2RFRA

Crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
154
Chain Sequence
GMDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALMADGCAHFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of uncharacterized protein (YP_001166107.1) from Novosphingobium aromaticivorans DSM 12444 at 1.16 A resolution
rcsb
source organism Novosphingobium aromaticivorans
total genus 56
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rfrA00
3NUVA 3EN8A 1NWWA 1JN5A 3GWRA 1W01A 2XR8B 1OUNA 1GY7A 4LGQA 2INXA 5AEUB 1ZO2A 3CNMA 4WWUC 3WMDA 5IERA 3NXJA 3EHCA 1Z1SA 2YFLB 3UJMA 1JN5B 4HZ9B 4ORLA 3FH1A 8CHOA 3DZLA 1ASKA 5BVBA 3JUMA 3E99A 5IG0A 2STDA 2RFRA 3K7CA 1IDPA 1ULIB 5D82A 3FZWA 1VZZA 2B1XB 1JKGA 2K54A 3MHEA 3M8CA 4STDA 2BNGA 3MG2A 3ER7A 3SEDA 1OF5A 3ECFA 3DM8A 4CDLA 5STDA 3KSPA 2HMNB 3OV4A 1O7GB 5CLKA 3JUPA 3H3HA 1JB4A 3FF0A 1JKGB 3EJVA 1OHSA 4HM4B 5BXQA 1OF5B 2R4IA 3GRDA 3KKGA 3ROBA 5JPUA 4HM1B 4OUQA 4XBTA 5CF2A 3GZRA 4MJDA 3RGAA 5AEWB 4R9KA 5IF6A 1Q42A 1QJGA 2CKFB 1NDOB 4L7KA 1Q40A 3S5CA 3G8ZA 5DRVA 1A2KA 3F8HA 1JB5A 3UNLA 2F86B 3MSOA 5FW5A 1AR0A 3GZBA 3EBTA 1C7HA 3HX8A 3VGNA 3MKIA 4HM3B 1K41A 2QGUA 4KVHA 4XB5A 1Q40B 1W6YA 3CNXA 4IIAA 3F8XA 3FLJA 4L8PA 2BMQB 3DXOA 3DMCA 3H51A 3KE7A 3FGYA 2Z77A 3DUKA 3RGRA 3GZYB 5D83A 4X2HA 4HZBB 1DMQA 2A15A 4R9LA 3LZAA 4HM8B 5JPPA 1JB2A 3OWUA 5KP3A 3EBYA 2OWPA 5IENA 1ISKA 3NM2A 1TP6A 1OH0A 1GYBA 1O7NB 2XSHB 5AIHA 1OCVA 3EX9A 1GS3A 2XRXB 4WYKA 4LEHA 3Q90A 3B7CA 3JUNA 4HM6B 1S5AA 1U5OA 3NBRA 5KP4A 1TUHA 5CXOA 3K0ZA 2CHCA 4L8OA 4XDVA 1GY6A 3LYGA 3MG1A 4HM5B 2HMKB 4XBYA 3JUOA 3STDA 1UUWB 3OWYA 2JQ5A 1DMMA 1E3RA 4RZMA 4PEJA 3GZXB 3B8LA 2I9WA 4J8TA 6STDA 3FF2A 1WQLB 2RGQA 1OPYA 3NHXA 5TGNA 2F98A 3F7XA 5AIFA 2B24B 4K1UA 2IMJA 1STDA 4FCJA 3BB9A 2BMRB 5HGRA 4U13A 3JUQA 4GB5A 4H3UA 5IG3A 2Z7AA 7STDA 4LMIA 2QIYA 3EN1B 3EQQB 3F7SA 1OGXA 4I4KA 3IPTA 1EG9B 5CF1A 4OVMA 2GXFA 3CU3A 1BUQA 1ZX2A 5AIIA 4XM4A 5AI1A 3SOAA 1NU3A 4FCMA 3A76A 4K1VA 1O7WB 4Q53A 1W00A 3CPOA 1UUVB 3OXAA 1O7HB 4HM2B 4WP5A 2HMLB 1W02A 5D81A 5G2GA 1E97A 4HVNA 5IEOA 2F99A 4J9AA 1GY5A 3T8UA 4HM0B 2GBWB 2YFIB 3F14A 1E3VA 3EC9A 3MG3A 1QMAA 5KP1A 2GEYA 2HMJB 2HMMB 3F9SA 2BMOB 3G0KA 4HKVB 3FKAA 1ULJB 4WYKB 5IG4A 3SOYA 3B4PA 2PZVA 3NV0A 1DMNA 2UX0A 1HKXA 3VSYA 3KZTA 1OHOA 2HMOB 3EF8A 5AIGA 2RCDA 5IEPA 3HZPA 3OWSA 5EVHA 2GBXB 1EA2A 3NV0B 1OGZA 1OHPA 2Z76A 2W2CA 3F40A 1O7PB 2XSOB 4N3VA 4HM7B 3T8NA 4HJLB 4XBXA 3B4OA 5CK6A 4X2OA 3BLZA 3I0YA 5DREA 5IG5A 3MYTA 4R1KA 1CQSA 3HK4A 3G16A 3OX9A 1O7MB 4XDWA 2YFJB 1SJWA 3D9RA 3FSDA 2GEXA
chains in the Genus database with same CATH superfamily
3D5IA 3EN8A 1NWWA 1BRHA 3NUVA 1WTHA 5G1KA 1JN5A 1RCKA 1B21A 3GWRA 1W01A 1UCKA 2XR8B 2OTL3 1OUNA 2KF5A 3D4AA 1GY7A 4LGQA 1BANA 6RNTA 1GOVA 2INXA 1IU7A 3DY5A 3PCRA 1FA3A 4O2HA 5AEUB 1ZO2A 3CNMA 3LT9A 4WWUC 1W5ZA 3WA3A 2CC3A 3D5GA 3WMDA 5IERA 3HIIA 3NXJA 2GU1A 1DETA 2P0XA 1VQP3 2CFGA 4O8SA 3FCSB 4EYCA 1BUJA 3EHCA 1ROAA 2O3OA 3LT8A 1D6ZA 2ZA4A 1IVWA 4KFFA 1KQS2 2Q07A 1FYSA 2XGNA 1RTUA 1B27A 3EE1A 1Z1SA 2YFLB 2OTJ3 3UJMA 1JN5B 1BU4A 1W4NA 1AV4A 1N9EA 1QVF2 1IVVA 4HZ9B 5FGOA 4ORLA 3FH1A 8CHOA 1W6CA 3CD63 3DZLA 1N5HA 1ASKA 5BVBA 3JUMA 1YVBI 1IK3A 3E99A 5IG0A 1IV7A 2STDA 2P09A 5HOHA 2RFRA 1LNHA 3K7CA 3Q3FA 1IDPA 2IUKA 3CCE3 1BNRA 3UL5A 1M1XB 1ULIB 1W6GA 2C4BA 5D82A 3LTAA 3FZWA 2KXGA 1WMPA 2F5WA 5EQLA 3K9MC 1VZZA 1FGMA 2CWTA 3PS8A 1RN1A 2B1XB 4RNTA 2JDIH 1IT7A 1JKGA 2WOHA 2BU4A 1RNBA 2K54A 2CG1A 1KC84 3MHEA 4WHAA 3M8CA 4STDA 1I70A 2BNGA 3MG2A 3ER7A 2CH9A 3SEDA 1UDII 4BU4A 2OQEC 1OF5A 1YJW3 3Q2PA 2H0IA 3ECFA 1RJOA 3DH2A 3DM8A 1IVUA 1K28A 3HIGA 1RGGA 4CDLA 4I5QA 5STDA 1YIT3 1SARA 1GOUA 3KSPA 1GMQA 1BNGA 3D3LA 1VQ83 4QWTA 2HMNB 1AVLA 3OV4A 1O7GB 2IUJA 2HOHA 3NX0A 2XFSA 3LMLA 1UCLA 4O3VA 5CLKA 4ZM8A 4KFDA 3JUPA 1FUWA 3H3HA 1NJI4 2ML5A 2KAAA 2RBIA 1JB4A 1BRKA 1UGHI 3FF0A 4AKYA 1JKGB 1BNEA 3EJVA 3CXC2 2FNQA 4IPBA 1AY7A 1FUSA 2AADA 1OHSA 4HM4B 2CFLA 4NHFA 5BXQA 2F56A 1OF5B 1J2BA 1LOVA 1IQ8A 2CIUA 2R4IA 4N6OB 3GRDA 3KKGA 3N54B 4O02B 1BRNL 3ROBA 1BNIA 1W7CA 3CC73 4FMBA 5JPUA 5M1AA 4HM1B 4MMXB 4OUQA 3N9HA 5LC7A 1T5YA 4XBTA 3BNDA 3G713 1LRAA 3QRDA 5CF2A 3GZRA 4MJDA 3RGAA 1AVKA 2J8XB 2XEPA 5AEWB 3DGOA 4R9KA 5ELUA 1VQ53 3DGNA 5IF6A 1RKYA 1Q42A 1QJGA 2CKFB 2E2TA 2K3DA 1B2XA 2W0QA 3DGMA 1MNLA 1BSBA 1NDOB 4HOHA 5RNTA 1VQ93 3X3XA 1IT8A 3AMOA 4HBRA 4L7KA 1Q40A 1Q7HA 1V74A 3NQYA 3WHOA 5BIRA 3S5CA 3G8ZA 5DRVA 3CC23 2KCDA 1YIJ3 1CEWI 1SIIA 1A2KA 3BNEA 1Q7Y4 1JBRA 2MC8A 2BIRA 1BOXA 1FGRA 3F8HA 1JB5A 3UNLA 2F86B 1PU4A 3MSOA 3LOYA 1ZS7A 5FW5A 1AR0A 1KWIA 1JNQA 3FG1A 3GZBA 1JRQA 4CJNA 1B2MA 1M9GA 1WMOA 4ILFA 3EBTA 1C7HA 1NO3A 3GAXA 3HX8A 4HYZA 3MKIA 4HM3B 1L5GB 1K41A 1HU9A 3VGNA 2OQEA 2ZHXB 1UI8A 1PY3A 2QGUA 2H0GA 3AMOB 4KVHA 3X3YA 2FXTA 4XB5A 1Q40B 1HYFA 1YGWA 5I97A 1W6YA 2BT3A 1U8CB 1D6YA 4GSPA 1ZGXA 3KSED 2D42A 4K61A 4R4KA 3KN4A 3CNXA 1Q9EA 1GMPA 2XFTA 4IIAA 3ZG0A 3N8BA 3D79A 5BU4A 2W6JH 3F8XA 3CPW2 3FLJA 1VQK3 1JZDA 2BMQB 4L8PA 3DXOA 2C11A 3DMCA 3H51A 3KE7A 3DGYA 1IQYA 3FGYA 1UCJA 3IJEB 6GSPA 1TU5A 4HAAA 2Z77A 3DUKA 2IYJA 1STFI 2CW9A 1CH0A 1NB3I 1TTOA 2UGIA 3ALAA 4J5GA 3I553 1VQN3 3RGRA 3GZYB 5D83A 4R80A 3VF1A 2GU3A 1RGLA 3TDGA 4X2HA 1RNTA 3NBJA 5G1LA 4HZBB 5JBSA 1KSIA 1B2ZA 1BRGA 1DMQA 3EB8A 4LSOA 1MWTA 2A15A 3PCSA 4R9LA 1X1YA 2QEX3 1D6UA 3LZAA 4HM8B 5JPPA 1JB2A 3OWUA 1JZOA 1VQ43 5KP3A 3EBYA 9RNTA 3HOHA 1UUGB 4NREA 4N6NB 1X1UA 2WOFA 3LTBA 4GHOA 1LOXA 1SPUA 2OWPA 1EUIC 3PYJA 4BTXA 5IENA 1ISKA 1GD4A 3NM2A 1S723 3CCU3 1TP6A 2FGTA 1OH0A 2CWUA 3I563 1GYBA 1O7NB 2XSHB 4BIRA 1K9M4 1EKMA 1M904 3ZFZA 5AIHA 1OCVA 3X3ZA 5GSPA 3EX9A 1OACA 1GS3A 2XRXB 4WYKA 1WMNA 4FMCA 1IVXA 2M7OA 4LEHA 1Q864 4H61A 3Q90A 1YNVX 3B7CA 1GMRA 2XH9A 3JUNA 2IY2A 4HM6B 2XF3A 1BGSA 1S5AA 1JBTA 1U5OA 1YVSA 4AEQA 1GOYA 3NBRA 5KP4A 1R4CA 1X1WA 1EEJA 1TUHA 1LQMB 4MEIA 1RGFA 1B3SA 1VQO3 1RN4A 3K0ZA 5CXOA 1UI7A 3LTDA 1CYVA 5LC6A 2K0MA 2SBLA 3V92A 1C54A 2CHCA 1LOYA 4L8OA 4XDVA 1GY6A 1BRJA 3RNTA 4MMZB 3LYGA 2L4VA 1N8QA 3CME3 3MG1A 4HM5B 1VQ73 1FGOA 2HMKB 4XBYA 4JF8A 1F8NA 2WO0A 1YJN3 1DE3A 2CK3H 3JUOA 3STDA 1UUWB 2P38A 1DYUA 1Y4KA 4BTYA 1W2B2 3OWYA 2JQ5A 1DMMA 1E3RA 1IYYA 4RZMA 1TFOA 5M18A 4PEJA 3GZXB 1YI23 1JJ22 4N6UA 3KCHA 3AGOA 3B8LA 1VQL3 2I9WA 1RLSA 4J8TA 1RHLA 3FF2A 6STDA 1WQLB 2RGQA 1X1XA 3CCS3 1OPYA 3SVAA 1EQKA 3IMAB 1RGAA 3NHXA 4NPBA 5TGNA 2L1SA 2P0MA 2F98A 4CPKA 3X40A 1FW7A 5ELJA 3SYUA 1BSDA 1TFKA 3CC43 3F7XA 1I2FA 2O9UX 1FUTA 5AIFA 1FZUA 1MGRA 2B24B 4K1UA 3UL6A 1CYUA 3PGBA 1A2VA 2IMJA 1STDA 3V98A 4FCJA 3BB9A 1DVCA 2BMRB 1LVNA 2F5MA 4K90B 5HGRA 1PFPA 1KD14 3NQZA 1UCIA 3O8YA 4EW5A 1BNJA 4N6V0 4N6MA 1RGCA 4U13A 1IQXA 3JUQA 1MGWA 4GB5A 4H3UA 2W9QA 1YGEA 2Y74A 1A2PA 5IG3A 1SIHA 1TIJA 2Z7AA 5KP1A 2P05A 4CCVA 2LYXA 7STDA 7GSPA 3GSPA 4LMIA 2KRTA 2PNCA 5A0OB 1MOLA 1MWUA 1W2ZA 2QIYA 1BSAA 1VQQA 3EN1B 3EQQB 1TRPA 2Y73A 2E2VA 2WGOA 3S67A 1BRIA 3F7SA 1G02A 1OGXA 3CCM3 1QVG2 3WOEB 1HZ1A 2D1WA 5IW9A 2W04A 1AQZA 4I4KA 3UB1A 3IPTA 2CX0A 1EG9B 1BSEA 3WOFB 1LNIA 1T2HA 4OVMA 4BTWA 5CF1A 4RNYA 2GXFA 3CU3A 4JRFA 1LXEA 1BUQA 1ZX2A 2E2UA 3FG3A 5AIIA 3RDEA 3SX1A 4XM4A 4EXRA 5AI1A 3SOAA 1N8R4 1NU3A 4KT3B 1PYLA 3BU4A 1BAOA 2KF4A 3X42A 1FGTA 4FCMA 2W56A 1BNFA 2LQVA 3LH4A 1G96A 5AYRB 1N5PA 3WA2X 3A76A 1LOWA 1I0XA 4K1VA 3S28A 2IA7A 2RNTA 1LQGC 1QALA 1O7WB 3FG4A 3G6E3 1W00A 4Q53A 3CPOA 1UUVB 3OXAA 4BL2A 1O7HB 4HM2B 2C10A 2ML6A 4WP5A 4WFOA 2HMLB 3CMA3 1W02A 2CX1A 3BNCA 3NM7A 4N6TA 2SARA 1V57A 3KFQC 5D81A 3PXMA 5G2GA 1YJ93 1M1K4 1RRLA 1E97A 1IV9A 1GD3A 1JV2B 4HVNA 2F99A 4J9AA 1NNVA 5IEOA 1NB5I 1GY5A 2W56B 3QK9A 3T8UA 1B20A 4HM0B 2GBWB 2YFIB 3F14A 1I8VA 3AHWA 2KF3A 1E3VA 3V99A 1QAKA 1US1A 3EC9A 2V1LA 2WGQA 2Z6BA 3MG3A 3CCL3 1QMAA 1UGIA 2OOVC 2GEYA 2HMJB 2HMMB 3HI7A 1SQWA 3KIIA 3MPHA 4BL3A 4EC6A 3F9SA 4EV5A 2BMOB 2RSXA 1RGKA 3J7Yd 2GSPA 1TJDA 1R4YA 1ROVA 3G0KA 5EEOA 2H0HA 3LTCA 4LZIA 4HKVB 1RN7A 3S27A 3AGNA 4RNZA 1I0VA 3OW22 3L0RA 3CCQ3 3FKAA 1T3BA 1GSPA 3JVCA 1ULJB 4FMDA 4N6LA 3T0UA 1K8A4 1RSNA 4WYKB 3X41A 1VQM3 5M19A 4RBNA 5IG4A 1T2IA 2ZDJA 3SOYA 3B4PA 3SXXA 2QA43 2PZVA 3NV0A 1G0TA 3CCV3 2CFDA 1A67A 1B2UA 4FMAA 1DMNA 2UX0A 7RNTA 1Q814 1HKXA 2CFKA 3LXUX 1FGQA 2CG0A 1MWRA 3VSYA 1RCLA 3A5EA 3WODG 3KZTA 3K63A 1OHOA 2HMOB 3EF8A 1BRSA 4OK0A 2CWVA 2KF6A 2UUGC 5AIGA 8RNTA 1I2EA 2RCDA 3Q1CA 5AYSC 5IEPA 4LYLB 1WNHA 3URPA 1RDSA 1RGEA 3HZPA 3OWSA 5EVHA 1RRHA 1BSCA 2GBXB 3WR2A 1I3IA 1EA2A 3DGLA 3WDGB 1Q824 1QAFA 3NV0B 1OGZA 1OHPA 2Z76A 3PZWA 4MMYB 2W2CA 2W03A 3SLUA 3ZG5A 1BIRA 3F40A 4J5KA 4IT7A 4TX4A 1O7PB 1N9JA 2AAEA 2XSOB 4HM7B 4N3VA 3T8NA 2YX9A 4HJLB 3U97A 1K734 2ZL8A 4XBXA 2R41A 1BVIA 3B4OA 3NBBA 1UW1A 4X2OA 1B2SA 5CK6A 3S29A 3BLZA 3I0YA 1MWSA 3K5TA 5DREA 4KZ1A 3G4S3 5IG5A 3AHSA 4EBGA 3MYTA 1DVDA 4R1KA 1CQSA 2BO9B 4G1MB 3CCJ3 4KFEA 4AKZA 3MWZA 3HK4A 2OCTA 2F4YA 1TRQA 4DKIA 1V58A 1YHQ3 3G16A 3OX9A 4FCZA 1A90A 1O7MB 4GL6A 2XGLA 2W9PA 1VQ63 4XDWA 2CFWA 2YFJB 1RGHA 2BHMA 3BNBA 1I3FA 1SJWA 3CCR3 1BNSA 3D9RA 2OOVA 1I2GA 3BIRA 2MF7A 3U1WA 3FSDA 4EV2A 1JBSA 4FR9A 2GEXA 1RMSA
chains in the Genus database with same CATH topology
3NUVA 3EN8A 1NWWA 1WTHA 1JN5A 3GWRA 1W01A 2XR8B 2OTL3 1OUNA 1GY7A 4LGQA 2INXA 1IU7A 3DY5A 3PCRA 1FA3A 4O2HA 5AEUB 1ZO2A 3CNMA 3LT9A 4WWUC 1W5ZA 3WA3A 2CC3A 3WMDA 5IERA 3HIIA 3NXJA 2GU1A 2P0XA 1VQP3 2CFGA 4O8SA 3FCSB 4EYCA 3EHCA 1ROAA 2O3OA 3LT8A 1D6ZA 1IVWA 4KFFA 1KQS2 2Q07A 2XGNA 3EE1A 1Z1SA 2YFLB 2OTJ3 3UJMA 1JN5B 1QVF2 1W4NA 1AV4A 1N9EA 1IVVA 4HZ9B 5FGOA 4ORLA 3FH1A 8CHOA 1W6CA 3CD63 3DZLA 1N5HA 1ASKA 5BVBA 3JUMA 1YVBI 1IK3A 3E99A 5IG0A 1IV7A 2STDA 2P09A 2RFRA 1LNHA 3K7CA 1IDPA 2IUKA 3CCE3 3UL5A 1M1XB 1ULIB 1W6GA 5D82A 3LTAA 3FZWA 2KXGA 1WMPA 5EQLA 3K9MC 1VZZA 1FGMA 2CWTA 3PS8A 2B1XB 2JDIH 1IT7A 1JKGA 2WOHA 2K54A 2CG1A 3MHEA 4WHAA 3M8CA 4STDA 2BNGA 3MG2A 3ER7A 2CH9A 3SEDA 2OQEC 1OF5A 1YJW3 3Q2PA 3ECFA 1RJOA 3DM8A 1IVUA 1K28A 3HIGA 4CDLA 5STDA 1YIT3 1VQ83 3KSPA 3D3LA 4QWTA 2HMNB 1AVLA 3OV4A 1O7GB 2IUJA 3NX0A 2XFSA 3LMLA 4O3VA 5CLKA 4ZM8A 4KFDA 3JUPA 3H3HA 1NJI4 2ML5A 1JB4A 4AKYA 3FF0A 1JKGB 3EJVA 3CXC2 2FNQA 4IPBA 1OHSA 4HM4B 2CFLA 4NHFA 5BXQA 1OF5B 1J2BA 1IQ8A 2CIUA 2R4IA 4N6OB 3GRDA 3KKGA 3N54B 4O02B 3ROBA 1W7CA 3CC73 4FMBA 5JPUA 4HM1B 4MMXB 4OUQA 3N9HA 5LC7A 1T5YA 4XBTA 3BNDA 3G713 3QRDA 5CF2A 3GZRA 4MJDA 3RGAA 1AVKA 2XEPA 5AEWB 3DGOA 4R9KA 5ELUA 1VQ53 3DGNA 5IF6A 1RKYA 1Q42A 1QJGA 2CKFB 2E2TA 2W0QA 3DGMA 1FUWA 1MNLA 1NDOB 1VQ93 3X3XA 1IT8A 3AMOA 4HBRA 4L7KA 1Q40A 1V74A 3NQYA 3S5CA 3G8ZA 5DRVA 3CC23 2KCDA 1YIJ3 1CEWI 1SIIA 1A2KA 3BNEA 1Q7Y4 2MC8A 1FGRA 3F8HA 1JB5A 3UNLA 2F86B 1PU4A 3MSOA 3LOYA 5FW5A 1AR0A 1KWIA 1JNQA 3FG1A 3GZBA 1JRQA 1M9GA 1WMOA 3EBTA 1C7HA 1NO3A 3GAXA 3HX8A 4HYZA 3MKIA 4HM3B 1L5GB 1K41A 1HU9A 3VGNA 2OQEA 1UI8A 2QGUA 3AMOB 4KVHA 3X3YA 2FXTA 4XB5A 1Q40B 5I97A 1W6YA 2BT3A 1U8CB 1D6YA 3KSED 4R4KA 2D42A 4K61A 3KN4A 3CNXA 2XFTA 4IIAA 3N8BA 2W6JH 3F8XA 3CPW2 3FLJA 1VQK3 4L8PA 2BMQB 3DXOA 2C11A 3DMCA 3H51A 3KE7A 1IQYA 3FGYA 3IJEB 1TU5A 2Z77A 3DUKA 1STFI 2CW9A 1NB3I 3ALAA 3I553 1VQN3 3RGRA 3GZYB 5D83A 4R80A 3VF1A 2GU3A 3TDGA 4X2HA 3NBJA 4HZBB 5JBSA 1KSIA 3EB8A 1DMQA 4LSOA 2A15A 3PCSA 4R9LA 2QEX3 1D6UA 3LZAA 4HM8B 5JPPA 1JB2A 3OWUA 1VQ43 5KP3A 3EBYA 4NREA 4N6NB 2WOFA 3LTBA 1LOXA 1SPUA 2OWPA 3PYJA 4BTXA 5IENA 1ISKA 1GD4A 3NM2A 1S723 3CCU3 1TP6A 2FGTA 1OH0A 2CWUA 3I563 1GYBA 1O7NB 2XSHB 1K9M4 1EKMA 1M904 5AIHA 1OCVA 3X3ZA 3EX9A 1OACA 1GS3A 2XRXB 4WYKA 1WMNA 4FMCA 1IVXA 2M7OA 4LEHA 1Q864 4H61A 3Q90A 3B7CA 3JUNA 2XH9A 4HM6B 2XF3A 1S5AA 1U5OA 4AEQA 3NBRA 5KP4A 1R4CA 1TUHA 4MEIA 1VQO3 3K0ZA 5CXOA 1UI7A 3LTDA 1CYVA 5LC6A 2K0MA 2SBLA 3V92A 2CHCA 4L8OA 4XDVA 1GY6A 4MMZB 3LYGA 2L4VA 1N8QA 3CME3 3MG1A 4HM5B 1VQ73 1FGOA 2HMKB 4XBYA 4JF8A 1F8NA 2WO0A 1YJN3 2CK3H 3JUOA 3STDA 1UUWB 2P38A 1DYUA 1Y4KA 4BTYA 1W2B2 3OWYA 2JQ5A 1DMMA 1E3RA 4RZMA 1TFOA 4PEJA 3GZXB 1YI23 1JJ22 4N6UA 3B8LA 1VQL3 2I9WA 4J8TA 6STDA 3FF2A 1WQLB 2RGQA 3CCS3 1OPYA 3SVAA 1EQKA 3IMAB 3NHXA 5TGNA 2P0MA 2F98A 3X40A 5ELJA 1TFKA 3CC43 3F7XA 2O9UX 5AIFA 2B24B 4K1UA 3UL6A 1CYUA 3PGBA 1A2VA 2IMJA 1STDA 3V98A 4FCJA 3BB9A 1DVCA 2BMRB 1LVNA 4K90B 5HGRA 1PFPA 1KD14 3NQZA 3O8YA 4N6V0 4N6MA 4U13A 1IQXA 3JUQA 4GB5A 4H3UA 2W9QA 1YGEA 2Y74A 5IG3A 1SIHA 1TIJA 2Z7AA 2P05A 4CCVA 2LYXA 7STDA 4LMIA 2KRTA 2PNCA 5A0OB 1MOLA 1W2ZA 2QIYA 3EN1B 3EQQB 2Y73A 2E2VA 2WGOA 3S67A 3F7SA 1OGXA 3CCM3 1QVG2 3WOEB 2D1WA 5IW9A 2W04A 4I4KA 3UB1A 3IPTA 3WOFB 1EG9B 4BTWA 5CF1A 4OVMA 4RNYA 2GXFA 3CU3A 4JRFA 1LXEA 1BUQA 1ZX2A 2E2UA 3FG3A 5AIIA 3RDEA 3SX1A 4XM4A 4EXRA 5AI1A 3SOAA 1N8R4 1NU3A 3X42A 1FGTA 4FCMA 2W56A 2LQVA 3LH4A 1G96A 5AYRB 1N5PA 3WA2X 3A76A 4K1VA 3S28A 2IA7A 1O7WB 1QALA 3FG4A 3G6E3 1W00A 4Q53A 3CPOA 1UUVB 3OXAA 1O7HB 4HM2B 2C10A 2ML6A 4WP5A 4WFOA 2HMLB 3CMA3 1W02A 3BNCA 3NM7A 4N6TA 3KFQC 5D81A 3PXMA 5G2GA 1YJ93 1M1K4 1E97A 1RRLA 1IV9A 1GD3A 1JV2B 4HVNA 2F99A 4J9AA 5IEOA 1NB5I 1GY5A 2W56B 3QK9A 3T8UA 4HM0B 2GBWB 2YFIB 3F14A 1E3VA 3V99A 1QAKA 1US1A 3EC9A 2V1LA 2WGQA 2Z6BA 3MG3A 3CCL3 1QMAA 2OOVC 3HI7A 2GEYA 2HMJB 2HMMB 3KIIA 1SQWA 5KP1A 3MPHA 4EC6A 3F9SA 4EV5A 2BMOB 2RSXA 3J7Yd 1ROVA 3G0KA 5EEOA 4LZIA 3LTCA 4HKVB 1RN7A 3S27A 4RNZA 3OW22 3L0RA 3CCQ3 3FKAA 3JVCA 4N6LA 3T0UA 1ULJB 4FMDA 1K8A4 4WYKB 3X41A 1VQM3 4RBNA 5IG4A 2ZDJA 3SOYA 3B4PA 3SXXA 2QA43 2PZVA 3NV0A 3CCV3 2CFDA 1A67A 4FMAA 1DMNA 2UX0A 1Q814 1HKXA 2CFKA 3LXUX 1FGQA 2CG0A 3VSYA 3WODG 3KZTA 3K63A 1OHOA 2HMOB 3EF8A 4OK0A 2CWVA 5AIGA 2RCDA 3Q1CA 5IEPA 5AYSC 1WNHA 3HZPA 3OWSA 5EVHA 1RRHA 2GBXB 1EA2A 3DGLA 3WDGB 1Q824 1QAFA 3NV0B 1OGZA 1OHPA 2Z76A 3PZWA 4MMYB 2W2CA 2W03A 3SLUA 1KC84 3F40A 4TX4A 4IT7A 1O7PB 1N9JA 2XSOB 4HM7B 4N3VA 3T8NA 2YX9A 4HJLB 3U97A 1K734 2ZL8A 4XBXA 3S29A 3B4OA 3NBBA 1UW1A 4X2OA 5CK6A 3BLZA 3I0YA 3K5TA 5DREA 4KZ1A 3G4S3 5IG5A 4EBGA 3MYTA 1DVDA 4R1KA 1CQSA 2BO9B 4G1MB 3CCJ3 4KFEA 4AKZA 3MWZA 3HK4A 2OCTA 1YHQ3 3G16A 3OX9A 4FCZA 1A90A 1O7MB 4GL6A 2XGLA 2W9PA 1VQ63 4XDWA 2CFWA 2YFJB 2BHMA 3BNBA 1SJWA 3CCR3 3D9RA 2OOVA 2MF7A 3U1WA 3FSDA 4EV2A 4FR9A 2GEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUV A;  3EN8 A;  1NWW A;  1JN5 A;  3GWR A;  1W01 A;  2XR8 B;  1OUN A;  1GY7 A;  4LGQ A;  2INX A;  5AEU B;  1ZO2 A;  3CNM A;  4WWU C;  3WMD A;  5IER A;  3NXJ A;  3EHC A;  1Z1S A;  2YFL B;  3UJM A;  1JN5 B;  4HZ9 B;  4ORL A;  3FH1 A;  8CHO A;  3DZL A;  1ASK A;  5BVB A;  3JUM A;  3E99 A;  5IG0 A;  2STD A;  2RFR A;  3K7C A;  1IDP A;  1ULI B;  5D82 A;  3FZW A;  1VZZ A;  2B1X B;  1JKG A;  2K54 A;  3MHE A;  3M8C A;  4STD A;  2BNG A;  3MG2 A;  3ER7 A;  3SED A;  1OF5 A;  3ECF A;  3DM8 A;  4CDL A;  5STD A;  3KSP A;  2HMN B;  3OV4 A;  1O7G B;  5CLK A;  3JUP A;  3H3H A;  1JB4 A;  3FF0 A;  1JKG B;  3EJV A;  1OHS A;  4HM4 B;  5BXQ A;  1OF5 B;  2R4I A;  3GRD A;  3KKG A;  3ROB A;  5JPU A;  4HM1 B;  4OUQ A;  4XBT A;  5CF2 A;  3GZR A;  4MJD A;  3RGA A;  5AEW B;  4R9K A;  5IF6 A;  1Q42 A;  1QJG A;  2CKF B;  1NDO B;  4L7K A;  1Q40 A;  3S5C A;  3G8Z A;  5DRV A;  1A2K A;  3F8H A;  1JB5 A;  3UNL A;  2F86 B;  3MSO A;  5FW5 A;  1AR0 A;  3GZB A;  3EBT A;  1C7H A;  3HX8 A;  3VGN A;  3MKI A;  4HM3 B;  1K41 A;  2QGU A;  4KVH A;  4XB5 A;  1Q40 B;  1W6Y A;  3CNX A;  4IIA A;  3F8X A;  3FLJ A;  4L8P A;  2BMQ B;  3DXO A;  3DMC A;  3H51 A;  3KE7 A;  3FGY A;  2Z77 A;  3DUK A;  3RGR A;  3GZY B;  5D83 A;  4X2H A;  4HZB B;  1DMQ A;  2A15 A;  4R9L A;  3LZA A;  4HM8 B;  5JPP A;  1JB2 A;  3OWU A;  5KP3 A;  3EBY A;  2OWP A;  5IEN A;  1ISK A;  3NM2 A;  1TP6 A;  1OH0 A;  1GYB A;  1O7N B;  2XSH B;  5AIH A;  1OCV A;  3EX9 A;  1GS3 A;  2XRX B;  4WYK A;  4LEH A;  3Q90 A;  3B7C A;  3JUN A;  4HM6 B;  1S5A A;  1U5O A;  3NBR A;  5KP4 A;  1TUH A;  5CXO A;  3K0Z A;  2CHC A;  4L8O A;  4XDV A;  1GY6 A;  3LYG A;  3MG1 A;  4HM5 B;  2HMK B;  4XBY A;  3JUO A;  3STD A;  1UUW B;  3OWY A;  2JQ5 A;  1DMM A;  1E3R A;  4RZM A;  4PEJ A;  3GZX B;  3B8L A;  2I9W A;  4J8T A;  6STD A;  3FF2 A;  1WQL B;  2RGQ A;  1OPY A;  3NHX A;  5TGN A;  2F98 A;  3F7X A;  5AIF A;  2B24 B;  4K1U A;  2IMJ A;  1STD A;  4FCJ A;  3BB9 A;  2BMR B;  5HGR A;  4U13 A;  3JUQ A;  4GB5 A;  4H3U A;  5IG3 A;  2Z7A A;  7STD A;  4LMI A;  2QIY A;  3EN1 B;  3EQQ B;  3F7S A;  1OGX A;  4I4K A;  3IPT A;  1EG9 B;  5CF1 A;  4OVM A;  2GXF A;  3CU3 A;  1BUQ A;  1ZX2 A;  5AII A;  4XM4 A;  5AI1 A;  3SOA A;  1NU3 A;  4FCM A;  3A76 A;  4K1V A;  1O7W B;  4Q53 A;  1W00 A;  3CPO A;  1UUV B;  3OXA A;  1O7H B;  4HM2 B;  4WP5 A;  2HML B;  1W02 A;  5D81 A;  5G2G A;  1E97 A;  4HVN A;  5IEO A;  2F99 A;  4J9A A;  1GY5 A;  3T8U A;  4HM0 B;  2GBW B;  2YFI B;  3F14 A;  1E3V A;  3EC9 A;  3MG3 A;  1QMA A;  5KP1 A;  2GEY A;  2HMJ B;  2HMM B;  3F9S A;  2BMO B;  3G0K A;  4HKV B;  3FKA A;  1ULJ B;  4WYK B;  5IG4 A;  3SOY A;  3B4P A;  2PZV A;  3NV0 A;  1DMN A;  2UX0 A;  1HKX A;  3VSY A;  3KZT A;  1OHO A;  2HMO B;  3EF8 A;  5AIG A;  2RCD A;  5IEP A;  3HZP A;  3OWS A;  5EVH A;  2GBX B;  1EA2 A;  3NV0 B;  1OGZ A;  1OHP A;  2Z76 A;  2W2C A;  3F40 A;  1O7P B;  2XSO B;  4N3V A;  4HM7 B;  3T8N A;  4HJL B;  4XBX A;  3B4O A;  5CK6 A;  4X2O A;  3BLZ A;  3I0Y A;  5DRE A;  5IG5 A;  3MYT A;  4R1K A;  1CQS A;  3HK4 A;  3G16 A;  3OX9 A;  1O7M B;  4XDW A;  2YFJ B;  1SJW A;  3D9R A;  3FSD A;  2GEX A; 
#chains in the Genus database with same CATH topology
 3D5I A;  3EN8 A;  1NWW A;  1BRH A;  3NUV A;  1WTH A;  5G1K A;  1JN5 A;  1RCK A;  1B21 A;  3GWR A;  1W01 A;  1UCK A;  2XR8 B;  2OTL 3;  1OUN A;  2KF5 A;  3D4A A;  1GY7 A;  4LGQ A;  1BAN A;  6RNT A;  1GOV A;  2INX A;  1IU7 A;  3DY5 A;  3PCR A;  1FA3 A;  4O2H A;  5AEU B;  1ZO2 A;  3CNM A;  3LT9 A;  4WWU C;  1W5Z A;  3WA3 A;  2CC3 A;  3D5G A;  3WMD A;  5IER A;  3HII A;  3NXJ A;  2GU1 A;  1DET A;  2P0X A;  1VQP 3;  2CFG A;  4O8S A;  3FCS B;  4EYC A;  1BUJ A;  3EHC A;  1ROA A;  2O3O A;  3LT8 A;  1D6Z A;  2ZA4 A;  1IVW A;  4KFF A;  1KQS 2;  2Q07 A;  1FYS A;  2XGN A;  1RTU A;  1B27 A;  3EE1 A;  1Z1S A;  2YFL B;  2OTJ 3;  3UJM A;  1JN5 B;  1BU4 A;  1W4N A;  1AV4 A;  1N9E A;  1QVF 2;  1IVV A;  4HZ9 B;  5FGO A;  4ORL A;  3FH1 A;  8CHO A;  1W6C A;  3CD6 3;  3DZL A;  1N5H A;  1ASK A;  5BVB A;  3JUM A;  1YVB I;  1IK3 A;  3E99 A;  5IG0 A;  1IV7 A;  2STD A;  2P09 A;  5HOH A;  2RFR A;  1LNH A;  3K7C A;  3Q3F A;  1IDP A;  2IUK A;  3CCE 3;  1BNR A;  3UL5 A;  1M1X B;  1ULI B;  1W6G A;  2C4B A;  5D82 A;  3LTA A;  3FZW A;  2KXG A;  1WMP A;  2F5W A;  5EQL A;  3K9M C;  1VZZ A;  1FGM A;  2CWT A;  3PS8 A;  1RN1 A;  2B1X B;  4RNT A;  2JDI H;  1IT7 A;  1JKG A;  2WOH A;  2BU4 A;  1RNB A;  2K54 A;  2CG1 A;  1KC8 4;  3MHE A;  4WHA A;  3M8C A;  4STD A;  1I70 A;  2BNG A;  3MG2 A;  3ER7 A;  2CH9 A;  3SED A;  1UDI I;  4BU4 A;  2OQE C;  1OF5 A;  1YJW 3;  3Q2P A;  2H0I A;  3ECF A;  1RJO A;  3DH2 A;  3DM8 A;  1IVU A;  1K28 A;  3HIG A;  1RGG A;  4CDL A;  4I5Q A;  5STD A;  1YIT 3;  1SAR A;  1GOU A;  3KSP A;  1GMQ A;  1BNG A;  3D3L A;  1VQ8 3;  4QWT A;  2HMN B;  1AVL A;  3OV4 A;  1O7G B;  2IUJ A;  2HOH A;  3NX0 A;  2XFS A;  3LML A;  1UCL A;  4O3V A;  5CLK A;  4ZM8 A;  4KFD A;  3JUP A;  1FUW A;  3H3H A;  1NJI 4;  2ML5 A;  2KAA A;  2RBI A;  1JB4 A;  1BRK A;  1UGH I;  3FF0 A;  4AKY A;  1JKG B;  1BNE A;  3EJV A;  3CXC 2;  2FNQ A;  4IPB A;  1AY7 A;  1FUS A;  2AAD A;  1OHS A;  4HM4 B;  2CFL A;  4NHF A;  5BXQ A;  2F56 A;  1OF5 B;  1J2B A;  1LOV A;  1IQ8 A;  2CIU A;  2R4I A;  4N6O B;  3GRD A;  3KKG A;  3N54 B;  4O02 B;  1BRN L;  3ROB A;  1BNI A;  1W7C A;  3CC7 3;  4FMB A;  5JPU A;  5M1A A;  4HM1 B;  4MMX B;  4OUQ A;  3N9H A;  5LC7 A;  1T5Y A;  4XBT A;  3BND A;  3G71 3;  1LRA A;  3QRD A;  5CF2 A;  3GZR A;  4MJD A;  3RGA A;  1AVK A;  2J8X B;  2XEP A;  5AEW B;  3DGO A;  4R9K A;  5ELU A;  1VQ5 3;  3DGN A;  5IF6 A;  1RKY A;  1Q42 A;  1QJG A;  2CKF B;  2E2T A;  2K3D A;  1B2X A;  2W0Q A;  3DGM A;  1MNL A;  1BSB A;  1NDO B;  4HOH A;  5RNT A;  1VQ9 3;  3X3X A;  1IT8 A;  3AMO A;  4HBR A;  4L7K A;  1Q40 A;  1Q7H A;  1V74 A;  3NQY A;  3WHO A;  5BIR A;  3S5C A;  3G8Z A;  5DRV A;  3CC2 3;  2KCD A;  1YIJ 3;  1CEW I;  1SII A;  1A2K A;  3BNE A;  1Q7Y 4;  1JBR A;  2MC8 A;  2BIR A;  1BOX A;  1FGR A;  3F8H A;  1JB5 A;  3UNL A;  2F86 B;  1PU4 A;  3MSO A;  3LOY A;  1ZS7 A;  5FW5 A;  1AR0 A;  1KWI A;  1JNQ A;  3FG1 A;  3GZB A;  1JRQ A;  4CJN A;  1B2M A;  1M9G A;  1WMO A;  4ILF A;  3EBT A;  1C7H A;  1NO3 A;  3GAX A;  3HX8 A;  4HYZ A;  3MKI A;  4HM3 B;  1L5G B;  1K41 A;  1HU9 A;  3VGN A;  2OQE A;  2ZHX B;  1UI8 A;  1PY3 A;  2QGU A;  2H0G A;  3AMO B;  4KVH A;  3X3Y A;  2FXT A;  4XB5 A;  1Q40 B;  1HYF A;  1YGW A;  5I97 A;  1W6Y A;  2BT3 A;  1U8C B;  1D6Y A;  4GSP A;  1ZGX A;  3KSE D;  2D42 A;  4K61 A;  4R4K A;  3KN4 A;  3CNX A;  1Q9E A;  1GMP A;  2XFT A;  4IIA A;  3ZG0 A;  3N8B A;  3D79 A;  5BU4 A;  2W6J H;  3F8X A;  3CPW 2;  3FLJ A;  1VQK 3;  1JZD A;  2BMQ B;  4L8P A;  3DXO A;  2C11 A;  3DMC A;  3H51 A;  3KE7 A;  3DGY A;  1IQY A;  3FGY A;  1UCJ A;  3IJE B;  6GSP A;  1TU5 A;  4HAA A;  2Z77 A;  3DUK A;  2IYJ A;  1STF I;  2CW9 A;  1CH0 A;  1NB3 I;  1TTO A;  2UGI A;  3ALA A;  4J5G A;  3I55 3;  1VQN 3;  3RGR A;  3GZY B;  5D83 A;  4R80 A;  3VF1 A;  2GU3 A;  1RGL A;  3TDG A;  4X2H A;  1RNT A;  3NBJ A;  5G1L A;  4HZB B;  5JBS A;  1KSI A;  1B2Z A;  1BRG A;  1DMQ A;  3EB8 A;  4LSO A;  1MWT A;  2A15 A;  3PCS A;  4R9L A;  1X1Y A;  2QEX 3;  1D6U A;  3LZA A;  4HM8 B;  5JPP A;  1JB2 A;  3OWU A;  1JZO A;  1VQ4 3;  5KP3 A;  3EBY A;  9RNT A;  3HOH A;  1UUG B;  4NRE A;  4N6N B;  1X1U A;  2WOF A;  3LTB A;  4GHO A;  1LOX A;  1SPU A;  2OWP A;  1EUI C;  3PYJ A;  4BTX A;  5IEN A;  1ISK A;  1GD4 A;  3NM2 A;  1S72 3;  3CCU 3;  1TP6 A;  2FGT A;  1OH0 A;  2CWU A;  3I56 3;  1GYB A;  1O7N B;  2XSH B;  4BIR A;  1K9M 4;  1EKM A;  1M90 4;  3ZFZ A;  5AIH A;  1OCV A;  3X3Z A;  5GSP A;  3EX9 A;  1OAC A;  1GS3 A;  2XRX B;  4WYK A;  1WMN A;  4FMC A;  1IVX A;  2M7O A;  4LEH A;  1Q86 4;  4H61 A;  3Q90 A;  1YNV X;  3B7C A;  1GMR A;  2XH9 A;  3JUN A;  2IY2 A;  4HM6 B;  2XF3 A;  1BGS A;  1S5A A;  1JBT A;  1U5O A;  1YVS A;  4AEQ A;  1GOY A;  3NBR A;  5KP4 A;  1R4C A;  1X1W A;  1EEJ A;  1TUH A;  1LQM B;  4MEI A;  1RGF A;  1B3S A;  1VQO 3;  1RN4 A;  3K0Z A;  5CXO A;  1UI7 A;  3LTD A;  1CYV A;  5LC6 A;  2K0M A;  2SBL A;  3V92 A;  1C54 A;  2CHC A;  1LOY A;  4L8O A;  4XDV A;  1GY6 A;  1BRJ A;  3RNT A;  4MMZ B;  3LYG A;  2L4V A;  1N8Q A;  3CME 3;  3MG1 A;  4HM5 B;  1VQ7 3;  1FGO A;  2HMK B;  4XBY A;  4JF8 A;  1F8N A;  2WO0 A;  1YJN 3;  1DE3 A;  2CK3 H;  3JUO A;  3STD A;  1UUW B;  2P38 A;  1DYU A;  1Y4K A;  4BTY A;  1W2B 2;  3OWY A;  2JQ5 A;  1DMM A;  1E3R A;  1IYY A;  4RZM A;  1TFO A;  5M18 A;  4PEJ A;  3GZX B;  1YI2 3;  1JJ2 2;  4N6U A;  3KCH A;  3AGO A;  3B8L A;  1VQL 3;  2I9W A;  1RLS A;  4J8T A;  1RHL A;  3FF2 A;  6STD A;  1WQL B;  2RGQ A;  1X1X A;  3CCS 3;  1OPY A;  3SVA A;  1EQK A;  3IMA B;  1RGA A;  3NHX A;  4NPB A;  5TGN A;  2L1S A;  2P0M A;  2F98 A;  4CPK A;  3X40 A;  1FW7 A;  5ELJ A;  3SYU A;  1BSD A;  1TFK A;  3CC4 3;  3F7X A;  1I2F A;  2O9U X;  1FUT A;  5AIF A;  1FZU A;  1MGR A;  2B24 B;  4K1U A;  3UL6 A;  1CYU A;  3PGB A;  1A2V A;  2IMJ A;  1STD A;  3V98 A;  4FCJ A;  3BB9 A;  1DVC A;  2BMR B;  1LVN A;  2F5M A;  4K90 B;  5HGR A;  1PFP A;  1KD1 4;  3NQZ A;  1UCI A;  3O8Y A;  4EW5 A;  1BNJ A;  4N6V 0;  4N6M A;  1RGC A;  4U13 A;  1IQX A;  3JUQ A;  1MGW A;  4GB5 A;  4H3U A;  2W9Q A;  1YGE A;  2Y74 A;  1A2P A;  5IG3 A;  1SIH A;  1TIJ A;  2Z7A A;  5KP1 A;  2P05 A;  4CCV A;  2LYX A;  7STD A;  7GSP A;  3GSP A;  4LMI A;  2KRT A;  2PNC A;  5A0O B;  1MOL A;  1MWU A;  1W2Z A;  2QIY A;  1BSA A;  1VQQ A;  3EN1 B;  3EQQ B;  1TRP A;  2Y73 A;  2E2V A;  2WGO A;  3S67 A;  1BRI A;  3F7S A;  1G02 A;  1OGX A;  3CCM 3;  1QVG 2;  3WOE B;  1HZ1 A;  2D1W A;  5IW9 A;  2W04 A;  1AQZ A;  4I4K A;  3UB1 A;  3IPT A;  2CX0 A;  1EG9 B;  1BSE A;  3WOF B;  1LNI A;  1T2H A;  4OVM A;  4BTW A;  5CF1 A;  4RNY A;  2GXF A;  3CU3 A;  4JRF A;  1LXE A;  1BUQ A;  1ZX2 A;  2E2U A;  3FG3 A;  5AII A;  3RDE A;  3SX1 A;  4XM4 A;  4EXR A;  5AI1 A;  3SOA A;  1N8R 4;  1NU3 A;  4KT3 B;  1PYL A;  3BU4 A;  1BAO A;  2KF4 A;  3X42 A;  1FGT A;  4FCM A;  2W56 A;  1BNF A;  2LQV A;  3LH4 A;  1G96 A;  5AYR B;  1N5P A;  3WA2 X;  3A76 A;  1LOW A;  1I0X A;  4K1V A;  3S28 A;  2IA7 A;  2RNT A;  1LQG C;  1QAL A;  1O7W B;  3FG4 A;  3G6E 3;  1W00 A;  4Q53 A;  3CPO A;  1UUV B;  3OXA A;  4BL2 A;  1O7H B;  4HM2 B;  2C10 A;  2ML6 A;  4WP5 A;  4WFO A;  2HML B;  3CMA 3;  1W02 A;  2CX1 A;  3BNC A;  3NM7 A;  4N6T A;  2SAR A;  1V57 A;  3KFQ C;  5D81 A;  3PXM A;  5G2G A;  1YJ9 3;  1M1K 4;  1RRL A;  1E97 A;  1IV9 A;  1GD3 A;  1JV2 B;  4HVN A;  2F99 A;  4J9A A;  1NNV A;  5IEO A;  1NB5 I;  1GY5 A;  2W56 B;  3QK9 A;  3T8U A;  1B20 A;  4HM0 B;  2GBW B;  2YFI B;  3F14 A;  1I8V A;  3AHW A;  2KF3 A;  1E3V A;  3V99 A;  1QAK A;  1US1 A;  3EC9 A;  2V1L A;  2WGQ A;  2Z6B A;  3MG3 A;  3CCL 3;  1QMA A;  1UGI A;  2OOV C;  2GEY A;  2HMJ B;  2HMM B;  3HI7 A;  1SQW A;  3KII A;  3MPH A;  4BL3 A;  4EC6 A;  3F9S A;  4EV5 A;  2BMO B;  2RSX A;  1RGK A;  3J7Y d;  2GSP A;  1TJD A;  1R4Y A;  1ROV A;  3G0K A;  5EEO A;  2H0H A;  3LTC A;  4LZI A;  4HKV B;  1RN7 A;  3S27 A;  3AGN A;  4RNZ A;  1I0V A;  3OW2 2;  3L0R A;  3CCQ 3;  3FKA A;  1T3B A;  1GSP A;  3JVC A;  1ULJ B;  4FMD A;  4N6L A;  3T0U A;  1K8A 4;  1RSN A;  4WYK B;  3X41 A;  1VQM 3;  5M19 A;  4RBN A;  5IG4 A;  1T2I A;  2ZDJ A;  3SOY A;  3B4P A;  3SXX A;  2QA4 3;  2PZV A;  3NV0 A;  1G0T A;  3CCV 3;  2CFD A;  1A67 A;  1B2U A;  4FMA A;  1DMN A;  2UX0 A;  7RNT A;  1Q81 4;  1HKX A;  2CFK A;  3LXU X;  1FGQ A;  2CG0 A;  1MWR A;  3VSY A;  1RCL A;  3A5E A;  3WOD G;  3KZT A;  3K63 A;  1OHO A;  2HMO B;  3EF8 A;  1BRS A;  4OK0 A;  2CWV A;  2KF6 A;  2UUG C;  5AIG A;  8RNT A;  1I2E A;  2RCD A;  3Q1C A;  5AYS C;  5IEP A;  4LYL B;  1WNH A;  3URP A;  1RDS A;  1RGE A;  3HZP A;  3OWS A;  5EVH A;  1RRH A;  1BSC A;  2GBX B;  3WR2 A;  1I3I A;  1EA2 A;  3DGL A;  3WDG B;  1Q82 4;  1QAF A;  3NV0 B;  1OGZ A;  1OHP A;  2Z76 A;  3PZW A;  4MMY B;  2W2C A;  2W03 A;  3SLU A;  3ZG5 A;  1BIR A;  3F40 A;  4J5K A;  4IT7 A;  4TX4 A;  1O7P B;  1N9J A;  2AAE A;  2XSO B;  4HM7 B;  4N3V A;  3T8N A;  2YX9 A;  4HJL B;  3U97 A;  1K73 4;  2ZL8 A;  4XBX A;  2R41 A;  1BVI A;  3B4O A;  3NBB A;  1UW1 A;  4X2O A;  1B2S A;  5CK6 A;  3S29 A;  3BLZ A;  3I0Y A;  1MWS A;  3K5T A;  5DRE A;  4KZ1 A;  3G4S 3;  5IG5 A;  3AHS A;  4EBG A;  3MYT A;  1DVD A;  4R1K A;  1CQS A;  2BO9 B;  4G1M B;  3CCJ 3;  4KFE A;  4AKZ A;  3MWZ A;  3HK4 A;  2OCT A;  2F4Y A;  1TRQ A;  4DKI A;  1V58 A;  1YHQ 3;  3G16 A;  3OX9 A;  4FCZ A;  1A90 A;  1O7M B;  4GL6 A;  2XGL A;  2W9P A;  1VQ6 3;  4XDW A;  2CFW A;  2YFJ B;  1RGH A;  2BHM A;  3BNB A;  1I3F A;  1SJW A;  3CCR 3;  1BNS A;  3D9R A;  2OOV A;  1I2G A;  3BIR A;  2MF7 A;  3U1W A;  3FSD A;  4EV2 A;  1JBS A;  4FR9 A;  2GEX A;  1RMS A; 
#chains in the Genus database with same CATH homology
 3NUV A;  3EN8 A;  1NWW A;  1WTH A;  1JN5 A;  3GWR A;  1W01 A;  2XR8 B;  2OTL 3;  1OUN A;  1GY7 A;  4LGQ A;  2INX A;  1IU7 A;  3DY5 A;  3PCR A;  1FA3 A;  4O2H A;  5AEU B;  1ZO2 A;  3CNM A;  3LT9 A;  4WWU C;  1W5Z A;  3WA3 A;  2CC3 A;  3WMD A;  5IER A;  3HII A;  3NXJ A;  2GU1 A;  2P0X A;  1VQP 3;  2CFG A;  4O8S A;  3FCS B;  4EYC A;  3EHC A;  1ROA A;  2O3O A;  3LT8 A;  1D6Z A;  1IVW A;  4KFF A;  1KQS 2;  2Q07 A;  2XGN A;  3EE1 A;  1Z1S A;  2YFL B;  2OTJ 3;  3UJM A;  1JN5 B;  1QVF 2;  1W4N A;  1AV4 A;  1N9E A;  1IVV A;  4HZ9 B;  5FGO A;  4ORL A;  3FH1 A;  8CHO A;  1W6C A;  3CD6 3;  3DZL A;  1N5H A;  1ASK A;  5BVB A;  3JUM A;  1YVB I;  1IK3 A;  3E99 A;  5IG0 A;  1IV7 A;  2STD A;  2P09 A;  2RFR A;  1LNH A;  3K7C A;  1IDP A;  2IUK A;  3CCE 3;  3UL5 A;  1M1X B;  1ULI B;  1W6G A;  5D82 A;  3LTA A;  3FZW A;  2KXG A;  1WMP A;  5EQL A;  3K9M C;  1VZZ A;  1FGM A;  2CWT A;  3PS8 A;  2B1X B;  2JDI H;  1IT7 A;  1JKG A;  2WOH A;  2K54 A;  2CG1 A;  3MHE A;  4WHA A;  3M8C A;  4STD A;  2BNG A;  3MG2 A;  3ER7 A;  2CH9 A;  3SED A;  2OQE C;  1OF5 A;  1YJW 3;  3Q2P A;  3ECF A;  1RJO A;  3DM8 A;  1IVU A;  1K28 A;  3HIG A;  4CDL A;  5STD A;  1YIT 3;  1VQ8 3;  3KSP A;  3D3L A;  4QWT A;  2HMN B;  1AVL A;  3OV4 A;  1O7G B;  2IUJ A;  3NX0 A;  2XFS A;  3LML A;  4O3V A;  5CLK A;  4ZM8 A;  4KFD A;  3JUP A;  3H3H A;  1NJI 4;  2ML5 A;  1JB4 A;  4AKY A;  3FF0 A;  1JKG B;  3EJV A;  3CXC 2;  2FNQ A;  4IPB A;  1OHS A;  4HM4 B;  2CFL A;  4NHF A;  5BXQ A;  1OF5 B;  1J2B A;  1IQ8 A;  2CIU A;  2R4I A;  4N6O B;  3GRD A;  3KKG A;  3N54 B;  4O02 B;  3ROB A;  1W7C A;  3CC7 3;  4FMB A;  5JPU A;  4HM1 B;  4MMX B;  4OUQ A;  3N9H A;  5LC7 A;  1T5Y A;  4XBT A;  3BND A;  3G71 3;  3QRD A;  5CF2 A;  3GZR A;  4MJD A;  3RGA A;  1AVK A;  2XEP A;  5AEW B;  3DGO A;  4R9K A;  5ELU A;  1VQ5 3;  3DGN A;  5IF6 A;  1RKY A;  1Q42 A;  1QJG A;  2CKF B;  2E2T A;  2W0Q A;  3DGM A;  1FUW A;  1MNL A;  1NDO B;  1VQ9 3;  3X3X A;  1IT8 A;  3AMO A;  4HBR A;  4L7K A;  1Q40 A;  1V74 A;  3NQY A;  3S5C A;  3G8Z A;  5DRV A;  3CC2 3;  2KCD A;  1YIJ 3;  1CEW I;  1SII A;  1A2K A;  3BNE A;  1Q7Y 4;  2MC8 A;  1FGR A;  3F8H A;  1JB5 A;  3UNL A;  2F86 B;  1PU4 A;  3MSO A;  3LOY A;  5FW5 A;  1AR0 A;  1KWI A;  1JNQ A;  3FG1 A;  3GZB A;  1JRQ A;  1M9G A;  1WMO A;  3EBT A;  1C7H A;  1NO3 A;  3GAX A;  3HX8 A;  4HYZ A;  3MKI A;  4HM3 B;  1L5G B;  1K41 A;  1HU9 A;  3VGN A;  2OQE A;  1UI8 A;  2QGU A;  3AMO B;  4KVH A;  3X3Y A;  2FXT A;  4XB5 A;  1Q40 B;  5I97 A;  1W6Y A;  2BT3 A;  1U8C B;  1D6Y A;  3KSE D;  4R4K A;  2D42 A;  4K61 A;  3KN4 A;  3CNX A;  2XFT A;  4IIA A;  3N8B A;  2W6J H;  3F8X A;  3CPW 2;  3FLJ A;  1VQK 3;  4L8P A;  2BMQ B;  3DXO A;  2C11 A;  3DMC A;  3H51 A;  3KE7 A;  1IQY A;  3FGY A;  3IJE B;  1TU5 A;  2Z77 A;  3DUK A;  1STF I;  2CW9 A;  1NB3 I;  3ALA A;  3I55 3;  1VQN 3;  3RGR A;  3GZY B;  5D83 A;  4R80 A;  3VF1 A;  2GU3 A;  3TDG A;  4X2H A;  3NBJ A;  4HZB B;  5JBS A;  1KSI A;  3EB8 A;  1DMQ A;  4LSO A;  2A15 A;  3PCS A;  4R9L A;  2QEX 3;  1D6U A;  3LZA A;  4HM8 B;  5JPP A;  1JB2 A;  3OWU A;  1VQ4 3;  5KP3 A;  3EBY A;  4NRE A;  4N6N B;  2WOF A;  3LTB A;  1LOX A;  1SPU A;  2OWP A;  3PYJ A;  4BTX A;  5IEN A;  1ISK A;  1GD4 A;  3NM2 A;  1S72 3;  3CCU 3;  1TP6 A;  2FGT A;  1OH0 A;  2CWU A;  3I56 3;  1GYB A;  1O7N B;  2XSH B;  1K9M 4;  1EKM A;  1M90 4;  5AIH A;  1OCV A;  3X3Z A;  3EX9 A;  1OAC A;  1GS3 A;  2XRX B;  4WYK A;  1WMN A;  4FMC A;  1IVX A;  2M7O A;  4LEH A;  1Q86 4;  4H61 A;  3Q90 A;  3B7C A;  3JUN A;  2XH9 A;  4HM6 B;  2XF3 A;  1S5A A;  1U5O A;  4AEQ A;  3NBR A;  5KP4 A;  1R4C A;  1TUH A;  4MEI A;  1VQO 3;  3K0Z A;  5CXO A;  1UI7 A;  3LTD A;  1CYV A;  5LC6 A;  2K0M A;  2SBL A;  3V92 A;  2CHC A;  4L8O A;  4XDV A;  1GY6 A;  4MMZ B;  3LYG A;  2L4V A;  1N8Q A;  3CME 3;  3MG1 A;  4HM5 B;  1VQ7 3;  1FGO A;  2HMK B;  4XBY A;  4JF8 A;  1F8N A;  2WO0 A;  1YJN 3;  2CK3 H;  3JUO A;  3STD A;  1UUW B;  2P38 A;  1DYU A;  1Y4K A;  4BTY A;  1W2B 2;  3OWY A;  2JQ5 A;  1DMM A;  1E3R A;  4RZM A;  1TFO A;  4PEJ A;  3GZX B;  1YI2 3;  1JJ2 2;  4N6U A;  3B8L A;  1VQL 3;  2I9W A;  4J8T A;  6STD A;  3FF2 A;  1WQL B;  2RGQ A;  3CCS 3;  1OPY A;  3SVA A;  1EQK A;  3IMA B;  3NHX A;  5TGN A;  2P0M A;  2F98 A;  3X40 A;  5ELJ A;  1TFK A;  3CC4 3;  3F7X A;  2O9U X;  5AIF A;  2B24 B;  4K1U A;  3UL6 A;  1CYU A;  3PGB A;  1A2V A;  2IMJ A;  1STD A;  3V98 A;  4FCJ A;  3BB9 A;  1DVC A;  2BMR B;  1LVN A;  4K90 B;  5HGR A;  1PFP A;  1KD1 4;  3NQZ A;  3O8Y A;  4N6V 0;  4N6M A;  4U13 A;  1IQX A;  3JUQ A;  4GB5 A;  4H3U A;  2W9Q A;  1YGE A;  2Y74 A;  5IG3 A;  1SIH A;  1TIJ A;  2Z7A A;  2P05 A;  4CCV A;  2LYX A;  7STD A;  4LMI A;  2KRT A;  2PNC A;  5A0O B;  1MOL A;  1W2Z A;  2QIY A;  3EN1 B;  3EQQ B;  2Y73 A;  2E2V A;  2WGO A;  3S67 A;  3F7S A;  1OGX A;  3CCM 3;  1QVG 2;  3WOE B;  2D1W A;  5IW9 A;  2W04 A;  4I4K A;  3UB1 A;  3IPT A;  3WOF B;  1EG9 B;  4BTW A;  5CF1 A;  4OVM A;  4RNY A;  2GXF A;  3CU3 A;  4JRF A;  1LXE A;  1BUQ A;  1ZX2 A;  2E2U A;  3FG3 A;  5AII A;  3RDE A;  3SX1 A;  4XM4 A;  4EXR A;  5AI1 A;  3SOA A;  1N8R 4;  1NU3 A;  3X42 A;  1FGT A;  4FCM A;  2W56 A;  2LQV A;  3LH4 A;  1G96 A;  5AYR B;  1N5P A;  3WA2 X;  3A76 A;  4K1V A;  3S28 A;  2IA7 A;  1O7W B;  1QAL A;  3FG4 A;  3G6E 3;  1W00 A;  4Q53 A;  3CPO A;  1UUV B;  3OXA A;  1O7H B;  4HM2 B;  2C10 A;  2ML6 A;  4WP5 A;  4WFO A;  2HML B;  3CMA 3;  1W02 A;  3BNC A;  3NM7 A;  4N6T A;  3KFQ C;  5D81 A;  3PXM A;  5G2G A;  1YJ9 3;  1M1K 4;  1E97 A;  1RRL A;  1IV9 A;  1GD3 A;  1JV2 B;  4HVN A;  2F99 A;  4J9A A;  5IEO A;  1NB5 I;  1GY5 A;  2W56 B;  3QK9 A;  3T8U A;  4HM0 B;  2GBW B;  2YFI B;  3F14 A;  1E3V A;  3V99 A;  1QAK A;  1US1 A;  3EC9 A;  2V1L A;  2WGQ A;  2Z6B A;  3MG3 A;  3CCL 3;  1QMA A;  2OOV C;  3HI7 A;  2GEY A;  2HMJ B;  2HMM B;  3KII A;  1SQW A;  5KP1 A;  3MPH A;  4EC6 A;  3F9S A;  4EV5 A;  2BMO B;  2RSX A;  3J7Y d;  1ROV A;  3G0K A;  5EEO A;  4LZI A;  3LTC A;  4HKV B;  1RN7 A;  3S27 A;  4RNZ A;  3OW2 2;  3L0R A;  3CCQ 3;  3FKA A;  3JVC A;  4N6L A;  3T0U A;  1ULJ B;  4FMD A;  1K8A 4;  4WYK B;  3X41 A;  1VQM 3;  4RBN A;  5IG4 A;  2ZDJ A;  3SOY A;  3B4P A;  3SXX A;  2QA4 3;  2PZV A;  3NV0 A;  3CCV 3;  2CFD A;  1A67 A;  4FMA A;  1DMN A;  2UX0 A;  1Q81 4;  1HKX A;  2CFK A;  3LXU X;  1FGQ A;  2CG0 A;  3VSY A;  3WOD G;  3KZT A;  3K63 A;  1OHO A;  2HMO B;  3EF8 A;  4OK0 A;  2CWV A;  5AIG A;  2RCD A;  3Q1C A;  5IEP A;  5AYS C;  1WNH A;  3HZP A;  3OWS A;  5EVH A;  1RRH A;  2GBX B;  1EA2 A;  3DGL A;  3WDG B;  1Q82 4;  1QAF A;  3NV0 B;  1OGZ A;  1OHP A;  2Z76 A;  3PZW A;  4MMY B;  2W2C A;  2W03 A;  3SLU A;  1KC8 4;  3F40 A;  4TX4 A;  4IT7 A;  1O7P B;  1N9J A;  2XSO B;  4HM7 B;  4N3V A;  3T8N A;  2YX9 A;  4HJL B;  3U97 A;  1K73 4;  2ZL8 A;  4XBX A;  3S29 A;  3B4O A;  3NBB A;  1UW1 A;  4X2O A;  5CK6 A;  3BLZ A;  3I0Y A;  3K5T A;  5DRE A;  4KZ1 A;  3G4S 3;  5IG5 A;  4EBG A;  3MYT A;  1DVD A;  4R1K A;  1CQS A;  2BO9 B;  4G1M B;  3CCJ 3;  4KFE A;  4AKZ A;  3MWZ A;  3HK4 A;  2OCT A;  1YHQ 3;  3G16 A;  3OX9 A;  4FCZ A;  1A90 A;  1O7M B;  4GL6 A;  2XGL A;  2W9P A;  1VQ6 3;  4XDW A;  2CFW A;  2YFJ B;  2BHM A;  3BNB A;  1SJW A;  3CCR 3;  3D9R A;  2OOV A;  2MF7 A;  3U1W A;  3FSD A;  4EV2 A;  4FR9 A;  2GEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...