2RFRA

Crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
154
Chain Sequence
GMDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALMADGCAHFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_001166107.1) from Novosphingobium aromaticivorans DSM 12444 at 1.16 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Unknown function
total genus 56
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rfrA00
3I0YA 2Z76A 4PEJA 3EBTA 4R1KA 4OVMA 4XDWA 1DMNA 1BUQA 2RCDA 2B24B 3K0ZA 2I9WA 2F98A 2XSHB 3KSPA 3EC9A 1W01A 3OWUA 3E99A 4MJDA 4XBYA 3STDA 1Q40A 3F9SA 2F86B 4XM4A 4X2OA 1O7NB 3KZTA 4HM7B 4RZMA 3F8XA 3JUOA 5IERA 1Q40B 5KP1A 1EG9B 5AIIA 2RFRA 3KE7A 4HM5B 2YFLB 4J9AA 1SJWA 2HMNB 5KP4A 1STDA 2W2CA 1WQLB 7STDA 1QMAA 3DXOA 2GBXB 5HGRA 5CXOA 1E3VA 5IENA 3G0KA 4K1UA 3MG2A 3FLJA 5IG5A 2XR8B 4WYKA 8CHOA 3OWSA 2GBWB 2CKFB 2B1XB 2IMJA 3GZRA 5DRVA 2STDA 3CU3A 3JUQA 1ULIB 3NBRA 3ER7A 5STDA 3DMCA 2Z7AA 1UUVB 5G2GA 2HMMB 1W00A 3MG3A 1EA2A 2XRXB 3EHCA 1JKGA 4WYKB 5CF2A 3A76A 5JPPA 4HJLB 3FZWA 4L8PA 4XBXA 3GZBA 1IDPA 1W6YA 3LZAA 4FCMA 1U5OA 1JKGB 2Z77A 4HM2B 4WP5A 1W02A 5AEWB 1GYBA 3RGRA 5IEOA 3JUPA 1NWWA 3LYGA 1TP6A 1OHOA 1C7HA 4XB5A 3B7CA 4L8OA 3UJMA 3B4OA 1TUHA 2GXFA 3JUMA 5IF6A 4U13A 5IG0A 3F7SA 1ZO2A 2UX0A 3DZLA 3G16A 3FGYA 1O7WB 5DREA 1ISKA 3M8CA 2HMKB 4N3VA 4HZBB 1OGXA 2GEXA 1UUWB 3OXAA 3H3HA 3HZPA 3RGAA 2YFJB 3HK4A 2CHCA 1CQSA 4HM0B 4KVHA 2F99A 3EBYA 4Q53A 5CK6A 3EX9A 2BMOB 1JB4A 4HM1B 1NU3A 3UNLA 3S5CA 4HKVB 3F8HA 1O7GB 1DMQA 3EN1B 1O7MB 4R9KA 3CPOA 1OH0A 1OF5A 4HM3B 4OUQA 3D9RA 2JQ5A 5BVBA 4CDLA 5JPUA 1JB5A 4XDVA 5D83A 3K7CA 5CLKA 5AIFA 3NXJA 3T8UA 4HM6B 1OUNA 3BLZA 3SOAA 3EQQB 2HMOB 3F7XA 1OF5B 3GWRA 5IG3A 4H3UA 5FW5A 1VZZA 2BMRB 4GB5A 3GZYB 3GZXB 4WWUC 5TGNA 1AR0A 3VSYA 5AIHA 4LGQA 2YFIB 4K1VA 3NUVA 5AI1A 3CNMA 3ROBA 3BB9A 5EVHA 3G8ZA 3IPTA 3OV4A 5AIGA 2INXA 3MSOA 4X2HA 3JUNA 4LMIA 1OHPA 1A2KA 3FF2A 1QJGA 5D82A 2R4IA 5CF1A 1OCVA 1OHSA 1ULJB 4FCJA 3VGNA 4STDA 3GRDA 1JN5A 2BNGA 2QIYA 5IEPA 1GY5A 2BMQB 5KP3A 4I4KA 1Z1SA 4J8TA 4ORLA 2GEYA 3HX8A 1JN5B 3CNXA 4R9LA 5IG4A 3EF8A 2OWPA 2K54A 3SEDA 3MHEA 3NV0A 4L7KA 6STDA 2PZVA 1NDOB 3DM8A 3DUKA 3FF0A 1GS3A 1HKXA 1GY6A 3B4PA 4LEHA 1ZX2A 3ECFA 3NM2A 4HM4B 1K41A 3FSDA 3F40A 4HVNA 3F14A 3NV0B 3B8LA 3NHXA 2XSOB 5D81A 3OWYA 1S5AA 1Q42A 3EJVA 3EN8A 1JB2A 3OX9A 3Q90A 3FKAA 3KKGA 1OGZA 2HMLB 2RGQA 3FH1A 3MG1A 5AEUB 4HZ9B 5BXQA 4HM8B 3T8NA 3H51A 1ASKA 3MYTA 1O7HB 3SOYA 3WMDA 1GY7A 3MKIA 1E3RA 4XBTA 2A15A 1O7PB 2HMJB 1OPYA 2QGUA 1E97A 4IIAA 1DMMA
chains in the Genus database with same CATH superfamily
2C4BA 3I0YA 2HOHA 2Z76A 4PEJA 2ML5A 3S27A 3V92A 3EBTA 3WODG 3G6E3 1K734 4AKYA 3LT9A 2WGQA 4R1KA 1YJ93 4OVMA 3S28A 2J8XB 3DH2A 4MMXB 4XDWA 1L5GB 1DMNA 3WA2X 4EYCA 1BNRA 1BUQA 1YVBI 2RCDA 4HBRA 2CFDA 1MGWA 3EB8A 1WMPA 5AYSC 3UL6A 1IK3A 2CFWA 2B24B 3LXUX 2K3DA 3V99A 3X3XA 2P09A 1WNHA 2W9PA 3IMAB 2I9WA 3K0ZA 1IQXA 3AHSA 1B2MA 2F98A 2XSHB 4BL2A 1RRHA 2QEX3 2C10A 4KT3B 2H0IA 3O8YA 1I2EA 3KSPA 1GOUA 3EC9A 4FMCA 3BNEA 4OK0A 1W01A 3OWUA 3CCU3 1BNIA 4N6UA 1X1WA 3E99A 4MJDA 3CD63 4XBYA 2LQVA 5ELJA 3STDA 1YI23 1Q40A 3F9SA 1WMNA 1TTOA 2F86B 5BIRA 4XM4A 3AGNA 4X2OA 4FMBA 1B2UA 1O7NB 3KZTA 2RSXA 3FCSB 4LSOA 2KXGA 4JRFA 2SBLA 1BU4A 3FG3A 3LMLA 1V58A 1GD4A 4HM7B 1YHQ3 4J5GA 1LNIA 5JBSA 1Q7HA 1LVNA 4RZMA 1RDSA 1B2ZA 3F8XA 4O3VA 3WOEB 1N9JA 2XFSA 1IT8A 3JUOA 4KFEA 1JV2B 1Q40B 5IERA 5KP1A 1EG9B 2KAAA 2XGLA 5AIIA 1PYLA 1YJN3 2RFRA 1TU5A 3KE7A 1K9M4 3CC73 4HM5B 2YFLB 1TRPA 4J9AA 2CG0A 3CME3 2F5MA 1SJWA 3WR2A 2HMNB 1B2SA 3NQZA 1STDA 1TFKA 2W2CA 5KP4A 3S67A 1WQLB 7STDA 4BTXA 1RGCA 2MC8A 4H61A 1QMAA 2BO9B 2CFLA 2OQEA 3SXXA 3DXOA 4O8SA 2GBXB 3KFQC 5HGRA 4EC6A 5CXOA 1DE3A 1E3VA 5IENA 3G0KA 3QK9A 4K1UA 2CK3H 3MG2A 1BGSA 3AMOA 1VQ83 1NJI4 3PGBA 3FLJA 4J5KA 1B27A 5IG5A 2XR8B 4WYKA 3LOYA 8CHOA 4GSPA 4KFDA 2XEPA 2Q07A 3OWSA 3NBJA 2GBWB 2CKFB 2UUGC 3DY5A 2B1XB 2GU1A 2IMJA 3AHWA 3GZRA 5DRVA 1Q9EA 2STDA 3AGOA 3CU3A 3JUQA 3WOFB 3GSPA 1ULIB 3NBRA 3ER7A 5STDA 3DMCA 2Z7AA 4EV5A 1UUVB 2HMMB 5G2GA 1D6ZA 1HU9A 1W00A 1T2IA 3MG3A 4BTWA 2KF6A 1RGLA 1EA2A 3AMOB 2XRXB 3BU4A 1G96A 3EHCA 3D5GA 3L0RA 4CPKA 5RNTA 3CPW2 1SPUA 1JKGA 4BTYA 4EBGA 2OTL3 2OTJ3 2W6JH 4WYKB 2IY2A 5CF2A 1K8A4 2CIUA 1JNQA 2W03A 2L4VA 3A76A 1W4NA 5FGOA 5LC7A 5JPPA 4HJLB 3FZWA 4L8PA 4XBXA 3I553 4QWTA 3MWZA 3CCQ3 1BRNL 3FG1A 3U1WA 1QVF2 3CCS3 3GZBA 5AYRB 1YNVX 3S29A 3X3ZA 4N6TA 1C54A 2F4YA 2D42A 4N6LA 1IDPA 1RGEA 3NQYA 1W6YA 3LZAA 2W56A 4FCMA 2ZHXB 1UI7A 4CCVA 1U5OA 1JKGB 1ROVA 1BRKA 2Z77A 4HM2B 1M904 1UCKA 1EKMA 1RGAA 4RBNA 3SVAA 4WP5A 3CMA3 1W02A 2R41A 1IQYA 1M1XB 3D79A 1N8R4 3QRDA 1U8CB 1EUIC 5AEWB 1IVWA 1A90A 1UDII 2CWTA 1GYBA 1HYFA 3BIRA 1SARA 4DKIA 1DYUA 3RGRA 3WHOA 5IEOA 3X40A 2MF7A 1LOXA 1B21A 3JUPA 7RNTA 1BNEA 1NWWA 3LYGA 2W56B 2C11A 1LXEA 1TP6A 4N6V0 1G0TA 1W6GA 1OHOA 1UCJA 1LOYA 3ZG5A 1BRJA 1C7HA 2BHMA 2QA43 4XB5A 4HYZA 3B7CA 4L8OA 3BNCA 1SQWA 2W04A 3B4OA 4FR9A 1I3IA 3UJMA 5M19A 1TUHA 5EQLA 2BT3A 1BNFA 4GHOA 1R4YA 7GSPA 2GXFA 1QVG2 1JZOA 2UGIA 3JUMA 1RMSA 1Q824 3IJEB 1QAFA 3K63A 5IF6A 4N6MA 1RTUA 4GL6A 4U13A 1MGRA 3N8BA 5IG0A 1NNVA 3BNDA 3F7SA 1CH0A 1MWTA 1ZO2A 1PFPA 2UX0A 1LOVA 1TJDA 3VF1A 2CH9A 2L1SA 3DZLA 3G16A 3FGYA 2CG1A 1O7WB 1YGWA 5DREA 1ISKA 1W7CA 3KN4A 4NPBA 2FXTA 3M8CA 2Y73A 2HMKB 1D6UA 1TRQA 4HAAA 4HZBB 4N3VA 4JF8A 1X1YA 1X1XA 1IVUA 3J7Yd 1GOYA 2P0MA 3X3YA 1AVKA 2OOVC 1BANA 1OGXA 1UUWB 2GEXA 1EEJA 1G02A 3OXAA 4LZIA 3H3HA 3T0UA 3HZPA 1S723 1QALA 3N9HA 3DGYA 3RGAA 2YFJB 3HK4A 2CHCA 1BVIA 3URPA 1CQSA 2WGOA 4HOHA 4HM0B 4KVHA 2F99A 2KF4A 4FCZA 3EBYA 4Q53A 5BU4A 1FGQA 3HIGA 1RN4A 4ILFA 5CK6A 2F5WA 1WMOA 3EX9A 2KRTA 1BNJA 2BMOB 1V74A 1JB4A 1KC84 4R80A 3ZG0A 3DGMA 3NM7A 1PU4A 4HM1B 1NU3A 1IYYA 1IVVA 4N6NB 3UNLA 1M1K4 2CX1A 1VQ53 4K61A 3S5CA 1I8VA 2O9UX 4HKVB 3F8HA 3PCSA 1VQ73 1O7GB 1DMQA 5GSPA 3CC43 1VQO3 3EN1B 1O7MB 4FMAA 1I0VA 4R9KA 3KIIA 3N54B 3CPOA 4R4KA 1RJOA 1JJ22 1OH0A 1OF5A 1RGFA 1UW1A 4HM3B 4OUQA 1SIHA 3D9RA 1RHLA 3OW22 2JQ5A 5BVBA 4CDLA 2ZL8A 5JPUA 1JB5A 1CYVA 3LT8A 1RKYA 4G1MB 3UL5A 1BIRA 1I0XA 4XDVA 1QAKA 1V57A 5D83A 3RDEA 1RNBA 1N9EA 1Q7Y4 1A2PA 2BU4A 3K7CA 5CLKA 5AIFA 2CFKA 1SIIA 1TFOA 2KF3A 3NXJA 1LOWA 1W6CA 1BSCA 2FNQA 3T8UA 2CW9A 4HM6B 2O3OA 1OUNA 3BLZA 3SOAA 1IV9A 4RNZA 1VQN3 1FGOA 2LYXA 3KSED 3EQQB 1W2B2 2CC3A 2HMOB 3F7XA 1MNLA 1UGHI 2FGTA 2RBIA 1OF5B 1KD14 1N5HA 1EQKA 2WOFA 2CFGA 1J2BA 1JBSA 2H0GA 1FUTA 3PYJA 1YGEA 1AV4A 1Q864 3GWRA 3Q1CA 3K9MC 6GSPA 1D6YA 3CCE3 5IG3A 4H3UA 1RN1A 3SLUA 4AKZA 1FW7A 2V1LA 5FW5A 4I5QA 1VZZA 1T5YA 1IT7A 1UCLA 1BNSA 1STFI 3D4AA 1ZGXA 1AY7A 1GMRA 4BIRA 2BMRB 2P05A 4GB5A 5M1AA 3WA3A 1BSEA 3Q2PA 1B20A 1LRAA 3GZYB 1A67A 3GZXB 4WWUC 5TGNA 1AR0A 3G4S3 1VQP3 1RGKA 1K28A 1MWUA 3VSYA 5AIHA 4LGQA 1RCLA 3KCHA 1BUJA 4EV2A 2GU3A 1WTHA 2YFIB 4MMYB 1X1UA 4MEIA 4K1VA 2WOHA 3NUVA 4CJNA 1UGIA 1BRIA 2K0MA 3UB1A 5AI1A 3CNMA 2AADA 3ROBA 3BB9A 2Z6BA 5G1KA 1RCKA 3LTAA 3DGOA 2IUKA 3K5TA 5EVHA 3G8ZA 3ZFZA 1Q814 3IPTA 3OV4A 3CXC2 1AQZA 3GAXA 5AIGA 1YJW3 1RNTA 2INXA 4NREA 3MSOA 1ZS7A 4X2HA 1KQS2 1FZUA 3JUNA 4LMIA 5EEOA 1FYSA 1RRLA 4TX4A 5I97A 1RSNA 2W0QA 4FMDA 1OHPA 2E2VA 1BRGA 1A2KA 2H0HA 3CCM3 1I3FA 3U97A 1LNHA 3FF2A 1QJGA 3PXMA 2XGNA 3PZWA 3JVCA 5D82A 1PY3A 2XF3A 2R4IA 2AAEA 5CF1A 2E2TA 4IT7A 1VQM3 1NB5I 4N6OB 1OCVA 1OHSA 1NO3A 1ULJB 4FCJA 3SX1A 2M7OA 4BL3A 2CWUA 3VGNA 4STDA 3GRDA 1GMPA 4WFOA 3CCJ3 1JN5A 2BNGA 1JZDA 1DVDA 1GOVA 2QIYA 5IEPA 1VQQA 5M18A 1GY5A 2BMQB 4KFFA 1GSPA 4NHFA 5KP3A 4I4KA 4O02B 1Z1SA 1F8NA 2CX0A 4J8TA 4ORLA 1MOLA 3G713 1HZ1A 1DVCA 2GEYA 3HX8A 2OQEC 5A0OB 3CCV3 3HOHA 2KCDA 2IA7A 1T2HA 2GSPA 5IW9A 3BNBA 3X41A 1UUGB 1VQ93 1KWIA 3HIIA 1UI8A 1A2VA 2RNTA 1BSDA 3DGLA 1IQ8A 1JN5B 1N8QA 2ZA4A 3CNXA 3D5IA 4R9LA 3CCR3 1MWSA 5IG4A 3EF8A 1YIT3 2OCTA 2XH9A 3NX0A 1T3BA 1AVLA 2OWPA 2K54A 1W5ZA 2ZDJA 3SEDA 2F56A 1VQ63 2SARA 1BSBA 2E2UA 2OOVA 3MHEA 1RLSA 4ZM8A 3NV0A 3NBBA 1FGMA 2Y74A 3CC23 1LQGC 4L7KA 6STDA 3I563 1N5PA 2PZVA 2WO0A 1NDOB 4MMZB 1B2XA 1BOXA 3DM8A 3DUKA 3FF0A 4K90B 1VQ43 1RGHA 1GS3A 1HKXA 1GY6A 4WHAA 1I70A 5ELUA 3WDGB 3B4PA 2YX9A 3LTBA 6RNTA 2BIRA 1US1A 2JDIH 4LEHA 1ZX2A 1MWRA 1FGTA 1M9GA 3X42A 1CEWI 1BSAA 1GMQA 3ECFA 3NM2A 4HM4B 1K41A 4LYLB 3TDGA 4AEQA 1VQK3 3FSDA 1FA3A 3F40A 1R4CA 5G1LA 4HVNA 3F14A 1W2ZA 3NV0B 3B8LA 3NHXA 2XSOB 5D81A 3ALAA 1S5AA 3OWYA 3CCL3 1Q42A 1B3SA 3SYUA 3EJVA 8RNTA 3EN8A 1JB2A 1FUWA 3OX9A 3Q90A 1NB3I 3V98A 4KZ1A 1LQMB 3FKAA 3KKGA 2P38A 1JRQA 1OGZA 2HMLB 3RNTA 1UCIA 2IUJA 3PS8A 2P0XA 2W9QA 3A5EA 2RGQA 5LC6A 1I2FA 3FH1A 4EXRA 1FGRA 3MG1A 5AEUB 1YIJ3 4HZ9B 1OACA 1BRHA 5BXQA 4HM8B 2KF5A 3T8NA 1IV7A 1IVXA 2CWVA 1ASKA 3H51A 1ROAA 2D1WA 3MYTA 9RNTA 3MPHA 3LTDA 2XFTA 1JBRA 3PCRA 1RGGA 1O7HB 3SOYA 3WMDA 1GY7A 1BRSA 4IPBA 3MKIA 1E3RA 4XBTA 2ML6A 4EW5A 1BAOA 3DGNA 1YVSA 3Q3FA 1VQL3 4RNTA 1KSIA 3HI7A 1IU7A 1I2GA 2PNCA 2A15A 2IYJA 3LH4A 4RNYA 3LTCA 1O7PB 1RN7A 1BNGA 1Y4KA 1DETA 1GD3A 1OPYA 1TIJA 2HMJB 2QGUA 1E97A 3FG4A 4O2HA 1FUSA 3D3LA 1JBTA 1CYUA 3EE1A 4IIAA 1DMMA 4BU4A 5HOHA
chains in the Genus database with same CATH topology
3I0YA 2Z76A 4PEJA 3S27A 2ML5A 3V92A 3WODG 3EBTA 3G6E3 1K734 4AKYA 3LT9A 2WGQA 4R1KA 1YJ93 4OVMA 3S28A 4MMXB 1L5GB 4XDWA 3WA2X 1DMNA 4EYCA 1BUQA 1YVBI 2RCDA 4HBRA 2CFDA 3EB8A 1WMPA 5AYSC 3UL6A 1IK3A 2CFWA 2B24B 3LXUX 3V99A 3X3XA 2P09A 1WNHA 2W9PA 3IMAB 2I9WA 3K0ZA 1IQXA 2F98A 2XSHB 1RRHA 2QEX3 2C10A 3O8YA 3KSPA 3EC9A 4FMCA 3BNEA 4OK0A 1W01A 3OWUA 3CCU3 4N6UA 3E99A 4MJDA 3CD63 4XBYA 2LQVA 5ELJA 3STDA 1YI23 1Q40A 3F9SA 1WMNA 2F86B 4XM4A 4X2OA 4FMBA 1O7NB 3KZTA 2RSXA 3FCSB 4LSOA 2KXGA 4JRFA 2SBLA 3FG3A 3LMLA 1GD4A 4HM7B 1YHQ3 5JBSA 1LVNA 4RZMA 3F8XA 4O3VA 3WOEB 1N9JA 2XFSA 1IT8A 3JUOA 4KFEA 1JV2B 1Q40B 5IERA 5KP1A 1EG9B 2XGLA 1YJN3 5AIIA 2RFRA 1TU5A 3KE7A 1K9M4 3CC73 4HM5B 2YFLB 3CME3 4J9AA 2CG0A 1SJWA 2HMNB 3NQZA 5KP4A 1STDA 1TFKA 2W2CA 3S67A 1WQLB 7STDA 4BTXA 2MC8A 4H61A 1QMAA 2BO9B 2CFLA 2OQEA 3SXXA 3DXOA 4O8SA 2GBXB 3KFQC 5HGRA 4EC6A 5CXOA 1E3VA 5IENA 3G0KA 3QK9A 4K1UA 2CK3H 3MG2A 3AMOA 1VQ83 1NJI4 3PGBA 3FLJA 5IG5A 2XR8B 4WYKA 3LOYA 8CHOA 4KFDA 2XEPA 2Q07A 3OWSA 3NBJA 2GBWB 2CKFB 3DY5A 2B1XB 2GU1A 2IMJA 3GZRA 5DRVA 2STDA 3CU3A 3JUQA 3WOFB 1ULIB 3NBRA 3ER7A 5STDA 3DMCA 2Z7AA 4EV5A 2HMMB 1UUVB 5G2GA 1D6ZA 1HU9A 1W00A 3MG3A 4BTWA 1EA2A 3AMOB 2XRXB 3EHCA 1G96A 3L0RA 3CPW2 2OTJ3 1SPUA 1JKGA 4BTYA 4EBGA 2OTL3 2W6JH 4WYKB 5CF2A 1K8A4 2CIUA 1JNQA 2W03A 2L4VA 3A76A 1W4NA 5FGOA 5LC7A 5JPPA 4HJLB 3FZWA 4L8PA 4XBXA 3I553 4QWTA 3MWZA 3CCQ3 3FG1A 3U1WA 1QVF2 3CCS3 3GZBA 5AYRB 3S29A 3X3ZA 4N6TA 2D42A 4N6LA 1IDPA 3NQYA 1W6YA 3LZAA 2W56A 4FCMA 4CCVA 1UI7A 1U5OA 1JKGB 1ROVA 2Z77A 4HM2B 1M904 4RBNA 1EKMA 3SVAA 4WP5A 3CMA3 1W02A 1IQYA 1M1XB 1N8R4 3QRDA 1U8CB 5AEWB 1IVWA 1A90A 2CWTA 1GYBA 1DYUA 3RGRA 3X40A 5IEOA 2MF7A 1LOXA 3JUPA 1NWWA 3LYGA 2W56B 2C11A 1LXEA 1TP6A 4N6V0 1W6GA 1OHOA 1C7HA 2BHMA 2QA43 4XB5A 4HYZA 3B7CA 4L8OA 3BNCA 1SQWA 2W04A 3B4OA 4FR9A 3UJMA 1TUHA 5EQLA 2BT3A 1QVG2 2GXFA 3JUMA 1Q824 3IJEB 1QAFA 3K63A 5IF6A 4GL6A 4U13A 3N8BA 5IG0A 3F7SA 3BNDA 1ZO2A 1PFPA 2UX0A 3VF1A 2CH9A 3DZLA 3G16A 3FGYA 2CG1A 1O7WB 5DREA 1ISKA 1W7CA 3KN4A 2FXTA 3M8CA 2Y73A 2HMKB 1D6UA 4N3VA 4HZBB 4JF8A 1IVUA 3J7Yd 2P0MA 3X3YA 1AVKA 2OOVC 1OGXA 2GEXA 1UUWB 3OXAA 4LZIA 3T0UA 3H3HA 3HZPA 1S723 1QALA 3N9HA 3RGAA 2YFJB 3HK4A 2CHCA 1CQSA 2WGOA 4HM0B 4KVHA 2F99A 4FCZA 3EBYA 4Q53A 1FGQA 3HIGA 5CK6A 1WMOA 3EX9A 2KRTA 2BMOB 1V74A 1JB4A 1KC84 4R80A 3DGMA 3NM7A 1PU4A 4HM1B 1NU3A 1IVVA 4N6NB 3UNLA 1M1K4 1VQ53 4K61A 3S5CA 2O9UX 4HKVB 3F8HA 3PCSA 1VQ73 1O7GB 1DMQA 3CC43 1VQO3 3EN1B 1O7MB 4FMAA 4R9KA 3KIIA 3N54B 3CPOA 4R4KA 1RJOA 1JJ22 1OH0A 1OF5A 1UW1A 4HM3B 4OUQA 3OW22 1SIHA 3D9RA 2JQ5A 5BVBA 4CDLA 2ZL8A 5JPUA 1JB5A 1CYVA 3LT8A 1RKYA 4G1MB 3UL5A 4XDVA 1QAKA 5D83A 3RDEA 1N9EA 1Q7Y4 3K7CA 5CLKA 5AIFA 2CFKA 1SIIA 1TFOA 3NXJA 1W6CA 2FNQA 3T8UA 2CW9A 4HM6B 2O3OA 1OUNA 3BLZA 3SOAA 1IV9A 4RNZA 1VQN3 1FGOA 2LYXA 3KSED 3EQQB 1W2B2 2CC3A 2HMOB 3F7XA 1MNLA 2FGTA 1OF5B 1KD14 1N5HA 1EQKA 2WOFA 2CFGA 1J2BA 3PYJA 1YGEA 1AV4A 1Q864 3GWRA 3Q1CA 3K9MC 1D6YA 3CCE3 5IG3A 4H3UA 3SLUA 4AKZA 2V1LA 5FW5A 1VZZA 1T5YA 1IT7A 1STFI 2BMRB 2P05A 4GB5A 3WA3A 3Q2PA 3GZYB 1A67A 3GZXB 4WWUC 5TGNA 1AR0A 3G4S3 1K28A 3VSYA 5AIHA 4LGQA 4EV2A 2GU3A 1WTHA 2YFIB 4MMYB 4MEIA 4K1VA 2WOHA 3NUVA 2K0MA 3UB1A 5AI1A 3CNMA 3ROBA 3BB9A 2Z6BA 3LTAA 3DGOA 2IUKA 3K5TA 5EVHA 3G8ZA 1Q814 3IPTA 3OV4A 3CXC2 3GAXA 5AIGA 1YJW3 2INXA 4NREA 3MSOA 4X2HA 1KQS2 5EEOA 3JUNA 4LMIA 1RRLA 4TX4A 5I97A 2W0QA 4FMDA 1OHPA 2E2VA 1A2KA 3CCM3 1LNHA 3FF2A 1QJGA 3PXMA 2XGNA 3PZWA 3JVCA 5D82A 2XF3A 2R4IA 5CF1A 2E2TA 4IT7A 1VQM3 1NB5I 4N6OB 1OCVA 1OHSA 1NO3A 1ULJB 4FCJA 3SX1A 2M7OA 2CWUA 3VGNA 4STDA 3GRDA 4WFOA 3CCJ3 1JN5A 2BNGA 1DVDA 2QIYA 5IEPA 1GY5A 2BMQB 4KFFA 4NHFA 5KP3A 4I4KA 4O02B 1Z1SA 1F8NA 4J8TA 4ORLA 1MOLA 3G713 1DVCA 2GEYA 3HX8A 2OQEC 5A0OB 3CCV3 2KCDA 2IA7A 5IW9A 3BNBA 3X41A 1VQ93 1KWIA 3HIIA 1UI8A 1A2VA 3DGLA 1IQ8A 1JN5B 1N8QA 3CNXA 4R9LA 3CCR3 5IG4A 3EF8A 1YIT3 2OCTA 2XH9A 3NX0A 1AVLA 2OWPA 2K54A 1W5ZA 2ZDJA 3SEDA 1VQ63 2E2UA 2OOVA 3MHEA 4ZM8A 3NV0A 3NBBA 1FGMA 2Y74A 3CC23 4L7KA 6STDA 3I563 1N5PA 2PZVA 2WO0A 1NDOB 4MMZB 3DM8A 3DUKA 3FF0A 4K90B 1VQ43 1GS3A 1HKXA 1GY6A 4WHAA 5ELUA 3WDGB 3B4PA 2YX9A 3LTBA 1US1A 2JDIH 4LEHA 1ZX2A 1M9GA 1FGTA 3X42A 1CEWI 3TDGA 3ECFA 3NM2A 4HM4B 1K41A 4AEQA 1FA3A 1VQK3 3FSDA 3F40A 1R4CA 4HVNA 3F14A 1W2ZA 3NV0B 3B8LA 3NHXA 2XSOB 5D81A 3ALAA 1S5AA 3OWYA 3CCL3 1Q42A 3EJVA 3EN8A 1JB2A 1FUWA 3OX9A 3Q90A 1NB3I 3V98A 4KZ1A 3FKAA 3KKGA 2P38A 1JRQA 1OGZA 2HMLB 2IUJA 3PS8A 2P0XA 2W9QA 2RGQA 5LC6A 3FH1A 4EXRA 1YIJ3 1FGRA 3MG1A 5AEUB 4HZ9B 1OACA 5BXQA 4HM8B 3T8NA 1IV7A 1IVXA 2CWVA 1ASKA 3H51A 1ROAA 2D1WA 3MYTA 3MPHA 3LTDA 2XFTA 3PCRA 1O7HB 3SOYA 3WMDA 1GY7A 4IPBA 3MKIA 1E3RA 4XBTA 2ML6A 3DGNA 1VQL3 1KSIA 3HI7A 1IU7A 2PNCA 3LH4A 2A15A 4RNYA 1VQP3 3U97A 3LTCA 1O7PB 1RN7A 4N6MA 1Y4KA 1GD3A 1TIJA 1OPYA 2HMJB 2QGUA 3FG4A 1E97A 4O2HA 1CYUA 3D3LA 3EE1A 4IIAA 1DMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0Y A;  2Z76 A;  4PEJ A;  3EBT A;  4R1K A;  4OVM A;  4XDW A;  1DMN A;  1BUQ A;  2RCD A;  2B24 B;  3K0Z A;  2I9W A;  2F98 A;  2XSH B;  3KSP A;  3EC9 A;  1W01 A;  3OWU A;  3E99 A;  4MJD A;  4XBY A;  3STD A;  1Q40 A;  3F9S A;  2F86 B;  4XM4 A;  4X2O A;  1O7N B;  3KZT A;  4HM7 B;  4RZM A;  3F8X A;  3JUO A;  5IER A;  1Q40 B;  5KP1 A;  1EG9 B;  5AII A;  2RFR A;  3KE7 A;  4HM5 B;  2YFL B;  4J9A A;  1SJW A;  2HMN B;  5KP4 A;  1STD A;  2W2C A;  1WQL B;  7STD A;  1QMA A;  3DXO A;  2GBX B;  5HGR A;  5CXO A;  1E3V A;  5IEN A;  3G0K A;  4K1U A;  3MG2 A;  3FLJ A;  5IG5 A;  2XR8 B;  4WYK A;  8CHO A;  3OWS A;  2GBW B;  2CKF B;  2B1X B;  2IMJ A;  3GZR A;  5DRV A;  2STD A;  3CU3 A;  3JUQ A;  1ULI B;  3NBR A;  3ER7 A;  5STD A;  3DMC A;  2Z7A A;  1UUV B;  5G2G A;  2HMM B;  1W00 A;  3MG3 A;  1EA2 A;  2XRX B;  3EHC A;  1JKG A;  4WYK B;  5CF2 A;  3A76 A;  5JPP A;  4HJL B;  3FZW A;  4L8P A;  4XBX A;  3GZB A;  1IDP A;  1W6Y A;  3LZA A;  4FCM A;  1U5O A;  1JKG B;  2Z77 A;  4HM2 B;  4WP5 A;  1W02 A;  5AEW B;  1GYB A;  3RGR A;  5IEO A;  3JUP A;  1NWW A;  3LYG A;  1TP6 A;  1OHO A;  1C7H A;  4XB5 A;  3B7C A;  4L8O A;  3UJM A;  3B4O A;  1TUH A;  2GXF A;  3JUM A;  5IF6 A;  4U13 A;  5IG0 A;  3F7S A;  1ZO2 A;  2UX0 A;  3DZL A;  3G16 A;  3FGY A;  1O7W B;  5DRE A;  1ISK A;  3M8C A;  2HMK B;  4N3V A;  4HZB B;  1OGX A;  2GEX A;  1UUW B;  3OXA A;  3H3H A;  3HZP A;  3RGA A;  2YFJ B;  3HK4 A;  2CHC A;  1CQS A;  4HM0 B;  4KVH A;  2F99 A;  3EBY A;  4Q53 A;  5CK6 A;  3EX9 A;  2BMO B;  1JB4 A;  4HM1 B;  1NU3 A;  3UNL A;  3S5C A;  4HKV B;  3F8H A;  1O7G B;  1DMQ A;  3EN1 B;  1O7M B;  4R9K A;  3CPO A;  1OH0 A;  1OF5 A;  4HM3 B;  4OUQ A;  3D9R A;  2JQ5 A;  5BVB A;  4CDL A;  5JPU A;  1JB5 A;  4XDV A;  5D83 A;  3K7C A;  5CLK A;  5AIF A;  3NXJ A;  3T8U A;  4HM6 B;  1OUN A;  3BLZ A;  3SOA A;  3EQQ B;  2HMO B;  3F7X A;  1OF5 B;  3GWR A;  5IG3 A;  4H3U A;  5FW5 A;  1VZZ A;  2BMR B;  4GB5 A;  3GZY B;  3GZX B;  4WWU C;  5TGN A;  1AR0 A;  3VSY A;  5AIH A;  4LGQ A;  2YFI B;  4K1V A;  3NUV A;  5AI1 A;  3CNM A;  3ROB A;  3BB9 A;  5EVH A;  3G8Z A;  3IPT A;  3OV4 A;  5AIG A;  2INX A;  3MSO A;  4X2H A;  3JUN A;  4LMI A;  1OHP A;  1A2K A;  3FF2 A;  1QJG A;  5D82 A;  2R4I A;  5CF1 A;  1OCV A;  1OHS A;  1ULJ B;  4FCJ A;  3VGN A;  4STD A;  3GRD A;  1JN5 A;  2BNG A;  2QIY A;  5IEP A;  1GY5 A;  2BMQ B;  5KP3 A;  4I4K A;  1Z1S A;  4J8T A;  4ORL A;  2GEY A;  3HX8 A;  1JN5 B;  3CNX A;  4R9L A;  5IG4 A;  3EF8 A;  2OWP A;  2K54 A;  3SED A;  3MHE A;  3NV0 A;  4L7K A;  6STD A;  2PZV A;  1NDO B;  3DM8 A;  3DUK A;  3FF0 A;  1GS3 A;  1HKX A;  1GY6 A;  3B4P A;  4LEH A;  1ZX2 A;  3ECF A;  3NM2 A;  4HM4 B;  1K41 A;  3FSD A;  3F40 A;  4HVN A;  3F14 A;  3NV0 B;  3B8L A;  3NHX A;  2XSO B;  5D81 A;  3OWY A;  1S5A A;  1Q42 A;  3EJV A;  3EN8 A;  1JB2 A;  3OX9 A;  3Q90 A;  3FKA A;  3KKG A;  1OGZ A;  2HML B;  2RGQ A;  3FH1 A;  3MG1 A;  5AEU B;  4HZ9 B;  5BXQ A;  4HM8 B;  3T8N A;  3H51 A;  1ASK A;  3MYT A;  1O7H B;  3SOY A;  3WMD A;  1GY7 A;  3MKI A;  1E3R A;  4XBT A;  2A15 A;  1O7P B;  2HMJ B;  1OPY A;  2QGU A;  1E97 A;  4IIA A;  1DMM A; 
#chains in the Genus database with same CATH topology
 2C4B A;  3I0Y A;  2HOH A;  2Z76 A;  4PEJ A;  2ML5 A;  3S27 A;  3V92 A;  3EBT A;  3WOD G;  3G6E 3;  1K73 4;  4AKY A;  3LT9 A;  2WGQ A;  4R1K A;  1YJ9 3;  4OVM A;  3S28 A;  2J8X B;  3DH2 A;  4MMX B;  4XDW A;  1L5G B;  1DMN A;  3WA2 X;  4EYC A;  1BNR A;  1BUQ A;  1YVB I;  2RCD A;  4HBR A;  2CFD A;  1MGW A;  3EB8 A;  1WMP A;  5AYS C;  3UL6 A;  1IK3 A;  2CFW A;  2B24 B;  3LXU X;  2K3D A;  3V99 A;  3X3X A;  2P09 A;  1WNH A;  2W9P A;  3IMA B;  2I9W A;  3K0Z A;  1IQX A;  3AHS A;  1B2M A;  2F98 A;  2XSH B;  4BL2 A;  1RRH A;  2QEX 3;  2C10 A;  4KT3 B;  2H0I A;  3O8Y A;  1I2E A;  3KSP A;  1GOU A;  3EC9 A;  4FMC A;  3BNE A;  4OK0 A;  1W01 A;  3OWU A;  3CCU 3;  1BNI A;  4N6U A;  1X1W A;  3E99 A;  4MJD A;  3CD6 3;  4XBY A;  2LQV A;  5ELJ A;  3STD A;  1YI2 3;  1Q40 A;  3F9S A;  1WMN A;  1TTO A;  2F86 B;  5BIR A;  4XM4 A;  3AGN A;  4X2O A;  4FMB A;  1B2U A;  1O7N B;  3KZT A;  2RSX A;  3FCS B;  4LSO A;  2KXG A;  4JRF A;  2SBL A;  1BU4 A;  3FG3 A;  3LML A;  1V58 A;  1GD4 A;  4HM7 B;  1YHQ 3;  4J5G A;  1LNI A;  5JBS A;  1Q7H A;  1LVN A;  4RZM A;  1RDS A;  1B2Z A;  3F8X A;  4O3V A;  3WOE B;  1N9J A;  2XFS A;  1IT8 A;  3JUO A;  4KFE A;  1JV2 B;  1Q40 B;  5IER A;  5KP1 A;  1EG9 B;  2KAA A;  2XGL A;  5AII A;  1PYL A;  1YJN 3;  2RFR A;  1TU5 A;  3KE7 A;  1K9M 4;  3CC7 3;  4HM5 B;  2YFL B;  1TRP A;  4J9A A;  2CG0 A;  3CME 3;  2F5M A;  1SJW A;  3WR2 A;  2HMN B;  1B2S A;  3NQZ A;  1STD A;  1TFK A;  2W2C A;  5KP4 A;  3S67 A;  1WQL B;  7STD A;  4BTX A;  1RGC A;  2MC8 A;  4H61 A;  1QMA A;  2BO9 B;  2CFL A;  2OQE A;  3SXX A;  3DXO A;  4O8S A;  2GBX B;  3KFQ C;  5HGR A;  4EC6 A;  5CXO A;  1DE3 A;  1E3V A;  5IEN A;  3G0K A;  3QK9 A;  4K1U A;  2CK3 H;  3MG2 A;  1BGS A;  3AMO A;  1VQ8 3;  1NJI 4;  3PGB A;  3FLJ A;  4J5K A;  1B27 A;  5IG5 A;  2XR8 B;  4WYK A;  3LOY A;  8CHO A;  4GSP A;  4KFD A;  2XEP A;  2Q07 A;  3OWS A;  3NBJ A;  2GBW B;  2CKF B;  2UUG C;  3DY5 A;  2B1X B;  2GU1 A;  2IMJ A;  3AHW A;  3GZR A;  5DRV A;  1Q9E A;  2STD A;  3AGO A;  3CU3 A;  3JUQ A;  3WOF B;  3GSP A;  1ULI B;  3NBR A;  3ER7 A;  5STD A;  3DMC A;  2Z7A A;  4EV5 A;  1UUV B;  2HMM B;  5G2G A;  1D6Z A;  1HU9 A;  1W00 A;  1T2I A;  3MG3 A;  4BTW A;  2KF6 A;  1RGL A;  1EA2 A;  3AMO B;  2XRX B;  3BU4 A;  1G96 A;  3EHC A;  3D5G A;  3L0R A;  4CPK A;  5RNT A;  3CPW 2;  1SPU A;  1JKG A;  4BTY A;  4EBG A;  2OTL 3;  2OTJ 3;  2W6J H;  4WYK B;  2IY2 A;  5CF2 A;  1K8A 4;  2CIU A;  1JNQ A;  2W03 A;  2L4V A;  3A76 A;  1W4N A;  5FGO A;  5LC7 A;  5JPP A;  4HJL B;  3FZW A;  4L8P A;  4XBX A;  3I55 3;  4QWT A;  3MWZ A;  3CCQ 3;  1BRN L;  3FG1 A;  3U1W A;  1QVF 2;  3CCS 3;  3GZB A;  5AYR B;  1YNV X;  3S29 A;  3X3Z A;  4N6T A;  1C54 A;  2F4Y A;  2D42 A;  4N6L A;  1IDP A;  1RGE A;  3NQY A;  1W6Y A;  3LZA A;  2W56 A;  4FCM A;  2ZHX B;  1UI7 A;  4CCV A;  1U5O A;  1JKG B;  1ROV A;  1BRK A;  2Z77 A;  4HM2 B;  1M90 4;  1UCK A;  1EKM A;  1RGA A;  4RBN A;  3SVA A;  4WP5 A;  3CMA 3;  1W02 A;  2R41 A;  1IQY A;  1M1X B;  3D79 A;  1N8R 4;  3QRD A;  1U8C B;  1EUI C;  5AEW B;  1IVW A;  1A90 A;  1UDI I;  2CWT A;  1GYB A;  1HYF A;  3BIR A;  1SAR A;  4DKI A;  1DYU A;  3RGR A;  3WHO A;  5IEO A;  3X40 A;  2MF7 A;  1LOX A;  1B21 A;  3JUP A;  7RNT A;  1BNE A;  1NWW A;  3LYG A;  2W56 B;  2C11 A;  1LXE A;  1TP6 A;  4N6V 0;  1G0T A;  1W6G A;  1OHO A;  1UCJ A;  1LOY A;  3ZG5 A;  1BRJ A;  1C7H A;  2BHM A;  2QA4 3;  4XB5 A;  4HYZ A;  3B7C A;  4L8O A;  3BNC A;  1SQW A;  2W04 A;  3B4O A;  4FR9 A;  1I3I A;  3UJM A;  5M19 A;  1TUH A;  5EQL A;  2BT3 A;  1BNF A;  4GHO A;  1R4Y A;  7GSP A;  2GXF A;  1QVG 2;  1JZO A;  2UGI A;  3JUM A;  1RMS A;  1Q82 4;  3IJE B;  1QAF A;  3K63 A;  5IF6 A;  4N6M A;  1RTU A;  4GL6 A;  4U13 A;  1MGR A;  3N8B A;  5IG0 A;  1NNV A;  3BND A;  3F7S A;  1CH0 A;  1MWT A;  1ZO2 A;  1PFP A;  2UX0 A;  1LOV A;  1TJD A;  3VF1 A;  2CH9 A;  2L1S A;  3DZL A;  3G16 A;  3FGY A;  2CG1 A;  1O7W B;  1YGW A;  5DRE A;  1ISK A;  1W7C A;  3KN4 A;  4NPB A;  2FXT A;  3M8C A;  2Y73 A;  2HMK B;  1D6U A;  1TRQ A;  4HAA A;  4HZB B;  4N3V A;  4JF8 A;  1X1Y A;  1X1X A;  1IVU A;  3J7Y d;  1GOY A;  2P0M A;  3X3Y A;  1AVK A;  2OOV C;  1BAN A;  1OGX A;  1UUW B;  2GEX A;  1EEJ A;  1G02 A;  3OXA A;  4LZI A;  3H3H A;  3T0U A;  3HZP A;  1S72 3;  1QAL A;  3N9H A;  3DGY A;  3RGA A;  2YFJ B;  3HK4 A;  2CHC A;  1BVI A;  3URP A;  1CQS A;  2WGO A;  4HOH A;  4HM0 B;  4KVH A;  2F99 A;  2KF4 A;  4FCZ A;  3EBY A;  4Q53 A;  5BU4 A;  1FGQ A;  3HIG A;  1RN4 A;  4ILF A;  5CK6 A;  2F5W A;  1WMO A;  3EX9 A;  2KRT A;  1BNJ A;  2BMO B;  1V74 A;  1JB4 A;  1KC8 4;  4R80 A;  3ZG0 A;  3DGM A;  3NM7 A;  1PU4 A;  4HM1 B;  1NU3 A;  1IYY A;  1IVV A;  4N6N B;  3UNL A;  1M1K 4;  2CX1 A;  1VQ5 3;  4K61 A;  3S5C A;  1I8V A;  2O9U X;  4HKV B;  3F8H A;  3PCS A;  1VQ7 3;  1O7G B;  1DMQ A;  5GSP A;  3CC4 3;  1VQO 3;  3EN1 B;  1O7M B;  4FMA A;  1I0V A;  4R9K A;  3KII A;  3N54 B;  3CPO A;  4R4K A;  1RJO A;  1JJ2 2;  1OH0 A;  1OF5 A;  1RGF A;  1UW1 A;  4HM3 B;  4OUQ A;  1SIH A;  3D9R A;  1RHL A;  3OW2 2;  2JQ5 A;  5BVB A;  4CDL A;  2ZL8 A;  5JPU A;  1JB5 A;  1CYV A;  3LT8 A;  1RKY A;  4G1M B;  3UL5 A;  1BIR A;  1I0X A;  4XDV A;  1QAK A;  1V57 A;  5D83 A;  3RDE A;  1RNB A;  1N9E A;  1Q7Y 4;  1A2P A;  2BU4 A;  3K7C A;  5CLK A;  5AIF A;  2CFK A;  1SII A;  1TFO A;  2KF3 A;  3NXJ A;  1LOW A;  1W6C A;  1BSC A;  2FNQ A;  3T8U A;  2CW9 A;  4HM6 B;  2O3O A;  1OUN A;  3BLZ A;  3SOA A;  1IV9 A;  4RNZ A;  1VQN 3;  1FGO A;  2LYX A;  3KSE D;  3EQQ B;  1W2B 2;  2CC3 A;  2HMO B;  3F7X A;  1MNL A;  1UGH I;  2FGT A;  2RBI A;  1OF5 B;  1KD1 4;  1N5H A;  1EQK A;  2WOF A;  2CFG A;  1J2B A;  1JBS A;  2H0G A;  1FUT A;  3PYJ A;  1YGE A;  1AV4 A;  1Q86 4;  3GWR A;  3Q1C A;  3K9M C;  6GSP A;  1D6Y A;  3CCE 3;  5IG3 A;  4H3U A;  1RN1 A;  3SLU A;  4AKZ A;  1FW7 A;  2V1L A;  5FW5 A;  4I5Q A;  1VZZ A;  1T5Y A;  1IT7 A;  1UCL A;  1BNS A;  1STF I;  3D4A A;  1ZGX A;  1AY7 A;  1GMR A;  4BIR A;  2BMR B;  2P05 A;  4GB5 A;  5M1A A;  3WA3 A;  1BSE A;  3Q2P A;  1B20 A;  1LRA A;  3GZY B;  1A67 A;  3GZX B;  4WWU C;  5TGN A;  1AR0 A;  3G4S 3;  1VQP 3;  1RGK A;  1K28 A;  1MWU A;  3VSY A;  5AIH A;  4LGQ A;  1RCL A;  3KCH A;  1BUJ A;  4EV2 A;  2GU3 A;  1WTH A;  2YFI B;  4MMY B;  1X1U A;  4MEI A;  4K1V A;  2WOH A;  3NUV A;  4CJN A;  1UGI A;  1BRI A;  2K0M A;  3UB1 A;  5AI1 A;  3CNM A;  2AAD A;  3ROB A;  3BB9 A;  2Z6B A;  5G1K A;  1RCK A;  3LTA A;  3DGO A;  2IUK A;  3K5T A;  5EVH A;  3G8Z A;  3ZFZ A;  1Q81 4;  3IPT A;  3OV4 A;  3CXC 2;  1AQZ A;  3GAX A;  5AIG A;  1YJW 3;  1RNT A;  2INX A;  4NRE A;  3MSO A;  1ZS7 A;  4X2H A;  1KQS 2;  1FZU A;  3JUN A;  4LMI A;  5EEO A;  1FYS A;  1RRL A;  4TX4 A;  5I97 A;  1RSN A;  2W0Q A;  4FMD A;  1OHP A;  2E2V A;  1BRG A;  1A2K A;  2H0H A;  3CCM 3;  1I3F A;  3U97 A;  1LNH A;  3FF2 A;  1QJG A;  3PXM A;  2XGN A;  3PZW A;  3JVC A;  5D82 A;  1PY3 A;  2XF3 A;  2R4I A;  2AAE A;  5CF1 A;  2E2T A;  4IT7 A;  1VQM 3;  1NB5 I;  4N6O B;  1OCV A;  1OHS A;  1NO3 A;  1ULJ B;  4FCJ A;  3SX1 A;  2M7O A;  4BL3 A;  2CWU A;  3VGN A;  4STD A;  3GRD A;  1GMP A;  4WFO A;  3CCJ 3;  1JN5 A;  2BNG A;  1JZD A;  1DVD A;  1GOV A;  2QIY A;  5IEP A;  1VQQ A;  5M18 A;  1GY5 A;  2BMQ B;  4KFF A;  1GSP A;  4NHF A;  5KP3 A;  4I4K A;  4O02 B;  1Z1S A;  1F8N A;  2CX0 A;  4J8T A;  4ORL A;  1MOL A;  3G71 3;  1HZ1 A;  1DVC A;  2GEY A;  3HX8 A;  2OQE C;  5A0O B;  3CCV 3;  3HOH A;  2KCD A;  2IA7 A;  1T2H A;  2GSP A;  5IW9 A;  3BNB A;  3X41 A;  1UUG B;  1VQ9 3;  1KWI A;  3HII A;  1UI8 A;  1A2V A;  2RNT A;  1BSD A;  3DGL A;  1IQ8 A;  1JN5 B;  1N8Q A;  2ZA4 A;  3CNX A;  3D5I A;  4R9L A;  3CCR 3;  1MWS A;  5IG4 A;  3EF8 A;  1YIT 3;  2OCT A;  2XH9 A;  3NX0 A;  1T3B A;  1AVL A;  2OWP A;  2K54 A;  1W5Z A;  2ZDJ A;  3SED A;  2F56 A;  1VQ6 3;  2SAR A;  1BSB A;  2E2U A;  2OOV A;  3MHE A;  1RLS A;  4ZM8 A;  3NV0 A;  3NBB A;  1FGM A;  2Y74 A;  3CC2 3;  1LQG C;  4L7K A;  6STD A;  3I56 3;  1N5P A;  2PZV A;  2WO0 A;  1NDO B;  4MMZ B;  1B2X A;  1BOX A;  3DM8 A;  3DUK A;  3FF0 A;  4K90 B;  1VQ4 3;  1RGH A;  1GS3 A;  1HKX A;  1GY6 A;  4WHA A;  1I70 A;  5ELU A;  3WDG B;  3B4P A;  2YX9 A;  3LTB A;  6RNT A;  2BIR A;  1US1 A;  2JDI H;  4LEH A;  1ZX2 A;  1MWR A;  1FGT A;  1M9G A;  3X42 A;  1CEW I;  1BSA A;  1GMQ A;  3ECF A;  3NM2 A;  4HM4 B;  1K41 A;  4LYL B;  3TDG A;  4AEQ A;  1VQK 3;  3FSD A;  1FA3 A;  3F40 A;  1R4C A;  5G1L A;  4HVN A;  3F14 A;  1W2Z A;  3NV0 B;  3B8L A;  3NHX A;  2XSO B;  5D81 A;  3ALA A;  1S5A A;  3OWY A;  3CCL 3;  1Q42 A;  1B3S A;  3SYU A;  3EJV A;  8RNT A;  3EN8 A;  1JB2 A;  1FUW A;  3OX9 A;  3Q90 A;  1NB3 I;  3V98 A;  4KZ1 A;  1LQM B;  3FKA A;  3KKG A;  2P38 A;  1JRQ A;  1OGZ A;  2HML B;  3RNT A;  1UCI A;  2IUJ A;  3PS8 A;  2P0X A;  2W9Q A;  3A5E A;  2RGQ A;  5LC6 A;  1I2F A;  3FH1 A;  4EXR A;  1FGR A;  3MG1 A;  5AEU B;  1YIJ 3;  4HZ9 B;  1OAC A;  1BRH A;  5BXQ A;  4HM8 B;  2KF5 A;  3T8N A;  1IV7 A;  1IVX A;  2CWV A;  1ASK A;  3H51 A;  1ROA A;  2D1W A;  3MYT A;  9RNT A;  3MPH A;  3LTD A;  2XFT A;  1JBR A;  3PCR A;  1RGG A;  1O7H B;  3SOY A;  3WMD A;  1GY7 A;  1BRS A;  4IPB A;  3MKI A;  1E3R A;  4XBT A;  2ML6 A;  4EW5 A;  1BAO A;  3DGN A;  1YVS A;  3Q3F A;  1VQL 3;  4RNT A;  1KSI A;  3HI7 A;  1IU7 A;  1I2G A;  2PNC A;  2A15 A;  2IYJ A;  3LH4 A;  4RNY A;  3LTC A;  1O7P B;  1RN7 A;  1BNG A;  1Y4K A;  1DET A;  1GD3 A;  1OPY A;  1TIJ A;  2HMJ B;  2QGU A;  1E97 A;  3FG4 A;  4O2H A;  1FUS A;  3D3L A;  1JBT A;  1CYU A;  3EE1 A;  4IIA A;  1DMM A;  4BU4 A;  5HOH A; 
#chains in the Genus database with same CATH homology
 3I0Y A;  2Z76 A;  4PEJ A;  3S27 A;  2ML5 A;  3V92 A;  3WOD G;  3EBT A;  3G6E 3;  1K73 4;  4AKY A;  3LT9 A;  2WGQ A;  4R1K A;  1YJ9 3;  4OVM A;  3S28 A;  4MMX B;  1L5G B;  4XDW A;  3WA2 X;  1DMN A;  4EYC A;  1BUQ A;  1YVB I;  2RCD A;  4HBR A;  2CFD A;  3EB8 A;  1WMP A;  5AYS C;  3UL6 A;  1IK3 A;  2CFW A;  2B24 B;  3LXU X;  3V99 A;  3X3X A;  2P09 A;  1WNH A;  2W9P A;  3IMA B;  2I9W A;  3K0Z A;  1IQX A;  2F98 A;  2XSH B;  1RRH A;  2QEX 3;  2C10 A;  3O8Y A;  3KSP A;  3EC9 A;  4FMC A;  3BNE A;  4OK0 A;  1W01 A;  3OWU A;  3CCU 3;  4N6U A;  3E99 A;  4MJD A;  3CD6 3;  4XBY A;  2LQV A;  5ELJ A;  3STD A;  1YI2 3;  1Q40 A;  3F9S A;  1WMN A;  2F86 B;  4XM4 A;  4X2O A;  4FMB A;  1O7N B;  3KZT A;  2RSX A;  3FCS B;  4LSO A;  2KXG A;  4JRF A;  2SBL A;  3FG3 A;  3LML A;  1GD4 A;  4HM7 B;  1YHQ 3;  5JBS A;  1LVN A;  4RZM A;  3F8X A;  4O3V A;  3WOE B;  1N9J A;  2XFS A;  1IT8 A;  3JUO A;  4KFE A;  1JV2 B;  1Q40 B;  5IER A;  5KP1 A;  1EG9 B;  2XGL A;  1YJN 3;  5AII A;  2RFR A;  1TU5 A;  3KE7 A;  1K9M 4;  3CC7 3;  4HM5 B;  2YFL B;  3CME 3;  4J9A A;  2CG0 A;  1SJW A;  2HMN B;  3NQZ A;  5KP4 A;  1STD A;  1TFK A;  2W2C A;  3S67 A;  1WQL B;  7STD A;  4BTX A;  2MC8 A;  4H61 A;  1QMA A;  2BO9 B;  2CFL A;  2OQE A;  3SXX A;  3DXO A;  4O8S A;  2GBX B;  3KFQ C;  5HGR A;  4EC6 A;  5CXO A;  1E3V A;  5IEN A;  3G0K A;  3QK9 A;  4K1U A;  2CK3 H;  3MG2 A;  3AMO A;  1VQ8 3;  1NJI 4;  3PGB A;  3FLJ A;  5IG5 A;  2XR8 B;  4WYK A;  3LOY A;  8CHO A;  4KFD A;  2XEP A;  2Q07 A;  3OWS A;  3NBJ A;  2GBW B;  2CKF B;  3DY5 A;  2B1X B;  2GU1 A;  2IMJ A;  3GZR A;  5DRV A;  2STD A;  3CU3 A;  3JUQ A;  3WOF B;  1ULI B;  3NBR A;  3ER7 A;  5STD A;  3DMC A;  2Z7A A;  4EV5 A;  2HMM B;  1UUV B;  5G2G A;  1D6Z A;  1HU9 A;  1W00 A;  3MG3 A;  4BTW A;  1EA2 A;  3AMO B;  2XRX B;  3EHC A;  1G96 A;  3L0R A;  3CPW 2;  2OTJ 3;  1SPU A;  1JKG A;  4BTY A;  4EBG A;  2OTL 3;  2W6J H;  4WYK B;  5CF2 A;  1K8A 4;  2CIU A;  1JNQ A;  2W03 A;  2L4V A;  3A76 A;  1W4N A;  5FGO A;  5LC7 A;  5JPP A;  4HJL B;  3FZW A;  4L8P A;  4XBX A;  3I55 3;  4QWT A;  3MWZ A;  3CCQ 3;  3FG1 A;  3U1W A;  1QVF 2;  3CCS 3;  3GZB A;  5AYR B;  3S29 A;  3X3Z A;  4N6T A;  2D42 A;  4N6L A;  1IDP A;  3NQY A;  1W6Y A;  3LZA A;  2W56 A;  4FCM A;  4CCV A;  1UI7 A;  1U5O A;  1JKG B;  1ROV A;  2Z77 A;  4HM2 B;  1M90 4;  4RBN A;  1EKM A;  3SVA A;  4WP5 A;  3CMA 3;  1W02 A;  1IQY A;  1M1X B;  1N8R 4;  3QRD A;  1U8C B;  5AEW B;  1IVW A;  1A90 A;  2CWT A;  1GYB A;  1DYU A;  3RGR A;  3X40 A;  5IEO A;  2MF7 A;  1LOX A;  3JUP A;  1NWW A;  3LYG A;  2W56 B;  2C11 A;  1LXE A;  1TP6 A;  4N6V 0;  1W6G A;  1OHO A;  1C7H A;  2BHM A;  2QA4 3;  4XB5 A;  4HYZ A;  3B7C A;  4L8O A;  3BNC A;  1SQW A;  2W04 A;  3B4O A;  4FR9 A;  3UJM A;  1TUH A;  5EQL A;  2BT3 A;  1QVG 2;  2GXF A;  3JUM A;  1Q82 4;  3IJE B;  1QAF A;  3K63 A;  5IF6 A;  4GL6 A;  4U13 A;  3N8B A;  5IG0 A;  3F7S A;  3BND A;  1ZO2 A;  1PFP A;  2UX0 A;  3VF1 A;  2CH9 A;  3DZL A;  3G16 A;  3FGY A;  2CG1 A;  1O7W B;  5DRE A;  1ISK A;  1W7C A;  3KN4 A;  2FXT A;  3M8C A;  2Y73 A;  2HMK B;  1D6U A;  4N3V A;  4HZB B;  4JF8 A;  1IVU A;  3J7Y d;  2P0M A;  3X3Y A;  1AVK A;  2OOV C;  1OGX A;  2GEX A;  1UUW B;  3OXA A;  4LZI A;  3T0U A;  3H3H A;  3HZP A;  1S72 3;  1QAL A;  3N9H A;  3RGA A;  2YFJ B;  3HK4 A;  2CHC A;  1CQS A;  2WGO A;  4HM0 B;  4KVH A;  2F99 A;  4FCZ A;  3EBY A;  4Q53 A;  1FGQ A;  3HIG A;  5CK6 A;  1WMO A;  3EX9 A;  2KRT A;  2BMO B;  1V74 A;  1JB4 A;  1KC8 4;  4R80 A;  3DGM A;  3NM7 A;  1PU4 A;  4HM1 B;  1NU3 A;  1IVV A;  4N6N B;  3UNL A;  1M1K 4;  1VQ5 3;  4K61 A;  3S5C A;  2O9U X;  4HKV B;  3F8H A;  3PCS A;  1VQ7 3;  1O7G B;  1DMQ A;  3CC4 3;  1VQO 3;  3EN1 B;  1O7M B;  4FMA A;  4R9K A;  3KII A;  3N54 B;  3CPO A;  4R4K A;  1RJO A;  1JJ2 2;  1OH0 A;  1OF5 A;  1UW1 A;  4HM3 B;  4OUQ A;  3OW2 2;  1SIH A;  3D9R A;  2JQ5 A;  5BVB A;  4CDL A;  2ZL8 A;  5JPU A;  1JB5 A;  1CYV A;  3LT8 A;  1RKY A;  4G1M B;  3UL5 A;  4XDV A;  1QAK A;  5D83 A;  3RDE A;  1N9E A;  1Q7Y 4;  3K7C A;  5CLK A;  5AIF A;  2CFK A;  1SII A;  1TFO A;  3NXJ A;  1W6C A;  2FNQ A;  3T8U A;  2CW9 A;  4HM6 B;  2O3O A;  1OUN A;  3BLZ A;  3SOA A;  1IV9 A;  4RNZ A;  1VQN 3;  1FGO A;  2LYX A;  3KSE D;  3EQQ B;  1W2B 2;  2CC3 A;  2HMO B;  3F7X A;  1MNL A;  2FGT A;  1OF5 B;  1KD1 4;  1N5H A;  1EQK A;  2WOF A;  2CFG A;  1J2B A;  3PYJ A;  1YGE A;  1AV4 A;  1Q86 4;  3GWR A;  3Q1C A;  3K9M C;  1D6Y A;  3CCE 3;  5IG3 A;  4H3U A;  3SLU A;  4AKZ A;  2V1L A;  5FW5 A;  1VZZ A;  1T5Y A;  1IT7 A;  1STF I;  2BMR B;  2P05 A;  4GB5 A;  3WA3 A;  3Q2P A;  3GZY B;  1A67 A;  3GZX B;  4WWU C;  5TGN A;  1AR0 A;  3G4S 3;  1K28 A;  3VSY A;  5AIH A;  4LGQ A;  4EV2 A;  2GU3 A;  1WTH A;  2YFI B;  4MMY B;  4MEI A;  4K1V A;  2WOH A;  3NUV A;  2K0M A;  3UB1 A;  5AI1 A;  3CNM A;  3ROB A;  3BB9 A;  2Z6B A;  3LTA A;  3DGO A;  2IUK A;  3K5T A;  5EVH A;  3G8Z A;  1Q81 4;  3IPT A;  3OV4 A;  3CXC 2;  3GAX A;  5AIG A;  1YJW 3;  2INX A;  4NRE A;  3MSO A;  4X2H A;  1KQS 2;  5EEO A;  3JUN A;  4LMI A;  1RRL A;  4TX4 A;  5I97 A;  2W0Q A;  4FMD A;  1OHP A;  2E2V A;  1A2K A;  3CCM 3;  1LNH A;  3FF2 A;  1QJG A;  3PXM A;  2XGN A;  3PZW A;  3JVC A;  5D82 A;  2XF3 A;  2R4I A;  5CF1 A;  2E2T A;  4IT7 A;  1VQM 3;  1NB5 I;  4N6O B;  1OCV A;  1OHS A;  1NO3 A;  1ULJ B;  4FCJ A;  3SX1 A;  2M7O A;  2CWU A;  3VGN A;  4STD A;  3GRD A;  4WFO A;  3CCJ 3;  1JN5 A;  2BNG A;  1DVD A;  2QIY A;  5IEP A;  1GY5 A;  2BMQ B;  4KFF A;  4NHF A;  5KP3 A;  4I4K A;  4O02 B;  1Z1S A;  1F8N A;  4J8T A;  4ORL A;  1MOL A;  3G71 3;  1DVC A;  2GEY A;  3HX8 A;  2OQE C;  5A0O B;  3CCV 3;  2KCD A;  2IA7 A;  5IW9 A;  3BNB A;  3X41 A;  1VQ9 3;  1KWI A;  3HII A;  1UI8 A;  1A2V A;  3DGL A;  1IQ8 A;  1JN5 B;  1N8Q A;  3CNX A;  4R9L A;  3CCR 3;  5IG4 A;  3EF8 A;  1YIT 3;  2OCT A;  2XH9 A;  3NX0 A;  1AVL A;  2OWP A;  2K54 A;  1W5Z A;  2ZDJ A;  3SED A;  1VQ6 3;  2E2U A;  2OOV A;  3MHE A;  4ZM8 A;  3NV0 A;  3NBB A;  1FGM A;  2Y74 A;  3CC2 3;  4L7K A;  6STD A;  3I56 3;  1N5P A;  2PZV A;  2WO0 A;  1NDO B;  4MMZ B;  3DM8 A;  3DUK A;  3FF0 A;  4K90 B;  1VQ4 3;  1GS3 A;  1HKX A;  1GY6 A;  4WHA A;  5ELU A;  3WDG B;  3B4P A;  2YX9 A;  3LTB A;  1US1 A;  2JDI H;  4LEH A;  1ZX2 A;  1M9G A;  1FGT A;  3X42 A;  1CEW I;  3TDG A;  3ECF A;  3NM2 A;  4HM4 B;  1K41 A;  4AEQ A;  1FA3 A;  1VQK 3;  3FSD A;  3F40 A;  1R4C A;  4HVN A;  3F14 A;  1W2Z A;  3NV0 B;  3B8L A;  3NHX A;  2XSO B;  5D81 A;  3ALA A;  1S5A A;  3OWY A;  3CCL 3;  1Q42 A;  3EJV A;  3EN8 A;  1JB2 A;  1FUW A;  3OX9 A;  3Q90 A;  1NB3 I;  3V98 A;  4KZ1 A;  3FKA A;  3KKG A;  2P38 A;  1JRQ A;  1OGZ A;  2HML B;  2IUJ A;  3PS8 A;  2P0X A;  2W9Q A;  2RGQ A;  5LC6 A;  3FH1 A;  4EXR A;  1YIJ 3;  1FGR A;  3MG1 A;  5AEU B;  4HZ9 B;  1OAC A;  5BXQ A;  4HM8 B;  3T8N A;  1IV7 A;  1IVX A;  2CWV A;  1ASK A;  3H51 A;  1ROA A;  2D1W A;  3MYT A;  3MPH A;  3LTD A;  2XFT A;  3PCR A;  1O7H B;  3SOY A;  3WMD A;  1GY7 A;  4IPB A;  3MKI A;  1E3R A;  4XBT A;  2ML6 A;  3DGN A;  1VQL 3;  1KSI A;  3HI7 A;  1IU7 A;  2PNC A;  3LH4 A;  2A15 A;  4RNY A;  1VQP 3;  3U97 A;  3LTC A;  1O7P B;  1RN7 A;  4N6M A;  1Y4K A;  1GD3 A;  1TIJ A;  1OPY A;  2HMJ B;  2QGU A;  3FG4 A;  1E97 A;  4O2H A;  1CYU A;  3D3L A;  3EE1 A;  4IIA A;  1DMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...