2F4YA

Barnase cross-linked with glutaraldehyde
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Hydrolase
total genus 36
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f4yA00
3AGNA 1BNFA 3AGOA 2F56A 1X1WA 1PYLA 1R4YA 1G02A 7GSPA 1RGAA 1BANA 1BNIA 1BSCA 1I2GA 1TRQA 2BU4A 4HAAA 1BGSA 1RSNA 1X1XA 1MGWA 1RGGA 4HOHA 1SARA 1HZ1A 1AY7A 1FZUA 1I0VA 1GOUA 3SYUA 2AADA 1RGCA 1TRPA 1BRSA 1LOYA 3URPA 3Q3FA 1BRIA 2HOHA 2KF6A 3RNTA 3BU4A 1FUSA 8RNTA 1JBTA 1BRGA 1BVIA 1BRHA 1I0XA 1YVSA 1UCKA 3GSPA 3A5EA 1I2EA 1AQZA 1PY3A 1RGHA 1GMQA 1RGLA 3WR2A 4GSPA 1X1UA 1RN1A 1TTOA 1FW7A 1LRAA 1RGFA 1GOYA 2C4BA 3DH2A 6RNTA 1BAOA 1BRKA 3HOHA 5HOHA 1T2HA 1ZGXA 1GOVA 2F5MA 1B3SA 3WHOA 1I3IA 1RTUA 1LOVA 1UCIA 5RNTA 3D4AA 4BU4A 1BOXA 1BSEA 2KAAA 1DETA 1I70A 2ZA4A 3D5GA 4J5KA 1GMPA 4RNTA 2KF4A 1B20A 9RNTA 1BSDA 1BU4A 1LNIA 5BIRA 1BNGA 3KCHA 1BUJA 1BSBA 1I8VA 1RGKA 1RNTA 4BIRA 1B21A 1FUTA 2GSPA 1B2MA 3AHSA 5BU4A 1Q9EA 1RHLA 1B2UA 2F5WA 3D5IA 1BNEA 3BIRA 1JBRA 1C54A 2RNTA 1BNSA 1RNBA 1B2ZA 1T2IA 1GSPA 4J5GA 2F4YA 1BNRA 1JBSA 1FYSA 1A2PA 1RCKA 1I3FA 1RLSA 1I2FA 1UCLA 1BRJA 1YNVX 3AHWA 1BIRA 1YGWA 1UCJA 1B2SA 1MGRA 6GSPA 1IYYA 1GMRA 1RCLA 5GSPA 1B27A 1RDSA 2KF3A 2KF5A 1BSAA 1HYFA 2AAEA 2RBIA 1CH0A 1RMSA 4GHOA 7RNTA 3DGYA 1RGEA 1X1YA 1RN4A 1DE3A 1B2XA 1BRNL 2SARA 1LOWA 1BNJA 2BIRA
chains in the Genus database with same CATH superfamily
1Z1SA 3AGNA 3E99A 3F7SA 2F56A 1X1WA 2JQ5A 3X3YA 1PYLA 3T8NA 3VSYA 1PU4A 3GZYB 5LC6A 3K63A 1YJ93 1W02A 2BMOB 1RGAA 1BSCA 1BNIA 2FGTA 3DGMA 3V92A 1BGSA 1RSNA 1MGWA 5FGOA 4HOHA 4EBGA 3JUPA 1SARA 3CD63 3AMOB 3CME3 1AY7A 1M9GA 2CFGA 3GWRA 3GRDA 2HMKB 2AADA 2XF3A 3BNEA 3N8BA 1MOLA 2YFLB 1BRSA 3TDGA 1W01A 3K7CA 4NHFA 1VQM3 1Q814 1BRIA 2R41A 2KF6A 4IIAA 1JB5A 3K9MC 3BU4A 1V74A 2IMJA 3MPHA 1VQ53 1DMNA 3DM8A 1A90A 4L7KA 1WMNA 1F8NA 3GSPA 1NU3A 1QALA 3A5EA 2XH9A 1GY6A 4H61A 4KZ1A 3WMDA 1OGZA 4N6OB 5EQLA 4BL3A 4GSPA 1D6YA 5CK6A 1E97A 4X2OA 4EC6A 3OW22 1K28A 3F8XA 1GOYA 1N8R4 3BLZA 3BNDA 3WDGB 1BRKA 1M1K4 3AMOA 4FMBA 5G1LA 2SBLA 3F40A 1W2B2 2CC3A 3ECFA 4R4KA 1B3SA 3GZRA 2YFJB 3NQYA 2OOVA 6STDA 4HVNA 4K1VA 2CFDA 3D4AA 4OK0A 1SQWA 4BU4A 3FH1A 4OVMA 5IF6A 2OTJ3 4N6UA 3MKIA 3RGRA 3G4S3 1ZO2A 2IY2A 1Q40B 2F98A 1JZDA 2ZA4A 1TU5A 3NBJA 2Z76A 1VQQA 2CK3H 3LT9A 3NX0A 3EN8A 5AIGA 2STDA 1B20A 3CCL3 1W6YA 3S27A 4EXRA 1UI7A 3PCSA 1UGHI 4KT3B 3CCV3 2BHMA 2HMLB 3WOEB 2WGQA 1FGRA 1RNTA 2KXGA 1FUTA 4G1MB 1VQN3 1W2ZA 5CXOA 1HU9A 1B2MA 1RJOA 1EA2A 4JRFA 2Q07A 1QVG2 1ROAA 1Q42A 1RN7A 3CNXA 1B2UA 1FGMA 2F5WA 2WGOA 3D5IA 3FKAA 3BIRA 5STDA 1N9JA 1TFOA 2QA43 1BNSA 4WWUC 3CCE3 1Q7Y4 2P38A 1B2ZA 1Q7HA 1RRLA 1GSPA 2OOVC 1EG9B 2RGQA 1FYSA 1UCLA 3DY5A 2XSOB 1BRJA 3LTCA 1ASKA 3AHWA 2R4IA 1YGWA 3S5CA 3CCS3 1JJ22 1NNVA 2P0XA 2XFTA 1IK3A 3O8YA 3G6E3 6GSPA 2F99A 1K8A4 1K734 1IYYA 4J8TA 1RCLA 5GSPA 1B27A 1JB2A 3EX9A 3MSOA 5CF1A 7STDA 1VQL3 3EC9A 1RDSA 3B4PA 3EB8A 3KE7A 3MHEA 5M19A 1BSAA 4RNZA 4DKIA 3F14A 3HI7A 2C10A 4CCVA 1RMSA 4GHOA 1M1XB 4XBYA 3CXC2 1U5OA 1RGEA 1EQKA 3BNCA 5JBSA 4O2HA 3ALAA 3PYJA 4MJDA 2RSXA 4OUQA 4N6MA 5IW9A 2BIRA 1U8CB 1OHPA 3G16A 2CHCA 2CFKA 4IT7A 1QMAA 3KZTA 2XGLA 3HIGA 3LZAA 1LOXA 3IPTA 4HYZA 5AIIA 3UNLA 5BVBA 7GSPA 1JB4A 1IT8A 3NV0B 5LC7A 4XB5A 1S723 1NB5I 1TRQA 2BU4A 2CIUA 1SIIA 2WO0A 4XDWA 3KFQC 5DRVA 2XGNA 2Z6BA 1YJW3 3B7CA 2IA7A 2IYJA 2O9UX 3DMCA 1A67A 2E2VA 5CF2A 3PZWA 1UI8A 1GOUA 4WHAA 3BB9A 3MYTA 5G2GA 5EEOA 1LOYA 2CWVA 3KKGA 4N6TA 1T3BA 4HBRA 1O7NB 2GU3A 2HOHA 3RNTA 3Q2PA 1CEWI 1AR0A 1FUSA 3CCM3 1BVIA 1ZS7A 1BRHA 1STFI 4FMAA 4TX4A 1RGHA 4O8SA 1MWSA 3X3XA 1N9EA 1GMQA 3NV0A 1IQ8A 1HKXA 3CPOA 2BNGA 1LXEA 1TTOA 3OWSA 1LRAA 3UL5A 3X42A 1FGQA 2C4BA 1KD14 1SJWA 5IG0A 2CH9A 1WMPA 1VQ93 1IV7A 1JNQA 2BMRB 1STDA 3FG1A 3HOHA 1O7PB 4CDLA 1FA3A 2BT3A 3NBBA 3T8UA 2F5MA 2W9QA 3H51A 2OCTA 2INXA 1UCIA 1QAFA 3JVCA 1BOXA 3F9SA 1CYUA 1BSEA 3Q1CA 2W56B 4FCJA 3EN1B 3HX8A 4HM4B 1MWRA 5M1AA 3LYGA 4X2HA 5JPUA 1DETA 3PCRA 3NM2A 4XM4A 4RNTA 1IVUA 1DVCA 1GMPA 1IT7A 2MF7A 1PFPA 2PZVA 4FCMA 2FNQA 1LNIA 1WTHA 3SXXA 5G1KA 2HMNB 3CCR3 1BSBA 1I8VA 1UDII 1RGKA 1WNHA 3NUVA 4NREA 1IQXA 2IUKA 2JDIH 4LGQA 2XEPA 2CX0A 3AHSA 4GL6A 4LYLB 1E3VA 3GZBA 4O3VA 5IG3A 2UX0A 1UW1A 5BU4A 1Q9EA 1TUHA 3FCSB 1IQYA 1BNEA 1E3RA 3JUQA 2IUJA 4HM6B 3FG4A 3N54B 3LT8A 2RNTA 2MC8A 3ER7A 1RNBA 3EQQB 1Q864 2Y74A 5D81A 4R9LA 2F4YA 2W56A 3EHCA 5KP3A 1BNRA 1JBSA 1WMOA 1RLSA 3V98A 1VQP3 1DVDA 3RGAA 3DZLA 1BIRA 3OWUA 1DMMA 1ULJB 1UCJA 2P0MA 3OXAA 4HM2B 1QAKA 2XRXB 2J8XB 4FR9A 3DGOA 3MG2A 4FCZA 2BMQB 2C11A 3DUKA 4R9KA 4MMYB 4HJLB 4JF8A 1D6ZA 2KF3A 4BTWA 5A0OB 2KF5A 5KP4A 1JV2B 2V1LA 1CYVA 4XBTA 1BUQA 4CPKA 1Y4KA 5IERA 2RBIA 3CC23 3LOYA 4AEQA 3I563 2ML6A 3IMAB 1X1YA 2LYXA 1KWIA 1GYBA 3FF0A 1B2XA 2F86B 2SARA 3LXUX 4N6V0 3AGOA 4RZMA 1US1A 2ML5A 4MMZB 2W6JH 3V99A 3QK9A 3LTAA 4IPBA 1C7HA 2YFIB 4U13A 3SEDA 3FZWA 1DYUA 4HAAA 1X1XA 4NPBA 3U97A 1VQK3 1RGGA 1JZOA 3N9HA 4KFDA 1LQGC 4J9AA 2E2TA 1W00A 4LEHA 4HKVB 1FZUA 3LMLA 4RNYA 3ZG5A 1OACA 4STDA 4WYKB 1N5HA 3SYUA 1NB3I 2K0MA 1FUWA 3NQZA 1TRPA 3NXJA 3ZFZA 3GAXA 1OHSA 3URPA 3D9RA 1UGIA 4BL2A 1EUIC 3HZPA 4BTYA 2D42A 3UB1A 4WFOA 1YHQ3 1J2BA 8RNTA 4EYCA 3SOYA 3CMA3 1IU7A 3NHXA 2E2UA 1YVSA 1I0XA 4I5QA 1UCKA 4XBXA 1I2EA 3IJEB 3JUOA 1AQZA 1EEJA 1PY3A 2OQEC 2UGIA 1RGLA 4N6LA 4N6NB 3WR2A 4ORLA 3KSPA 1T5YA 4K90B 5IG4A 1O7MB 3CC73 3DH2A 1GD4A 1FGTA 2KRTA 3K5TA 5DREA 3JUMA 3D79A 4HM8B 5AI1A 3EF8A 4EV2A 1ZGXA 2D1WA 1GOVA 4HM7B 1W6CA 4K1UA 1TFKA 5AIFA 3WHOA 1I3IA 4QWTA 4WYKA 1LOVA 4WP5A 1QJGA 1YI23 2Y73A 2CX1A 2H0IA 5I97A 3D5GA 1I70A 4AKZA 2KF4A 3U1WA 9RNTA 1JN5B 1BSDA 3HK4A 3ROBA 1TP6A 1O7WB 3NM7A 4HM1B 3WOFB 2Z77A 5AIHA 3VF1A 2B1XB 3WODG 1BUJA 1ULIB 1MWTA 1B21A 2YX9A 2GSPA 2HMMB 2RCDA 2CW9A 1VQO3 3RDEA 3X41A 1GY5A 1TIJA 1LQMB 1V58A 1KSIA 1N5PA 1JBRA 1C54A 1DMQA 3UL6A 1V57A 2GXFA 3LTBA 1EKMA 1S5AA 3MG1A 1T2IA 2QGUA 4J5GA 5IEOA 3G8ZA 1ISKA 3D3LA 1I3FA 1O7HB 2ZDJA 2O3OA 2CFWA 5TGNA 2FXTA 1JN5A 1MGRA 3GZXB 5HGRA 3B4OA 3JUNA 4HZ9B 5AEUB 5IENA 1W4NA 1YIJ3 2GEXA 3HIIA 3Q90A 1K41A 1NDOB 3OWYA 4KFFA 1GMRA 1A2KA 1NWWA 2WOHA 3I0YA 4RBNA 3WA2X 3X3ZA 1OF5B 1GY7A 1HYFA 2ZHXB 1IVWA 1WQLB 2XSHB 8CHOA 5ELUA 2GBXB 2XR8B 2UUGC 2HMOB 1OUNA 3UJMA 2W03A 3DGYA 3G0KA 3J7Yd 1VQ63 3EE1A 1AVKA 2M7OA 1RN4A 2P09A 1AVLA 2K3DA 3FF2A 2L1SA 5HOHA 1LOWA 3CCQ3 1A2VA 1BNFA 3KIIA 4I4KA 1OH0A 1LNHA 3LTDA 3B8LA 2XFSA 4Q53A 1R4YA 1UUVB 3FSDA 2CG1A 1G02A 2GBWB 1YIT3 2HMJB 5M18A 4HM3B 3M8CA 3DGNA 1BANA 1I2GA 1SPUA 2OWPA 1MNLA 3K0ZA 3G713 1LVNA 2B24B 3DXOA 1HZ1A 2CWTA 3FLJA 3PXMA 1IV9A 3X40A 4N3VA 2W9PA 1Q824 2CG0A 3FGYA 1I0VA 4MMXB 4EW5A 4CJNA 4R80A 1RGCA 1OF5A 2W0QA 5EVHA 1OCVA 3Q3FA 3F7XA 1YVBI 2W04A 5ELJA 1D6UA 4HM0B 2GU1A 4PEJA 3S28A 1NJI4 1FGOA 1G96A 2OQEA 1BRGA 3CNMA 1JBTA 3L0RA 1W6GA 5JPPA 3CCU3 1JKGB 3T0UA 2BO9B 3WA3A 1YJN3 1KC84 4K61A 2KCDA 2GEYA 1TJDA 1X1UA 3CU3A 1RN1A 1OGXA 4AKYA 5BXQA 1K9M4 1M904 1FW7A 1RGFA 3KN4A 4KVHA 1ROVA 2Z7AA 1BAOA 4L8OA 4XDVA 6RNTA 3CPW2 2H0HA 1QVF2 3I553 5KP1A 1T2HA 1IVVA 1MWUA 3KSED 3OX9A 1RTUA 2ZL8A 3F8HA 4L8PA 5RNTA 4ILFA 3A76A 3FG3A 3OV4A 1GS3A 1OHOA 1VZZA 2KAAA 5IEPA 5D83A 4FMCA 2A15A 3SLUA 1Q40A 5FW5A 1UUWB 2K54A 3S29A 4J5KA 4KFEA 1BU4A 3SVAA 2CKFB 4EV5A 1JKGA 4FMDA 5BIRA 1BNGA 3KCHA 3H3HA 3EBTA 1W7CA 4BIRA 2L4VA 4LMIA 3CC43 1GD3A 1N8QA 1VQ43 3ZG0A 1KQS2 1RHLA 3S67A 2QEX3 1AV4A 4LZIA 3PS8A 3MWZA 1L5GB 5D82A 4BTXA 3DGLA 1YGEA 2PNCA 2W2CA 1IVXA 3CCJ3 5IG5A 1A2PA 1RCKA 3STDA 1I2FA 5AEWB 1VQ73 4O02B 1YNVX 1OPYA 2RFRA 1W5ZA 2WOFA 4LSOA 2P05A 1B2SA 1UUGB 3NBRA 2OTL3 3EBYA 3EJVA 3PGBA 1CQSA 1IDPA 3SOAA 1O7GB 2H0GA 4GB5A 3SX1A 1VQ83 3QRDA 2I9WA 4H3UA 4MEIA 4R1KA 3BNBA 4HZBB 2AAEA 1G0TA 4HM5B 5AYRB 2LQVA 1RRHA 1JRQA 2CFLA 4ZM8A 1SIHA 1CH0A 1NO3A 3LH4A 2QIYA 5CLKA 5AYSC 1R4CA 3MG3A 7RNTA 1RKYA 3VGNA 1DE3A 1BRNL 1ZX2A 2CWUA 1BNJA
chains in the Genus database with same CATH topology
3AGNA 1BNFA 3AGOA 2F56A 1X1WA 1PYLA 1R4YA 1G02A 7GSPA 1RGAA 1BANA 1BNIA 1BSCA 1I2GA 1TRQA 2BU4A 4HAAA 1BGSA 1RSNA 1X1XA 1MGWA 1RGGA 4HOHA 1SARA 1HZ1A 1AY7A 1FZUA 1I0VA 1GOUA 3SYUA 2AADA 1RGCA 1TRPA 1BRSA 1LOYA 3URPA 3Q3FA 1BRIA 2HOHA 2KF6A 3RNTA 3BU4A 1FUSA 8RNTA 1JBTA 1BRGA 1BVIA 1BRHA 1I0XA 1YVSA 1UCKA 3GSPA 3A5EA 1I2EA 1AQZA 1PY3A 1RGHA 1GMQA 1RGLA 3WR2A 4GSPA 1X1UA 1RN1A 1TTOA 1FW7A 1LRAA 1RGFA 1GOYA 2C4BA 3DH2A 6RNTA 1BAOA 1BRKA 3HOHA 5HOHA 1T2HA 1ZGXA 1GOVA 2F5MA 1B3SA 3WHOA 1I3IA 1RTUA 1LOVA 1UCIA 5RNTA 3D4AA 4BU4A 1BOXA 1BSEA 2KAAA 1DETA 1I70A 2ZA4A 3D5GA 4J5KA 1GMPA 4RNTA 2KF4A 1B20A 9RNTA 1BSDA 1BU4A 1LNIA 5BIRA 1BNGA 3KCHA 1BUJA 1BSBA 1I8VA 1RGKA 1RNTA 4BIRA 1B21A 1FUTA 2GSPA 1B2MA 3AHSA 5BU4A 1Q9EA 1RHLA 1B2UA 2F5WA 3D5IA 1BNEA 3BIRA 1JBRA 1C54A 2RNTA 1BNSA 1RNBA 1B2ZA 1T2IA 1GSPA 4J5GA 2F4YA 1BNRA 1JBSA 1FYSA 1A2PA 1RCKA 1I3FA 1RLSA 1I2FA 1UCLA 1BRJA 1YNVX 3AHWA 1BIRA 1YGWA 1UCJA 1B2SA 1MGRA 6GSPA 1IYYA 1GMRA 1RCLA 5GSPA 1B27A 1RDSA 2KF3A 2KF5A 1BSAA 1HYFA 2AAEA 2RBIA 1CH0A 1RMSA 4GHOA 7RNTA 3DGYA 1RGEA 1X1YA 1RN4A 1DE3A 1B2XA 1BRNL 2SARA 1LOWA 1BNJA 2BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGN A;  1BNF A;  3AGO A;  2F56 A;  1X1W A;  1PYL A;  1R4Y A;  1G02 A;  7GSP A;  1RGA A;  1BAN A;  1BNI A;  1BSC A;  1I2G A;  1TRQ A;  2BU4 A;  4HAA A;  1BGS A;  1RSN A;  1X1X A;  1MGW A;  1RGG A;  4HOH A;  1SAR A;  1HZ1 A;  1AY7 A;  1FZU A;  1I0V A;  1GOU A;  3SYU A;  2AAD A;  1RGC A;  1TRP A;  1BRS A;  1LOY A;  3URP A;  3Q3F A;  1BRI A;  2HOH A;  2KF6 A;  3RNT A;  3BU4 A;  1FUS A;  8RNT A;  1JBT A;  1BRG A;  1BVI A;  1BRH A;  1I0X A;  1YVS A;  1UCK A;  3GSP A;  3A5E A;  1I2E A;  1AQZ A;  1PY3 A;  1RGH A;  1GMQ A;  1RGL A;  3WR2 A;  4GSP A;  1X1U A;  1RN1 A;  1TTO A;  1FW7 A;  1LRA A;  1RGF A;  1GOY A;  2C4B A;  3DH2 A;  6RNT A;  1BAO A;  1BRK A;  3HOH A;  5HOH A;  1T2H A;  1ZGX A;  1GOV A;  2F5M A;  1B3S A;  3WHO A;  1I3I A;  1RTU A;  1LOV A;  1UCI A;  5RNT A;  3D4A A;  4BU4 A;  1BOX A;  1BSE A;  2KAA A;  1DET A;  1I70 A;  2ZA4 A;  3D5G A;  4J5K A;  1GMP A;  4RNT A;  2KF4 A;  1B20 A;  9RNT A;  1BSD A;  1BU4 A;  1LNI A;  5BIR A;  1BNG A;  3KCH A;  1BUJ A;  1BSB A;  1I8V A;  1RGK A;  1RNT A;  4BIR A;  1B21 A;  1FUT A;  2GSP A;  1B2M A;  3AHS A;  5BU4 A;  1Q9E A;  1RHL A;  1B2U A;  2F5W A;  3D5I A;  1BNE A;  3BIR A;  1JBR A;  1C54 A;  2RNT A;  1BNS A;  1RNB A;  1B2Z A;  1T2I A;  1GSP A;  4J5G A;  2F4Y A;  1BNR A;  1JBS A;  1FYS A;  1A2P A;  1RCK A;  1I3F A;  1RLS A;  1I2F A;  1UCL A;  1BRJ A;  1YNV X;  3AHW A;  1BIR A;  1YGW A;  1UCJ A;  1B2S A;  1MGR A;  6GSP A;  1IYY A;  1GMR A;  1RCL A;  5GSP A;  1B27 A;  1RDS A;  2KF3 A;  2KF5 A;  1BSA A;  1HYF A;  2AAE A;  2RBI A;  1CH0 A;  1RMS A;  4GHO A;  7RNT A;  3DGY A;  1RGE A;  1X1Y A;  1RN4 A;  1DE3 A;  1B2X A;  1BRN L;  2SAR A;  1LOW A;  1BNJ A;  2BIR A; 
#chains in the Genus database with same CATH topology
 1Z1S A;  3AGN A;  3E99 A;  3F7S A;  2F56 A;  1X1W A;  2JQ5 A;  3X3Y A;  1PYL A;  3T8N A;  3VSY A;  1PU4 A;  3GZY B;  5LC6 A;  3K63 A;  1YJ9 3;  1W02 A;  2BMO B;  1RGA A;  1BSC A;  1BNI A;  2FGT A;  3DGM A;  3V92 A;  1BGS A;  1RSN A;  1MGW A;  5FGO A;  4HOH A;  4EBG A;  3JUP A;  1SAR A;  3CD6 3;  3AMO B;  3CME 3;  1AY7 A;  1M9G A;  2CFG A;  3GWR A;  3GRD A;  2HMK B;  2AAD A;  2XF3 A;  3BNE A;  3N8B A;  1MOL A;  2YFL B;  1BRS A;  3TDG A;  1W01 A;  3K7C A;  4NHF A;  1VQM 3;  1Q81 4;  1BRI A;  2R41 A;  2KF6 A;  4IIA A;  1JB5 A;  3K9M C;  3BU4 A;  1V74 A;  2IMJ A;  3MPH A;  1VQ5 3;  1DMN A;  3DM8 A;  1A90 A;  4L7K A;  1WMN A;  1F8N A;  3GSP A;  1NU3 A;  1QAL A;  3A5E A;  2XH9 A;  1GY6 A;  4H61 A;  4KZ1 A;  3WMD A;  1OGZ A;  4N6O B;  5EQL A;  4BL3 A;  4GSP A;  1D6Y A;  5CK6 A;  1E97 A;  4X2O A;  4EC6 A;  3OW2 2;  1K28 A;  3F8X A;  1GOY A;  1N8R 4;  3BLZ A;  3BND A;  3WDG B;  1BRK A;  1M1K 4;  3AMO A;  4FMB A;  5G1L A;  2SBL A;  3F40 A;  1W2B 2;  2CC3 A;  3ECF A;  4R4K A;  1B3S A;  3GZR A;  2YFJ B;  3NQY A;  2OOV A;  6STD A;  4HVN A;  4K1V A;  2CFD A;  3D4A A;  4OK0 A;  1SQW A;  4BU4 A;  3FH1 A;  4OVM A;  5IF6 A;  2OTJ 3;  4N6U A;  3MKI A;  3RGR A;  3G4S 3;  1ZO2 A;  2IY2 A;  1Q40 B;  2F98 A;  1JZD A;  2ZA4 A;  1TU5 A;  3NBJ A;  2Z76 A;  1VQQ A;  2CK3 H;  3LT9 A;  3NX0 A;  3EN8 A;  5AIG A;  2STD A;  1B20 A;  3CCL 3;  1W6Y A;  3S27 A;  4EXR A;  1UI7 A;  3PCS A;  1UGH I;  4KT3 B;  3CCV 3;  2BHM A;  2HML B;  3WOE B;  2WGQ A;  1FGR A;  1RNT A;  2KXG A;  1FUT A;  4G1M B;  1VQN 3;  1W2Z A;  5CXO A;  1HU9 A;  1B2M A;  1RJO A;  1EA2 A;  4JRF A;  2Q07 A;  1QVG 2;  1ROA A;  1Q42 A;  1RN7 A;  3CNX A;  1B2U A;  1FGM A;  2F5W A;  2WGO A;  3D5I A;  3FKA A;  3BIR A;  5STD A;  1N9J A;  1TFO A;  2QA4 3;  1BNS A;  4WWU C;  3CCE 3;  1Q7Y 4;  2P38 A;  1B2Z A;  1Q7H A;  1RRL A;  1GSP A;  2OOV C;  1EG9 B;  2RGQ A;  1FYS A;  1UCL A;  3DY5 A;  2XSO B;  1BRJ A;  3LTC A;  1ASK A;  3AHW A;  2R4I A;  1YGW A;  3S5C A;  3CCS 3;  1JJ2 2;  1NNV A;  2P0X A;  2XFT A;  1IK3 A;  3O8Y A;  3G6E 3;  6GSP A;  2F99 A;  1K8A 4;  1K73 4;  1IYY A;  4J8T A;  1RCL A;  5GSP A;  1B27 A;  1JB2 A;  3EX9 A;  3MSO A;  5CF1 A;  7STD A;  1VQL 3;  3EC9 A;  1RDS A;  3B4P A;  3EB8 A;  3KE7 A;  3MHE A;  5M19 A;  1BSA A;  4RNZ A;  4DKI A;  3F14 A;  3HI7 A;  2C10 A;  4CCV A;  1RMS A;  4GHO A;  1M1X B;  4XBY A;  3CXC 2;  1U5O A;  1RGE A;  1EQK A;  3BNC A;  5JBS A;  4O2H A;  3ALA A;  3PYJ A;  4MJD A;  2RSX A;  4OUQ A;  4N6M A;  5IW9 A;  2BIR A;  1U8C B;  1OHP A;  3G16 A;  2CHC A;  2CFK A;  4IT7 A;  1QMA A;  3KZT A;  2XGL A;  3HIG A;  3LZA A;  1LOX A;  3IPT A;  4HYZ A;  5AII A;  3UNL A;  5BVB A;  7GSP A;  1JB4 A;  1IT8 A;  3NV0 B;  5LC7 A;  4XB5 A;  1S72 3;  1NB5 I;  1TRQ A;  2BU4 A;  2CIU A;  1SII A;  2WO0 A;  4XDW A;  3KFQ C;  5DRV A;  2XGN A;  2Z6B A;  1YJW 3;  3B7C A;  2IA7 A;  2IYJ A;  2O9U X;  3DMC A;  1A67 A;  2E2V A;  5CF2 A;  3PZW A;  1UI8 A;  1GOU A;  4WHA A;  3BB9 A;  3MYT A;  5G2G A;  5EEO A;  1LOY A;  2CWV A;  3KKG A;  4N6T A;  1T3B A;  4HBR A;  1O7N B;  2GU3 A;  2HOH A;  3RNT A;  3Q2P A;  1CEW I;  1AR0 A;  1FUS A;  3CCM 3;  1BVI A;  1ZS7 A;  1BRH A;  1STF I;  4FMA A;  4TX4 A;  1RGH A;  4O8S A;  1MWS A;  3X3X A;  1N9E A;  1GMQ A;  3NV0 A;  1IQ8 A;  1HKX A;  3CPO A;  2BNG A;  1LXE A;  1TTO A;  3OWS A;  1LRA A;  3UL5 A;  3X42 A;  1FGQ A;  2C4B A;  1KD1 4;  1SJW A;  5IG0 A;  2CH9 A;  1WMP A;  1VQ9 3;  1IV7 A;  1JNQ A;  2BMR B;  1STD A;  3FG1 A;  3HOH A;  1O7P B;  4CDL A;  1FA3 A;  2BT3 A;  3NBB A;  3T8U A;  2F5M A;  2W9Q A;  3H51 A;  2OCT A;  2INX A;  1UCI A;  1QAF A;  3JVC A;  1BOX A;  3F9S A;  1CYU A;  1BSE A;  3Q1C A;  2W56 B;  4FCJ A;  3EN1 B;  3HX8 A;  4HM4 B;  1MWR A;  5M1A A;  3LYG A;  4X2H A;  5JPU A;  1DET A;  3PCR A;  3NM2 A;  4XM4 A;  4RNT A;  1IVU A;  1DVC A;  1GMP A;  1IT7 A;  2MF7 A;  1PFP A;  2PZV A;  4FCM A;  2FNQ A;  1LNI A;  1WTH A;  3SXX A;  5G1K A;  2HMN B;  3CCR 3;  1BSB A;  1I8V A;  1UDI I;  1RGK A;  1WNH A;  3NUV A;  4NRE A;  1IQX A;  2IUK A;  2JDI H;  4LGQ A;  2XEP A;  2CX0 A;  3AHS A;  4GL6 A;  4LYL B;  1E3V A;  3GZB A;  4O3V A;  5IG3 A;  2UX0 A;  1UW1 A;  5BU4 A;  1Q9E A;  1TUH A;  3FCS B;  1IQY A;  1BNE A;  1E3R A;  3JUQ A;  2IUJ A;  4HM6 B;  3FG4 A;  3N54 B;  3LT8 A;  2RNT A;  2MC8 A;  3ER7 A;  1RNB A;  3EQQ B;  1Q86 4;  2Y74 A;  5D81 A;  4R9L A;  2F4Y A;  2W56 A;  3EHC A;  5KP3 A;  1BNR A;  1JBS A;  1WMO A;  1RLS A;  3V98 A;  1VQP 3;  1DVD A;  3RGA A;  3DZL A;  1BIR A;  3OWU A;  1DMM A;  1ULJ B;  1UCJ A;  2P0M A;  3OXA A;  4HM2 B;  1QAK A;  2XRX B;  2J8X B;  4FR9 A;  3DGO A;  3MG2 A;  4FCZ A;  2BMQ B;  2C11 A;  3DUK A;  4R9K A;  4MMY B;  4HJL B;  4JF8 A;  1D6Z A;  2KF3 A;  4BTW A;  5A0O B;  2KF5 A;  5KP4 A;  1JV2 B;  2V1L A;  1CYV A;  4XBT A;  1BUQ A;  4CPK A;  1Y4K A;  5IER A;  2RBI A;  3CC2 3;  3LOY A;  4AEQ A;  3I56 3;  2ML6 A;  3IMA B;  1X1Y A;  2LYX A;  1KWI A;  1GYB A;  3FF0 A;  1B2X A;  2F86 B;  2SAR A;  3LXU X;  4N6V 0;  3AGO A;  4RZM A;  1US1 A;  2ML5 A;  4MMZ B;  2W6J H;  3V99 A;  3QK9 A;  3LTA A;  4IPB A;  1C7H A;  2YFI B;  4U13 A;  3SED A;  3FZW A;  1DYU A;  4HAA A;  1X1X A;  4NPB A;  3U97 A;  1VQK 3;  1RGG A;  1JZO A;  3N9H A;  4KFD A;  1LQG C;  4J9A A;  2E2T A;  1W00 A;  4LEH A;  4HKV B;  1FZU A;  3LML A;  4RNY A;  3ZG5 A;  1OAC A;  4STD A;  4WYK B;  1N5H A;  3SYU A;  1NB3 I;  2K0M A;  1FUW A;  3NQZ A;  1TRP A;  3NXJ A;  3ZFZ A;  3GAX A;  1OHS A;  3URP A;  3D9R A;  1UGI A;  4BL2 A;  1EUI C;  3HZP A;  4BTY A;  2D42 A;  3UB1 A;  4WFO A;  1YHQ 3;  1J2B A;  8RNT A;  4EYC A;  3SOY A;  3CMA 3;  1IU7 A;  3NHX A;  2E2U A;  1YVS A;  1I0X A;  4I5Q A;  1UCK A;  4XBX A;  1I2E A;  3IJE B;  3JUO A;  1AQZ A;  1EEJ A;  1PY3 A;  2OQE C;  2UGI A;  1RGL A;  4N6L A;  4N6N B;  3WR2 A;  4ORL A;  3KSP A;  1T5Y A;  4K90 B;  5IG4 A;  1O7M B;  3CC7 3;  3DH2 A;  1GD4 A;  1FGT A;  2KRT A;  3K5T A;  5DRE A;  3JUM A;  3D79 A;  4HM8 B;  5AI1 A;  3EF8 A;  4EV2 A;  1ZGX A;  2D1W A;  1GOV A;  4HM7 B;  1W6C A;  4K1U A;  1TFK A;  5AIF A;  3WHO A;  1I3I A;  4QWT A;  4WYK A;  1LOV A;  4WP5 A;  1QJG A;  1YI2 3;  2Y73 A;  2CX1 A;  2H0I A;  5I97 A;  3D5G A;  1I70 A;  4AKZ A;  2KF4 A;  3U1W A;  9RNT A;  1JN5 B;  1BSD A;  3HK4 A;  3ROB A;  1TP6 A;  1O7W B;  3NM7 A;  4HM1 B;  3WOF B;  2Z77 A;  5AIH A;  3VF1 A;  2B1X B;  3WOD G;  1BUJ A;  1ULI B;  1MWT A;  1B21 A;  2YX9 A;  2GSP A;  2HMM B;  2RCD A;  2CW9 A;  1VQO 3;  3RDE A;  3X41 A;  1GY5 A;  1TIJ A;  1LQM B;  1V58 A;  1KSI A;  1N5P A;  1JBR A;  1C54 A;  1DMQ A;  3UL6 A;  1V57 A;  2GXF A;  3LTB A;  1EKM A;  1S5A A;  3MG1 A;  1T2I A;  2QGU A;  4J5G A;  5IEO A;  3G8Z A;  1ISK A;  3D3L A;  1I3F A;  1O7H B;  2ZDJ A;  2O3O A;  2CFW A;  5TGN A;  2FXT A;  1JN5 A;  1MGR A;  3GZX B;  5HGR A;  3B4O A;  3JUN A;  4HZ9 B;  5AEU B;  5IEN A;  1W4N A;  1YIJ 3;  2GEX A;  3HII A;  3Q90 A;  1K41 A;  1NDO B;  3OWY A;  4KFF A;  1GMR A;  1A2K A;  1NWW A;  2WOH A;  3I0Y A;  4RBN A;  3WA2 X;  3X3Z A;  1OF5 B;  1GY7 A;  1HYF A;  2ZHX B;  1IVW A;  1WQL B;  2XSH B;  8CHO A;  5ELU A;  2GBX B;  2XR8 B;  2UUG C;  2HMO B;  1OUN A;  3UJM A;  2W03 A;  3DGY A;  3G0K A;  3J7Y d;  1VQ6 3;  3EE1 A;  1AVK A;  2M7O A;  1RN4 A;  2P09 A;  1AVL A;  2K3D A;  3FF2 A;  2L1S A;  5HOH A;  1LOW A;  3CCQ 3;  1A2V A;  1BNF A;  3KII A;  4I4K A;  1OH0 A;  1LNH A;  3LTD A;  3B8L A;  2XFS A;  4Q53 A;  1R4Y A;  1UUV B;  3FSD A;  2CG1 A;  1G02 A;  2GBW B;  1YIT 3;  2HMJ B;  5M18 A;  4HM3 B;  3M8C A;  3DGN A;  1BAN A;  1I2G A;  1SPU A;  2OWP A;  1MNL A;  3K0Z A;  3G71 3;  1LVN A;  2B24 B;  3DXO A;  1HZ1 A;  2CWT A;  3FLJ A;  3PXM A;  1IV9 A;  3X40 A;  4N3V A;  2W9P A;  1Q82 4;  2CG0 A;  3FGY A;  1I0V A;  4MMX B;  4EW5 A;  4CJN A;  4R80 A;  1RGC A;  1OF5 A;  2W0Q A;  5EVH A;  1OCV A;  3Q3F A;  3F7X A;  1YVB I;  2W04 A;  5ELJ A;  1D6U A;  4HM0 B;  2GU1 A;  4PEJ A;  3S28 A;  1NJI 4;  1FGO A;  1G96 A;  2OQE A;  1BRG A;  3CNM A;  1JBT A;  3L0R A;  1W6G A;  5JPP A;  3CCU 3;  1JKG B;  3T0U A;  2BO9 B;  3WA3 A;  1YJN 3;  1KC8 4;  4K61 A;  2KCD A;  2GEY A;  1TJD A;  1X1U A;  3CU3 A;  1RN1 A;  1OGX A;  4AKY A;  5BXQ A;  1K9M 4;  1M90 4;  1FW7 A;  1RGF A;  3KN4 A;  4KVH A;  1ROV A;  2Z7A A;  1BAO A;  4L8O A;  4XDV A;  6RNT A;  3CPW 2;  2H0H A;  1QVF 2;  3I55 3;  5KP1 A;  1T2H A;  1IVV A;  1MWU A;  3KSE D;  3OX9 A;  1RTU A;  2ZL8 A;  3F8H A;  4L8P A;  5RNT A;  4ILF A;  3A76 A;  3FG3 A;  3OV4 A;  1GS3 A;  1OHO A;  1VZZ A;  2KAA A;  5IEP A;  5D83 A;  4FMC A;  2A15 A;  3SLU A;  1Q40 A;  5FW5 A;  1UUW B;  2K54 A;  3S29 A;  4J5K A;  4KFE A;  1BU4 A;  3SVA A;  2CKF B;  4EV5 A;  1JKG A;  4FMD A;  5BIR A;  1BNG A;  3KCH A;  3H3H A;  3EBT A;  1W7C A;  4BIR A;  2L4V A;  4LMI A;  3CC4 3;  1GD3 A;  1N8Q A;  1VQ4 3;  3ZG0 A;  1KQS 2;  1RHL A;  3S67 A;  2QEX 3;  1AV4 A;  4LZI A;  3PS8 A;  3MWZ A;  1L5G B;  5D82 A;  4BTX A;  3DGL A;  1YGE A;  2PNC A;  2W2C A;  1IVX A;  3CCJ 3;  5IG5 A;  1A2P A;  1RCK A;  3STD A;  1I2F A;  5AEW B;  1VQ7 3;  4O02 B;  1YNV X;  1OPY A;  2RFR A;  1W5Z A;  2WOF A;  4LSO A;  2P05 A;  1B2S A;  1UUG B;  3NBR A;  2OTL 3;  3EBY A;  3EJV A;  3PGB A;  1CQS A;  1IDP A;  3SOA A;  1O7G B;  2H0G A;  4GB5 A;  3SX1 A;  1VQ8 3;  3QRD A;  2I9W A;  4H3U A;  4MEI A;  4R1K A;  3BNB A;  4HZB B;  2AAE A;  1G0T A;  4HM5 B;  5AYR B;  2LQV A;  1RRH A;  1JRQ A;  2CFL A;  4ZM8 A;  1SIH A;  1CH0 A;  1NO3 A;  3LH4 A;  2QIY A;  5CLK A;  5AYS C;  1R4C A;  3MG3 A;  7RNT A;  1RKY A;  3VGN A;  1DE3 A;  1BRN L;  1ZX2 A;  2CWU A;  1BNJ A; 
#chains in the Genus database with same CATH homology
 3AGN A;  1BNF A;  3AGO A;  2F56 A;  1X1W A;  1PYL A;  1R4Y A;  1G02 A;  7GSP A;  1RGA A;  1BAN A;  1BNI A;  1BSC A;  1I2G A;  1TRQ A;  2BU4 A;  4HAA A;  1BGS A;  1RSN A;  1X1X A;  1MGW A;  1RGG A;  4HOH A;  1SAR A;  1HZ1 A;  1AY7 A;  1FZU A;  1I0V A;  1GOU A;  3SYU A;  2AAD A;  1RGC A;  1TRP A;  1BRS A;  1LOY A;  3URP A;  3Q3F A;  1BRI A;  2HOH A;  2KF6 A;  3RNT A;  3BU4 A;  1FUS A;  8RNT A;  1JBT A;  1BRG A;  1BVI A;  1BRH A;  1I0X A;  1YVS A;  1UCK A;  3GSP A;  3A5E A;  1I2E A;  1AQZ A;  1PY3 A;  1RGH A;  1GMQ A;  1RGL A;  3WR2 A;  4GSP A;  1X1U A;  1RN1 A;  1TTO A;  1FW7 A;  1LRA A;  1RGF A;  1GOY A;  2C4B A;  3DH2 A;  6RNT A;  1BAO A;  1BRK A;  3HOH A;  5HOH A;  1T2H A;  1ZGX A;  1GOV A;  2F5M A;  1B3S A;  3WHO A;  1I3I A;  1RTU A;  1LOV A;  1UCI A;  5RNT A;  3D4A A;  4BU4 A;  1BOX A;  1BSE A;  2KAA A;  1DET A;  1I70 A;  2ZA4 A;  3D5G A;  4J5K A;  1GMP A;  4RNT A;  2KF4 A;  1B20 A;  9RNT A;  1BSD A;  1BU4 A;  1LNI A;  5BIR A;  1BNG A;  3KCH A;  1BUJ A;  1BSB A;  1I8V A;  1RGK A;  1RNT A;  4BIR A;  1B21 A;  1FUT A;  2GSP A;  1B2M A;  3AHS A;  5BU4 A;  1Q9E A;  1RHL A;  1B2U A;  2F5W A;  3D5I A;  1BNE A;  3BIR A;  1JBR A;  1C54 A;  2RNT A;  1BNS A;  1RNB A;  1B2Z A;  1T2I A;  1GSP A;  4J5G A;  2F4Y A;  1BNR A;  1JBS A;  1FYS A;  1A2P A;  1RCK A;  1I3F A;  1RLS A;  1I2F A;  1UCL A;  1BRJ A;  1YNV X;  3AHW A;  1BIR A;  1YGW A;  1UCJ A;  1B2S A;  1MGR A;  6GSP A;  1IYY A;  1GMR A;  1RCL A;  5GSP A;  1B27 A;  1RDS A;  2KF3 A;  2KF5 A;  1BSA A;  1HYF A;  2AAE A;  2RBI A;  1CH0 A;  1RMS A;  4GHO A;  7RNT A;  3DGY A;  1RGE A;  1X1Y A;  1RN4 A;  1DE3 A;  1B2X A;  1BRN L;  2SAR A;  1LOW A;  1BNJ A;  2BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...