2RFRA

Crystal structure of an ntf2-like protein with a cystatin-like fold (saro_3722) from novosphingobium aromaticivorans dsm at 1.16 a resolution
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
154
structure length
154
Chain Sequence
GMDDLTNLAARLRLLEDREEIRELIARYGPLADSGDAEALSELWVEDGEYAVVGFATAKGRAAIAALIDGQTHRALMADGCAHFLGPATVTVEGDTATARCHSVVFRCVSGTFGSHRVSANRWTFRRTPAGWRAVRRENALLDGSAAARALLQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized protein (YP_001166107.1) from Novosphingobium aromaticivorans DSM 12444 at 1.16 A resolution
rcsb
source organism Novosphingobium aromaticivorans
molecule tags Unknown function
molecule keywords Uncharacterized protein
total genus 56
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2rfrA00
3OWYA 5AI1A 2HMLB 2JQ5A 1GYBA 2CKFB 3EX9A 2QIYA 5DREA 5G2GA 5BVBA 1QJGA 2F86B 4ORLA 3H51A 3DUKA 2BNGA 1IDPA 3F7SA 2HMKB 3FSDA 4GB5A 4XDVA 3MYTA 1OGXA 2Z77A 1K41A 3I0YA 1JB2A 1ULIB 4HM5B 1BUQA 1JB4A 3E99A 2F99A 3B8LA 3SEDA 3EC9A 1WQLB 3A76A 2R4IA 3CNMA 5TGNA 3UJMA 3G8ZA 3ROBA 3G0KA 1EA2A 3UNLA 6STDA 3EN8A 3MSOA 3K7CA 2RCDA 3WMDA 2HMNB 3EBTA 2XR8B 4J9AA 3CNXA 5CLKA 2GBWB 3FLJA 4L8PA 1E3RA 3FH1A 4J8TA 4OUQA 4R1KA 1OGZA 3F14A 1OH0A 3JUMA 3DXOA 3JUPA 3MHEA 3F8XA 4HVNA 2YFLB 2STDA 3OXAA 4WWUC 4K1UA 2B24B 1Q40A 1QMAA 4KVHA 5IF6A 5IG4A 1EG9B 4XM4A 5JPUA 4HJLB 4LMIA 3B4OA 5IG3A 4XBYA 1CQSA 5KP1A 2I9WA 3DZLA 2Z7AA 5STDA 3LZAA 5JPPA 5IEPA 3M8CA 4N3VA 2BMOB 3NM2A 4PEJA 4XBXA 3F7XA 3FZWA 4L8OA 4XDWA 3KZTA 5AEUB 1JKGB 1JB5A 1VZZA 2IMJA 2BMRB 3D9RA 3IPTA 1HKXA 1DMNA 3BLZA 3GWRA 4K1VA 3EBYA 4RZMA 2W2CA 1C7HA 2A15A 3MKIA 1W6YA 4HM1B 2GBXB 4OVMA 1STDA 8CHOA 3MG3A 3NV0B 1DMMA 3OWUA 1S5AA 1O7MB 3GZXB 5D81A 1JN5B 5CXOA 2YFJB 3HX8A 3SOAA 5IENA 1O7GB 2HMMB 4I4KA 1O7NB 2XSOB 4HM4B 3T8UA 4MJDA 4R9KA 1W00A 3FGYA 3EF8A 2UX0A 3OX9A 3S5CA 1AR0A 1E3VA 1OF5B 1W01A 3EHCA 5IERA 1NU3A 2XSHB 4FCJA 4HM3B 4HZ9B 4STDA 3B4PA 5CK6A 3T8NA 2GXFA 4HM8B 2B1XB 4IIAA 1NDOB 2OWPA 4H3UA 4WYKA 2RFRA 1OHOA 3F9SA 3H3HA 3NBRA 1GS3A 3F8HA 1OUNA 3GZRA 2GEXA 5FW5A 2K54A 2HMOB 4X2OA 1OHPA 1O7HB 5AEWB 3JUOA 1GY6A 4XB5A 3B7CA 2HMJB 5D83A 3CPOA 3LYGA 1O7WB 1OHSA 2INXA 3OV4A 1GY7A 3JUNA 3NHXA 3HK4A 3F40A 3JUQA 5CF1A 3FF0A 3CU3A 3G16A 3GRDA 1UUWB 4WP5A 3VSYA 4X2HA 4LEHA 4FCMA 4WYKB 3K0ZA 3GZBA 4R9LA 4L7KA 4HKVB 4CDLA 1JKGA 3FF2A 1O7PB 4HM6B 3SOYA 4HZBB 1OF5A 5EVHA 1UUVB 1ULJB 3ECFA 1OPYA 5BXQA 3MG1A 2F98A 5AIGA 2XRXB 3KSPA 5KP3A 3ER7A 4HM7B 1NWWA 1DMQA 1ZO2A 3FKAA 5IEOA 2GEYA 2QGUA 3EJVA 3MG2A 3DMCA 2YFIB 3Q90A 1Q40B 5DRVA 1JN5A 1A2KA 3OWSA 3NUVA 3NV0A 1E97A 5IG0A 1Q42A 4XBTA 3NXJA 1U5OA 3BB9A 3EQQB 2RGQA 4U13A 4HM0B 5AIIA 2PZVA 7STDA 5IG5A 3GZYB 3RGRA 1TP6A 5AIFA 1ZX2A 3DM8A 5KP4A 1ASKA 5HGRA 4LGQA 2Z76A 2CHCA 1SJWA 3STDA 4HM2B 5AIHA 5CF2A 1TUHA 5D82A 2BMQB 3EN1B 3VGNA 1OCVA 1ISKA 4Q53A 3HZPA 1GY5A 3KE7A 1Z1SA 3RGAA 3KKGA 1W02A
chains in the Genus database with same CATH superfamily
2BIRA 4LYLB 2O9UX 4FR9A 5AI1A 5G2GA 1LXEA 4I5QA 5JBSA 2F86B 3S29A 3Q1CA 3H51A 3DUKA 3SYUA 1IVWA 2F5WA 1BSEA 3N54B 1VQK3 1UCJA 1Q7Y4 3KN4A 1N9JA 3CC73 1BUQA 3SVAA 3B8LA 4NHFA 5G1KA 3EC9A 3G6E3 1JJ22 2BHMA 3QK9A 2ZHXB 3EBTA 1UCIA 4DKIA 1MGWA 1RJOA 5CLKA 3FLJA 3N9HA 3JVCA 1DVCA 4OUQA 4JRFA 4R1KA 1OGZA 3PCRA 5EEOA 4WFOA 3X3XA 4HVNA 2BT3A 3MHEA 3F8XA 1I70A 1W5ZA 5AYRB 1RN1A 3FCSB 3QRDA 5IG4A 1W4NA 3RDEA 4LMIA 3GSPA 1NO3A 2KF5A 4H61A 1MWRA 1FZUA 3LZAA 5JPPA 3X41A 4N3VA 2L4VA 2ZDJA 3NM2A 3AMOB 3FZWA 1GD3A 5AEUB 1KSIA 1DVDA 1JKGB 1SIHA 1Y4KA 2UGIA 4IT7A 1D6YA 1I3FA 1NNVA 2E2VA 1BAOA 1DMNA 3K5TA 5HOHA 1KQS2 1EUIC 2C10A 2FGTA 1RRLA 1W6YA 3MKIA 1WNHA 4OK0A 1UI8A 1DMMA 3CCQ3 2CWUA 1O7MB 1W6GA 1YVSA 4GHOA 2YFJB 3SOAA 3NM7A 1KC84 4N6V0 1L5GB 3T8UA 1K28A 2P0XA 3FGYA 3EF8A 5GSPA 1BNFA 3J7Yd 1AR0A 1E3VA 1OF5B 3UB1A 3EHCA 4STDA 3B4PA 3WHOA 1V57A 2GXFA 2H0IA 3LOYA 3LXUX 4IIAA 3UL6A 4HBRA 4NREA 1D6UA 3WR2A 3K9MC 2K54A 1ROAA 4NPBA 1EKMA 1UDII 1M9GA 3JUOA 6RNTA 1B27A 4N6OB 3B7CA 4R4KA 6GSPA 2CG0A 1RGAA 1O7WB 1T2IA 1GY7A 3F40A 3JUQA 4EW5A 1RNTA 2MF7A 2WGOA 4MEIA 5M1AA 4R9LA 4RNZA 4AKYA 1DE3A 1MOLA 1IT7A 1O7PB 5EQLA 3CCE3 1MWUA 4HZBB 1JBTA 1UUVB 3DH2A 4LSOA 1OACA 1OPYA 1MGRA 1VQM3 3LTBA 4HM7B 1YJ93 1RN4A 1ZO2A 2GEYA 3EB8A 2YFIB 1Q40B 3L0RA 1SPUA 5IG0A 1GOYA 4CCVA 4HM0B 2XGLA 3NX0A 2OOVC 4RNYA 1CEWI 2WOHA 3GZYB 1BRJA 1IK3A 3DM8A 1JZDA 2F5MA 1ASKA 4MMYB 4O2HA 3PXMA 4CPKA 1IVXA 1TIJA 5AIHA 3LTDA 3VGNA 2OQEA 1RNBA 5M18A 4BL2A 2CFDA 3CME3 1RGEA 1GOUA 3ZG0A 2HMLB 2JQ5A 3EX9A 3O8YA 1A2PA 2XFSA 1QJGA 3I563 4GB5A 4XDVA 2HMKB 3MYTA 1RLSA 1YNVX 1BUJA 1JB2A 1I8VA 3G713 1QAFA 1JBSA 2F99A 3SEDA 2P0MA 3SXXA 3T0UA 2R4IA 3CNMA 3UJMA 2RSXA 4CJNA 1U8CB 3K7CA 2AADA 2RCDA 1RGFA 3AGOA 3FG3A 2HMNB 3CCU3 3CNXA 1BOXA 2GBWB 2ML5A 2P09A 1YHQ3 1I3IA 1RCLA 1UGHI 2CWTA 2KRTA 3JUPA 2IUJA 2YFLB 2STDA 4K1UA 2B24B 1M1K4 3V99A 3HOHA 4LZIA 4XM4A 3B4OA 5IG3A 5I97A 4XBYA 2I9WA 4RNTA 2D1WA 2GU1A 4FMDA 5STDA 4R80A 5A0OB 2XFTA 4PEJA 4XBXA 1BSCA 1X1XA 2H0HA 1RRHA 1X1WA 3KZTA 3V92A 3AGNA 1JB5A 1VZZA 1PU4A 4RBNA 7RNTA 1B20A 3IPTA 1K734 3BLZA 1KWIA 1QALA 3D4AA 4FMBA 1C7HA 1G0TA 2A15A 2GSPA 4HM1B 2GBXB 2CG1A 4OVMA 3OWUA 1FGTA 1WMOA 2HOHA 3KSED 1JN5B 1LQGC 1SQWA 3HX8A 1FUSA 3UL5A 4BIRA 1BNEA 3WA2X 2XSOB 4HM4B 4KFFA 1LVNA 2MC8A 3OX9A 4EYCA 1W01A 1IYYA 1IV9A 1NU3A 4FCJA 3LH4A 5CK6A 1KD14 2BU4A 2FXTA 2J8XB 2CK3H 1B2SA 3BNBA 1GSPA 1N8R4 4H3UA 1B3SA 1OHOA 2IY2A 2KF4A 3NBRA 2WO0A 1A90A 2WGQA 3CCJ3 1FGQA 1LOWA 3LT8A 4HAAA 5D83A 4FMCA 9RNTA 1OHSA 2INXA 1BU4A 2ZL8A 1HU9A 3OV4A 4KFDA 1WMPA 3JUNA 3KFQC 3HK4A 3NHXA 3G4S3 1VQ73 3CCM3 3V98A 2W04A 3G16A 1M1XB 1UUWB 3D5IA 3TDGA 1UCKA 3WA3A 1QVG2 2JDIH 3GZBA 3CD63 3CCL3 3FF2A 4ZM8A 2W6JH 3SLUA 3CCR3 1ULJB 1BGSA 1T5YA 2F98A 3KSPA 1DMQA 2SBLA 2P05A 3FKAA 2QGUA 1UI7A 3N8BA 3Q90A 4WHAA 1K8A4 1HYFA 5ELJA 1JN5A 1UGIA 3S27A 1BRGA 1NJI4 1RN7A 1BNIA 1I2EA 2M7OA 1Q42A 2CFLA 3NXJA 4KFEA 1EEJA 3BU4A 3EQQB 1EQKA 5AIIA 4BTXA 5IG5A 1RSNA 3RGRA 5AIFA 2L1SA 2E2UA 5HGRA 1IVVA 4FMAA 1TFOA 4HM2B 4EC6A 5BU4A 4N6NB 1TUHA 2BMQB 3KIIA 4N6MA 4Q53A 1IQXA 2CFGA 1JV2B 3X40A 1BSAA 3OWYA 3Q3FA 5DREA 1YGEA 1YIT3 1M904 1RDSA 2QIYA 1FYSA 1LOYA 3ALAA 4IPBA 3URPA 5BVBA 1VQ63 1B2XA 4ORLA 1YGWA 4EXRA 1TRQA 2BNGA 1IDPA 3F7SA 3FSDA 3U97A 1A67A 1I2FA 1BNRA 1R4CA 1HZ1A 2W0QA 3PS8A 3CXC2 1ZGXA 1QAKA 2XEPA 4HM5B 1JB4A 4O02B 3CPW2 1WQLB 5TGNA 3UNLA 1FGOA 3G8ZA 3ROBA 3G0KA 1EA2A 6STDA 1Q824 1B2ZA 3EN8A 5ELUA 1RTUA 1IQYA 1JZOA 1FGRA 4BTYA 2KF3A 2XR8B 1RKYA 3CCS3 3HIGA 1K9M4 1E3RA 5LC7A 4J8TA 3F14A 3S67A 3AHWA 3JUMA 3DXOA 1I0XA 4GL6A 2P38A 4EBGA 2CW9A 1A2VA 1RHLA 1Q40A 1QMAA 5IF6A 2CX0A 1EG9B 2W9QA 1VQQA 1C54A 4N6TA 1MNLA 2C4BA 2IUKA 1CQSA 2CIUA 4BL3A 1N9EA 1PYLA 1B21A 1WMNA 2Y74A 2Z7AA 3DZLA 3LT9A 1I2GA 1JRQA 3M8CA 3WOFB 1N5PA 2F4YA 3F7XA 1VQ53 2YX9A 1NB5I 2IMJA 3MWZA 3D9RA 2CX1A 1HKXA 3GWRA 4K1VA 4RZMA 2W56B 2W2CA 1TJDA 3NQZA 3MG3A 3NV0B 4HYZA 2Z6BA 1S5AA 1G96A 4FCZA 1W7CA 2QA43 2O3OA 3RNTA 1O7NB 3LMLA 1UW1A 1DYUA 4MJDA 1RCKA 4R9KA 4EV2A 2UX0A 3S5CA 1Q7HA 4ILFA 5IERA 1YIJ3 3T8NA 4HZ9B 4J5GA 4HM8B 2PNCA 1NDOB 2K3DA 3AMOA 4WYKA 1LNIA 1W6CA 2KXGA 3LTCA 1GS3A 3F8HA 5FW5A 2LQVA 3GZRA 1BIRA 4MMZB 5LC6A 1GMQA 3U1WA 1VQ83 2HMOB 3DGNA 1OHPA 1O7HB 4QWTA 1GY6A 2Y73A 1PFPA 2HMJB 3LYGA 4N6UA 2KCDA 3X3ZA 1FW7A 1DETA 1RGGA 3CU3A 3VSYA 4WP5A 4FCMA 4N6LA 5IW9A 4MMXB 4HKVB 4CDLA 1JKGA 2D42A 5BXQA 1OF5A 2IYJA 1R4YA 3MG1A 1PY3A 2W9PA 4G1MB 2XRXB 3WOEB 3ER7A 1NWWA 2ML6A 1AV4A 2OCTA 3MG2A 1YJW3 3DMCA 1BVIA 1T2HA 3OWSA 2CFKA 3I553 5AYSC 3NUVA 4O3VA 1BNJA 2QEX3 1E97A 1IU7A 1ZS7A 4XBTA 1U5OA 3DGOA 3GAXA 3DGLA 4U13A 3PGBA 1X1YA 5RNTA 2PZVA 2W56A 1LQMB 1BRKA 1S723 3WDGB 1FA3A 4AEQA 4LGQA 1AY7A 2Z76A 3NQYA 2OTL3 1RGHA 3STDA 3ZG5A 5D82A 1US1A 1BRHA 3EN1B 1BSBA 4GSPA 1ISKA 3KE7A 1GY5A 1RGCA 3OW22 1GYBA 2CKFB 2CWVA 1STFI 1UUGB 1Q9EA 3DGMA 1W2B2 2CC3A 3NBBA 2CFWA 1N8QA 2LYXA 1OGXA 2Z77A 3D79A 1K41A 3PYJA 3I0YA 1J2BA 1ULIB 1T3BA 3BIRA 3HI7A 3E99A 3IMAB 3CC23 1VQO3 1B2MA 1LOVA 2OOVA 1SARA 3A76A 1CYUA 2KAAA 1D6ZA 1IV7A 1FGMA 1MWSA 4EV5A 3MSOA 1Q814 1VQL3 1FUWA 3NBJA 1IT8A 3WMDA 4J9AA 3PCSA 1LNHA 4L8PA 3BNDA 3FH1A 1WTHA 1AVLA 2R41A 3DGYA 1OH0A 2F56A 4WWUC 3OXAA 1ROVA 3D5GA 3FG4A 3VF1A 1IVUA 5JPUA 4KVHA 1BRNL 1LOXA 2V1LA 4HJLB 5KP1A 3CC43 5IEPA 3CMA3 1VQN3 2BMOB 4XDWA 3EE1A 4L8OA 4HOHA 1F8NA 1BRSA 2BMRB 3AHSA 3FG1A 1VQ43 1BNGA 3EBYA 1V74A 4O8SA 7GSPA 2ZA4A 4J5KA 8CHOA 1STDA 3K63A 2CH9A 3PZWA 4TX4A 3Q2PA 1GD4A 3IJEB 1N5HA 1I0VA 1NB3I 2RBIA 3GZXB 5D81A 5CXOA 1G02A 3BNEA 2C11A 5IENA 4BU4A 1O7GB 1BRIA 2HMMB 4I4KA 1W00A 2BO9B 2OQEC 1VQP3 3X3YA 1YI23 4BTWA 3HIIA 2XSHB 4HM3B 2IA7A 3A5EA 2B1XB 1B2UA 1JBRA 1RGLA 2OWPA 2RFRA 3F9SA 3H3HA 1YVBI 1OUNA 1RGKA 2GEXA 2WOFA 5M19A 1LRAA 1TU5A 3KCHA 4X2OA 1VQ93 1V58A 5AEWB 5G1LA 4XB5A 2GU3A 2FNQA 2W03A 3CPOA 1W2ZA 4JF8A 4K90B 1GMRA 2AAEA 5CF1A 3ZFZA 3FF0A 3GRDA 3LTAA 1QVF2 4X2HA 4LEHA 4WYKB 8RNTA 3K0ZA 3D3LA 1TRPA 5FGOA 4L7KA 4AKZA 4HM6B 3SOYA 1X1UA 3SX1A 4KZ1A 1MWTA 3ECFA 5EVHA 4KT3B 5AIGA 1CYVA 1JNQA 2Q07A 5KP3A 1YJN3 2OTJ3 1AQZA 5IEOA 3EJVA 1CH0A 2XGNA 1GMPA 2XF3A 3BNCA 5DRVA 1A2KA 2SARA 3CCV3 1Q864 2UUGC 3NV0A 5BIRA 3MPHA 3WODG 3X42A 1BNSA 2RNTA 1SIIA 2RGQA 1TTOA 3BB9A 7STDA 2H0GA 1BSDA 1GOVA 1BANA 1TP6A 2E2TA 1ZX2A 1AVKA 5KP4A 1IQ8A 1FUTA 2CHCA 4K61A 3DY5A 1SJWA 3S28A 5CF2A 1RMSA 1TFKA 2XH9A 2K0MA 1OCVA 1UCLA 3HZPA 2KF6A 1Z1SA 3RGAA 3KKGA 1W02A
chains in the Genus database with same CATH topology
5AI1A 2O9UX 4FR9A 5G2GA 1LXEA 5JBSA 2F86B 3S29A 3Q1CA 3H51A 3DUKA 1IVWA 3N54B 1VQK3 1Q7Y4 3KN4A 1N9JA 3CC73 1BUQA 3SVAA 3B8LA 4NHFA 3EC9A 3G6E3 1JJ22 2BHMA 3QK9A 3EBTA 5CLKA 1RJOA 3FLJA 3N9HA 3JVCA 1DVCA 4OUQA 4JRFA 4R1KA 1OGZA 3PCRA 5EEOA 4WFOA 3X3XA 4HVNA 2BT3A 3MHEA 3F8XA 1W5ZA 5AYRB 3QRDA 3FCSB 5IG4A 1W4NA 3RDEA 4LMIA 1NO3A 4H61A 5JPPA 3LZAA 3X41A 4N3VA 2L4VA 2ZDJA 3NM2A 3AMOB 3FZWA 1GD3A 5AEUB 1KSIA 1DVDA 1JKGB 1SIHA 1Y4KA 4IT7A 1D6YA 3K5TA 1DMNA 2E2VA 1KQS2 2C10A 2FGTA 1RRLA 1W6YA 3MKIA 1WNHA 4OK0A 1UI8A 1DMMA 3CCQ3 2CWUA 1O7MB 1W6GA 2YFJB 3SOAA 3NM7A 1KC84 4N6V0 1L5GB 3T8UA 1K28A 2P0XA 3FGYA 3EF8A 3J7Yd 1AR0A 1E3VA 1OF5B 3UB1A 3EHCA 4STDA 3B4PA 2GXFA 3LOYA 3LXUX 4IIAA 3UL6A 4HBRA 4NREA 1D6UA 3K9MC 2K54A 1ROAA 1EKMA 1M9GA 3JUOA 4N6OB 3B7CA 4R4KA 2CG0A 1O7WB 1GY7A 3F40A 3JUQA 2MF7A 2WGOA 4MEIA 4R9LA 4RNZA 4AKYA 1MOLA 1IT7A 1O7PB 5EQLA 3CCE3 4HZBB 1UUVB 4LSOA 1OACA 1OPYA 3LTBA 4HM7B 1YJ93 1ZO2A 2GEYA 3EB8A 2YFIB 1Q40B 3L0RA 1SPUA 5IG0A 4CCVA 4HM0B 2XGLA 3NX0A 2OOVC 4RNYA 1CEWI 2WOHA 3GZYB 1IK3A 3DM8A 4MMYB 1ASKA 4O2HA 3PXMA 1IVXA 1TIJA 5AIHA 3LTDA 3VGNA 2OQEA 2CFDA 3CME3 2HMLB 2JQ5A 3EX9A 3O8YA 2XFSA 1QJGA 3I563 4GB5A 4XDVA 2HMKB 3MYTA 1JB2A 3G713 1QAFA 2F99A 3SEDA 2P0MA 3SXXA 3T0UA 2R4IA 3CNMA 3UJMA 2RSXA 1U8CB 3K7CA 3CCU3 2RCDA 3FG3A 2HMNB 3CNXA 2GBWB 2P09A 2ML5A 1YHQ3 2IUJA 2KRTA 2CWTA 3JUPA 2YFLB 2STDA 4K1UA 2B24B 1M1K4 3V99A 4LZIA 4XM4A 3B4OA 5IG3A 5I97A 4XBYA 2I9WA 2D1WA 2GU1A 4FMDA 5STDA 4R80A 5A0OB 2XFTA 4PEJA 4XBXA 3V92A 1RRHA 3KZTA 1JB5A 1VZZA 1PU4A 4RBNA 3IPTA 1K734 3BLZA 1KWIA 1QALA 4FMBA 1C7HA 2A15A 4HM1B 2GBXB 2CG1A 4OVMA 3OWUA 1FGTA 1WMOA 3KSED 1JN5B 1SQWA 3HX8A 3UL5A 3WA2X 2XSOB 4HM4B 4KFFA 1LVNA 2MC8A 3OX9A 4EYCA 1W01A 1IV9A 1NU3A 4FCJA 3LH4A 5CK6A 1KD14 2FXTA 2CK3H 3BNBA 1N8R4 4H3UA 1OHOA 3NBRA 2WO0A 1A90A 2WGQA 3CCJ3 1FGQA 3LT8A 5D83A 4FMCA 1OHSA 2INXA 2ZL8A 1HU9A 3OV4A 4KFDA 1WMPA 3JUNA 3KFQC 3HK4A 3NHXA 3G4S3 1VQ73 3CCM3 3V98A 2W04A 3G16A 1M1XB 1UUWB 3TDGA 3WA3A 1QVG2 2JDIH 3GZBA 3CD63 3CCL3 3FF2A 4ZM8A 2W6JH 3SLUA 3CCR3 1ULJB 1T5YA 2F98A 3KSPA 1DMQA 2SBLA 2P05A 3FKAA 2QGUA 1UI7A 3N8BA 3Q90A 4WHAA 1K8A4 5ELJA 1JN5A 3S27A 1NJI4 1RN7A 2M7OA 1Q42A 2CFLA 3NXJA 4KFEA 1EQKA 3EQQB 5AIIA 4BTXA 5IG5A 3RGRA 5AIFA 2E2UA 5HGRA 1IVVA 4FMAA 1TFOA 4HM2B 4EC6A 4N6NB 1TUHA 2BMQB 3KIIA 4N6MA 4Q53A 1IQXA 2CFGA 1JV2B 3X40A 3OWYA 5DREA 1YIT3 1M904 1YGEA 2QIYA 3ALAA 4IPBA 1VQ63 5BVBA 4ORLA 4EXRA 1A67A 2BNGA 1IDPA 3F7SA 3FSDA 3U97A 1R4CA 3PS8A 2W0QA 3CXC2 2XEPA 1QAKA 4HM5B 1JB4A 4O02B 3CPW2 1WQLB 5TGNA 3UNLA 1FGOA 3G8ZA 3ROBA 3G0KA 1EA2A 6STDA 1Q824 3EN8A 5ELUA 1IQYA 1FGRA 4BTYA 1RKYA 2XR8B 3CCS3 3HIGA 1K9M4 1E3RA 5LC7A 4J8TA 3F14A 3S67A 3JUMA 3DXOA 4GL6A 2P38A 4EBGA 2CW9A 1A2VA 1Q40A 1QMAA 5IF6A 1EG9B 2W9QA 4N6TA 1MNLA 2IUKA 1CQSA 2CIUA 1VQM3 1N9EA 2Y74A 3DZLA 1WMNA 2Z7AA 3LT9A 3PCSA 3WOFB 1JRQA 3M8CA 1N5PA 3F7XA 1VQ53 2YX9A 1NB5I 2IMJA 3MWZA 3D9RA 1HKXA 3GWRA 4K1VA 4RZMA 2W56B 2W2CA 3NQZA 3MG3A 3NV0B 4HYZA 2Z6BA 1S5AA 1G96A 4FCZA 1W7CA 2QA43 2O3OA 1O7NB 3LMLA 1UW1A 1DYUA 4MJDA 4R9KA 4EV2A 2UX0A 3S5CA 1YIJ3 5IERA 3T8NA 4HZ9B 4HM8B 2PNCA 1NDOB 3AMOA 4WYKA 1W6CA 2KXGA 3LTCA 1GS3A 3F8HA 5FW5A 2LQVA 3GZRA 4MMZB 5LC6A 1VQ83 3U1WA 2HMOB 3DGNA 1OHPA 1O7HB 4QWTA 1GY6A 2Y73A 1PFPA 2HMJB 3LYGA 4N6UA 2KCDA 3X3ZA 3CU3A 3VSYA 4WP5A 4FCMA 4N6LA 5IW9A 4MMXB 4HKVB 4CDLA 1JKGA 2D42A 5BXQA 1OF5A 3MG1A 2W9PA 4G1MB 2XRXB 3WOEB 3ER7A 1NWWA 2ML6A 1AV4A 2OCTA 3MG2A 1YJW3 3DMCA 3OWSA 2CFKA 3I553 5AYSC 3NUVA 4O3VA 2QEX3 1E97A 1IU7A 4XBTA 1U5OA 3DGOA 3GAXA 3DGLA 4U13A 3PGBA 2PZVA 2W56A 1S723 3WDGB 1FA3A 4AEQA 4LGQA 3NQYA 2Z76A 2OTL3 3STDA 5D82A 1US1A 3EN1B 1ISKA 3KE7A 1GY5A 3OW22 1GYBA 2CKFB 2CWVA 1STFI 3DGMA 1W2B2 2CC3A 3NBBA 2CFWA 1N8QA 2LYXA 1OGXA 2Z77A 1K41A 3PYJA 3I0YA 1J2BA 1ULIB 3HI7A 3E99A 3IMAB 3CC23 1VQO3 2OOVA 1CYUA 3A76A 1D6ZA 1IV7A 1FGMA 4EV5A 3MSOA 1Q814 1VQL3 1FUWA 3NBJA 1IT8A 3WMDA 4J9AA 4L8PA 1LNHA 3BNDA 3FH1A 1WTHA 1AVLA 1OH0A 4WWUC 3OXAA 1ROVA 3FG4A 3VF1A 1IVUA 5JPUA 4KVHA 1LOXA 2V1LA 4HJLB 5KP1A 3CC43 5IEPA 3CMA3 1VQN3 2BMOB 4XDWA 3EE1A 4L8OA 1F8NA 2BMRB 3FG1A 1VQ43 3EBYA 1V74A 4O8SA 8CHOA 1STDA 3K63A 2CH9A 3PZWA 4TX4A 3Q2PA 1GD4A 3IJEB 1NB3I 1N5HA 3GZXB 5D81A 5CXOA 3BNEA 2C11A 5IENA 1O7GB 2HMMB 4I4KA 1W00A 2BO9B 2OQEC 1VQP3 3X3YA 1YI23 4BTWA 3HIIA 2XSHB 4HM3B 2IA7A 2B1XB 2OWPA 2RFRA 3F9SA 3H3HA 1YVBI 1OUNA 2GEXA 2WOFA 1TU5A 4X2OA 1VQ93 5AEWB 4XB5A 2GU3A 2FNQA 2W03A 3CPOA 1W2ZA 4JF8A 4K90B 5CF1A 3FF0A 3GRDA 3LTAA 1QVF2 4X2HA 4LEHA 4WYKB 3K0ZA 3D3LA 5FGOA 4L7KA 4AKZA 4HM6B 3SOYA 3SX1A 4KZ1A 5EVHA 3ECFA 5AIGA 1CYVA 1JNQA 2Q07A 5KP3A 1YJN3 2OTJ3 5IEOA 3EJVA 2XGNA 2XF3A 3BNCA 5DRVA 1A2KA 3CCV3 1Q864 3NV0A 3MPHA 3WODG 3X42A 3BB9A 1SIIA 2RGQA 7STDA 2E2TA 1TP6A 1ZX2A 1AVKA 5KP4A 1IQ8A 2CHCA 4K61A 3DY5A 1SJWA 3S28A 5CF2A 2XH9A 1TFKA 2K0MA 1OCVA 3HZPA 3RGAA 1Z1SA 3KKGA 1W02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWY A;  5AI1 A;  2HML B;  2JQ5 A;  1GYB A;  2CKF B;  3EX9 A;  2QIY A;  5DRE A;  5G2G A;  5BVB A;  1QJG A;  2F86 B;  4ORL A;  3H51 A;  3DUK A;  2BNG A;  1IDP A;  3F7S A;  2HMK B;  3FSD A;  4GB5 A;  4XDV A;  3MYT A;  1OGX A;  2Z77 A;  1K41 A;  3I0Y A;  1JB2 A;  1ULI B;  4HM5 B;  1BUQ A;  1JB4 A;  3E99 A;  2F99 A;  3B8L A;  3SED A;  3EC9 A;  1WQL B;  3A76 A;  2R4I A;  3CNM A;  5TGN A;  3UJM A;  3G8Z A;  3ROB A;  3G0K A;  1EA2 A;  3UNL A;  6STD A;  3EN8 A;  3MSO A;  3K7C A;  2RCD A;  3WMD A;  2HMN B;  3EBT A;  2XR8 B;  4J9A A;  3CNX A;  5CLK A;  2GBW B;  3FLJ A;  4L8P A;  1E3R A;  3FH1 A;  4J8T A;  4OUQ A;  4R1K A;  1OGZ A;  3F14 A;  1OH0 A;  3JUM A;  3DXO A;  3JUP A;  3MHE A;  3F8X A;  4HVN A;  2YFL B;  2STD A;  3OXA A;  4WWU C;  4K1U A;  2B24 B;  1Q40 A;  1QMA A;  4KVH A;  5IF6 A;  5IG4 A;  1EG9 B;  4XM4 A;  5JPU A;  4HJL B;  4LMI A;  3B4O A;  5IG3 A;  4XBY A;  1CQS A;  5KP1 A;  2I9W A;  3DZL A;  2Z7A A;  5STD A;  3LZA A;  5JPP A;  5IEP A;  3M8C A;  4N3V A;  2BMO B;  3NM2 A;  4PEJ A;  4XBX A;  3F7X A;  3FZW A;  4L8O A;  4XDW A;  3KZT A;  5AEU B;  1JKG B;  1JB5 A;  1VZZ A;  2IMJ A;  2BMR B;  3D9R A;  3IPT A;  1HKX A;  1DMN A;  3BLZ A;  3GWR A;  4K1V A;  3EBY A;  4RZM A;  2W2C A;  1C7H A;  2A15 A;  3MKI A;  1W6Y A;  4HM1 B;  2GBX B;  4OVM A;  1STD A;  8CHO A;  3MG3 A;  3NV0 B;  1DMM A;  3OWU A;  1S5A A;  1O7M B;  3GZX B;  5D81 A;  1JN5 B;  5CXO A;  2YFJ B;  3HX8 A;  3SOA A;  5IEN A;  1O7G B;  2HMM B;  4I4K A;  1O7N B;  2XSO B;  4HM4 B;  3T8U A;  4MJD A;  4R9K A;  1W00 A;  3FGY A;  3EF8 A;  2UX0 A;  3OX9 A;  3S5C A;  1AR0 A;  1E3V A;  1OF5 B;  1W01 A;  3EHC A;  5IER A;  1NU3 A;  2XSH B;  4FCJ A;  4HM3 B;  4HZ9 B;  4STD A;  3B4P A;  5CK6 A;  3T8N A;  2GXF A;  4HM8 B;  2B1X B;  4IIA A;  1NDO B;  2OWP A;  4H3U A;  4WYK A;  2RFR A;  1OHO A;  3F9S A;  3H3H A;  3NBR A;  1GS3 A;  3F8H A;  1OUN A;  3GZR A;  2GEX A;  5FW5 A;  2K54 A;  2HMO B;  4X2O A;  1OHP A;  1O7H B;  5AEW B;  3JUO A;  1GY6 A;  4XB5 A;  3B7C A;  2HMJ B;  5D83 A;  3CPO A;  3LYG A;  1O7W B;  1OHS A;  2INX A;  3OV4 A;  1GY7 A;  3JUN A;  3NHX A;  3HK4 A;  3F40 A;  3JUQ A;  5CF1 A;  3FF0 A;  3CU3 A;  3G16 A;  3GRD A;  1UUW B;  4WP5 A;  3VSY A;  4X2H A;  4LEH A;  4FCM A;  4WYK B;  3K0Z A;  3GZB A;  4R9L A;  4L7K A;  4HKV B;  4CDL A;  1JKG A;  3FF2 A;  1O7P B;  4HM6 B;  3SOY A;  4HZB B;  1OF5 A;  5EVH A;  1UUV B;  1ULJ B;  3ECF A;  1OPY A;  5BXQ A;  3MG1 A;  2F98 A;  5AIG A;  2XRX B;  3KSP A;  5KP3 A;  3ER7 A;  4HM7 B;  1NWW A;  1DMQ A;  1ZO2 A;  3FKA A;  5IEO A;  2GEY A;  2QGU A;  3EJV A;  3MG2 A;  3DMC A;  2YFI B;  3Q90 A;  1Q40 B;  5DRV A;  1JN5 A;  1A2K A;  3OWS A;  3NUV A;  3NV0 A;  1E97 A;  5IG0 A;  1Q42 A;  4XBT A;  3NXJ A;  1U5O A;  3BB9 A;  3EQQ B;  2RGQ A;  4U13 A;  4HM0 B;  5AII A;  2PZV A;  7STD A;  5IG5 A;  3GZY B;  3RGR A;  1TP6 A;  5AIF A;  1ZX2 A;  3DM8 A;  5KP4 A;  1ASK A;  5HGR A;  4LGQ A;  2Z76 A;  2CHC A;  1SJW A;  3STD A;  4HM2 B;  5AIH A;  5CF2 A;  1TUH A;  5D82 A;  2BMQ B;  3EN1 B;  3VGN A;  1OCV A;  1ISK A;  4Q53 A;  3HZP A;  1GY5 A;  3KE7 A;  1Z1S A;  3RGA A;  3KKG A;  1W02 A; 
#chains in the Genus database with same CATH topology
 2BIR A;  4LYL B;  2O9U X;  4FR9 A;  5AI1 A;  5G2G A;  1LXE A;  4I5Q A;  5JBS A;  2F86 B;  3S29 A;  3Q1C A;  3H51 A;  3DUK A;  3SYU A;  1IVW A;  2F5W A;  1BSE A;  3N54 B;  1VQK 3;  1UCJ A;  1Q7Y 4;  3KN4 A;  1N9J A;  3CC7 3;  1BUQ A;  3SVA A;  3B8L A;  4NHF A;  5G1K A;  3EC9 A;  3G6E 3;  1JJ2 2;  2BHM A;  3QK9 A;  2ZHX B;  3EBT A;  1UCI A;  4DKI A;  1MGW A;  1RJO A;  5CLK A;  3FLJ A;  3N9H A;  3JVC A;  1DVC A;  4OUQ A;  4JRF A;  4R1K A;  1OGZ A;  3PCR A;  5EEO A;  4WFO A;  3X3X A;  4HVN A;  2BT3 A;  3MHE A;  3F8X A;  1I70 A;  1W5Z A;  5AYR B;  1RN1 A;  3FCS B;  3QRD A;  5IG4 A;  1W4N A;  3RDE A;  4LMI A;  3GSP A;  1NO3 A;  2KF5 A;  4H61 A;  1MWR A;  1FZU A;  3LZA A;  5JPP A;  3X41 A;  4N3V A;  2L4V A;  2ZDJ A;  3NM2 A;  3AMO B;  3FZW A;  1GD3 A;  5AEU B;  1KSI A;  1DVD A;  1JKG B;  1SIH A;  1Y4K A;  2UGI A;  4IT7 A;  1D6Y A;  1I3F A;  1NNV A;  2E2V A;  1BAO A;  1DMN A;  3K5T A;  5HOH A;  1KQS 2;  1EUI C;  2C10 A;  2FGT A;  1RRL A;  1W6Y A;  3MKI A;  1WNH A;  4OK0 A;  1UI8 A;  1DMM A;  3CCQ 3;  2CWU A;  1O7M B;  1W6G A;  1YVS A;  4GHO A;  2YFJ B;  3SOA A;  3NM7 A;  1KC8 4;  4N6V 0;  1L5G B;  3T8U A;  1K28 A;  2P0X A;  3FGY A;  3EF8 A;  5GSP A;  1BNF A;  3J7Y d;  1AR0 A;  1E3V A;  1OF5 B;  3UB1 A;  3EHC A;  4STD A;  3B4P A;  3WHO A;  1V57 A;  2GXF A;  2H0I A;  3LOY A;  3LXU X;  4IIA A;  3UL6 A;  4HBR A;  4NRE A;  1D6U A;  3WR2 A;  3K9M C;  2K54 A;  1ROA A;  4NPB A;  1EKM A;  1UDI I;  1M9G A;  3JUO A;  6RNT A;  1B27 A;  4N6O B;  3B7C A;  4R4K A;  6GSP A;  2CG0 A;  1RGA A;  1O7W B;  1T2I A;  1GY7 A;  3F40 A;  3JUQ A;  4EW5 A;  1RNT A;  2MF7 A;  2WGO A;  4MEI A;  5M1A A;  4R9L A;  4RNZ A;  4AKY A;  1DE3 A;  1MOL A;  1IT7 A;  1O7P B;  5EQL A;  3CCE 3;  1MWU A;  4HZB B;  1JBT A;  1UUV B;  3DH2 A;  4LSO A;  1OAC A;  1OPY A;  1MGR A;  1VQM 3;  3LTB A;  4HM7 B;  1YJ9 3;  1RN4 A;  1ZO2 A;  2GEY A;  3EB8 A;  2YFI B;  1Q40 B;  3L0R A;  1SPU A;  5IG0 A;  1GOY A;  4CCV A;  4HM0 B;  2XGL A;  3NX0 A;  2OOV C;  4RNY A;  1CEW I;  2WOH A;  3GZY B;  1BRJ A;  1IK3 A;  3DM8 A;  1JZD A;  2F5M A;  1ASK A;  4MMY B;  4O2H A;  3PXM A;  4CPK A;  1IVX A;  1TIJ A;  5AIH A;  3LTD A;  3VGN A;  2OQE A;  1RNB A;  5M18 A;  4BL2 A;  2CFD A;  3CME 3;  1RGE A;  1GOU A;  3ZG0 A;  2HML B;  2JQ5 A;  3EX9 A;  3O8Y A;  1A2P A;  2XFS A;  1QJG A;  3I56 3;  4GB5 A;  4XDV A;  2HMK B;  3MYT A;  1RLS A;  1YNV X;  1BUJ A;  1JB2 A;  1I8V A;  3G71 3;  1QAF A;  1JBS A;  2F99 A;  3SED A;  2P0M A;  3SXX A;  3T0U A;  2R4I A;  3CNM A;  3UJM A;  2RSX A;  4CJN A;  1U8C B;  3K7C A;  2AAD A;  2RCD A;  1RGF A;  3AGO A;  3FG3 A;  2HMN B;  3CCU 3;  3CNX A;  1BOX A;  2GBW B;  2ML5 A;  2P09 A;  1YHQ 3;  1I3I A;  1RCL A;  1UGH I;  2CWT A;  2KRT A;  3JUP A;  2IUJ A;  2YFL B;  2STD A;  4K1U A;  2B24 B;  1M1K 4;  3V99 A;  3HOH A;  4LZI A;  4XM4 A;  3B4O A;  5IG3 A;  5I97 A;  4XBY A;  2I9W A;  4RNT A;  2D1W A;  2GU1 A;  4FMD A;  5STD A;  4R80 A;  5A0O B;  2XFT A;  4PEJ A;  4XBX A;  1BSC A;  1X1X A;  2H0H A;  1RRH A;  1X1W A;  3KZT A;  3V92 A;  3AGN A;  1JB5 A;  1VZZ A;  1PU4 A;  4RBN A;  7RNT A;  1B20 A;  3IPT A;  1K73 4;  3BLZ A;  1KWI A;  1QAL A;  3D4A A;  4FMB A;  1C7H A;  1G0T A;  2A15 A;  2GSP A;  4HM1 B;  2GBX B;  2CG1 A;  4OVM A;  3OWU A;  1FGT A;  1WMO A;  2HOH A;  3KSE D;  1JN5 B;  1LQG C;  1SQW A;  3HX8 A;  1FUS A;  3UL5 A;  4BIR A;  1BNE A;  3WA2 X;  2XSO B;  4HM4 B;  4KFF A;  1LVN A;  2MC8 A;  3OX9 A;  4EYC A;  1W01 A;  1IYY A;  1IV9 A;  1NU3 A;  4FCJ A;  3LH4 A;  5CK6 A;  1KD1 4;  2BU4 A;  2FXT A;  2J8X B;  2CK3 H;  1B2S A;  3BNB A;  1GSP A;  1N8R 4;  4H3U A;  1B3S A;  1OHO A;  2IY2 A;  2KF4 A;  3NBR A;  2WO0 A;  1A90 A;  2WGQ A;  3CCJ 3;  1FGQ A;  1LOW A;  3LT8 A;  4HAA A;  5D83 A;  4FMC A;  9RNT A;  1OHS A;  2INX A;  1BU4 A;  2ZL8 A;  1HU9 A;  3OV4 A;  4KFD A;  1WMP A;  3JUN A;  3KFQ C;  3HK4 A;  3NHX A;  3G4S 3;  1VQ7 3;  3CCM 3;  3V98 A;  2W04 A;  3G16 A;  1M1X B;  1UUW B;  3D5I A;  3TDG A;  1UCK A;  3WA3 A;  1QVG 2;  2JDI H;  3GZB A;  3CD6 3;  3CCL 3;  3FF2 A;  4ZM8 A;  2W6J H;  3SLU A;  3CCR 3;  1ULJ B;  1BGS A;  1T5Y A;  2F98 A;  3KSP A;  1DMQ A;  2SBL A;  2P05 A;  3FKA A;  2QGU A;  1UI7 A;  3N8B A;  3Q90 A;  4WHA A;  1K8A 4;  1HYF A;  5ELJ A;  1JN5 A;  1UGI A;  3S27 A;  1BRG A;  1NJI 4;  1RN7 A;  1BNI A;  1I2E A;  2M7O A;  1Q42 A;  2CFL A;  3NXJ A;  4KFE A;  1EEJ A;  3BU4 A;  3EQQ B;  1EQK A;  5AII A;  4BTX A;  5IG5 A;  1RSN A;  3RGR A;  5AIF A;  2L1S A;  2E2U A;  5HGR A;  1IVV A;  4FMA A;  1TFO A;  4HM2 B;  4EC6 A;  5BU4 A;  4N6N B;  1TUH A;  2BMQ B;  3KII A;  4N6M A;  4Q53 A;  1IQX A;  2CFG A;  1JV2 B;  3X40 A;  1BSA A;  3OWY A;  3Q3F A;  5DRE A;  1YGE A;  1YIT 3;  1M90 4;  1RDS A;  2QIY A;  1FYS A;  1LOY A;  3ALA A;  4IPB A;  3URP A;  5BVB A;  1VQ6 3;  1B2X A;  4ORL A;  1YGW A;  4EXR A;  1TRQ A;  2BNG A;  1IDP A;  3F7S A;  3FSD A;  3U97 A;  1A67 A;  1I2F A;  1BNR A;  1R4C A;  1HZ1 A;  2W0Q A;  3PS8 A;  3CXC 2;  1ZGX A;  1QAK A;  2XEP A;  4HM5 B;  1JB4 A;  4O02 B;  3CPW 2;  1WQL B;  5TGN A;  3UNL A;  1FGO A;  3G8Z A;  3ROB A;  3G0K A;  1EA2 A;  6STD A;  1Q82 4;  1B2Z A;  3EN8 A;  5ELU A;  1RTU A;  1IQY A;  1JZO A;  1FGR A;  4BTY A;  2KF3 A;  2XR8 B;  1RKY A;  3CCS 3;  3HIG A;  1K9M 4;  1E3R A;  5LC7 A;  4J8T A;  3F14 A;  3S67 A;  3AHW A;  3JUM A;  3DXO A;  1I0X A;  4GL6 A;  2P38 A;  4EBG A;  2CW9 A;  1A2V A;  1RHL A;  1Q40 A;  1QMA A;  5IF6 A;  2CX0 A;  1EG9 B;  2W9Q A;  1VQQ A;  1C54 A;  4N6T A;  1MNL A;  2C4B A;  2IUK A;  1CQS A;  2CIU A;  4BL3 A;  1N9E A;  1PYL A;  1B21 A;  1WMN A;  2Y74 A;  2Z7A A;  3DZL A;  3LT9 A;  1I2G A;  1JRQ A;  3M8C A;  3WOF B;  1N5P A;  2F4Y A;  3F7X A;  1VQ5 3;  2YX9 A;  1NB5 I;  2IMJ A;  3MWZ A;  3D9R A;  2CX1 A;  1HKX A;  3GWR A;  4K1V A;  4RZM A;  2W56 B;  2W2C A;  1TJD A;  3NQZ A;  3MG3 A;  3NV0 B;  4HYZ A;  2Z6B A;  1S5A A;  1G96 A;  4FCZ A;  1W7C A;  2QA4 3;  2O3O A;  3RNT A;  1O7N B;  3LML A;  1UW1 A;  1DYU A;  4MJD A;  1RCK A;  4R9K A;  4EV2 A;  2UX0 A;  3S5C A;  1Q7H A;  4ILF A;  5IER A;  1YIJ 3;  3T8N A;  4HZ9 B;  4J5G A;  4HM8 B;  2PNC A;  1NDO B;  2K3D A;  3AMO A;  4WYK A;  1LNI A;  1W6C A;  2KXG A;  3LTC A;  1GS3 A;  3F8H A;  5FW5 A;  2LQV A;  3GZR A;  1BIR A;  4MMZ B;  5LC6 A;  1GMQ A;  3U1W A;  1VQ8 3;  2HMO B;  3DGN A;  1OHP A;  1O7H B;  4QWT A;  1GY6 A;  2Y73 A;  1PFP A;  2HMJ B;  3LYG A;  4N6U A;  2KCD A;  3X3Z A;  1FW7 A;  1DET A;  1RGG A;  3CU3 A;  3VSY A;  4WP5 A;  4FCM A;  4N6L A;  5IW9 A;  4MMX B;  4HKV B;  4CDL A;  1JKG A;  2D42 A;  5BXQ A;  1OF5 A;  2IYJ A;  1R4Y A;  3MG1 A;  1PY3 A;  2W9P A;  4G1M B;  2XRX B;  3WOE B;  3ER7 A;  1NWW A;  2ML6 A;  1AV4 A;  2OCT A;  3MG2 A;  1YJW 3;  3DMC A;  1BVI A;  1T2H A;  3OWS A;  2CFK A;  3I55 3;  5AYS C;  3NUV A;  4O3V A;  1BNJ A;  2QEX 3;  1E97 A;  1IU7 A;  1ZS7 A;  4XBT A;  1U5O A;  3DGO A;  3GAX A;  3DGL A;  4U13 A;  3PGB A;  1X1Y A;  5RNT A;  2PZV A;  2W56 A;  1LQM B;  1BRK A;  1S72 3;  3WDG B;  1FA3 A;  4AEQ A;  4LGQ A;  1AY7 A;  2Z76 A;  3NQY A;  2OTL 3;  1RGH A;  3STD A;  3ZG5 A;  5D82 A;  1US1 A;  1BRH A;  3EN1 B;  1BSB A;  4GSP A;  1ISK A;  3KE7 A;  1GY5 A;  1RGC A;  3OW2 2;  1GYB A;  2CKF B;  2CWV A;  1STF I;  1UUG B;  1Q9E A;  3DGM A;  1W2B 2;  2CC3 A;  3NBB A;  2CFW A;  1N8Q A;  2LYX A;  1OGX A;  2Z77 A;  3D79 A;  1K41 A;  3PYJ A;  3I0Y A;  1J2B A;  1ULI B;  1T3B A;  3BIR A;  3HI7 A;  3E99 A;  3IMA B;  3CC2 3;  1VQO 3;  1B2M A;  1LOV A;  2OOV A;  1SAR A;  3A76 A;  1CYU A;  2KAA A;  1D6Z A;  1IV7 A;  1FGM A;  1MWS A;  4EV5 A;  3MSO A;  1Q81 4;  1VQL 3;  1FUW A;  3NBJ A;  1IT8 A;  3WMD A;  4J9A A;  3PCS A;  1LNH A;  4L8P A;  3BND A;  3FH1 A;  1WTH A;  1AVL A;  2R41 A;  3DGY A;  1OH0 A;  2F56 A;  4WWU C;  3OXA A;  1ROV A;  3D5G A;  3FG4 A;  3VF1 A;  1IVU A;  5JPU A;  4KVH A;  1BRN L;  1LOX A;  2V1L A;  4HJL B;  5KP1 A;  3CC4 3;  5IEP A;  3CMA 3;  1VQN 3;  2BMO B;  4XDW A;  3EE1 A;  4L8O A;  4HOH A;  1F8N A;  1BRS A;  2BMR B;  3AHS A;  3FG1 A;  1VQ4 3;  1BNG A;  3EBY A;  1V74 A;  4O8S A;  7GSP A;  2ZA4 A;  4J5K A;  8CHO A;  1STD A;  3K63 A;  2CH9 A;  3PZW A;  4TX4 A;  3Q2P A;  1GD4 A;  3IJE B;  1N5H A;  1I0V A;  1NB3 I;  2RBI A;  3GZX B;  5D81 A;  5CXO A;  1G02 A;  3BNE A;  2C11 A;  5IEN A;  4BU4 A;  1O7G B;  1BRI A;  2HMM B;  4I4K A;  1W00 A;  2BO9 B;  2OQE C;  1VQP 3;  3X3Y A;  1YI2 3;  4BTW A;  3HII A;  2XSH B;  4HM3 B;  2IA7 A;  3A5E A;  2B1X B;  1B2U A;  1JBR A;  1RGL A;  2OWP A;  2RFR A;  3F9S A;  3H3H A;  1YVB I;  1OUN A;  1RGK A;  2GEX A;  2WOF A;  5M19 A;  1LRA A;  1TU5 A;  3KCH A;  4X2O A;  1VQ9 3;  1V58 A;  5AEW B;  5G1L A;  4XB5 A;  2GU3 A;  2FNQ A;  2W03 A;  3CPO A;  1W2Z A;  4JF8 A;  4K90 B;  1GMR A;  2AAE A;  5CF1 A;  3ZFZ A;  3FF0 A;  3GRD A;  3LTA A;  1QVF 2;  4X2H A;  4LEH A;  4WYK B;  8RNT A;  3K0Z A;  3D3L A;  1TRP A;  5FGO A;  4L7K A;  4AKZ A;  4HM6 B;  3SOY A;  1X1U A;  3SX1 A;  4KZ1 A;  1MWT A;  3ECF A;  5EVH A;  4KT3 B;  5AIG A;  1CYV A;  1JNQ A;  2Q07 A;  5KP3 A;  1YJN 3;  2OTJ 3;  1AQZ A;  5IEO A;  3EJV A;  1CH0 A;  2XGN A;  1GMP A;  2XF3 A;  3BNC A;  5DRV A;  1A2K A;  2SAR A;  3CCV 3;  1Q86 4;  2UUG C;  3NV0 A;  5BIR A;  3MPH A;  3WOD G;  3X42 A;  1BNS A;  2RNT A;  1SII A;  2RGQ A;  1TTO A;  3BB9 A;  7STD A;  2H0G A;  1BSD A;  1GOV A;  1BAN A;  1TP6 A;  2E2T A;  1ZX2 A;  1AVK A;  5KP4 A;  1IQ8 A;  1FUT A;  2CHC A;  4K61 A;  3DY5 A;  1SJW A;  3S28 A;  5CF2 A;  1RMS A;  1TFK A;  2XH9 A;  2K0M A;  1OCV A;  1UCL A;  3HZP A;  2KF6 A;  1Z1S A;  3RGA A;  3KKG A;  1W02 A; 
#chains in the Genus database with same CATH homology
 5AI1 A;  2O9U X;  4FR9 A;  5G2G A;  1LXE A;  5JBS A;  2F86 B;  3S29 A;  3Q1C A;  3H51 A;  3DUK A;  1IVW A;  3N54 B;  1VQK 3;  1Q7Y 4;  3KN4 A;  1N9J A;  3CC7 3;  1BUQ A;  3SVA A;  3B8L A;  4NHF A;  3EC9 A;  3G6E 3;  1JJ2 2;  2BHM A;  3QK9 A;  3EBT A;  5CLK A;  1RJO A;  3FLJ A;  3N9H A;  3JVC A;  1DVC A;  4OUQ A;  4JRF A;  4R1K A;  1OGZ A;  3PCR A;  5EEO A;  4WFO A;  3X3X A;  4HVN A;  2BT3 A;  3MHE A;  3F8X A;  1W5Z A;  5AYR B;  3QRD A;  3FCS B;  5IG4 A;  1W4N A;  3RDE A;  4LMI A;  1NO3 A;  4H61 A;  5JPP A;  3LZA A;  3X41 A;  4N3V A;  2L4V A;  2ZDJ A;  3NM2 A;  3AMO B;  3FZW A;  1GD3 A;  5AEU B;  1KSI A;  1DVD A;  1JKG B;  1SIH A;  1Y4K A;  4IT7 A;  1D6Y A;  3K5T A;  1DMN A;  2E2V A;  1KQS 2;  2C10 A;  2FGT A;  1RRL A;  1W6Y A;  3MKI A;  1WNH A;  4OK0 A;  1UI8 A;  1DMM A;  3CCQ 3;  2CWU A;  1O7M B;  1W6G A;  2YFJ B;  3SOA A;  3NM7 A;  1KC8 4;  4N6V 0;  1L5G B;  3T8U A;  1K28 A;  2P0X A;  3FGY A;  3EF8 A;  3J7Y d;  1AR0 A;  1E3V A;  1OF5 B;  3UB1 A;  3EHC A;  4STD A;  3B4P A;  2GXF A;  3LOY A;  3LXU X;  4IIA A;  3UL6 A;  4HBR A;  4NRE A;  1D6U A;  3K9M C;  2K54 A;  1ROA A;  1EKM A;  1M9G A;  3JUO A;  4N6O B;  3B7C A;  4R4K A;  2CG0 A;  1O7W B;  1GY7 A;  3F40 A;  3JUQ A;  2MF7 A;  2WGO A;  4MEI A;  4R9L A;  4RNZ A;  4AKY A;  1MOL A;  1IT7 A;  1O7P B;  5EQL A;  3CCE 3;  4HZB B;  1UUV B;  4LSO A;  1OAC A;  1OPY A;  3LTB A;  4HM7 B;  1YJ9 3;  1ZO2 A;  2GEY A;  3EB8 A;  2YFI B;  1Q40 B;  3L0R A;  1SPU A;  5IG0 A;  4CCV A;  4HM0 B;  2XGL A;  3NX0 A;  2OOV C;  4RNY A;  1CEW I;  2WOH A;  3GZY B;  1IK3 A;  3DM8 A;  4MMY B;  1ASK A;  4O2H A;  3PXM A;  1IVX A;  1TIJ A;  5AIH A;  3LTD A;  3VGN A;  2OQE A;  2CFD A;  3CME 3;  2HML B;  2JQ5 A;  3EX9 A;  3O8Y A;  2XFS A;  1QJG A;  3I56 3;  4GB5 A;  4XDV A;  2HMK B;  3MYT A;  1JB2 A;  3G71 3;  1QAF A;  2F99 A;  3SED A;  2P0M A;  3SXX A;  3T0U A;  2R4I A;  3CNM A;  3UJM A;  2RSX A;  1U8C B;  3K7C A;  3CCU 3;  2RCD A;  3FG3 A;  2HMN B;  3CNX A;  2GBW B;  2P09 A;  2ML5 A;  1YHQ 3;  2IUJ A;  2KRT A;  2CWT A;  3JUP A;  2YFL B;  2STD A;  4K1U A;  2B24 B;  1M1K 4;  3V99 A;  4LZI A;  4XM4 A;  3B4O A;  5IG3 A;  5I97 A;  4XBY A;  2I9W A;  2D1W A;  2GU1 A;  4FMD A;  5STD A;  4R80 A;  5A0O B;  2XFT A;  4PEJ A;  4XBX A;  3V92 A;  1RRH A;  3KZT A;  1JB5 A;  1VZZ A;  1PU4 A;  4RBN A;  3IPT A;  1K73 4;  3BLZ A;  1KWI A;  1QAL A;  4FMB A;  1C7H A;  2A15 A;  4HM1 B;  2GBX B;  2CG1 A;  4OVM A;  3OWU A;  1FGT A;  1WMO A;  3KSE D;  1JN5 B;  1SQW A;  3HX8 A;  3UL5 A;  3WA2 X;  2XSO B;  4HM4 B;  4KFF A;  1LVN A;  2MC8 A;  3OX9 A;  4EYC A;  1W01 A;  1IV9 A;  1NU3 A;  4FCJ A;  3LH4 A;  5CK6 A;  1KD1 4;  2FXT A;  2CK3 H;  3BNB A;  1N8R 4;  4H3U A;  1OHO A;  3NBR A;  2WO0 A;  1A90 A;  2WGQ A;  3CCJ 3;  1FGQ A;  3LT8 A;  5D83 A;  4FMC A;  1OHS A;  2INX A;  2ZL8 A;  1HU9 A;  3OV4 A;  4KFD A;  1WMP A;  3JUN A;  3KFQ C;  3HK4 A;  3NHX A;  3G4S 3;  1VQ7 3;  3CCM 3;  3V98 A;  2W04 A;  3G16 A;  1M1X B;  1UUW B;  3TDG A;  3WA3 A;  1QVG 2;  2JDI H;  3GZB A;  3CD6 3;  3CCL 3;  3FF2 A;  4ZM8 A;  2W6J H;  3SLU A;  3CCR 3;  1ULJ B;  1T5Y A;  2F98 A;  3KSP A;  1DMQ A;  2SBL A;  2P05 A;  3FKA A;  2QGU A;  1UI7 A;  3N8B A;  3Q90 A;  4WHA A;  1K8A 4;  5ELJ A;  1JN5 A;  3S27 A;  1NJI 4;  1RN7 A;  2M7O A;  1Q42 A;  2CFL A;  3NXJ A;  4KFE A;  1EQK A;  3EQQ B;  5AII A;  4BTX A;  5IG5 A;  3RGR A;  5AIF A;  2E2U A;  5HGR A;  1IVV A;  4FMA A;  1TFO A;  4HM2 B;  4EC6 A;  4N6N B;  1TUH A;  2BMQ B;  3KII A;  4N6M A;  4Q53 A;  1IQX A;  2CFG A;  1JV2 B;  3X40 A;  3OWY A;  5DRE A;  1YIT 3;  1M90 4;  1YGE A;  2QIY A;  3ALA A;  4IPB A;  1VQ6 3;  5BVB A;  4ORL A;  4EXR A;  1A67 A;  2BNG A;  1IDP A;  3F7S A;  3FSD A;  3U97 A;  1R4C A;  3PS8 A;  2W0Q A;  3CXC 2;  2XEP A;  1QAK A;  4HM5 B;  1JB4 A;  4O02 B;  3CPW 2;  1WQL B;  5TGN A;  3UNL A;  1FGO A;  3G8Z A;  3ROB A;  3G0K A;  1EA2 A;  6STD A;  1Q82 4;  3EN8 A;  5ELU A;  1IQY A;  1FGR A;  4BTY A;  1RKY A;  2XR8 B;  3CCS 3;  3HIG A;  1K9M 4;  1E3R A;  5LC7 A;  4J8T A;  3F14 A;  3S67 A;  3JUM A;  3DXO A;  4GL6 A;  2P38 A;  4EBG A;  2CW9 A;  1A2V A;  1Q40 A;  1QMA A;  5IF6 A;  1EG9 B;  2W9Q A;  4N6T A;  1MNL A;  2IUK A;  1CQS A;  2CIU A;  1VQM 3;  1N9E A;  2Y74 A;  3DZL A;  1WMN A;  2Z7A A;  3LT9 A;  3PCS A;  3WOF B;  1JRQ A;  3M8C A;  1N5P A;  3F7X A;  1VQ5 3;  2YX9 A;  1NB5 I;  2IMJ A;  3MWZ A;  3D9R A;  1HKX A;  3GWR A;  4K1V A;  4RZM A;  2W56 B;  2W2C A;  3NQZ A;  3MG3 A;  3NV0 B;  4HYZ A;  2Z6B A;  1S5A A;  1G96 A;  4FCZ A;  1W7C A;  2QA4 3;  2O3O A;  1O7N B;  3LML A;  1UW1 A;  1DYU A;  4MJD A;  4R9K A;  4EV2 A;  2UX0 A;  3S5C A;  1YIJ 3;  5IER A;  3T8N A;  4HZ9 B;  4HM8 B;  2PNC A;  1NDO B;  3AMO A;  4WYK A;  1W6C A;  2KXG A;  3LTC A;  1GS3 A;  3F8H A;  5FW5 A;  2LQV A;  3GZR A;  4MMZ B;  5LC6 A;  1VQ8 3;  3U1W A;  2HMO B;  3DGN A;  1OHP A;  1O7H B;  4QWT A;  1GY6 A;  2Y73 A;  1PFP A;  2HMJ B;  3LYG A;  4N6U A;  2KCD A;  3X3Z A;  3CU3 A;  3VSY A;  4WP5 A;  4FCM A;  4N6L A;  5IW9 A;  4MMX B;  4HKV B;  4CDL A;  1JKG A;  2D42 A;  5BXQ A;  1OF5 A;  3MG1 A;  2W9P A;  4G1M B;  2XRX B;  3WOE B;  3ER7 A;  1NWW A;  2ML6 A;  1AV4 A;  2OCT A;  3MG2 A;  1YJW 3;  3DMC A;  3OWS A;  2CFK A;  3I55 3;  5AYS C;  3NUV A;  4O3V A;  2QEX 3;  1E97 A;  1IU7 A;  4XBT A;  1U5O A;  3DGO A;  3GAX A;  3DGL A;  4U13 A;  3PGB A;  2PZV A;  2W56 A;  1S72 3;  3WDG B;  1FA3 A;  4AEQ A;  4LGQ A;  3NQY A;  2Z76 A;  2OTL 3;  3STD A;  5D82 A;  1US1 A;  3EN1 B;  1ISK A;  3KE7 A;  1GY5 A;  3OW2 2;  1GYB A;  2CKF B;  2CWV A;  1STF I;  3DGM A;  1W2B 2;  2CC3 A;  3NBB A;  2CFW A;  1N8Q A;  2LYX A;  1OGX A;  2Z77 A;  1K41 A;  3PYJ A;  3I0Y A;  1J2B A;  1ULI B;  3HI7 A;  3E99 A;  3IMA B;  3CC2 3;  1VQO 3;  2OOV A;  1CYU A;  3A76 A;  1D6Z A;  1IV7 A;  1FGM A;  4EV5 A;  3MSO A;  1Q81 4;  1VQL 3;  1FUW A;  3NBJ A;  1IT8 A;  3WMD A;  4J9A A;  4L8P A;  1LNH A;  3BND A;  3FH1 A;  1WTH A;  1AVL A;  1OH0 A;  4WWU C;  3OXA A;  1ROV A;  3FG4 A;  3VF1 A;  1IVU A;  5JPU A;  4KVH A;  1LOX A;  2V1L A;  4HJL B;  5KP1 A;  3CC4 3;  5IEP A;  3CMA 3;  1VQN 3;  2BMO B;  4XDW A;  3EE1 A;  4L8O A;  1F8N A;  2BMR B;  3FG1 A;  1VQ4 3;  3EBY A;  1V74 A;  4O8S A;  8CHO A;  1STD A;  3K63 A;  2CH9 A;  3PZW A;  4TX4 A;  3Q2P A;  1GD4 A;  3IJE B;  1NB3 I;  1N5H A;  3GZX B;  5D81 A;  5CXO A;  3BNE A;  2C11 A;  5IEN A;  1O7G B;  2HMM B;  4I4K A;  1W00 A;  2BO9 B;  2OQE C;  1VQP 3;  3X3Y A;  1YI2 3;  4BTW A;  3HII A;  2XSH B;  4HM3 B;  2IA7 A;  2B1X B;  2OWP A;  2RFR A;  3F9S A;  3H3H A;  1YVB I;  1OUN A;  2GEX A;  2WOF A;  1TU5 A;  4X2O A;  1VQ9 3;  5AEW B;  4XB5 A;  2GU3 A;  2FNQ A;  2W03 A;  3CPO A;  1W2Z A;  4JF8 A;  4K90 B;  5CF1 A;  3FF0 A;  3GRD A;  3LTA A;  1QVF 2;  4X2H A;  4LEH A;  4WYK B;  3K0Z A;  3D3L A;  5FGO A;  4L7K A;  4AKZ A;  4HM6 B;  3SOY A;  3SX1 A;  4KZ1 A;  5EVH A;  3ECF A;  5AIG A;  1CYV A;  1JNQ A;  2Q07 A;  5KP3 A;  1YJN 3;  2OTJ 3;  5IEO A;  3EJV A;  2XGN A;  2XF3 A;  3BNC A;  5DRV A;  1A2K A;  3CCV 3;  1Q86 4;  3NV0 A;  3MPH A;  3WOD G;  3X42 A;  3BB9 A;  1SII A;  2RGQ A;  7STD A;  2E2T A;  1TP6 A;  1ZX2 A;  1AVK A;  5KP4 A;  1IQ8 A;  2CHC A;  4K61 A;  3DY5 A;  1SJW A;  3S28 A;  5CF2 A;  2XH9 A;  1TFK A;  2K0M A;  1OCV A;  3HZP A;  3RGA A;  1Z1S A;  3KKG A;  1W02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...