 1YVBI 3ZG0A 4L8PA 1YI23 1S723 2O3OA 3PZWA 5AIHA 3F40A 4CPKA 4RNTA 3H3HA 4XBXA 3S67A 3X3YA 3EBTA 1GYBA 3JUMA 3D9RA 4FMAA 3D5IA 3KKGA 3Q3FA 1RGLA 1RGGA 2CWUA 3G0KA 4CJNA 5A0OB 2QEX3 1BNIA 1GSPA 3F8XA 5AEUB 1B2XA 3I553 2BMRB 1ZGXA 1BUQA 1EEJA 2Z76A 1LOWA 1IVVA 3CC23 1O7GB 1LOVA 3MWZA 1MWUA 1FW7A 2XGLA 3PS8A 1PU4A 2C4BA 3NM7A 1QVF2 2CX1A 2CFGA 1OGXA 5AIIA 1RLSA 2IY2A 1FGQA 2P09A 3HIIA 2CHCA 1UUWB 4KVHA 4XDVA 3B8LA 1SQWA 3HI7A 1KD14 1N9EA 1NNVA 3K5TA 6GSPA 1OUNA 2KF5A 4L7KA 3AGOA 1RN1A 4JRFA 2B1XB 3LTCA 4K1UA 1F8NA 1ROAA 3X42A 1B2SA 3F7XA 1VQL3 1RRLA 1NB3I 5CLKA 3BNDA 1RN7A 1TFOA 1IQXA 3CCR3 4WP5A 5AYSC 1NWWA 3WA2X 3RGAA 5AYRB 3CMA3 3DGOA 2WGOA 4BTWA 2W56A 3EE1A 1Q9EA 5G2GA 1TRQA 1VZZA 1UDII 1CH0A 5IG4A 4ILFA 1JBRA 7GSPA 1NB5I 1EQKA 1EKMA 3NM2A 1N8QA 1WMOA 1GMPA 1QAFA 1RMSA 2BNGA 3HX8A 1U5OA 3CCE3 1O7PB 1VQK3 3MG1A 4LZIA 1W2B2 1WNHA 1OACA 4FCZA 1VQ93 1FGOA 1RGCA 3F8HA 1RRHA 3MSOA 4L8OA 1VQO3 2RGQA 1BSAA 2CKFB 1QAKA 1TIJA 4CCVA 1AQZA 4HM5B 4MJDA 1OF5B 4NHFA 1BIRA 4N6V0 4K61A 4J5GA 3CD63 1MGRA 3LTAA 3OXAA 3NBBA 5KP4A 1A2KA 1UGIA 2XR8B 5CF1A 3BNBA 2MC8A 1JKGA 5D82A 3CPOA 1NDOB 5IERA 1M904 2F86B 2OTL3 1IQYA 1OCVA 2F5WA 3FSDA 1AR0A 4HZBB 3EQQB 3X3XA 1GMRA 1RCLA 1W6CA 4KFEA 3CPW2 1M9GA 5IENA 3D4AA 2H0HA 3LT9A 4BTYA 3LT8A 5ELJA 1GS3A 4HM3B 2GU3A 1BNEA 2E2TA 2K0MA 3AHSA 3VGNA 2IA7A 2HMNB 2R4IA 3DH2A 4WWUC 2H0GA 1LQGC 2RNTA 1OH0A 3G8ZA 1K734 2BO9B 1DVDA 1M1K4 1SJWA 4KFDA 2XRXB 6STDA 1IQ8A 2FGTA 2W03A 1BNGA 3G16A 1N8R4 1LXEA 1UUVB 1JRQA 1X1XA 2XSHB 3ER7A 3LXUX 4EV2A 3T0UA 3I563 3HZPA 1UCIA 1A67A 1MWRA 4LMIA 3NX0A 2ZL8A 3MG2A 3HK4A 2F56A 3D79A 1RTUA 1OPYA 3ECFA 4HBRA 5HGRA 1VQM3 3PCSA 1W6YA 2OOVA 3K9MC 4RNYA 1JN5B 2CK3H 4J8TA 3S28A 3EF8A 3NQZA 3FG1A 3CCL3 2HMKB 1IYYA 1NO3A 1W02A 3B7CA 1V74A 3SYUA 4XBTA 2C11A 1UCLA 2WGQA 4X2OA 1FGMA 3MPHA 5D83A 3KSED 3Q90A 1OHOA 1LOXA 1JKGB 2W6JH 1RGHA 3SOAA 1ZO2A 4HM6B 3QRDA 1RJOA 3MYTA 2RFRA 3X3ZA 1W6GA 3ZG5A 3WA3A 4R9LA 1BNRA 1FGRA 5G1LA 3UB1A 5BIRA 4HVNA 5AI1A 3SVAA 4U13A 5KP3A 1G0TA 1S5AA 3M8CA 1BRKA 1LNIA 4RNZA 3GWRA 3KZTA 2BHMA 5EQLA 3CXC2 2CFDA 2XSOB 3FG3A 1NU3A 1Y4KA 1SPUA 2HMOB 4MEIA 1JBSA 2E2VA 1AY7A 2CFLA 4N6OB 1VQ63 1IV7A 5JBSA 1BRJA 4EW5A 1GOVA 2CFKA 1HKXA 2K3DA 1BSEA 2CIUA 1FGTA 1MNLA 1RGAA 4LGQA 1Q7Y4 3CC43 1JN5A 3J7Yd 1DVCA 3AMOB 3EN8A 3D5GA 5DREA 2CG0A 2CWVA 1LOYA 4KFFA 2JDIH 1T2HA 2KCDA 2IYJA 1KSIA 3DGLA 1GY7A 1VQ53 3U97A 4IT7A 5JPPA 1G02A 5TGNA 1ISKA 2BIRA 1BGSA 2FNQA 3LYGA 1RGEA 4WYKA 1CYUA 3BIRA 4GL6A 6RNTA 5BXQA 3BNCA 2FXTA 1CQSA 2KF4A 2XF3A 3NV0B 4BL3A 4N6TA 5IF6A 3SLUA 2GBXB 3CCV3 1KWIA 1I2FA 4XDWA 1VQ73 2OCTA 4FMCA 1TJDA 4N6UA 1FUSA 1QALA 1OGZA 2L4VA 1CYVA 1I0XA 1W01A 3MG3A 3EHCA 4HOHA 5I97A 2QIYA 3G713 3AGNA 5JPUA 4HM1B 3STDA 3DZLA 3CCM3 1Q824 2CWTA 3QK9A 1V57A 1BNSA 4HJLB 2O9UX 1I2GA 4H3UA 3UL6A 1BSBA 1IVWA 1BRIA 2SARA 2Z77A 1JJ22 3DUKA 2C10A 2B24B 2D1WA 1W5ZA 2AADA 3AHWA 2E2UA 4WFOA 1RCKA 3NQYA 1FUTA 3V98A 1DMQA 3A76A 3FZWA 1QMAA 1I8VA 2CW9A 2CH9A 4O2HA 4ZM8A 3WOEB 1GD3A 1U8CB 1T3BA 3GZYB 3LH4A 3B4PA 3E99A 3KIIA 3Q1CA 4HAAA 1E3RA 1VQ43 2GU1A 3S29A 1I0VA 3FCSB 3GZBA 5EVHA 1T2IA 1K8A4 1DETA 1M1XB 1YJ93 4BIRA 1ZX2A 1W00A 3G6E3 1LRAA 4NREA 1BRGA 1BOXA 1RSNA 2OOVC 4MMYB 1ZS7A 1WMNA 1IVUA 2BMOB 3MHEA 3NUVA 2F5MA 5IEOA 4RBNA 1W4NA 2H0IA 3OX9A 1ASKA 4ORLA 3CNXA 4R4KA 2F98A 2W56B 1Q864 1R4CA 3GAXA 2Q07A 3PGBA 4N3VA 3OWUA 3A5EA 1GMQA 4JF8A 1HZ1A 1T5YA 1BRSA 3FF0A 3KSPA 1QVG2 2A15A 5RNTA 5CK6A 9RNTA 1JB4A 3SEDA 4HM2B 3RGRA 3CC73 4BTXA 3KFQC 4XBYA 2Y73A 5M19A 1A90A 4R9KA 2JQ5A 3JUOA 1JB5A 2IUKA 3ZFZA 3IPTA 4FCMA 3RNTA 3FH1A 3L0RA 3HIGA 3WHOA 5IG5A 5CXOA 1DYUA 1PFPA 5HOHA 2P38A 4HM0B 1D6ZA 8RNTA 2OWPA 2BU4A 1N5PA 3BB9A 4BL2A 3EBYA 1X1YA 3S27A 1A2VA 5IG0A 3NV0A 2XFSA 1VQP3 1AV4A 4RZMA 2CX0A 4I5QA 1N5HA 1R4YA 4GHOA 3NXJA 3V99A 4CDLA 4GSPA 1W2ZA 3PCRA 3VF1A 3BNEA 4LYLB 3GRDA 1BRHA 3CU3A 3N9HA 1I3IA 4HM8B 2OTJ3 1MGWA 3GZXB 2QGUA 3WOFB 4IIAA 1UI8A 2W9PA 1UCKA 4GB5A 3FKAA 1RHLA 1MOLA 3LMLA 3V92A 2RSXA 2GXFA 1BSCA 1DMNA 1WMPA 1IK3A 1TU5A 1N9JA 2RBIA 1SIIA 2IMJA 3H51A 2PNCA 2STDA 2Z6BA 3BLZA 3FGYA 1VQQA 4MMXB 4Q53A 3CNMA 2R41A 1BUJA 3NBRA 3LZAA 1YJW3 2WOHA 1D6YA 1YNVX 2ZDJA 2F99A 4HM4B 3GZRA 4TX4A 5STDA 1RNBA 1YJN3 4K1VA 1RGKA 2BT3A 2UGIA 3G4S3 3CCJ3 3U1WA 1IV9A 4LEHA 3SX1A 1ULIB 1JV2B 1X1WA 1YVSA 2UUGC 1QJGA 2Z7AA 5LC6A 2CG1A 5EEOA 3K63A 4AKYA 2AAEA 1BRNL 1OF5A 1YGWA 2ZA4A 3JVCA 1LVNA
chains in the Genus database with same CATH topology
3PYJA 4EV5A 2P05A 3LTBA 2Y74A 3K0ZA 1SIHA 3UJMA 1VQ83 1E97A 1TP6A 2HMLB 3ALAA 4MMZB 3B4OA 5DRVA 2XFTA 2BMQB 4O3VA 3CCQ3 2CFWA 2P0MA 4N6MA 1IDPA 2YFJB 1J2BA 3FG4A 2W04A 2W9QA 1GD4A 1C7HA 2XGNA 1GY6A 4O8SA 1Q40B 2HMMB 2W0QA 4I4KA 1LNHA 2V1LA 3JUQA 1OHSA 4IPBA 4OVMA 1K9M4 4WHAA 7STDA 3LTDA 1HU9A 3Q2PA 3SXXA 1ULJB 1FA3A 1W7CA 3OWSA 2ML5A 4OK0A 2XH9A 3X41A 4X2HA 1IT8A 4EBGA 1IT7A 4EYCA 3D3LA 4J9AA 3EB8A 4XB5A 5BVBA 1STFI 1JNQA 3AMOA 8CHOA 4R80A 4PEJA 3CME3 1IVXA 4N6LA 1WTHA 3IMAB 3O8YA 4EC6A 3EC9A 1TFKA 5ELUA 1US1A 2I9WA 2UX0A 1O7WB 1YGEA 2SBLA 1K41A 5AIFA 3TDGA 3FF2A 1O7MB 1WQLB 3CCU3 1Q814 2D42A 5LC7A 4O02B 5AEWB 1K28A 5FGOA 2W2CA 2YFLB 3F7SA 3S5CA 2XEPA 2IUJA 1DMMA 1OHPA 1Q40A 1VQN3 3N8BA 3IJEB 2RCDA 4HYZA 3WMDA 5CF2A 1O7HB 3ROBA 3OV4A 1L5GB 1CEWI 2MF7A 4STDA 2GEYA 1IU7A 2M7OA 3LOYA 3CCS3 2LQVA 4R1KA 4LSOA 2KXGA 3EN1B 3DMCA 2PZVA 4HM7B 4FMDA 3SOYA 3T8UA 3WODG 5KP1A 3PXMA 3EX9A 1Z1SA 1ROVA 1YHQ3 4QWTA 1AVKA 3EJVA 4KZ1A 3X40A 4H61A 1YIJ3 4XM4A 3DM8A 1EG9B 3OW22 3NBJA 4K90B 2OQEA 3RDEA 5IEPA 4HZ9B 2YX9A 4EXRA 5AIGA 3T8NA 2P0XA 1TUHA 4FMBA 1UI7A 1EA2A 3N54B 2CC3A 3F9SA 3JUPA 3OWYA 1UW1A 1KQS2 4WYKB 5IG3A 2K54A 1G96A 2OQEC 2LYXA 3DXOA 4FCJA 3VSYA 3DY5A 3I0YA 5IW9A 3F14A 1Q42A 3KN4A 3JUNA 3UL5A 4AKZA 1GY5A 4G1MB 1D6UA 3KE7A 3MKIA 3WDGB 4N6NB 1JB2A 1E3VA 2QA43 3DGMA 2HMJB 2KRTA 2WOFA 3UNLA 4OUQA 3NHXA 2GEXA 2YFIB 1RKYA 3K7CA 5D81A 2ML6A 1O7NB 4FR9A 2WO0A 3FLJA 2INXA 1STDA 4HKVB 1AVLA 5FW5A 1FUWA 1YIT3 1KC84 3DGNA 2GBWB 1NJI4 1YVBI 4L8PA 1YI23 1S723 2O3OA 3PZWA 5AIHA 3F40A 3H3HA 4XBXA 3S67A 3X3YA 3EBTA 1GYBA 3JUMA 3D9RA 4FMAA 3KKGA 2CWUA 5A0OB 3G0KA 2QEX3 3F8XA 5AEUB 3I553 2BMRB 1BUQA 2Z76A 3CC23 1IVVA 1O7GB 3MWZA 2XGLA 3PS8A 1PU4A 3NM7A 1QVF2 2CFGA 1OGXA 5AIIA 3HIIA 4XDVA 1FGQA 2P09A 2CHCA 1UUWB 4KVHA 3B8LA 1SQWA 3HI7A 1KD14 1N9EA 3K5TA 1OUNA 4L7KA 4JRFA 2B1XB 3LTCA 4K1UA 1F8NA 1ROAA 3X42A 3F7XA 1RRLA 1NB3I 5CLKA 3BNDA 1RN7A 1TFOA 1IQXA 3CCR3 4WP5A 5AYSC 1NWWA 3WA2X 3RGAA 5AYRB 3CMA3 3DGOA 2WGOA 4BTWA 2W56A 3EE1A 5G2GA 1VZZA 5IG4A 1NB5I 1EQKA 1EKMA 3NM2A 1N8QA 1WMOA 1QAFA 2BNGA 3HX8A 1U5OA 3CCE3 1O7PB 1VQK3 3MG1A 4LZIA 1W2B2 1WNHA 1OACA 4FCZA 1VQ93 1FGOA 3F8HA 1RRHA 3MSOA 4L8OA 1VQO3 2RGQA 2CKFB 1QAKA 1TIJA 4CCVA 4HM5B 4MJDA 1OF5B 4NHFA 4N6V0 4K61A 3CD63 3LTAA 3OXAA 3NBBA 5KP4A 1A2KA 2XR8B 5CF1A 3BNBA 2MC8A 1JKGA 5D82A 3CPOA 1NDOB 5IERA 1M904 2F86B 2OTL3 1IQYA 1OCVA 3FSDA 1AR0A 4HZBB 3EQQB 3X3XA 3CPW2 1W6CA 4KFEA 1M9GA 5IENA 3LT9A 4BTYA 3LT8A 5ELJA 1GS3A 4HM3B 2GU3A 2E2TA 2K0MA 3VGNA 2IA7A 2HMNB 2R4IA 4WWUC 1OH0A 3G8ZA 1K734 2BO9B 1DVDA 1M1K4 1SJWA 4KFDA 2XRXB 6STDA 1IQ8A 2FGTA 2W03A 3G16A 1N8R4 1LXEA 1UUVB 1JRQA 3ER7A 2XSHB 4EV2A 3LXUX 3I563 3T0UA 1VQL3 3HZPA 1A67A 4LMIA 3NX0A 2ZL8A 3MG2A 3HK4A 4HBRA 1OPYA 3ECFA 5HGRA 1VQM3 3PCSA 1W6YA 2OOVA 3K9MC 4RNYA 1JN5B 2CK3H 4J8TA 3S28A 3EF8A 3NQZA 3FG1A 3CCL3 2HMKB 1NO3A 1W02A 3B7CA 1V74A 4XBTA 2C11A 2WGQA 4X2OA 1FGMA 3MPHA 5D83A 3KSED 3Q90A 1OHOA 1LOXA 1JKGB 2W6JH 3SOAA 1ZO2A 4HM6B 3QRDA 1RJOA 3MYTA 2RFRA 3X3ZA 1W6GA 3WA3A 4R9LA 1FGRA 3UB1A 4HVNA 5AI1A 3SVAA 4U13A 5KP3A 1S5AA 3M8CA 4RNZA 3GWRA 3KZTA 2BHMA 5EQLA 3CXC2 2CFDA 2XSOB 3FG3A 1NU3A 1Y4KA 1SPUA 2HMOB 4MEIA 2E2VA 2CFLA 4N6OB 1VQ63 1IV7A 5JBSA 2CFKA 1HKXA 2CIUA 1FGTA 1MNLA 4LGQA 1Q7Y4 3CC43 1JN5A 1DVCA 3AMOB 3EN8A 5DREA 2CG0A 2CWVA 4KFFA 2JDIH 2KCDA 1KSIA 3DGLA 1GY7A 1VQ53 3U97A 4IT7A 5JPPA 1ISKA 5TGNA 2FNQA 3LYGA 4WYKA 1CYUA 4GL6A 5BXQA 3BNCA 2FXTA 1CQSA 2XF3A 3NV0B 4N6TA 5IF6A 3SLUA 2GBXB 3CCV3 1KWIA 4XDWA 1VQ73 2OCTA 4FMCA 4N6UA 1QALA 1OGZA 2L4VA 1CYVA 1W01A 3MG3A 3EHCA 5I97A 2QIYA 3G713 5JPUA 4HM1B 3STDA 3DZLA 3CCM3 1Q824 2CWTA 3QK9A 4HJLB 2O9UX 4H3UA 3UL6A 1IVWA 2Z77A 1JJ22 3DUKA 2C10A 2B24B 1W5ZA 2D1WA 2E2UA 4WFOA 3NQYA 3V98A 1DMQA 3A76A 3FZWA 1QMAA 2CW9A 2CH9A 4O2HA 4ZM8A 3WOEB 1GD3A 1U8CB 3GZYB 3LH4A 3B4PA 3E99A 3KIIA 3Q1CA 1E3RA 1VQ43 2GU1A 3S29A 3FCSB 3GZBA 5EVHA 1K8A4 1M1XB 1YJ93 1ZX2A 1W00A 3G6E3 4NREA 4MMYB 2OOVC 1WMNA 1IVUA 2BMOB 3MHEA 3NUVA 5IEOA 4RBNA 1W4NA 3OX9A 1ASKA 4ORLA 3CNXA 4R4KA 2F98A 2W56B 1Q864 1R4CA 3GAXA 2Q07A 3PGBA 4N3VA 3OWUA 4JF8A 1T5YA 3KSPA 3FF0A 1QVG2 2A15A 5CK6A 1JB4A 3SEDA 4HM2B 3RGRA 3CC73 4BTXA 3KFQC 4XBYA 2Y73A 1A90A 4R9KA 2JQ5A 3JUOA 1JB5A 2IUKA 3IPTA 4FCMA 3FH1A 3L0RA 3HIGA 5IG5A 5CXOA 1DYUA 1PFPA 2P38A 4HM0B 1D6ZA 2OWPA 1N5PA 3BB9A 3EBYA 3S27A 1A2VA 5IG0A 3NV0A 2XFSA 1VQP3 1AV4A 4RZMA 1N5HA 3V99A 3NXJA 4CDLA 1W2ZA 3PCRA 3VF1A 3BNEA 3GRDA 3CU3A 3N9HA 4HM8B 2OTJ3 3GZXB 2QGUA 3WOFB 4IIAA 1UI8A 2W9PA 4GB5A 3FKAA 1MOLA 3LMLA 3V92A 2RSXA 2GXFA 1DMNA 1WMPA 1IK3A 1TU5A 1N9JA 1SIIA 2IMJA 3H51A 2PNCA 2STDA 2Z6BA 3BLZA 3FGYA 4MMXB 4Q53A 3CNMA 3NBRA 3LZAA 1YJW3 2WOHA 1D6YA 2ZDJA 2F99A 4HM4B 3GZRA 4TX4A 5STDA 1YJN3 4K1VA 3G4S3 2BT3A 3CCJ3 3U1WA 1IV9A 4LEHA 3SX1A 1ULIB 1JV2B 2Z7AA 5LC6A 2CG1A 1QJGA 4AEQA 3J7Yd 5EEOA 3K63A 4AKYA 1OF5A 3JVCA 1LVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJW A;  2XRX B;  1DMQ A;  3A76 A;  3FZW A;  1QMA A;  6STD A;  3G16 A;  1JB2 A;  1E3V A;  1UUV B;  3ER7 A;  2XSH B;  3K0Z A;  3HZP A;  2HMJ B;  3UJM A;  3UNL A;  4OUQ A;  4LMI A;  3NHX A;  1E97 A;  1TP6 A;  2GEX A;  2HML B;  2YFI B;  3B4P A;  3B4O A;  3E99 A;  3GZY B;  2BMQ B;  3HK4 A;  3K7C A;  5D81 A;  5DRV A;  1O7N B;  1IDP A;  1OPY A;  3ECF A;  2YFJ B;  1E3R A;  3FLJ A;  2INX A;  5HGR A;  1STD A;  1W6Y A;  4HKV B;  5FW5 A;  3VSY A;  1C7H A;  1GY6 A;  1JN5 B;  1Q40 B;  2HMM B;  4J8T A;  2GBW B;  3EF8 A;  4I4K A;  2HMK B;  3GZB A;  5EVH A;  4L8P A;  3JUQ A;  5AIH A;  1W02 A;  1OHS A;  3B7C A;  3F40 A;  3SED A;  4XBT A;  1ZX2 A;  3H3H A;  1W00 A;  4XBX A;  4X2O A;  5D83 A;  4OVM A;  3Q90 A;  3EBT A;  1OHO A;  1GYB A;  1JKG B;  3JUM A;  2BMO B;  7STD A;  3D9R A;  3KKG A;  1ULJ B;  3MHE A;  3NUV A;  3SOA A;  3G0K A;  3OWS A;  1ZO2 A;  3F8X A;  5AEU B;  2BMR B;  5IEO A;  4HM6 B;  1BUQ A;  2Z76 A;  4X2H A;  3MYT A;  2RFR A;  1O7G B;  3OX9 A;  1ASK A;  4ORL A;  4R9L A;  3CNX A;  4J9A A;  4XB5 A;  5BVB A;  2F98 A;  4HVN A;  5AI1 A;  8CHO A;  4U13 A;  5KP3 A;  3MKI A;  4PEJ A;  1S5A A;  3M8C A;  4N3V A;  1OGX A;  3OWU A;  5AII A;  3GWR A;  3KZT A;  4XDV A;  2CHC A;  1UUW B;  2XSO B;  3FF0 A;  1NU3 A;  2A15 A;  3B8L A;  2HMO B;  3EC9 A;  3KSP A;  4KVH A;  1JB4 A;  5CK6 A;  2I9W A;  4HM2 B;  2UX0 A;  1O7W B;  1OUN A;  4L7K A;  1K41 A;  4XBY A;  5AIF A;  3FF2 A;  1O7M B;  1WQL B;  4R9K A;  3RGR A;  2JQ5 A;  3JUO A;  1JB5 A;  2B1X B;  4K1U A;  3IPT A;  4FCM A;  1HKX A;  3FH1 A;  3F7X A;  5AEW B;  5IG5 A;  5CLK A;  5CXO A;  2W2C A;  2YFL B;  3F7S A;  4HM0 B;  3S5C A;  2OWP A;  4LGQ A;  4WP5 A;  1NWW A;  1JN5 A;  1DMM A;  1OHP A;  1Q40 A;  3BB9 A;  3RGA A;  5CF2 A;  2RCD A;  3EBY A;  3WMD A;  1O7H B;  5IG0 A;  3ROB A;  3EN8 A;  3NV0 A;  3OV4 A;  5DRE A;  5G2G A;  1VZZ A;  4RZM A;  4STD A;  2GEY A;  5IG4 A;  4CDL A;  3NXJ A;  4R1K A;  1ISK A;  1GY7 A;  5JPP A;  3GRD A;  3NM2 A;  3EN1 B;  5TGN A;  3DMC A;  2PZV A;  3CU3 A;  3LYG A;  4HM7 B;  2BNG A;  4HM8 B;  3HX8 A;  1U5O A;  3GZX B;  2QGU A;  4WYK A;  1O7P B;  4IIA A;  3SOY A;  3MG1 A;  3T8U A;  5BXQ A;  4GB5 A;  5KP1 A;  3FKA A;  1CQS A;  3EX9 A;  1Z1S A;  3F8H A;  3MSO A;  3NV0 B;  4L8O A;  3EJV A;  2RGQ A;  2CKF B;  2GXF A;  1DMN A;  5IF6 A;  4HM5 B;  2GBX B;  2IMJ A;  4MJD A;  1OF5 B;  3H51 A;  4XDW A;  4XM4 A;  2STD A;  3DM8 A;  3BLZ A;  3FGY A;  1EG9 B;  3OXA A;  1OGZ A;  5KP4 A;  1A2K A;  1W01 A;  3CNM A;  3MG3 A;  4Q53 A;  3EHC A;  3NBR A;  2XR8 B;  3LZA A;  4HZ9 B;  5IEP A;  5CF1 A;  5AIG A;  1JKG A;  5D82 A;  3CPO A;  1NDO B;  2F99 A;  5IER A;  2F86 B;  3T8N A;  1TUH A;  4HM4 B;  1OCV A;  3FSD A;  1EA2 A;  2QIY A;  1AR0 A;  3F9S A;  3GZR A;  3JUP A;  5STD A;  4HZB B;  5JPU A;  3EQQ B;  3OWY A;  4HM1 B;  3DZL A;  4K1V A;  3STD A;  4WYK B;  5IG3 A;  2K54 A;  5IEN A;  4HJL B;  1GS3 A;  4HM3 B;  4H3U A;  4LEH A;  3DXO A;  4FCJ A;  3VGN A;  1ULI B;  2Z7A A;  2Z77 A;  2HMN B;  2R4I A;  1QJG A;  3F14 A;  1Q42 A;  3DUK A;  3I0Y A;  3MG2 A;  4WWU C;  2B24 B;  3JUN A;  1GY5 A;  1OH0 A;  1OF5 A;  3G8Z A;  3KE7 A; 
#chains in the Genus database with same CATH topology
 3PYJ A;  4EV5 A;  1I70 A;  2P05 A;  3LTB A;  2Y74 A;  3K0Z A;  1SIH A;  1BSD A;  3UJM A;  1VQ8 3;  1MWT A;  1E97 A;  1TP6 A;  2HML B;  3ALA A;  4MMZ B;  2HOH A;  3B4O A;  4NPB A;  2XFT A;  2BMQ B;  4O3V A;  5DRV A;  2CFW A;  2P0M A;  1BAO A;  4N6M A;  1IDP A;  2KF6 A;  3CCQ 3;  1EUI C;  2KF3 A;  2YFJ B;  1J2B A;  3FG4 A;  2GSP A;  2W04 A;  2W9Q A;  1GD4 A;  1C7H A;  2XGN A;  1GY6 A;  4O8S A;  1Q40 B;  2HMM B;  2F4Y A;  2W0Q A;  1LNH A;  2V1L A;  4I4K A;  5M18 A;  3JUQ A;  1UCJ A;  1OHS A;  1HYF A;  1BVI A;  1BNF A;  4IPB A;  4OVM A;  2L1S A;  1K9M 4;  4WHA A;  7STD A;  3LTD A;  1HU9 A;  3Q2P A;  3SXX A;  1ULJ B;  1FA3 A;  1W7C A;  3OWS A;  3DGY A;  2ZHX B;  2ML5 A;  1DE3 A;  4OK0 A;  2XH9 A;  5M1A A;  4X2H A;  1IT8 A;  3X41 A;  1B3S A;  4EBG A;  1IT7 A;  1RGF A;  3D3L A;  4EYC A;  4J9A A;  1PYL A;  3EB8 A;  4XB5 A;  5BVB A;  1STF I;  1JNQ A;  3AMO A;  8CHO A;  1MWS A;  4R80 A;  1GOY A;  1FYS A;  4PEJ A;  1A2P A;  3CME 3;  1IVX A;  1B21 A;  1Q7H A;  4N6L A;  1WTH A;  3IMA B;  3O8Y A;  4EC6 A;  3EC9 A;  1TFK A;  5ELU A;  1US1 A;  2I9W A;  2UX0 A;  1O7W B;  1YGE A;  2SBL A;  1K41 A;  5AIF A;  3TDG A;  3FF2 A;  1O7M B;  1WQL B;  3CCU 3;  1Q81 4;  1JBT A;  2D42 A;  1FZU A;  1RNT A;  5LC7 A;  4O02 B;  1BU4 A;  5AEW B;  1K28 A;  1BNJ A;  5FGO A;  1B27 A;  2W2C A;  2YFL B;  3F7S A;  1JZO A;  3S5C A;  2XEP A;  2IUJ A;  1DMM A;  1OHP A;  1Q40 A;  1VQN 3;  3N8B A;  3IJE B;  2RCD A;  4HYZ A;  3WMD A;  5CF2 A;  1O7H B;  1B20 A;  3ROB A;  3OV4 A;  1L5G B;  1CEW I;  2MF7 A;  4STD A;  2GEY A;  1IU7 A;  2M7O A;  3LOY A;  3CCS 3;  2LQV A;  4R1K A;  2J8X B;  4LSO A;  5G1K A;  2KXG A;  3EN1 B;  1UUG B;  3DMC A;  2PZV A;  4HM7 B;  4FMD A;  1C54 A;  3SOY A;  4BU4 A;  3HOH A;  3T8U A;  3WOD G;  5KP1 A;  3PXM A;  1B2M A;  4KT3 B;  3EX9 A;  1Z1S A;  1ROV A;  1YHQ 3;  4QWT A;  1AVK A;  3EJV A;  4KZ1 A;  5GSP A;  3X40 A;  4H61 A;  1YIJ 3;  2KAA A;  1SAR A;  3KCH A;  4XM4 A;  3DM8 A;  3GSP A;  1PY3 A;  1EG9 B;  3OW2 2;  4DKI A;  1BAN A;  3NBJ A;  4K90 B;  2OQE A;  3RDE A;  3URP A;  5IEP A;  4HZ9 B;  2YX9 A;  1V58 A;  1RDS A;  5AIG A;  4EXR A;  1LQM B;  3T8N A;  2P0X A;  1TUH A;  4FMB A;  1X1U A;  1UI7 A;  1EA2 A;  3N54 B;  2CC3 A;  3F9S A;  3JUP A;  1RN4 A;  3OWY A;  1UW1 A;  1KQS 2;  1B2Z A;  4WYK B;  5IG3 A;  2K54 A;  1G96 A;  2OQE C;  2LYX A;  3DXO A;  4FCJ A;  3VSY A;  3DY5 A;  3I0Y A;  5IW9 A;  1TRP A;  3F14 A;  1Q42 A;  3KN4 A;  4AEQ A;  1GOU A;  3JUN A;  3UL5 A;  4AKZ A;  1GY5 A;  4G1M B;  1D6U A;  1JZD A;  5BU4 A;  3KE7 A;  3MKI A;  1I2E A;  1I3F A;  3WDG B;  4N6N B;  1JB2 A;  1E3V A;  2QA4 3;  3DGM A;  2HMJ B;  2KRT A;  2WOF A;  3UNL A;  4OUQ A;  3NHX A;  2GEX A;  2YFI B;  1RKY A;  1UGH I;  3K7C A;  1B2U A;  5D81 A;  2ML6 A;  1O7N B;  4FR9 A;  2WO0 A;  3FLJ A;  2INX A;  1STD A;  4HKV B;  1AVL A;  5FW5 A;  7RNT A;  3WR2 A;  1YIT 3;  1FUW A;  4J5K A;  1KC8 4;  3DGN A;  2GBW B;  1NJI 4;  3BU4 A;  1TTO A;  1YVB I;  3ZG0 A;  4L8P A;  1YI2 3;  1S72 3;  2O3O A;  3PZW A;  5AIH A;  3F40 A;  4CPK A;  4RNT A;  3H3H A;  4XBX A;  3S67 A;  3X3Y A;  3EBT A;  1GYB A;  3JUM A;  3D9R A;  4FMA A;  3D5I A;  3KKG A;  3Q3F A;  1RGL A;  1RGG A;  2CWU A;  3G0K A;  4CJN A;  5A0O B;  2QEX 3;  1BNI A;  1GSP A;  3F8X A;  5AEU B;  1B2X A;  3I55 3;  2BMR B;  1ZGX A;  1BUQ A;  1EEJ A;  2Z76 A;  1LOW A;  1IVV A;  3CC2 3;  1O7G B;  1LOV A;  3MWZ A;  1MWU A;  1FW7 A;  2XGL A;  3PS8 A;  1PU4 A;  2C4B A;  3NM7 A;  1QVF 2;  2CX1 A;  2CFG A;  1OGX A;  5AII A;  1RLS A;  2IY2 A;  1FGQ A;  2P09 A;  3HII A;  2CHC A;  1UUW B;  4KVH A;  4XDV A;  3B8L A;  1SQW A;  3HI7 A;  1KD1 4;  1N9E A;  1NNV A;  3K5T A;  6GSP A;  1OUN A;  2KF5 A;  4L7K A;  3AGO A;  1RN1 A;  4JRF A;  2B1X B;  3LTC A;  4K1U A;  1F8N A;  1ROA A;  3X42 A;  1B2S A;  3F7X A;  1VQL 3;  1RRL A;  1NB3 I;  5CLK A;  3BND A;  1RN7 A;  1TFO A;  1IQX A;  3CCR 3;  4WP5 A;  5AYS C;  1NWW A;  3WA2 X;  3RGA A;  5AYR B;  3CMA 3;  3DGO A;  2WGO A;  4BTW A;  2W56 A;  3EE1 A;  1Q9E A;  5G2G A;  1TRQ A;  1VZZ A;  1UDI I;  1CH0 A;  5IG4 A;  4ILF A;  1JBR A;  7GSP A;  1NB5 I;  1EQK A;  1EKM A;  3NM2 A;  1N8Q A;  1WMO A;  1GMP A;  1QAF A;  1RMS A;  2BNG A;  3HX8 A;  1U5O A;  3CCE 3;  1O7P B;  1VQK 3;  3MG1 A;  4LZI A;  1W2B 2;  1WNH A;  1OAC A;  4FCZ A;  1VQ9 3;  1FGO A;  1RGC A;  3F8H A;  1RRH A;  3MSO A;  4L8O A;  1VQO 3;  2RGQ A;  1BSA A;  2CKF B;  1QAK A;  1TIJ A;  4CCV A;  1AQZ A;  4HM5 B;  4MJD A;  1OF5 B;  4NHF A;  1BIR A;  4N6V 0;  4K61 A;  4J5G A;  3CD6 3;  1MGR A;  3LTA A;  3OXA A;  3NBB A;  5KP4 A;  1A2K A;  1UGI A;  2XR8 B;  5CF1 A;  3BNB A;  2MC8 A;  1JKG A;  5D82 A;  3CPO A;  1NDO B;  5IER A;  1M90 4;  2F86 B;  2OTL 3;  1IQY A;  1OCV A;  2F5W A;  3FSD A;  1AR0 A;  4HZB B;  3EQQ B;  3X3X A;  1GMR A;  1RCL A;  1W6C A;  4KFE A;  3CPW 2;  1M9G A;  5IEN A;  3D4A A;  2H0H A;  3LT9 A;  4BTY A;  3LT8 A;  5ELJ A;  1GS3 A;  4HM3 B;  2GU3 A;  1BNE A;  2E2T A;  2K0M A;  3AHS A;  3VGN A;  2IA7 A;  2HMN B;  2R4I A;  3DH2 A;  4WWU C;  2H0G A;  1LQG C;  2RNT A;  1OH0 A;  3G8Z A;  1K73 4;  2BO9 B;  1DVD A;  1M1K 4;  1SJW A;  4KFD A;  2XRX B;  6STD A;  1IQ8 A;  2FGT A;  2W03 A;  1BNG A;  3G16 A;  1N8R 4;  1LXE A;  1UUV B;  1JRQ A;  1X1X A;  2XSH B;  3ER7 A;  3LXU X;  4EV2 A;  3T0U A;  3I56 3;  3HZP A;  1UCI A;  1A67 A;  1MWR A;  4LMI A;  3NX0 A;  2ZL8 A;  3MG2 A;  3HK4 A;  2F56 A;  3D79 A;  1RTU A;  1OPY A;  3ECF A;  4HBR A;  5HGR A;  1VQM 3;  3PCS A;  1W6Y A;  2OOV A;  3K9M C;  4RNY A;  1JN5 B;  2CK3 H;  4J8T A;  3S28 A;  3EF8 A;  3NQZ A;  3FG1 A;  3CCL 3;  2HMK B;  1IYY A;  1NO3 A;  1W02 A;  3B7C A;  1V74 A;  3SYU A;  4XBT A;  2C11 A;  1UCL A;  2WGQ A;  4X2O A;  1FGM A;  3MPH A;  5D83 A;  3KSE D;  3Q90 A;  1OHO A;  1LOX A;  1JKG B;  2W6J H;  1RGH A;  3SOA A;  1ZO2 A;  4HM6 B;  3QRD A;  1RJO A;  3MYT A;  2RFR A;  3X3Z A;  1W6G A;  3ZG5 A;  3WA3 A;  4R9L A;  1BNR A;  1FGR A;  5G1L A;  3UB1 A;  5BIR A;  4HVN A;  5AI1 A;  3SVA A;  4U13 A;  5KP3 A;  1G0T A;  1S5A A;  3M8C A;  1BRK A;  1LNI A;  4RNZ A;  3GWR A;  3KZT A;  2BHM A;  5EQL A;  3CXC 2;  2CFD A;  2XSO B;  3FG3 A;  1NU3 A;  1Y4K A;  1SPU A;  2HMO B;  4MEI A;  1JBS A;  2E2V A;  1AY7 A;  2CFL A;  4N6O B;  1VQ6 3;  1IV7 A;  5JBS A;  1BRJ A;  4EW5 A;  1GOV A;  2CFK A;  1HKX A;  2K3D A;  1BSE A;  2CIU A;  1FGT A;  1MNL A;  1RGA A;  4LGQ A;  1Q7Y 4;  3CC4 3;  1JN5 A;  3J7Y d;  1DVC A;  3AMO B;  3EN8 A;  3D5G A;  5DRE A;  2CG0 A;  2CWV A;  1LOY A;  4KFF A;  2JDI H;  1T2H A;  2KCD A;  2IYJ A;  1KSI A;  3DGL A;  1GY7 A;  1VQ5 3;  3U97 A;  4IT7 A;  5JPP A;  1G02 A;  5TGN A;  1ISK A;  2BIR A;  1BGS A;  2FNQ A;  3LYG A;  1RGE A;  4WYK A;  1CYU A;  3BIR A;  4GL6 A;  6RNT A;  5BXQ A;  3BNC A;  2FXT A;  1CQS A;  2KF4 A;  2XF3 A;  3NV0 B;  4BL3 A;  4N6T A;  5IF6 A;  3SLU A;  2GBX B;  3CCV 3;  1KWI A;  1I2F A;  4XDW A;  1VQ7 3;  2OCT A;  4FMC A;  1TJD A;  4N6U A;  1FUS A;  1QAL A;  1OGZ A;  2L4V A;  1CYV A;  1I0X A;  1W01 A;  3MG3 A;  3EHC A;  4HOH A;  5I97 A;  2QIY A;  3G71 3;  3AGN A;  5JPU A;  4HM1 B;  3STD A;  3DZL A;  3CCM 3;  1Q82 4;  2CWT A;  3QK9 A;  1V57 A;  1BNS A;  4HJL B;  2O9U X;  1I2G A;  4H3U A;  3UL6 A;  1BSB A;  1IVW A;  1BRI A;  2SAR A;  2Z77 A;  1JJ2 2;  3DUK A;  2C10 A;  2B24 B;  2D1W A;  1W5Z A;  2AAD A;  3AHW A;  2E2U A;  4WFO A;  1RCK A;  3NQY A;  1FUT A;  3V98 A;  1DMQ A;  3A76 A;  3FZW A;  1QMA A;  1I8V A;  2CW9 A;  2CH9 A;  4O2H A;  4ZM8 A;  3WOE B;  1GD3 A;  1U8C B;  1T3B A;  3GZY B;  3LH4 A;  3B4P A;  3E99 A;  3KII A;  3Q1C A;  4HAA A;  1E3R A;  1VQ4 3;  2GU1 A;  3S29 A;  1I0V A;  3FCS B;  3GZB A;  5EVH A;  1T2I A;  1K8A 4;  1DET A;  1M1X B;  1YJ9 3;  4BIR A;  1ZX2 A;  1W00 A;  3G6E 3;  1LRA A;  4NRE A;  1BRG A;  1BOX A;  1RSN A;  2OOV C;  4MMY B;  1ZS7 A;  1WMN A;  1IVU A;  2BMO B;  3MHE A;  3NUV A;  2F5M A;  5IEO A;  4RBN A;  1W4N A;  2H0I A;  3OX9 A;  1ASK A;  4ORL A;  3CNX A;  4R4K A;  2F98 A;  2W56 B;  1Q86 4;  1R4C A;  3GAX A;  2Q07 A;  3PGB A;  4N3V A;  3OWU A;  3A5E A;  1GMQ A;  4JF8 A;  1HZ1 A;  1T5Y A;  1BRS A;  3FF0 A;  3KSP A;  1QVG 2;  2A15 A;  5RNT A;  5CK6 A;  9RNT A;  1JB4 A;  3SED A;  4HM2 B;  3RGR A;  3CC7 3;  4BTX A;  3KFQ C;  4XBY A;  2Y73 A;  5M19 A;  1A90 A;  4R9K A;  2JQ5 A;  3JUO A;  1JB5 A;  2IUK A;  3ZFZ A;  3IPT A;  4FCM A;  3RNT A;  3FH1 A;  3L0R A;  3HIG A;  3WHO A;  5IG5 A;  5CXO A;  1DYU A;  1PFP A;  5HOH A;  2P38 A;  4HM0 B;  1D6Z A;  8RNT A;  2OWP A;  2BU4 A;  1N5P A;  3BB9 A;  4BL2 A;  3EBY A;  1X1Y A;  3S27 A;  1A2V A;  5IG0 A;  3NV0 A;  2XFS A;  1VQP 3;  1AV4 A;  4RZM A;  2CX0 A;  4I5Q A;  1N5H A;  1R4Y A;  4GHO A;  3NXJ A;  3V99 A;  4CDL A;  4GSP A;  1W2Z A;  3PCR A;  3VF1 A;  3BNE A;  4LYL B;  3GRD A;  1BRH A;  3CU3 A;  3N9H A;  1I3I A;  4HM8 B;  2OTJ 3;  1MGW A;  3GZX B;  2QGU A;  3WOF B;  4IIA A;  1UI8 A;  2W9P A;  1UCK A;  4GB5 A;  3FKA A;  1RHL A;  1MOL A;  3LML A;  3V92 A;  2RSX A;  2GXF A;  1BSC A;  1DMN A;  1WMP A;  1IK3 A;  1TU5 A;  1N9J A;  2RBI A;  1SII A;  2IMJ A;  3H51 A;  2PNC A;  2STD A;  2Z6B A;  3BLZ A;  3FGY A;  1VQQ A;  4MMX B;  4Q53 A;  3CNM A;  2R41 A;  1BUJ A;  3NBR A;  3LZA A;  1YJW 3;  2WOH A;  1D6Y A;  1YNV X;  2ZDJ A;  2F99 A;  4HM4 B;  3GZR A;  4TX4 A;  5STD A;  1RNB A;  1YJN 3;  4K1V A;  1RGK A;  2BT3 A;  2UGI A;  3G4S 3;  3CCJ 3;  3U1W A;  1IV9 A;  4LEH A;  3SX1 A;  1ULI B;  1JV2 B;  1X1W A;  1YVS A;  2UUG C;  1QJG A;  2Z7A A;  5LC6 A;  2CG1 A;  5EEO A;  3K63 A;  4AKY A;  2AAE A;  1BRN L;  1OF5 A;  1YGW A;  2ZA4 A;  3JVC A;  1LVN A; 
#chains in the Genus database with same CATH homology
 3PYJ A;  4EV5 A;  2P05 A;  3LTB A;  2Y74 A;  3K0Z A;  1SIH A;  3UJM A;  1VQ8 3;  1E97 A;  1TP6 A;  2HML B;  3ALA A;  4MMZ B;  3B4O A;  5DRV A;  2XFT A;  2BMQ B;  4O3V A;  3CCQ 3;  2CFW A;  2P0M A;  4N6M A;  1IDP A;  2YFJ B;  1J2B A;  3FG4 A;  2W04 A;  2W9Q A;  1GD4 A;  1C7H A;  2XGN A;  1GY6 A;  4O8S A;  1Q40 B;  2HMM B;  2W0Q A;  4I4K A;  1LNH A;  2V1L A;  3JUQ A;  1OHS A;  4IPB A;  4OVM A;  1K9M 4;  4WHA A;  7STD A;  3LTD A;  1HU9 A;  3Q2P A;  3SXX A;  1ULJ B;  1FA3 A;  1W7C A;  3OWS A;  2ML5 A;  4OK0 A;  2XH9 A;  3X41 A;  4X2H A;  1IT8 A;  4EBG A;  1IT7 A;  4EYC A;  3D3L A;  4J9A A;  3EB8 A;  4XB5 A;  5BVB A;  1STF I;  1JNQ A;  3AMO A;  8CHO A;  4R80 A;  4PEJ A;  3CME 3;  1IVX A;  4N6L A;  1WTH A;  3IMA B;  3O8Y A;  4EC6 A;  3EC9 A;  1TFK A;  5ELU A;  1US1 A;  2I9W A;  2UX0 A;  1O7W B;  1YGE A;  2SBL A;  1K41 A;  5AIF A;  3TDG A;  3FF2 A;  1O7M B;  1WQL B;  3CCU 3;  1Q81 4;  2D42 A;  5LC7 A;  4O02 B;  5AEW B;  1K28 A;  5FGO A;  2W2C A;  2YFL B;  3F7S A;  3S5C A;  2XEP A;  2IUJ A;  1DMM A;  1OHP A;  1Q40 A;  1VQN 3;  3N8B A;  3IJE B;  2RCD A;  4HYZ A;  3WMD A;  5CF2 A;  1O7H B;  3ROB A;  3OV4 A;  1L5G B;  1CEW I;  2MF7 A;  4STD A;  2GEY A;  1IU7 A;  2M7O A;  3LOY A;  3CCS 3;  2LQV A;  4R1K A;  4LSO A;  2KXG A;  3EN1 B;  3DMC A;  2PZV A;  4HM7 B;  4FMD A;  3SOY A;  3T8U A;  3WOD G;  5KP1 A;  3PXM A;  3EX9 A;  1Z1S A;  1ROV A;  1YHQ 3;  4QWT A;  1AVK A;  3EJV A;  4KZ1 A;  3X40 A;  4H61 A;  1YIJ 3;  4XM4 A;  3DM8 A;  1EG9 B;  3OW2 2;  3NBJ A;  4K90 B;  2OQE A;  3RDE A;  5IEP A;  4HZ9 B;  2YX9 A;  4EXR A;  5AIG A;  3T8N A;  2P0X A;  1TUH A;  4FMB A;  1UI7 A;  1EA2 A;  3N54 B;  2CC3 A;  3F9S A;  3JUP A;  3OWY A;  1UW1 A;  1KQS 2;  4WYK B;  5IG3 A;  2K54 A;  1G96 A;  2OQE C;  2LYX A;  3DXO A;  4FCJ A;  3VSY A;  3DY5 A;  3I0Y A;  5IW9 A;  3F14 A;  1Q42 A;  3KN4 A;  3JUN A;  3UL5 A;  4AKZ A;  1GY5 A;  4G1M B;  1D6U A;  3KE7 A;  3MKI A;  3WDG B;  4N6N B;  1JB2 A;  1E3V A;  2QA4 3;  3DGM A;  2HMJ B;  2KRT A;  2WOF A;  3UNL A;  4OUQ A;  3NHX A;  2GEX A;  2YFI B;  1RKY A;  3K7C A;  5D81 A;  2ML6 A;  1O7N B;  4FR9 A;  2WO0 A;  3FLJ A;  2INX A;  1STD A;  4HKV B;  1AVL A;  5FW5 A;  1FUW A;  1YIT 3;  1KC8 4;  3DGN A;  2GBW B;  1NJI 4;  1YVB I;  4L8P A;  1YI2 3;  1S72 3;  2O3O A;  3PZW A;  5AIH A;  3F40 A;  3H3H A;  4XBX A;  3S67 A;  3X3Y A;  3EBT A;  1GYB A;  3JUM A;  3D9R A;  4FMA A;  3KKG A;  2CWU A;  5A0O B;  3G0K A;  2QEX 3;  3F8X A;  5AEU B;  3I55 3;  2BMR B;  1BUQ A;  2Z76 A;  3CC2 3;  1IVV A;  1O7G B;  3MWZ A;  2XGL A;  3PS8 A;  1PU4 A;  3NM7 A;  1QVF 2;  2CFG A;  1OGX A;  5AII A;  3HII A;  4XDV A;  1FGQ A;  2P09 A;  2CHC A;  1UUW B;  4KVH A;  3B8L A;  1SQW A;  3HI7 A;  1KD1 4;  1N9E A;  3K5T A;  1OUN A;  4L7K A;  4JRF A;  2B1X B;  3LTC A;  4K1U A;  1F8N A;  1ROA A;  3X42 A;  3F7X A;  1RRL A;  1NB3 I;  5CLK A;  3BND A;  1RN7 A;  1TFO A;  1IQX A;  3CCR 3;  4WP5 A;  5AYS C;  1NWW A;  3WA2 X;  3RGA A;  5AYR B;  3CMA 3;  3DGO A;  2WGO A;  4BTW A;  2W56 A;  3EE1 A;  5G2G A;  1VZZ A;  5IG4 A;  1NB5 I;  1EQK A;  1EKM A;  3NM2 A;  1N8Q A;  1WMO A;  1QAF A;  2BNG A;  3HX8 A;  1U5O A;  3CCE 3;  1O7P B;  1VQK 3;  3MG1 A;  4LZI A;  1W2B 2;  1WNH A;  1OAC A;  4FCZ A;  1VQ9 3;  1FGO A;  3F8H A;  1RRH A;  3MSO A;  4L8O A;  1VQO 3;  2RGQ A;  2CKF B;  1QAK A;  1TIJ A;  4CCV A;  4HM5 B;  4MJD A;  1OF5 B;  4NHF A;  4N6V 0;  4K61 A;  3CD6 3;  3LTA A;  3OXA A;  3NBB A;  5KP4 A;  1A2K A;  2XR8 B;  5CF1 A;  3BNB A;  2MC8 A;  1JKG A;  5D82 A;  3CPO A;  1NDO B;  5IER A;  1M90 4;  2F86 B;  2OTL 3;  1IQY A;  1OCV A;  3FSD A;  1AR0 A;  4HZB B;  3EQQ B;  3X3X A;  3CPW 2;  1W6C A;  4KFE A;  1M9G A;  5IEN A;  3LT9 A;  4BTY A;  3LT8 A;  5ELJ A;  1GS3 A;  4HM3 B;  2GU3 A;  2E2T A;  2K0M A;  3VGN A;  2IA7 A;  2HMN B;  2R4I A;  4WWU C;  1OH0 A;  3G8Z A;  1K73 4;  2BO9 B;  1DVD A;  1M1K 4;  1SJW A;  4KFD A;  2XRX B;  6STD A;  1IQ8 A;  2FGT A;  2W03 A;  3G16 A;  1N8R 4;  1LXE A;  1UUV B;  1JRQ A;  3ER7 A;  2XSH B;  4EV2 A;  3LXU X;  3I56 3;  3T0U A;  1VQL 3;  3HZP A;  1A67 A;  4LMI A;  3NX0 A;  2ZL8 A;  3MG2 A;  3HK4 A;  4HBR A;  1OPY A;  3ECF A;  5HGR A;  1VQM 3;  3PCS A;  1W6Y A;  2OOV A;  3K9M C;  4RNY A;  1JN5 B;  2CK3 H;  4J8T A;  3S28 A;  3EF8 A;  3NQZ A;  3FG1 A;  3CCL 3;  2HMK B;  1NO3 A;  1W02 A;  3B7C A;  1V74 A;  4XBT A;  2C11 A;  2WGQ A;  4X2O A;  1FGM A;  3MPH A;  5D83 A;  3KSE D;  3Q90 A;  1OHO A;  1LOX A;  1JKG B;  2W6J H;  3SOA A;  1ZO2 A;  4HM6 B;  3QRD A;  1RJO A;  3MYT A;  2RFR A;  3X3Z A;  1W6G A;  3WA3 A;  4R9L A;  1FGR A;  3UB1 A;  4HVN A;  5AI1 A;  3SVA A;  4U13 A;  5KP3 A;  1S5A A;  3M8C A;  4RNZ A;  3GWR A;  3KZT A;  2BHM A;  5EQL A;  3CXC 2;  2CFD A;  2XSO B;  3FG3 A;  1NU3 A;  1Y4K A;  1SPU A;  2HMO B;  4MEI A;  2E2V A;  2CFL A;  4N6O B;  1VQ6 3;  1IV7 A;  5JBS A;  2CFK A;  1HKX A;  2CIU A;  1FGT A;  1MNL A;  4LGQ A;  1Q7Y 4;  3CC4 3;  1JN5 A;  1DVC A;  3AMO B;  3EN8 A;  5DRE A;  2CG0 A;  2CWV A;  4KFF A;  2JDI H;  2KCD A;  1KSI A;  3DGL A;  1GY7 A;  1VQ5 3;  3U97 A;  4IT7 A;  5JPP A;  1ISK A;  5TGN A;  2FNQ A;  3LYG A;  4WYK A;  1CYU A;  4GL6 A;  5BXQ A;  3BNC A;  2FXT A;  1CQS A;  2XF3 A;  3NV0 B;  4N6T A;  5IF6 A;  3SLU A;  2GBX B;  3CCV 3;  1KWI A;  4XDW A;  1VQ7 3;  2OCT A;  4FMC A;  4N6U A;  1QAL A;  1OGZ A;  2L4V A;  1CYV A;  1W01 A;  3MG3 A;  3EHC A;  5I97 A;  2QIY A;  3G71 3;  5JPU A;  4HM1 B;  3STD A;  3DZL A;  3CCM 3;  1Q82 4;  2CWT A;  3QK9 A;  4HJL B;  2O9U X;  4H3U A;  3UL6 A;  1IVW A;  2Z77 A;  1JJ2 2;  3DUK A;  2C10 A;  2B24 B;  1W5Z A;  2D1W A;  2E2U A;  4WFO A;  3NQY A;  3V98 A;  1DMQ A;  3A76 A;  3FZW A;  1QMA A;  2CW9 A;  2CH9 A;  4O2H A;  4ZM8 A;  3WOE B;  1GD3 A;  1U8C B;  3GZY B;  3LH4 A;  3B4P A;  3E99 A;  3KII A;  3Q1C A;  1E3R A;  1VQ4 3;  2GU1 A;  3S29 A;  3FCS B;  3GZB A;  5EVH A;  1K8A 4;  1M1X B;  1YJ9 3;  1ZX2 A;  1W00 A;  3G6E 3;  4NRE A;  4MMY B;  2OOV C;  1WMN A;  1IVU A;  2BMO B;  3MHE A;  3NUV A;  5IEO A;  4RBN A;  1W4N A;  3OX9 A;  1ASK A;  4ORL A;  3CNX A;  4R4K A;  2F98 A;  2W56 B;  1Q86 4;  1R4C A;  3GAX A;  2Q07 A;  3PGB A;  4N3V A;  3OWU A;  4JF8 A;  1T5Y A;  3KSP A;  3FF0 A;  1QVG 2;  2A15 A;  5CK6 A;  1JB4 A;  3SED A;  4HM2 B;  3RGR A;  3CC7 3;  4BTX A;  3KFQ C;  4XBY A;  2Y73 A;  1A90 A;  4R9K A;  2JQ5 A;  3JUO A;  1JB5 A;  2IUK A;  3IPT A;  4FCM A;  3FH1 A;  3L0R A;  3HIG A;  5IG5 A;  5CXO A;  1DYU A;  1PFP A;  2P38 A;  4HM0 B;  1D6Z A;  2OWP A;  1N5P A;  3BB9 A;  3EBY A;  3S27 A;  1A2V A;  5IG0 A;  3NV0 A;  2XFS A;  1VQP 3;  1AV4 A;  4RZM A;  1N5H A;  3V99 A;  3NXJ A;  4CDL A;  1W2Z A;  3PCR A;  3VF1 A;  3BNE A;  3GRD A;  3CU3 A;  3N9H A;  4HM8 B;  2OTJ 3;  3GZX B;  2QGU A;  3WOF B;  4IIA A;  1UI8 A;  2W9P A;  4GB5 A;  3FKA A;  1MOL A;  3LML A;  3V92 A;  2RSX A;  2GXF A;  1DMN A;  1WMP A;  1IK3 A;  1TU5 A;  1N9J A;  1SII A;  2IMJ A;  3H51 A;  2PNC A;  2STD A;  2Z6B A;  3BLZ A;  3FGY A;  4MMX B;  4Q53 A;  3CNM A;  3NBR A;  3LZA A;  1YJW 3;  2WOH A;  1D6Y A;  2ZDJ A;  2F99 A;  4HM4 B;  3GZR A;  4TX4 A;  5STD A;  1YJN 3;  4K1V A;  3G4S 3;  2BT3 A;  3CCJ 3;  3U1W A;  1IV9 A;  4LEH A;  3SX1 A;  1ULI B;  1JV2 B;  2Z7A A;  5LC6 A;  2CG1 A;  1QJG A;  4AEQ A;  3J7Y d;  5EEO A;  3K63 A;  4AKY A;  1OF5 A;  3JVC A;  1LVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...