2RFRA

Crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
154
Chain Sequence
GMDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALMADGCAHFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_001166107.1) from Novosphingobium aromaticivorans DSM 12444 at 1.16 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Unknown function
total genus 56
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rfrA00
5IF6A 5AIFA 1ZO2A 3B4OA 5EVHA 4WYKB 3JUMA 1OHOA 3Q90A 4HVNA 3MHEA 2W2CA 5AI1A 1NWWA 1W6YA 4R9KA 3K0ZA 5CLKA 3OWYA 1OF5B 3WMDA 1QMAA 4L8OA 5AEUB 1S5AA 3NXJA 1SJWA 3JUPA 3CNXA 4HM8B 1W00A 2F86B 4OVMA 3EF8A 1ZX2A 4Q53A 1DMQA 2GXFA 5DREA 2R4IA 1WQLB 3B7CA 4WYKA 1BUQA 4LEHA 1ISKA 4HZBB 2CHCA 4XBTA 5IEPA 4L8PA 2A15A 1TUHA 5CXOA 5IG5A 3M8CA 5AEWB 3DXOA 3GZBA 1JB4A 1OF5A 3ROBA 3ER7A 2BMRB 1GY7A 3EJVA 1JKGB 2INXA 4PEJA 3EC9A 1E97A 1EG9B 4XBYA 5D82A 3MSOA 3FLJA 1VZZA 4HM3B 5D83A 2UX0A 2Z77A 3GZXB 3G16A 4HM2B 4WP5A 3DUKA 4J9AA 3OXAA 2HMMB 2HMNB 1O7HB 2HMOB 1OCVA 1DMNA 1C7HA 2YFLB 3KZTA 4CDLA 2HMKB 3OV4A 5IERA 3OWSA 4HKVB 3GWRA 5JPUA 4K1VA 3SOAA 1JKGA 1O7WB 5KP3A 4H3UA 2QIYA 1OGZA 1OPYA 1CQSA 2QGUA 4HM6B 3EQQB 5HGRA 5IG3A 3KE7A 4WWUC 3MKIA 1OHPA 2PZVA 3IPTA 3BLZA 4HM0B 8CHOA 4HM1B 3NV0B 3FF2A 3JUOA 3B4PA 1K41A 5KP4A 1JN5B 3EHCA 7STDA 3ECFA 4X2HA 4J8TA 1A2KA 1OH0A 2B24B 5STDA 4HM7B 3F8XA 3F40A 3H51A 4RZMA 1U5OA 3F14A 3EN8A 5AIGA 2HMJB 3MG1A 5IG4A 2BMOB 3FSDA 4KVHA 4OUQA 2GBWB 3MG2A 3CPOA 1W01A 4HM4B 5BXQA 5JPPA 3SOYA 3RGAA 1OHSA 2BMQB 1ULIB 3NV0A 2OWPA 3DZLA 1TP6A 3A76A 1JN5A 3F8HA 3EN1B 2XSHB 5IENA 2HMLB 3KKGA 3JUQA 4K1UA 4LGQA 4FCMA 3I0YA 4GB5A 3DM8A 5CK6A 2JQ5A 3NHXA 3UNLA 5DRVA 4STDA 2GEYA 2IMJA 3NBRA 2XRXB 3D9RA 1UUVB 5KP1A 3E99A 3B8LA 1GYBA 3VGNA 5AIHA 1ULJB 3G8ZA 3JUNA 2Z7AA 1GS3A 3HK4A 5IEOA 4XDVA 3K7CA 3HX8A 3KSPA 5CF1A 3T8NA 1QJGA 3OWUA 3FZWA 3FKAA 2B1XB 1JB5A 3HZPA 2RGQA 3GZYB 4R1KA 3NUVA 1AR0A 1W02A 3S5CA 1STDA 4HZ9B 3F9SA 3F7SA 2XSOB 3GZRA 5BVBA 4XM4A 5TGNA 2F99A 4XDWA 2XR8B 4MJDA 1ASKA 1Q40B 1O7MB 4R9LA 1GY5A 1GY6A 1Q42A 1O7NB 3FF0A 3OX9A 4N3VA 2Z76A 5D81A 2CKFB 3EBYA 4X2OA 2GBXB 1HKXA 4L7KA 2I9WA 1DMMA 2BNGA 2YFIB 3LZAA 5FW5A 2YFJB 4XB5A 3VSYA 3EBTA 1JB2A 3MYTA 3UJMA 3G0KA 3H3HA 1UUWB 4HM5B 3BB9A 5G2GA 3FH1A 5CF2A 3NM2A 3SEDA 1Q40A 5IG0A 1O7PB 3T8UA 1OGXA 3GRDA 1NU3A 1E3RA 4IIAA 4LMIA 2RFRA 3MG3A 3CU3A 1OUNA 3DMCA 2F98A 4XBXA 5AIIA 4HJLB 4ORLA 4U13A 3CNMA 2RCDA 1IDPA 1EA2A 3RGRA 3F7XA 4I4KA 6STDA 2STDA 2K54A 1NDOB 1O7GB 1E3VA 2GEXA 3FGYA 3EX9A 3LYGA 1Z1SA 4FCJA 3STDA
chains in the Genus database with same CATH superfamily
2IUKA 2IA7A 5IF6A 1BANA 2F56A 3AHSA 1YIJ3 4RNTA 5AIFA 2V1LA 1B27A 2BHMA 1ZO2A 3B4OA 4TX4A 4WYKB 5EVHA 3JUMA 2P0XA 4EW5A 2KCDA 1YJW3 1OHOA 3Q90A 1FYSA 4HVNA 1N9JA 4G1MB 3UL6A 3X3XA 3MHEA 2W2CA 5AI1A 1NWWA 1I70A 3SVAA 1BNSA 1W6YA 4DKIA 1A2PA 1AY7A 4R9KA 3K0ZA 3V98A 2BT3A 3S27A 1VQ83 1BRKA 1EKMA 2K3DA 1I2FA 3OWYA 1RTUA 5CLKA 1Q824 1OF5B 4RNZA 3S67A 4FMBA 3WMDA 3G713 3CCS3 1IVXA 1QMAA 1I0XA 3D3LA 4BL2A 2PNCA 2WO0A 3FG1A 4L8OA 5AEUB 1S5AA 3NXJA 1SJWA 2BU4A 5EQLA 3N9HA 3D79A 4CCVA 1YVSA 1SQWA 1T3BA 4ZM8A 3JUPA 1LOVA 1FZUA 3BIRA 1N5PA 3CNXA 3J7Yd 4HM8B 1RRLA 2Q07A 4MMZB 1M904 1W00A 2F86B 1NNVA 1SARA 3EF8A 4N6NB 4OVMA 1TRPA 3N54B 1ZX2A 3PCSA 4Q53A 4EC6A 2CK3H 1DMQA 2C10A 2GXFA 1LOXA 1QALA 5DREA 3PYJA 3SYUA 1W4NA 1JJ22 2R4IA 1WQLB 1RKYA 2IYJA 3BU4A 3B7CA 1B2XA 1V58A 4WYKA 1BUQA 1JZDA 1IT8A 4LEHA 5G1KA 1ISKA 1JV2B 4HZBB 2CHCA 4XBTA 5IEPA 4L8PA 5AYSC 8RNTA 3I563 2P09A 2A15A 1AVKA 3RDEA 3G6E3 1B2MA 1TUHA 2ML6A 2MC8A 5CXOA 5IG5A 1G02A 3DGNA 3NBJA 3M8CA 1WMOA 4N6UA 5AEWB 3DXOA 3GZBA 4IPBA 4R4KA 2WOHA 1L5GB 2IUJA 1JB4A 1OF5A 1PFPA 4EBGA 5M18A 2OQEA 3ROBA 1GSPA 2RSXA 3ER7A 1LXEA 4GL6A 2BMRB 3CCL3 1LQMB 3LMLA 1GY7A 3EJVA 1T2HA 1JKGB 2JDIH 2INXA 4PEJA 1QAKA 1HYFA 3EC9A 1E97A 1MWUA 1FW7A 3WOFB 1EG9B 1SPUA 4XBYA 5D82A 1UGIA 3MSOA 3CPW2 1VQN3 3FLJA 1VZZA 4HM3B 1BNFA 1EEJA 2UX0A 4KT3B 5D83A 2Z77A 3GZXB 2KF5A 3CD63 1VQQA 3SXXA 2MF7A 5AYRB 3G16A 1I2EA 1V57A 1FUWA 1G0TA 4HM2B 4WP5A 9RNTA 3D5IA 4BL3A 3DUKA 1ZGXA 4J9AA 3OXAA 4MMYB 1FGOA 1Q9EA 3CXC2 4N6OB 2HMMB 1W7CA 1GOVA 1GMRA 1D6ZA 1JNQA 1LOWA 3DY5A 4IT7A 2HMNB 2ZHXB 4BTWA 3T0UA 4FMCA 2H0GA 1A90A 1O7HB 2HMOB 1OCVA 5M19A 1DMNA 1C7HA 1GMPA 2YFLB 3KZTA 3STDA 3K9MC 4NHFA 1RNBA 4EV2A 4CDLA 1EUIC 1T2IA 2HMKB 7RNTA 2P0MA 3DH2A 2W03A 4LSOA 1N5HA 2W9QA 3LH4A 3OV4A 4N6LA 3LT8A 3OWSA 4HKVB 3S29A 3GWRA 3U97A 1X1XA 5IERA 4K1VA 5JPUA 2F4YA 4H61A 3SOAA 1JKGA 1Q864 1HZ1A 1O7WB 4LYLB 5KP3A 2GSPA 4H3UA 4AKYA 2QIYA 1OGZA 3LT9A 1BRIA 2BO9B 1OPYA 1NO3A 1A67A 1CQSA 1RGKA 1LNHA 5RNTA 1EQKA 2FNQA 1WNHA 2QGUA 1BRJA 4HM6B 3EQQB 1LOYA 5HGRA 4BIRA 1GD3A 1RSNA 5IG3A 1Y4KA 3KE7A 3LTDA 1S723 4WWUC 4BTYA 3CC73 3PS8A 4R80A 3MKIA 1B3SA 1OHPA 2PZVA 5G1LA 3N8BA 3IPTA 1LQGC 3NBBA 3BLZA 1JBRA 1QVG2 4HM0B 8CHOA 2CWVA 4HM1B 3D4AA 1Q7Y4 3BNEA 4AEQA 3NV0B 4HOHA 3FF2A 3WR2A 2SBLA 1JBSA 1BRHA 1FUTA 3JUOA 1VQ63 3B4PA 3LOYA 1NJI4 2W6JH 1TRQA 2WGQA 1K41A 1UCKA 5KP4A 1VQ43 1YIT3 1JN5B 3EHCA 5A0OB 1K28A 7GSPA 7STDA 1Q7HA 4KZ1A 3ECFA 1RCKA 1CEWI 1SIIA 2AAEA 1WMPA 1A2KA 2W0QA 4J8TA 4X2HA 1K8A4 1OH0A 2B24B 2WGOA 3K63A 4KFDA 5STDA 6RNTA 3CME3 3LTBA 4NPBA 4HM7B 3F8XA 4FMDA 2CFWA 4BU4A 2D1WA 1C54A 3F40A 3H51A 3I553 3CCJ3 2RBIA 4RZMA 1MGWA 1BNJA 1U5OA 1HU9A 1AV4A 2W56B 3F14A 3HI7A 3EN8A 3KCHA 4ILFA 4WHAA 5AIGA 2XFSA 2HMJB 3O8YA 1RN7A 1I3IA 2XEPA 3PZWA 2H0IA 1BSCA 3MG1A 1BUJA 5IG4A 4LZIA 2BMOB 1MWTA 1RCLA 3FSDA 2AADA 4KVHA 3WOEB 1SIHA 4OUQA 1BIRA 2GBWB 3MG2A 3X3ZA 4FCZA 4BTXA 5HOHA 1D6UA 1W5ZA 3X3YA 2CWUA 1W01A 3CPOA 1YHQ3 4HM4B 3RNTA 1RLSA 3V92A 5BXQA 1W2ZA 3SOYA 3RGAA 3VF1A 5JPPA 3EB8A 1IQ8A 1D6YA 2E2UA 1OHSA 2BMQB 2CX1A 1ULIB 1DVDA 2LQVA 3MPHA 5LC7A 1TTOA 3WHOA 2W9PA 2J8XB 3NV0A 1A2VA 3HIIA 1NB5I 3CCR3 1I0VA 2OWPA 3DZLA 1M9GA 3IJEB 1YJN3 1BSDA 1X1UA 1FGRA 1DETA 1IV7A 1FGQA 1TP6A 3A76A 3AMOA 4RNYA 1BNIA 3QRDA 1JN5A 2WOFA 1KWIA 1MNLA 3F8HA 3KSED 1VQK3 4EXRA 1UUGB 1QVF2 3EN1B 4O02B 1RRHA 5EEOA 2OOVA 3KN4A 2XSHB 1CYVA 1BSBA 3PCRA 1LRAA 4K90B 5IENA 2HMLB 3KKGA 1RHLA 2H0HA 3JUQA 4K1UA 3UL5A 1KQS2 2XGLA 4CJNA 5LC6A 2OQEC 2W56A 5IW9A 1N9EA 1AQZA 1TFOA 2ML5A 2Y73A 1BOXA 2SARA 4FCMA 3I0YA 4LGQA 3WA2X 4GB5A 1IU7A 1N8QA 3DM8A 1QAFA 3BNCA 3OW22 5CK6A 3BNDA 3GSPA 2JQ5A 3CCU3 3BNBA 2Y74A 4GSPA 4FMAA 3NHXA 5BU4A 3CCQ3 3UNLA 1VQO3 5DRVA 1R4YA 4STDA 2GEYA 3ZFZA 5ELJA 1R4CA 1BNRA 2IMJA 1GOYA 2D42A 1RGHA 1RGCA 1NB3I 3CMA3 1RGLA 3NBRA 2XRXB 3D9RA 1UUVB 2QA43 1RGEA 5KP1A 3K5TA 2OTJ3 1WTHA 3AGNA 3E99A 3FG4A 4AKZA 1CYUA 3B8LA 1GYBA 2E2TA 1I8VA 3VGNA 4N6MA 5AIHA 2CG0A 2R41A 4JF8A 1ULJB 3G8ZA 2KRTA 3JUNA 2Z7AA 1GS3A 1BNGA 1I2GA 1TFKA 1UCJA 3CCM3 3HK4A 3IMAB 5IEOA 3KFQC 2KF6A 4XDVA 3K7CA 2BIRA 2OTL3 3EE1A 3HX8A 3KSPA 3L0RA 5CF1A 3T8NA 1W6CA 1X1WA 1QJGA 3HOHA 2OCTA 4KFFA 1GD4A 3OWUA 3Q1CA 1YJ93 3FZWA 4N6V0 3FKAA 1MWRA 2B1XB 1UI8A 2Z6BA 1JB5A 3HZPA 1WMNA 4FR9A 1TIJA 2C4BA 3U1WA 1YVBI 1K734 2RGQA 3FG3A 4HBRA 3CC43 3GZYB 1UI7A 1V74A 4O2HA 4R1KA 1BAOA 3NQZA 4O3VA 3NUVA 1AR0A 1B20A 4RBNA 2CFGA 1LNIA 3DGOA 4MEIA 2CW9A 3AHWA 1M1XB 1W02A 2CG1A 3KIIA 1STFI 1W6GA 2FGTA 3S5CA 3S28A 3AMOB 3V99A 1STDA 1YNVX 2M7OA 1YI23 2K0MA 3DGLA 4QWTA 2GU3A 4HZ9B 1N8R4 3F9SA 4JRFA 3F7SA 2LYXA 1B2UA 1KD14 1IVUA 3AGOA 3JVCA 2XSOB 1U8CB 1K9M4 1VQ73 2C11A 1UDII 1W2B2 1F8NA 5I97A 1IV9A 3GZRA 5BVBA 2CFKA 4XM4A 5TGNA 2F99A 4XDWA 3WODG 2F5MA 1RGGA 1B2SA 2XR8B 3SLUA 2KAAA 4I5QA 2ZL8A 1Q814 2KF4A 1DE3A 1RN1A 1UCIA 4MJDA 3Q3FA 1RMSA 1ASKA 3LTAA 2KXGA 1MWSA 2L1SA 1Q40B 3D5GA 1O7MB 2UGIA 1RDSA 1GY5A 1BNEA 1GY6A 1Q42A 4R9LA 1US1A 1O7NB 3LTCA 6GSPA 3ALAA 1B2ZA 1I3FA 3X40A 3CC23 3WA3A 2KF3A 1RNTA 3FF0A 3OX9A 4NREA 4GHOA 3ZG0A 1UCLA 1IT7A 1YGWA 2F5WA 2HOHA 2E2VA 3HIGA 4N3VA 4OK0A 3A5EA 3ZG5A 1BRSA 1RJOA 2XGNA 2Z76A 1DYUA 4EYCA 5D81A 1KSIA 1JBTA 1BRGA 2CFDA 2CKFB 2XH9A 1BVIA 1PYLA 3EBYA 1TU5A 1VQP3 3PXMA 4X2OA 1JZOA 2IY2A 2GBXB 1HKXA 4L7KA 2I9WA 1DMMA 2BNGA 2YFIB 1X1YA 4WFOA 5ELUA 3LZAA 4N6TA 1BSAA 1FGMA 2L4VA 2O9UX 5FW5A 2YFJB 5FGOA 2GU1A 1OACA 4XB5A 3VSYA 1BU4A 2P05A 3EBTA 4K61A 1IVVA 1JB2A 3X41A 3UB1A 3CCE3 1FA3A 3NX0A 1GOUA 3MYTA 3UJMA 4MMXB 3DGMA 2OOVC 1IQXA 3G0KA 1UUWB 3H3HA 3BB9A 4HM5B 4HYZA 4J5KA 5G2GA 1PU4A 2ZDJA 4EV5A 1YGEA 3WDGB 1IK3A 1TJDA 2ZA4A 3FH1A 5CF2A 3G4S3 5BIRA 1IYYA 3MWZA 3NM2A 5GSPA 3SEDA 3X42A 1Q40A 3GAXA 2CIUA 2O3OA 5IG0A 2RNTA 4KFEA 1O7PB 1LVNA 1AVLA 3T8UA 5JBSA 3LXUX 2FXTA 1VQM3 1OGXA 2CFLA 3GRDA 1NU3A 3NQYA 4J5GA 1ROAA 1VQ93 1BRNL 3SX1A 1T5YA 2CC3A 2XF3A 2XFTA 1VQL3 1IQYA 2UUGC 3DGYA 1ZS7A 1E3RA 4IIAA 4LMIA 1BGSA 1UGHI 1DVCA 2RFRA 3MG3A 3CU3A 1OUNA 1KC84 2P38A 3DMCA 3FCSB 2F98A 2W04A 4XBXA 2CWTA 2CX0A 5AIIA 1G96A 3PGBA 4HJLB 1RGAA 4ORLA 4U13A 1VQ53 1PY3A 1BSEA 3CNMA 2RCDA 4HAAA 1RN4A 5M1AA 2CH9A 3URPA 2YX9A 1IDPA 1EA2A 1FUSA 3RGRA 3F7XA 4I4KA 1GMQA 6STDA 3CCV3 1ROVA 1CH0A 3Q2PA 1MGRA 2STDA 2K54A 1IVWA 3TDGA 1NDOB 1O7GB 1E3VA 1RGFA 2GEXA 3FGYA 4CPKA 1FGTA 3NM7A 4O8SA 1UW1A 3EX9A 3LYGA 1J2BA 1M1K4 1JRQA 2QEX3 1B21A 1Z1SA 4FCJA 3QK9A 1MOLA
chains in the Genus database with same CATH topology
2IUKA 2IA7A 5IF6A 1YIJ3 5AIFA 2V1LA 2BHMA 1ZO2A 3B4OA 4TX4A 4WYKB 5EVHA 3JUMA 2P0XA 1YJW3 2KCDA 1OHOA 3Q90A 4HVNA 1N9JA 4G1MB 3UL6A 3X3XA 3MHEA 2W2CA 5AI1A 1NWWA 3SVAA 1W6YA 4R9KA 3K0ZA 3V98A 2BT3A 3S27A 1VQ83 1EKMA 5CLKA 3OWYA 1Q824 1OF5B 4RNZA 3S67A 4FMBA 3WMDA 3G713 3CCS3 1IVXA 1QMAA 3D3LA 2PNCA 2WO0A 3FG1A 4L8OA 5AEUB 1S5AA 3NXJA 1SJWA 5EQLA 4CCVA 3N9HA 1SQWA 4ZM8A 3JUPA 3CNXA 1N5PA 3J7Yd 4HM8B 1RRLA 2Q07A 4MMZB 1M904 1W00A 2F86B 4OVMA 3EF8A 4N6NB 3N54B 1ZX2A 3PCSA 4Q53A 4EC6A 2CK3H 1DMQA 2C10A 2GXFA 1LOXA 1QALA 5DREA 3PYJA 1W4NA 1JJ22 2R4IA 1WQLB 1RKYA 3B7CA 4WYKA 1BUQA 1IT8A 4LEHA 1ISKA 1JV2B 4HZBB 2CHCA 4XBTA 5IEPA 4L8PA 5AYSC 3I563 2P09A 2A15A 1AVKA 3RDEA 3G6E3 1TUHA 2ML6A 2MC8A 5CXOA 5IG5A 3DGNA 3NBJA 3M8CA 1WMOA 4N6UA 5AEWB 3DXOA 3GZBA 4IPBA 4R4KA 2WOHA 1L5GB 2IUJA 1JB4A 1OF5A 1PFPA 4EBGA 2OQEA 3ROBA 2RSXA 3ER7A 1LXEA 4GL6A 2BMRB 3CCL3 3LMLA 1GY7A 3EJVA 1JKGB 2JDIH 2INXA 4PEJA 1QAKA 3EC9A 1E97A 3WOFB 1EG9B 1SPUA 4XBYA 5D82A 3MSOA 3CPW2 1VQN3 3FLJA 1VZZA 4HM3B 5D83A 2UX0A 2Z77A 3GZXB 3CD63 3SXXA 2MF7A 5AYRB 3G16A 1FUWA 4HM2B 4WP5A 3DUKA 4J9AA 3OXAA 4MMYB 1FGOA 3CXC2 4N6OB 2HMMB 1W7CA 1D6ZA 1JNQA 3DY5A 4IT7A 2HMNB 4BTWA 3T0UA 4FMCA 1A90A 1O7HB 2HMOB 1OCVA 1DMNA 1C7HA 2YFLB 3KZTA 3STDA 3K9MC 4NHFA 4EV2A 4CDLA 2HMKB 2P0MA 2W03A 4LSOA 1N5HA 2W9QA 3LH4A 3OV4A 4N6LA 3LT8A 3OWSA 4HKVB 3S29A 3GWRA 3U97A 5IERA 5JPUA 4K1VA 1Q864 4H61A 3SOAA 1JKGA 1O7WB 5KP3A 4H3UA 4AKYA 2QIYA 1OGZA 3LT9A 2BO9B 1OPYA 1NO3A 1A67A 1CQSA 1LNHA 1EQKA 2FNQA 1WNHA 2QGUA 4HM6B 3EQQB 5HGRA 1GD3A 5IG3A 1Y4KA 3KE7A 3LTDA 1S723 4WWUC 4BTYA 3CC73 3PS8A 4R80A 3MKIA 1OHPA 2PZVA 3N8BA 3IPTA 3NBBA 3BLZA 1QVG2 4HM0B 8CHOA 2CWVA 4HM1B 1Q7Y4 3BNEA 4AEQA 3NV0B 3FF2A 2SBLA 3JUOA 1VQ63 3B4PA 3LOYA 1NJI4 2W6JH 2WGQA 1K41A 5KP4A 1VQ43 1YIT3 1JN5B 3EHCA 5A0OB 1K28A 7STDA 4KZ1A 3ECFA 1CEWI 1SIIA 2W0QA 1WMPA 1A2KA 4J8TA 4X2HA 1K8A4 2WGOA 1OH0A 2B24B 3K63A 4KFDA 5STDA 3CME3 3LTBA 4HM7B 3F8XA 4FMDA 2CFWA 2D1WA 3F40A 3H51A 3I553 3CCJ3 4RZMA 2W56B 1U5OA 1HU9A 1AV4A 3F14A 3HI7A 4WHAA 3EN8A 5AIGA 2XFSA 2HMJB 3O8YA 1RN7A 2XEPA 3PZWA 3MG1A 5IG4A 4LZIA 2BMOB 3FSDA 4KVHA 3WOEB 1SIHA 4OUQA 2GBWB 3MG2A 3X3ZA 4FCZA 4BTXA 1D6UA 1W5ZA 3X3YA 2CWUA 1W01A 3CPOA 1YHQ3 4HM4B 3V92A 5BXQA 1W2ZA 3SOYA 3RGAA 3VF1A 5JPPA 3EB8A 1IQ8A 1D6YA 2E2UA 1OHSA 2BMQB 1ULIB 1DVDA 2LQVA 3MPHA 5LC7A 2W9PA 3NV0A 1A2VA 3HIIA 1NB5I 3CCR3 2OWPA 3DZLA 1M9GA 3IJEB 1YJN3 1FGRA 1TP6A 1IV7A 1FGQA 3A76A 3AMOA 4RNYA 3QRDA 2WOFA 1JN5A 1MNLA 1KWIA 3F8HA 3KSED 1VQK3 4EXRA 1QVF2 3EN1B 4O02B 1RRHA 5EEOA 2OOVA 3KN4A 2XSHB 1CYVA 3PCRA 4K90B 5IENA 2HMLB 3KKGA 3JUQA 4K1UA 3UL5A 1KQS2 2XGLA 5LC6A 2OQEC 2W56A 5IW9A 1N9EA 2ML5A 1TFOA 2Y73A 4LGQA 4FCMA 3I0YA 3WA2X 4GB5A 1IU7A 1N8QA 3DM8A 1QAFA 3BNCA 3OW22 5CK6A 3BNDA 2JQ5A 3CCU3 3BNBA 2Y74A 4FMAA 3NHXA 3CCQ3 3UNLA 1VQO3 5DRVA 4STDA 2GEYA 5ELJA 1R4CA 2IMJA 2D42A 1NB3I 3CMA3 3NBRA 2XRXB 3D9RA 1UUVB 2QA43 5KP1A 3K5TA 2OTJ3 1WTHA 3FG4A 3E99A 4AKZA 1CYUA 3B8LA 1GYBA 2E2TA 3VGNA 4N6MA 5AIHA 2CG0A 4JF8A 1ULJB 3G8ZA 2KRTA 3JUNA 2Z7AA 1GS3A 1TFKA 3CCM3 3HK4A 3IMAB 5IEOA 3KFQC 4XDVA 3K7CA 2OTL3 3EE1A 3HX8A 3KSPA 3L0RA 5CF1A 3T8NA 1W6CA 1QJGA 2OCTA 4KFFA 1GD4A 3OWUA 3Q1CA 1YJ93 3FZWA 4N6V0 3FKAA 2B1XB 1UI8A 2Z6BA 1JB5A 3HZPA 1WMNA 4FR9A 1TIJA 3U1WA 1YVBI 1K734 2RGQA 3FG3A 4HBRA 3CC43 3GZYB 1UI7A 1V74A 4O2HA 4R1KA 3NQZA 4O3VA 3NUVA 1AR0A 4RBNA 2CFGA 3DGOA 4MEIA 2CW9A 1M1XB 1W02A 2CG1A 3KIIA 1STFI 1W6GA 2FGTA 3S5CA 3S28A 3AMOB 3V99A 1STDA 2M7OA 1YI23 2K0MA 3DGLA 4QWTA 2GU3A 4HZ9B 1N8R4 3F9SA 4JRFA 3F7SA 2LYXA 1KD14 1IVUA 3JVCA 2XSOB 1U8CB 1K9M4 1VQ73 2C11A 1W2B2 1F8NA 5I97A 1IV9A 3GZRA 5BVBA 2CFKA 4XM4A 5TGNA 2F99A 4XDWA 3WODG 2XR8B 3SLUA 2ZL8A 1Q814 4MJDA 1ASKA 3LTAA 2KXGA 1Q40B 1O7MB 4R9LA 1GY5A 1GY6A 1Q42A 1US1A 1O7NB 3LTCA 3ALAA 3X40A 3CC23 3WA3A 3FF0A 3OX9A 4NREA 1IT7A 3HIGA 2E2VA 4N3VA 4OK0A 1RJOA 2XGNA 2Z76A 1DYUA 4EYCA 5D81A 1KSIA 2CFDA 2CKFB 2XH9A 1TU5A 3EBYA 1VQP3 3PXMA 4X2OA 2GBXB 1HKXA 4L7KA 2I9WA 1DMMA 2BNGA 2YFIB 4WFOA 5ELUA 3LZAA 4N6TA 1FGMA 2L4VA 2O9UX 5FW5A 2YFJB 5FGOA 2GU1A 1OACA 4XB5A 3VSYA 2P05A 3EBTA 4K61A 1IVVA 1JB2A 3X41A 3UB1A 3CCE3 1FA3A 3NX0A 3MYTA 3UJMA 4MMXB 3DGMA 2OOVC 1IQXA 3G0KA 1UUWB 3H3HA 3BB9A 4HM5B 4HYZA 5G2GA 1PU4A 2ZDJA 4EV5A 1YGEA 3WDGB 1IK3A 3G4S3 3FH1A 5CF2A 3MWZA 3NM2A 3SEDA 3X42A 1Q40A 3GAXA 2CIUA 2O3OA 5IG0A 4KFEA 1O7PB 1LVNA 1AVLA 3T8UA 5JBSA 3LXUX 2FXTA 1VQM3 1OGXA 2CFLA 3GRDA 1NU3A 3NQYA 1ROAA 1VQ93 3SX1A 1T5YA 2CC3A 2XF3A 2XFTA 1VQL3 1IQYA 1E3RA 4IIAA 4LMIA 1DVCA 2RFRA 3MG3A 3CU3A 1OUNA 1KC84 2P38A 3DMCA 3FCSB 2F98A 2W04A 4XBXA 2CWTA 5AIIA 1G96A 3PGBA 4HJLB 4ORLA 4U13A 1VQ53 3CNMA 2RCDA 2CH9A 2YX9A 1IDPA 1EA2A 3RGRA 3F7XA 4I4KA 6STDA 3CCV3 1ROVA 3Q2PA 2STDA 2K54A 1IVWA 3TDGA 1NDOB 1O7GB 1E3VA 2GEXA 3FGYA 1FGTA 3NM7A 4O8SA 1UW1A 3EX9A 3LYGA 1J2BA 1M1K4 1JRQA 2QEX3 1Z1SA 4FCJA 3QK9A 1MOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IF6 A;  5AIF A;  1ZO2 A;  3B4O A;  5EVH A;  4WYK B;  3JUM A;  1OHO A;  3Q90 A;  4HVN A;  3MHE A;  2W2C A;  5AI1 A;  1NWW A;  1W6Y A;  4R9K A;  3K0Z A;  5CLK A;  3OWY A;  1OF5 B;  3WMD A;  1QMA A;  4L8O A;  5AEU B;  1S5A A;  3NXJ A;  1SJW A;  3JUP A;  3CNX A;  4HM8 B;  1W00 A;  2F86 B;  4OVM A;  3EF8 A;  1ZX2 A;  4Q53 A;  1DMQ A;  2GXF A;  5DRE A;  2R4I A;  1WQL B;  3B7C A;  4WYK A;  1BUQ A;  4LEH A;  1ISK A;  4HZB B;  2CHC A;  4XBT A;  5IEP A;  4L8P A;  2A15 A;  1TUH A;  5CXO A;  5IG5 A;  3M8C A;  5AEW B;  3DXO A;  3GZB A;  1JB4 A;  1OF5 A;  3ROB A;  3ER7 A;  2BMR B;  1GY7 A;  3EJV A;  1JKG B;  2INX A;  4PEJ A;  3EC9 A;  1E97 A;  1EG9 B;  4XBY A;  5D82 A;  3MSO A;  3FLJ A;  1VZZ A;  4HM3 B;  5D83 A;  2UX0 A;  2Z77 A;  3GZX B;  3G16 A;  4HM2 B;  4WP5 A;  3DUK A;  4J9A A;  3OXA A;  2HMM B;  2HMN B;  1O7H B;  2HMO B;  1OCV A;  1DMN A;  1C7H A;  2YFL B;  3KZT A;  4CDL A;  2HMK B;  3OV4 A;  5IER A;  3OWS A;  4HKV B;  3GWR A;  5JPU A;  4K1V A;  3SOA A;  1JKG A;  1O7W B;  5KP3 A;  4H3U A;  2QIY A;  1OGZ A;  1OPY A;  1CQS A;  2QGU A;  4HM6 B;  3EQQ B;  5HGR A;  5IG3 A;  3KE7 A;  4WWU C;  3MKI A;  1OHP A;  2PZV A;  3IPT A;  3BLZ A;  4HM0 B;  8CHO A;  4HM1 B;  3NV0 B;  3FF2 A;  3JUO A;  3B4P A;  1K41 A;  5KP4 A;  1JN5 B;  3EHC A;  7STD A;  3ECF A;  4X2H A;  4J8T A;  1A2K A;  1OH0 A;  2B24 B;  5STD A;  4HM7 B;  3F8X A;  3F40 A;  3H51 A;  4RZM A;  1U5O A;  3F14 A;  3EN8 A;  5AIG A;  2HMJ B;  3MG1 A;  5IG4 A;  2BMO B;  3FSD A;  4KVH A;  4OUQ A;  2GBW B;  3MG2 A;  3CPO A;  1W01 A;  4HM4 B;  5BXQ A;  5JPP A;  3SOY A;  3RGA A;  1OHS A;  2BMQ B;  1ULI B;  3NV0 A;  2OWP A;  3DZL A;  1TP6 A;  3A76 A;  1JN5 A;  3F8H A;  3EN1 B;  2XSH B;  5IEN A;  2HML B;  3KKG A;  3JUQ A;  4K1U A;  4LGQ A;  4FCM A;  3I0Y A;  4GB5 A;  3DM8 A;  5CK6 A;  2JQ5 A;  3NHX A;  3UNL A;  5DRV A;  4STD A;  2GEY A;  2IMJ A;  3NBR A;  2XRX B;  3D9R A;  1UUV B;  5KP1 A;  3E99 A;  3B8L A;  1GYB A;  3VGN A;  5AIH A;  1ULJ B;  3G8Z A;  3JUN A;  2Z7A A;  1GS3 A;  3HK4 A;  5IEO A;  4XDV A;  3K7C A;  3HX8 A;  3KSP A;  5CF1 A;  3T8N A;  1QJG A;  3OWU A;  3FZW A;  3FKA A;  2B1X B;  1JB5 A;  3HZP A;  2RGQ A;  3GZY B;  4R1K A;  3NUV A;  1AR0 A;  1W02 A;  3S5C A;  1STD A;  4HZ9 B;  3F9S A;  3F7S A;  2XSO B;  3GZR A;  5BVB A;  4XM4 A;  5TGN A;  2F99 A;  4XDW A;  2XR8 B;  4MJD A;  1ASK A;  1Q40 B;  1O7M B;  4R9L A;  1GY5 A;  1GY6 A;  1Q42 A;  1O7N B;  3FF0 A;  3OX9 A;  4N3V A;  2Z76 A;  5D81 A;  2CKF B;  3EBY A;  4X2O A;  2GBX B;  1HKX A;  4L7K A;  2I9W A;  1DMM A;  2BNG A;  2YFI B;  3LZA A;  5FW5 A;  2YFJ B;  4XB5 A;  3VSY A;  3EBT A;  1JB2 A;  3MYT A;  3UJM A;  3G0K A;  3H3H A;  1UUW B;  4HM5 B;  3BB9 A;  5G2G A;  3FH1 A;  5CF2 A;  3NM2 A;  3SED A;  1Q40 A;  5IG0 A;  1O7P B;  3T8U A;  1OGX A;  3GRD A;  1NU3 A;  1E3R A;  4IIA A;  4LMI A;  2RFR A;  3MG3 A;  3CU3 A;  1OUN A;  3DMC A;  2F98 A;  4XBX A;  5AII A;  4HJL B;  4ORL A;  4U13 A;  3CNM A;  2RCD A;  1IDP A;  1EA2 A;  3RGR A;  3F7X A;  4I4K A;  6STD A;  2STD A;  2K54 A;  1NDO B;  1O7G B;  1E3V A;  2GEX A;  3FGY A;  3EX9 A;  3LYG A;  1Z1S A;  4FCJ A;  3STD A; 
#chains in the Genus database with same CATH topology
 2IUK A;  2IA7 A;  5IF6 A;  1BAN A;  2F56 A;  3AHS A;  1YIJ 3;  4RNT A;  5AIF A;  2V1L A;  1B27 A;  2BHM A;  1ZO2 A;  3B4O A;  4TX4 A;  4WYK B;  5EVH A;  3JUM A;  2P0X A;  4EW5 A;  2KCD A;  1YJW 3;  1OHO A;  3Q90 A;  1FYS A;  4HVN A;  1N9J A;  4G1M B;  3UL6 A;  3X3X A;  3MHE A;  2W2C A;  5AI1 A;  1NWW A;  1I70 A;  3SVA A;  1BNS A;  1W6Y A;  4DKI A;  1A2P A;  1AY7 A;  4R9K A;  3K0Z A;  3V98 A;  2BT3 A;  3S27 A;  1VQ8 3;  1BRK A;  1EKM A;  2K3D A;  1I2F A;  3OWY A;  1RTU A;  5CLK A;  1Q82 4;  1OF5 B;  4RNZ A;  3S67 A;  4FMB A;  3WMD A;  3G71 3;  3CCS 3;  1IVX A;  1QMA A;  1I0X A;  3D3L A;  4BL2 A;  2PNC A;  2WO0 A;  3FG1 A;  4L8O A;  5AEU B;  1S5A A;  3NXJ A;  1SJW A;  2BU4 A;  5EQL A;  3N9H A;  3D79 A;  4CCV A;  1YVS A;  1SQW A;  1T3B A;  4ZM8 A;  3JUP A;  1LOV A;  1FZU A;  3BIR A;  1N5P A;  3CNX A;  3J7Y d;  4HM8 B;  1RRL A;  2Q07 A;  4MMZ B;  1M90 4;  1W00 A;  2F86 B;  1NNV A;  1SAR A;  3EF8 A;  4N6N B;  4OVM A;  1TRP A;  3N54 B;  1ZX2 A;  3PCS A;  4Q53 A;  4EC6 A;  2CK3 H;  1DMQ A;  2C10 A;  2GXF A;  1LOX A;  1QAL A;  5DRE A;  3PYJ A;  3SYU A;  1W4N A;  1JJ2 2;  2R4I A;  1WQL B;  1RKY A;  2IYJ A;  3BU4 A;  3B7C A;  1B2X A;  1V58 A;  4WYK A;  1BUQ A;  1JZD A;  1IT8 A;  4LEH A;  5G1K A;  1ISK A;  1JV2 B;  4HZB B;  2CHC A;  4XBT A;  5IEP A;  4L8P A;  5AYS C;  8RNT A;  3I56 3;  2P09 A;  2A15 A;  1AVK A;  3RDE A;  3G6E 3;  1B2M A;  1TUH A;  2ML6 A;  2MC8 A;  5CXO A;  5IG5 A;  1G02 A;  3DGN A;  3NBJ A;  3M8C A;  1WMO A;  4N6U A;  5AEW B;  3DXO A;  3GZB A;  4IPB A;  4R4K A;  2WOH A;  1L5G B;  2IUJ A;  1JB4 A;  1OF5 A;  1PFP A;  4EBG A;  5M18 A;  2OQE A;  3ROB A;  1GSP A;  2RSX A;  3ER7 A;  1LXE A;  4GL6 A;  2BMR B;  3CCL 3;  1LQM B;  3LML A;  1GY7 A;  3EJV A;  1T2H A;  1JKG B;  2JDI H;  2INX A;  4PEJ A;  1QAK A;  1HYF A;  3EC9 A;  1E97 A;  1MWU A;  1FW7 A;  3WOF B;  1EG9 B;  1SPU A;  4XBY A;  5D82 A;  1UGI A;  3MSO A;  3CPW 2;  1VQN 3;  3FLJ A;  1VZZ A;  4HM3 B;  1BNF A;  1EEJ A;  2UX0 A;  4KT3 B;  5D83 A;  2Z77 A;  3GZX B;  2KF5 A;  3CD6 3;  1VQQ A;  3SXX A;  2MF7 A;  5AYR B;  3G16 A;  1I2E A;  1V57 A;  1FUW A;  1G0T A;  4HM2 B;  4WP5 A;  9RNT A;  3D5I A;  4BL3 A;  3DUK A;  1ZGX A;  4J9A A;  3OXA A;  4MMY B;  1FGO A;  1Q9E A;  3CXC 2;  4N6O B;  2HMM B;  1W7C A;  1GOV A;  1GMR A;  1D6Z A;  1JNQ A;  1LOW A;  3DY5 A;  4IT7 A;  2HMN B;  2ZHX B;  4BTW A;  3T0U A;  4FMC A;  2H0G A;  1A90 A;  1O7H B;  2HMO B;  1OCV A;  5M19 A;  1DMN A;  1C7H A;  1GMP A;  2YFL B;  3KZT A;  3STD A;  3K9M C;  4NHF A;  1RNB A;  4EV2 A;  4CDL A;  1EUI C;  1T2I A;  2HMK B;  7RNT A;  2P0M A;  3DH2 A;  2W03 A;  4LSO A;  1N5H A;  2W9Q A;  3LH4 A;  3OV4 A;  4N6L A;  3LT8 A;  3OWS A;  4HKV B;  3S29 A;  3GWR A;  3U97 A;  1X1X A;  5IER A;  4K1V A;  5JPU A;  2F4Y A;  4H61 A;  3SOA A;  1JKG A;  1Q86 4;  1HZ1 A;  1O7W B;  4LYL B;  5KP3 A;  2GSP A;  4H3U A;  4AKY A;  2QIY A;  1OGZ A;  3LT9 A;  1BRI A;  2BO9 B;  1OPY A;  1NO3 A;  1A67 A;  1CQS A;  1RGK A;  1LNH A;  5RNT A;  1EQK A;  2FNQ A;  1WNH A;  2QGU A;  1BRJ A;  4HM6 B;  3EQQ B;  1LOY A;  5HGR A;  4BIR A;  1GD3 A;  1RSN A;  5IG3 A;  1Y4K A;  3KE7 A;  3LTD A;  1S72 3;  4WWU C;  4BTY A;  3CC7 3;  3PS8 A;  4R80 A;  3MKI A;  1B3S A;  1OHP A;  2PZV A;  5G1L A;  3N8B A;  3IPT A;  1LQG C;  3NBB A;  3BLZ A;  1JBR A;  1QVG 2;  4HM0 B;  8CHO A;  2CWV A;  4HM1 B;  3D4A A;  1Q7Y 4;  3BNE A;  4AEQ A;  3NV0 B;  4HOH A;  3FF2 A;  3WR2 A;  2SBL A;  1JBS A;  1BRH A;  1FUT A;  3JUO A;  1VQ6 3;  3B4P A;  3LOY A;  1NJI 4;  2W6J H;  1TRQ A;  2WGQ A;  1K41 A;  1UCK A;  5KP4 A;  1VQ4 3;  1YIT 3;  1JN5 B;  3EHC A;  5A0O B;  1K28 A;  7GSP A;  7STD A;  1Q7H A;  4KZ1 A;  3ECF A;  1RCK A;  1CEW I;  1SII A;  2AAE A;  1WMP A;  1A2K A;  2W0Q A;  4J8T A;  4X2H A;  1K8A 4;  1OH0 A;  2B24 B;  2WGO A;  3K63 A;  4KFD A;  5STD A;  6RNT A;  3CME 3;  3LTB A;  4NPB A;  4HM7 B;  3F8X A;  4FMD A;  2CFW A;  4BU4 A;  2D1W A;  1C54 A;  3F40 A;  3H51 A;  3I55 3;  3CCJ 3;  2RBI A;  4RZM A;  1MGW A;  1BNJ A;  1U5O A;  1HU9 A;  1AV4 A;  2W56 B;  3F14 A;  3HI7 A;  3EN8 A;  3KCH A;  4ILF A;  4WHA A;  5AIG A;  2XFS A;  2HMJ B;  3O8Y A;  1RN7 A;  1I3I A;  2XEP A;  3PZW A;  2H0I A;  1BSC A;  3MG1 A;  1BUJ A;  5IG4 A;  4LZI A;  2BMO B;  1MWT A;  1RCL A;  3FSD A;  2AAD A;  4KVH A;  3WOE B;  1SIH A;  4OUQ A;  1BIR A;  2GBW B;  3MG2 A;  3X3Z A;  4FCZ A;  4BTX A;  5HOH A;  1D6U A;  1W5Z A;  3X3Y A;  2CWU A;  1W01 A;  3CPO A;  1YHQ 3;  4HM4 B;  3RNT A;  1RLS A;  3V92 A;  5BXQ A;  1W2Z A;  3SOY A;  3RGA A;  3VF1 A;  5JPP A;  3EB8 A;  1IQ8 A;  1D6Y A;  2E2U A;  1OHS A;  2BMQ B;  2CX1 A;  1ULI B;  1DVD A;  2LQV A;  3MPH A;  5LC7 A;  1TTO A;  3WHO A;  2W9P A;  2J8X B;  3NV0 A;  1A2V A;  3HII A;  1NB5 I;  3CCR 3;  1I0V A;  2OWP A;  3DZL A;  1M9G A;  3IJE B;  1YJN 3;  1BSD A;  1X1U A;  1FGR A;  1DET A;  1IV7 A;  1FGQ A;  1TP6 A;  3A76 A;  3AMO A;  4RNY A;  1BNI A;  3QRD A;  1JN5 A;  2WOF A;  1KWI A;  1MNL A;  3F8H A;  3KSE D;  1VQK 3;  4EXR A;  1UUG B;  1QVF 2;  3EN1 B;  4O02 B;  1RRH A;  5EEO A;  2OOV A;  3KN4 A;  2XSH B;  1CYV A;  1BSB A;  3PCR A;  1LRA A;  4K90 B;  5IEN A;  2HML B;  3KKG A;  1RHL A;  2H0H A;  3JUQ A;  4K1U A;  3UL5 A;  1KQS 2;  2XGL A;  4CJN A;  5LC6 A;  2OQE C;  2W56 A;  5IW9 A;  1N9E A;  1AQZ A;  1TFO A;  2ML5 A;  2Y73 A;  1BOX A;  2SAR A;  4FCM A;  3I0Y A;  4LGQ A;  3WA2 X;  4GB5 A;  1IU7 A;  1N8Q A;  3DM8 A;  1QAF A;  3BNC A;  3OW2 2;  5CK6 A;  3BND A;  3GSP A;  2JQ5 A;  3CCU 3;  3BNB A;  2Y74 A;  4GSP A;  4FMA A;  3NHX A;  5BU4 A;  3CCQ 3;  3UNL A;  1VQO 3;  5DRV A;  1R4Y A;  4STD A;  2GEY A;  3ZFZ A;  5ELJ A;  1R4C A;  1BNR A;  2IMJ A;  1GOY A;  2D42 A;  1RGH A;  1RGC A;  1NB3 I;  3CMA 3;  1RGL A;  3NBR A;  2XRX B;  3D9R A;  1UUV B;  2QA4 3;  1RGE A;  5KP1 A;  3K5T A;  2OTJ 3;  1WTH A;  3AGN A;  3E99 A;  3FG4 A;  4AKZ A;  1CYU A;  3B8L A;  1GYB A;  2E2T A;  1I8V A;  3VGN A;  4N6M A;  5AIH A;  2CG0 A;  2R41 A;  4JF8 A;  1ULJ B;  3G8Z A;  2KRT A;  3JUN A;  2Z7A A;  1GS3 A;  1BNG A;  1I2G A;  1TFK A;  1UCJ A;  3CCM 3;  3HK4 A;  3IMA B;  5IEO A;  3KFQ C;  2KF6 A;  4XDV A;  3K7C A;  2BIR A;  2OTL 3;  3EE1 A;  3HX8 A;  3KSP A;  3L0R A;  5CF1 A;  3T8N A;  1W6C A;  1X1W A;  1QJG A;  3HOH A;  2OCT A;  4KFF A;  1GD4 A;  3OWU A;  3Q1C A;  1YJ9 3;  3FZW A;  4N6V 0;  3FKA A;  1MWR A;  2B1X B;  1UI8 A;  2Z6B A;  1JB5 A;  3HZP A;  1WMN A;  4FR9 A;  1TIJ A;  2C4B A;  3U1W A;  1YVB I;  1K73 4;  2RGQ A;  3FG3 A;  4HBR A;  3CC4 3;  3GZY B;  1UI7 A;  1V74 A;  4O2H A;  4R1K A;  1BAO A;  3NQZ A;  4O3V A;  3NUV A;  1AR0 A;  1B20 A;  4RBN A;  2CFG A;  1LNI A;  3DGO A;  4MEI A;  2CW9 A;  3AHW A;  1M1X B;  1W02 A;  2CG1 A;  3KII A;  1STF I;  1W6G A;  2FGT A;  3S5C A;  3S28 A;  3AMO B;  3V99 A;  1STD A;  1YNV X;  2M7O A;  1YI2 3;  2K0M A;  3DGL A;  4QWT A;  2GU3 A;  4HZ9 B;  1N8R 4;  3F9S A;  4JRF A;  3F7S A;  2LYX A;  1B2U A;  1KD1 4;  1IVU A;  3AGO A;  3JVC A;  2XSO B;  1U8C B;  1K9M 4;  1VQ7 3;  2C11 A;  1UDI I;  1W2B 2;  1F8N A;  5I97 A;  1IV9 A;  3GZR A;  5BVB A;  2CFK A;  4XM4 A;  5TGN A;  2F99 A;  4XDW A;  3WOD G;  2F5M A;  1RGG A;  1B2S A;  2XR8 B;  3SLU A;  2KAA A;  4I5Q A;  2ZL8 A;  1Q81 4;  2KF4 A;  1DE3 A;  1RN1 A;  1UCI A;  4MJD A;  3Q3F A;  1RMS A;  1ASK A;  3LTA A;  2KXG A;  1MWS A;  2L1S A;  1Q40 B;  3D5G A;  1O7M B;  2UGI A;  1RDS A;  1GY5 A;  1BNE A;  1GY6 A;  1Q42 A;  4R9L A;  1US1 A;  1O7N B;  3LTC A;  6GSP A;  3ALA A;  1B2Z A;  1I3F A;  3X40 A;  3CC2 3;  3WA3 A;  2KF3 A;  1RNT A;  3FF0 A;  3OX9 A;  4NRE A;  4GHO A;  3ZG0 A;  1UCL A;  1IT7 A;  1YGW A;  2F5W A;  2HOH A;  2E2V A;  3HIG A;  4N3V A;  4OK0 A;  3A5E A;  3ZG5 A;  1BRS A;  1RJO A;  2XGN A;  2Z76 A;  1DYU A;  4EYC A;  5D81 A;  1KSI A;  1JBT A;  1BRG A;  2CFD A;  2CKF B;  2XH9 A;  1BVI A;  1PYL A;  3EBY A;  1TU5 A;  1VQP 3;  3PXM A;  4X2O A;  1JZO A;  2IY2 A;  2GBX B;  1HKX A;  4L7K A;  2I9W A;  1DMM A;  2BNG A;  2YFI B;  1X1Y A;  4WFO A;  5ELU A;  3LZA A;  4N6T A;  1BSA A;  1FGM A;  2L4V A;  2O9U X;  5FW5 A;  2YFJ B;  5FGO A;  2GU1 A;  1OAC A;  4XB5 A;  3VSY A;  1BU4 A;  2P05 A;  3EBT A;  4K61 A;  1IVV A;  1JB2 A;  3X41 A;  3UB1 A;  3CCE 3;  1FA3 A;  3NX0 A;  1GOU A;  3MYT A;  3UJM A;  4MMX B;  3DGM A;  2OOV C;  1IQX A;  3G0K A;  1UUW B;  3H3H A;  3BB9 A;  4HM5 B;  4HYZ A;  4J5K A;  5G2G A;  1PU4 A;  2ZDJ A;  4EV5 A;  1YGE A;  3WDG B;  1IK3 A;  1TJD A;  2ZA4 A;  3FH1 A;  5CF2 A;  3G4S 3;  5BIR A;  1IYY A;  3MWZ A;  3NM2 A;  5GSP A;  3SED A;  3X42 A;  1Q40 A;  3GAX A;  2CIU A;  2O3O A;  5IG0 A;  2RNT A;  4KFE A;  1O7P B;  1LVN A;  1AVL A;  3T8U A;  5JBS A;  3LXU X;  2FXT A;  1VQM 3;  1OGX A;  2CFL A;  3GRD A;  1NU3 A;  3NQY A;  4J5G A;  1ROA A;  1VQ9 3;  1BRN L;  3SX1 A;  1T5Y A;  2CC3 A;  2XF3 A;  2XFT A;  1VQL 3;  1IQY A;  2UUG C;  3DGY A;  1ZS7 A;  1E3R A;  4IIA A;  4LMI A;  1BGS A;  1UGH I;  1DVC A;  2RFR A;  3MG3 A;  3CU3 A;  1OUN A;  1KC8 4;  2P38 A;  3DMC A;  3FCS B;  2F98 A;  2W04 A;  4XBX A;  2CWT A;  2CX0 A;  5AII A;  1G96 A;  3PGB A;  4HJL B;  1RGA A;  4ORL A;  4U13 A;  1VQ5 3;  1PY3 A;  1BSE A;  3CNM A;  2RCD A;  4HAA A;  1RN4 A;  5M1A A;  2CH9 A;  3URP A;  2YX9 A;  1IDP A;  1EA2 A;  1FUS A;  3RGR A;  3F7X A;  4I4K A;  1GMQ A;  6STD A;  3CCV 3;  1ROV A;  1CH0 A;  3Q2P A;  1MGR A;  2STD A;  2K54 A;  1IVW A;  3TDG A;  1NDO B;  1O7G B;  1E3V A;  1RGF A;  2GEX A;  3FGY A;  4CPK A;  1FGT A;  3NM7 A;  4O8S A;  1UW1 A;  3EX9 A;  3LYG A;  1J2B A;  1M1K 4;  1JRQ A;  2QEX 3;  1B21 A;  1Z1S A;  4FCJ A;  3QK9 A;  1MOL A; 
#chains in the Genus database with same CATH homology
 2IUK A;  2IA7 A;  5IF6 A;  1YIJ 3;  5AIF A;  2V1L A;  2BHM A;  1ZO2 A;  3B4O A;  4TX4 A;  4WYK B;  5EVH A;  3JUM A;  2P0X A;  1YJW 3;  2KCD A;  1OHO A;  3Q90 A;  4HVN A;  1N9J A;  4G1M B;  3UL6 A;  3X3X A;  3MHE A;  2W2C A;  5AI1 A;  1NWW A;  3SVA A;  1W6Y A;  4R9K A;  3K0Z A;  3V98 A;  2BT3 A;  3S27 A;  1VQ8 3;  1EKM A;  5CLK A;  3OWY A;  1Q82 4;  1OF5 B;  4RNZ A;  3S67 A;  4FMB A;  3WMD A;  3G71 3;  3CCS 3;  1IVX A;  1QMA A;  3D3L A;  2PNC A;  2WO0 A;  3FG1 A;  4L8O A;  5AEU B;  1S5A A;  3NXJ A;  1SJW A;  5EQL A;  4CCV A;  3N9H A;  1SQW A;  4ZM8 A;  3JUP A;  3CNX A;  1N5P A;  3J7Y d;  4HM8 B;  1RRL A;  2Q07 A;  4MMZ B;  1M90 4;  1W00 A;  2F86 B;  4OVM A;  3EF8 A;  4N6N B;  3N54 B;  1ZX2 A;  3PCS A;  4Q53 A;  4EC6 A;  2CK3 H;  1DMQ A;  2C10 A;  2GXF A;  1LOX A;  1QAL A;  5DRE A;  3PYJ A;  1W4N A;  1JJ2 2;  2R4I A;  1WQL B;  1RKY A;  3B7C A;  4WYK A;  1BUQ A;  1IT8 A;  4LEH A;  1ISK A;  1JV2 B;  4HZB B;  2CHC A;  4XBT A;  5IEP A;  4L8P A;  5AYS C;  3I56 3;  2P09 A;  2A15 A;  1AVK A;  3RDE A;  3G6E 3;  1TUH A;  2ML6 A;  2MC8 A;  5CXO A;  5IG5 A;  3DGN A;  3NBJ A;  3M8C A;  1WMO A;  4N6U A;  5AEW B;  3DXO A;  3GZB A;  4IPB A;  4R4K A;  2WOH A;  1L5G B;  2IUJ A;  1JB4 A;  1OF5 A;  1PFP A;  4EBG A;  2OQE A;  3ROB A;  2RSX A;  3ER7 A;  1LXE A;  4GL6 A;  2BMR B;  3CCL 3;  3LML A;  1GY7 A;  3EJV A;  1JKG B;  2JDI H;  2INX A;  4PEJ A;  1QAK A;  3EC9 A;  1E97 A;  3WOF B;  1EG9 B;  1SPU A;  4XBY A;  5D82 A;  3MSO A;  3CPW 2;  1VQN 3;  3FLJ A;  1VZZ A;  4HM3 B;  5D83 A;  2UX0 A;  2Z77 A;  3GZX B;  3CD6 3;  3SXX A;  2MF7 A;  5AYR B;  3G16 A;  1FUW A;  4HM2 B;  4WP5 A;  3DUK A;  4J9A A;  3OXA A;  4MMY B;  1FGO A;  3CXC 2;  4N6O B;  2HMM B;  1W7C A;  1D6Z A;  1JNQ A;  3DY5 A;  4IT7 A;  2HMN B;  4BTW A;  3T0U A;  4FMC A;  1A90 A;  1O7H B;  2HMO B;  1OCV A;  1DMN A;  1C7H A;  2YFL B;  3KZT A;  3STD A;  3K9M C;  4NHF A;  4EV2 A;  4CDL A;  2HMK B;  2P0M A;  2W03 A;  4LSO A;  1N5H A;  2W9Q A;  3LH4 A;  3OV4 A;  4N6L A;  3LT8 A;  3OWS A;  4HKV B;  3S29 A;  3GWR A;  3U97 A;  5IER A;  5JPU A;  4K1V A;  1Q86 4;  4H61 A;  3SOA A;  1JKG A;  1O7W B;  5KP3 A;  4H3U A;  4AKY A;  2QIY A;  1OGZ A;  3LT9 A;  2BO9 B;  1OPY A;  1NO3 A;  1A67 A;  1CQS A;  1LNH A;  1EQK A;  2FNQ A;  1WNH A;  2QGU A;  4HM6 B;  3EQQ B;  5HGR A;  1GD3 A;  5IG3 A;  1Y4K A;  3KE7 A;  3LTD A;  1S72 3;  4WWU C;  4BTY A;  3CC7 3;  3PS8 A;  4R80 A;  3MKI A;  1OHP A;  2PZV A;  3N8B A;  3IPT A;  3NBB A;  3BLZ A;  1QVG 2;  4HM0 B;  8CHO A;  2CWV A;  4HM1 B;  1Q7Y 4;  3BNE A;  4AEQ A;  3NV0 B;  3FF2 A;  2SBL A;  3JUO A;  1VQ6 3;  3B4P A;  3LOY A;  1NJI 4;  2W6J H;  2WGQ A;  1K41 A;  5KP4 A;  1VQ4 3;  1YIT 3;  1JN5 B;  3EHC A;  5A0O B;  1K28 A;  7STD A;  4KZ1 A;  3ECF A;  1CEW I;  1SII A;  2W0Q A;  1WMP A;  1A2K A;  4J8T A;  4X2H A;  1K8A 4;  2WGO A;  1OH0 A;  2B24 B;  3K63 A;  4KFD A;  5STD A;  3CME 3;  3LTB A;  4HM7 B;  3F8X A;  4FMD A;  2CFW A;  2D1W A;  3F40 A;  3H51 A;  3I55 3;  3CCJ 3;  4RZM A;  2W56 B;  1U5O A;  1HU9 A;  1AV4 A;  3F14 A;  3HI7 A;  4WHA A;  3EN8 A;  5AIG A;  2XFS A;  2HMJ B;  3O8Y A;  1RN7 A;  2XEP A;  3PZW A;  3MG1 A;  5IG4 A;  4LZI A;  2BMO B;  3FSD A;  4KVH A;  3WOE B;  1SIH A;  4OUQ A;  2GBW B;  3MG2 A;  3X3Z A;  4FCZ A;  4BTX A;  1D6U A;  1W5Z A;  3X3Y A;  2CWU A;  1W01 A;  3CPO A;  1YHQ 3;  4HM4 B;  3V92 A;  5BXQ A;  1W2Z A;  3SOY A;  3RGA A;  3VF1 A;  5JPP A;  3EB8 A;  1IQ8 A;  1D6Y A;  2E2U A;  1OHS A;  2BMQ B;  1ULI B;  1DVD A;  2LQV A;  3MPH A;  5LC7 A;  2W9P A;  3NV0 A;  1A2V A;  3HII A;  1NB5 I;  3CCR 3;  2OWP A;  3DZL A;  1M9G A;  3IJE B;  1YJN 3;  1FGR A;  1TP6 A;  1IV7 A;  1FGQ A;  3A76 A;  3AMO A;  4RNY A;  3QRD A;  2WOF A;  1JN5 A;  1MNL A;  1KWI A;  3F8H A;  3KSE D;  1VQK 3;  4EXR A;  1QVF 2;  3EN1 B;  4O02 B;  1RRH A;  5EEO A;  2OOV A;  3KN4 A;  2XSH B;  1CYV A;  3PCR A;  4K90 B;  5IEN A;  2HML B;  3KKG A;  3JUQ A;  4K1U A;  3UL5 A;  1KQS 2;  2XGL A;  5LC6 A;  2OQE C;  2W56 A;  5IW9 A;  1N9E A;  2ML5 A;  1TFO A;  2Y73 A;  4LGQ A;  4FCM A;  3I0Y A;  3WA2 X;  4GB5 A;  1IU7 A;  1N8Q A;  3DM8 A;  1QAF A;  3BNC A;  3OW2 2;  5CK6 A;  3BND A;  2JQ5 A;  3CCU 3;  3BNB A;  2Y74 A;  4FMA A;  3NHX A;  3CCQ 3;  3UNL A;  1VQO 3;  5DRV A;  4STD A;  2GEY A;  5ELJ A;  1R4C A;  2IMJ A;  2D42 A;  1NB3 I;  3CMA 3;  3NBR A;  2XRX B;  3D9R A;  1UUV B;  2QA4 3;  5KP1 A;  3K5T A;  2OTJ 3;  1WTH A;  3FG4 A;  3E99 A;  4AKZ A;  1CYU A;  3B8L A;  1GYB A;  2E2T A;  3VGN A;  4N6M A;  5AIH A;  2CG0 A;  4JF8 A;  1ULJ B;  3G8Z A;  2KRT A;  3JUN A;  2Z7A A;  1GS3 A;  1TFK A;  3CCM 3;  3HK4 A;  3IMA B;  5IEO A;  3KFQ C;  4XDV A;  3K7C A;  2OTL 3;  3EE1 A;  3HX8 A;  3KSP A;  3L0R A;  5CF1 A;  3T8N A;  1W6C A;  1QJG A;  2OCT A;  4KFF A;  1GD4 A;  3OWU A;  3Q1C A;  1YJ9 3;  3FZW A;  4N6V 0;  3FKA A;  2B1X B;  1UI8 A;  2Z6B A;  1JB5 A;  3HZP A;  1WMN A;  4FR9 A;  1TIJ A;  3U1W A;  1YVB I;  1K73 4;  2RGQ A;  3FG3 A;  4HBR A;  3CC4 3;  3GZY B;  1UI7 A;  1V74 A;  4O2H A;  4R1K A;  3NQZ A;  4O3V A;  3NUV A;  1AR0 A;  4RBN A;  2CFG A;  3DGO A;  4MEI A;  2CW9 A;  1M1X B;  1W02 A;  2CG1 A;  3KII A;  1STF I;  1W6G A;  2FGT A;  3S5C A;  3S28 A;  3AMO B;  3V99 A;  1STD A;  2M7O A;  1YI2 3;  2K0M A;  3DGL A;  4QWT A;  2GU3 A;  4HZ9 B;  1N8R 4;  3F9S A;  4JRF A;  3F7S A;  2LYX A;  1KD1 4;  1IVU A;  3JVC A;  2XSO B;  1U8C B;  1K9M 4;  1VQ7 3;  2C11 A;  1W2B 2;  1F8N A;  5I97 A;  1IV9 A;  3GZR A;  5BVB A;  2CFK A;  4XM4 A;  5TGN A;  2F99 A;  4XDW A;  3WOD G;  2XR8 B;  3SLU A;  2ZL8 A;  1Q81 4;  4MJD A;  1ASK A;  3LTA A;  2KXG A;  1Q40 B;  1O7M B;  4R9L A;  1GY5 A;  1GY6 A;  1Q42 A;  1US1 A;  1O7N B;  3LTC A;  3ALA A;  3X40 A;  3CC2 3;  3WA3 A;  3FF0 A;  3OX9 A;  4NRE A;  1IT7 A;  3HIG A;  2E2V A;  4N3V A;  4OK0 A;  1RJO A;  2XGN A;  2Z76 A;  1DYU A;  4EYC A;  5D81 A;  1KSI A;  2CFD A;  2CKF B;  2XH9 A;  1TU5 A;  3EBY A;  1VQP 3;  3PXM A;  4X2O A;  2GBX B;  1HKX A;  4L7K A;  2I9W A;  1DMM A;  2BNG A;  2YFI B;  4WFO A;  5ELU A;  3LZA A;  4N6T A;  1FGM A;  2L4V A;  2O9U X;  5FW5 A;  2YFJ B;  5FGO A;  2GU1 A;  1OAC A;  4XB5 A;  3VSY A;  2P05 A;  3EBT A;  4K61 A;  1IVV A;  1JB2 A;  3X41 A;  3UB1 A;  3CCE 3;  1FA3 A;  3NX0 A;  3MYT A;  3UJM A;  4MMX B;  3DGM A;  2OOV C;  1IQX A;  3G0K A;  1UUW B;  3H3H A;  3BB9 A;  4HM5 B;  4HYZ A;  5G2G A;  1PU4 A;  2ZDJ A;  4EV5 A;  1YGE A;  3WDG B;  1IK3 A;  3G4S 3;  3FH1 A;  5CF2 A;  3MWZ A;  3NM2 A;  3SED A;  3X42 A;  1Q40 A;  3GAX A;  2CIU A;  2O3O A;  5IG0 A;  4KFE A;  1O7P B;  1LVN A;  1AVL A;  3T8U A;  5JBS A;  3LXU X;  2FXT A;  1VQM 3;  1OGX A;  2CFL A;  3GRD A;  1NU3 A;  3NQY A;  1ROA A;  1VQ9 3;  3SX1 A;  1T5Y A;  2CC3 A;  2XF3 A;  2XFT A;  1VQL 3;  1IQY A;  1E3R A;  4IIA A;  4LMI A;  1DVC A;  2RFR A;  3MG3 A;  3CU3 A;  1OUN A;  1KC8 4;  2P38 A;  3DMC A;  3FCS B;  2F98 A;  2W04 A;  4XBX A;  2CWT A;  5AII A;  1G96 A;  3PGB A;  4HJL B;  4ORL A;  4U13 A;  1VQ5 3;  3CNM A;  2RCD A;  2CH9 A;  2YX9 A;  1IDP A;  1EA2 A;  3RGR A;  3F7X A;  4I4K A;  6STD A;  3CCV 3;  1ROV A;  3Q2P A;  2STD A;  2K54 A;  1IVW A;  3TDG A;  1NDO B;  1O7G B;  1E3V A;  2GEX A;  3FGY A;  1FGT A;  3NM7 A;  4O8S A;  1UW1 A;  3EX9 A;  3LYG A;  1J2B A;  1M1K 4;  1JRQ A;  2QEX 3;  1Z1S A;  4FCJ A;  3QK9 A;  1MOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...