2F4YA

Barnase cross-linked with glutaraldehyde
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease
publication title On the edge of the denaturation process: Application of X-ray diffraction to barnase and lysozyme cross-linked crystals with denaturants in molar concentrations.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 36
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 2f4yA00
1X1XA 5HOHA 2F56A 1X1WA 2F5MA 3WHOA 1BRGA 1B20A 1TTOA 1RCLA 1RGFA 1GSPA 1BVIA 1YNVX 1UCLA 3URPA 8RNTA 3D5GA 1B2MA 1B2UA 9RNTA 1YGWA 1RDSA 2KF3A 1RGGA 2BU4A 1BIRA 1IYYA 1RGEA 1I70A 1LOWA 1RHLA 1GOUA 2BIRA 1RMSA 1A2PA 1GMRA 2GSPA 1Q9EA 1YVSA 4GHOA 2KAAA 1JBRA 1I2EA 1BRIA 1BOXA 4BU4A 2KF6A 1BNIA 2KF4A 1BSDA 1FW7A 1BU4A 3GSPA 1BNRA 1UCJA 2KF5A 3WR2A 1PYLA 1I2GA 1BNFA 1FZUA 1HZ1A 4RNTA 1RSNA 1BUJA 2RNTA 1LOYA 3D5IA 1R4YA 1RNTA 1BSAA 1JBTA 1I0VA 3HOHA 1TRQA 1B2ZA 1RGHA 1BNEA 3AHWA 1BRKA 1DETA 2HOHA 1JBSA 4BIRA 3BU4A 1X1UA 1B3SA 4HAAA 1RNBA 1PY3A 3DGYA 1RCKA 3A5EA 2F5WA 1X1YA 1BANA 1BRNL 1BSCA 4GSPA 1G02A 1I2FA 3Q3FA 1I0XA 1I3IA 1LOVA 1FUSA 1T2HA 1BRJA 1RGKA 1BAOA 1BRSA 3BIRA 1T2IA 1B27A 1ZGXA 1GOVA 2F4YA 1RLSA 1BNGA 1RTUA 5BIRA 5BU4A 2C4BA 3AHSA 1C54A 1UCIA 1RN4A 3RNTA 1LRAA 1I3FA 1B2SA 1HYFA 1FYSA 1RGLA 2AADA 2ZA4A 1SARA 1DE3A 2SARA 2RBIA 1TRPA 1BNJA 1GOYA 5GSPA 1LNIA 1AQZA 6GSPA 1GMQA 4J5GA 5RNTA 1BSEA 1B2XA 1FUTA 1BGSA 1CH0A 1I8VA 7RNTA 3SYUA 6RNTA 1B21A 1MGRA 3KCHA 2AAEA 1BSBA 1MGWA 4J5KA 1BNSA 1AY7A 1RGAA 4HOHA 3D4AA 1RN1A 1GMPA 1RGCA 7GSPA 1BRHA 3AGNA 3DH2A 3AGOA 1UCKA
chains in the Genus database with same CATH superfamily
3F7XA 5M18A 4N6UA 3WHOA 1BRGA 1B20A 3GZYB 5JPPA 4KVHA 1GSPA 1WMPA 2YFLB 1YJW3 1EQKA 3X40A 2B1XB 3URPA 1W2ZA 3EE1A 4NPBA 1YGWA 3WA3A 4STDA 1VQP3 4OK0A 1V74A 1VQL3 3SVAA 1G0TA 1OF5A 1RDSA 2BMRB 1O7WB 3LMLA 1U5OA 1R4CA 2W2CA 3CD63 5IG5A 1EKMA 1JB2A 3K9MC 1YVSA 2WOFA 5DREA 1OPYA 3PXMA 4GHOA 1N8R4 1OACA 3CCM3 2OTJ3 3DUKA 3CU3A 2W56B 3LTBA 2KF6A 1NB3I 3Q90A 4BTXA 3CNMA 1OCVA 4R9KA 1YIJ3 1BSDA 1ISKA 1FW7A 1J2BA 1BU4A 1BNRA 1C7HA 1GY5A 2HMMB 1KD14 2F86B 1I2GA 2W6JH 1LOXA 1OHOA 3FCSB 1HZ1A 2OWPA 4RNTA 4QWTA 3FLJA 4AKYA 3UJMA 3GAXA 3DGMA 3LT9A 4KT3B 5IG4A 1R4YA 3S29A 1OGZA 1VQ73 1A2VA 2BT3A 4O8SA 1OGXA 2KCDA 2D42A 1BUQA 3F8XA 2FXTA 3EN1B 4XBXA 4WFOA 1SPUA 5HGRA 3FZWA 5FW5A 4BTWA 1STDA 3LTAA 1MOLA 4ORLA 5AIIA 2CFKA 1ULJB 1Y4KA 1RNBA 1LXEA 1RCKA 3DGYA 1N8QA 1X1YA 1BANA 1K41A 1WMNA 3DGLA 2RCDA 1BSCA 3UNLA 2IUKA 1JN5B 4ZM8A 4GSPA 5IEPA 2QA43 2W9QA 1I2FA 2C11A 3FH1A 4KZ1A 2IUJA 1IVVA 1NNVA 1T2HA 1BRJA 1BRSA 1TJDA 1Q42A 3BIRA 3PS8A 2IY2A 2O9UX 1ZGXA 3QRDA 4K1UA 1RLSA 3F8HA 3VGNA 1EEJA 5BU4A 3HIIA 3EN8A 2C4BA 3AHSA 2BNGA 6STDA 1UCIA 2W56A 2WOHA 1LRAA 1QAFA 2KRTA 1Z1SA 2R4IA 3LT8A 3KSPA 1NJI4 4XBYA 1IV9A 3NQZA 1JNQA 2SARA 2WGOA 1ULIB 1EUIC 2XRXB 3EBTA 2PZVA 2CC3A 4ILFA 4OUQA 3UL6A 1GMQA 2M7OA 4I4KA 1JKGA 5RNTA 1O7NB 2XSHB 1B2XA 2ML5A 1JZOA 4FCZA 1IVWA 5I97A 1I8VA 1CEWI 5AIHA 3SYUA 1DVDA 4RZMA 1TP6A 2YX9A 2LQVA 1MWRA 1MGRA 1UDII 4KFEA 1M904 4GB5A 3KCHA 4MMZB 1E3RA 1UUVB 3NBRA 1G96A 4LEHA 1BNSA 4GL6A 1RJOA 1Q7HA 1US1A 3ZG5A 4HM6B 4J9AA 5TGNA 4L8OA 5EVHA 1FA3A 4FMCA 1BRHA 3U1WA 3DH2A 3F9SA 1DMQA 3OX9A 3K7CA 2O3OA 2W04A 5HOHA 1IT7A 3CC43 1AVKA 3HK4A 3KSED 1TTOA 2J8XB 4R1KA 4MJDA 1RGFA 2WGQA 2MC8A 1BVIA 2XSOB 4MEIA 1E3VA 1UCLA 4G1MB 1WQLB 3LTDA 5A0OB 3EBYA 2ZDJA 4JRFA 5LC7A 5AIFA 2CFDA 3DZLA 2INXA 1RGGA 2B24B 3G8ZA 1GD4A 1BIRA 1T5YA 1RGEA 5CLKA 3ZG0A 1UGIA 1RHLA 3PGBA 4KFFA 2UX0A 2Z76A 3WOFB 5AEWB 2BMQB 1VQ53 1Q40A 2RGQA 3LYGA 1OHPA 2A15A 5KP4A 1YHQ3 1JBRA 4FMBA 1BRIA 4N6MA 1BOXA 5IEOA 1IK3A 1VQ83 1BNIA 1JB4A 3FG4A 2XR8B 3Q1CA 2Z77A 1RRHA 2L4VA 2CG0A 2QEX3 3WR2A 5D83A 4XB5A 1U8CB 4RBNA 1LQMB 4FR9A 4AEQA 3ER7A 3F40A 2CH9A 2CW9A 1RSNA 3BLZA 2CWUA 1UUGB 2R41A 1RKYA 2XH9A 5IENA 3CC73 3CCL3 1LOYA 4MMXB 3D5IA 2WO0A 4AKZA 5JPUA 1JBTA 3D3LA 5STDA 3PZWA 3HOHA 1TRQA 1B2ZA 2OOVC 1BNEA 1SQWA 3AHWA 1BRKA 2HOHA 1JBSA 2Z6BA 3FG1A 3H3HA 2UGIA 3BU4A 4XDWA 3FG3A 3T0UA 4HM7B 2K54A 1PY3A 2BMOB 2XFTA 2L1SA 3EB8A 1A2KA 2SBLA 3RDEA 1BRNL 1D6UA 3NX0A 4O2HA 4RNZA 3CCS3 3GRDA 1K9M4 2XF3A 2QIYA 2F99A 3HX8A 2K0MA 4RNYA 1I0XA 1I3IA 1LOVA 2GBWB 2V1LA 3CCV3 1BAOA 4HKVB 1T2IA 1JRQA 3NV0A 2OQEA 3HIGA 4BL3A 4WYKB 1GOVA 1TIJA 1W6YA 1Q864 3RGRA 1QAKA 1D6YA 1LVNA 1KC84 1M1XB 1NDOB 3RNTA 3D79A 4BL2A 3X3XA 4HM1B 1I3FA 4HM3B 5G1KA 2JQ5A 1HYFA 1FYSA 1MWUA 2AADA 2P09A 1AR0A 3FF2A 1GS3A 3JUOA 5GSPA 1IQ8A 1VQ93 3QK9A 5ELJA 4HM5B 1IT8A 1QMAA 2YFIB 3NBBA 4J5GA 4XM4A 5KP1A 1TUHA 5LC6A 2H0IA 4L7KA 5CK6A 1UI7A 1W7CA 3EHCA 4K90B 5KP3A 3NUVA 7RNTA 4CPKA 4I5QA 6RNTA 1IDPA 3I553 3HZPA 1GYBA 5IG0A 4JF8A 3UB1A 3TDGA 1L5GB 4HVNA 4J5KA 1UW1A 3FGYA 4PEJA 1AY7A 4N6V0 1RGAA 2IMJA 1RN1A 1GMPA 2E2TA 1KSIA 4EXRA 1VQM3 2HMLB 3CME3 1UCKA 1X1XA 2F56A 2I9WA 1X1WA 4HYZA 3U97A 2CFWA 5D82A 2JDIH 1RCLA 4WYKA 2ZHXB 4LGQA 4HJLB 3B4OA 2E2UA 1B2MA 1IV7A 1MWSA 1CYVA 1B2UA 4R9LA 3VF1A 3B7CA 9RNTA 3FKAA 3NXJA 3T8NA 5IERA 1D6ZA 1NWWA 4CJNA 2BU4A 1GY6A 3PYJA 1IYYA 1I70A 4LMIA 1VQ43 4EC6A 1LOWA 1FGMA 1GOUA 2BIRA 3N9HA 4H3UA 1RMSA 1A2PA 1YIT3 2CG1A 2GSPA 1JJ22 4R80A 3OW22 1Q824 1ROAA 3WA2X 1ASKA 5FGOA 1I2EA 1JN5A 3IMAB 3BNCA 4NHFA 1OH0A 2CKFB 5DRVA 1CYUA 4BU4A 1QVG2 2BHMA 5JBSA 2KF4A 1KWIA 2D1WA 1ZS7A 4LYLB 1N5PA 3D9RA 3DGNA 4U13A 1N5HA 1SIHA 2KF5A 5M19A 1PYLA 3Q2PA 1Q814 3E99A 4HM8B 5AIGA 3T8UA 3SOAA 1FZUA 4TX4A 3KIIA 3UL5A 4N6LA 1WTHA 2P0XA 3ZFZA 4HM4B 1FUWA 1DMNA 3ROBA 3LZAA 3SLUA 1RNTA 1BSAA 3I563 4H61A 1I0VA 3LTCA 1SIIA 3CCQ3 1IQXA 3G0KA 2W03A 3KZTA 1Q7Y4 1YI23 1QVF2 1OF5B 3BNEA 1DETA 4HM2B 3DXOA 1NO3A 3G4S3 4O3VA 5IG3A 3ECFA 3CMA3 3N54B 3CXC2 2F5WA 3V98A 3G16A 3KE7A 1S723 2XEPA 3K5TA 1W4NA 1FGQA 1IQYA 1WNHA 3LXUX 5IF6A 3I0YA 4K1VA 3Q3FA 3KFQC 2QGUA 1FUSA 1IVUA 1TFKA 4R4KA 3DM8A 3FSDA 1RGKA 5EEOA 1QALA 3GZRA 2GEYA 4HZ9B 1GY7A 1B27A 3IJEB 1A90A 2E2VA 2F4YA 1RTUA 1BNGA 3X3ZA 1LNHA 5BIRA 1LQGC 4O02B 5G2GA 8CHOA 4N3VA 1K28A 1VZZA 2XGNA 1B2SA 2PNCA 1RGLA 1JZDA 2F98A 2ZA4A 3CC23 2FGTA 3MSOA 1DMMA 1NU3A 2Y74A 2GU3A 3F7SA 3CCR3 1RRLA 2CHCA 3SEDA 1N9JA 1AQZA 1JB5A 3CNXA 2ML6A 3OXAA 3LH4A 1BSEA 3NQYA 1FUTA 3DGOA 1CH0A 4J8TA 1MWTA 1B21A 1FGRA 3X3YA 3NM2A 4HBRA 3SXXA 4CCVA 5AEUB 1MGWA 3OV4A 3MPHA 1TFOA 1JV2B 1W02A 2GBXB 2HMJB 4HOHA 3MYTA 4K61A 2KXGA 1W00A 1ZO2A 4EV5A 1RGCA 7GSPA 3WODG 3O8YA 3ALAA 4EV2A 2RFRA 2ZL8A 3AGOA 5CXOA 4IIAA 3NM7A 2F5MA 2FNQA 3AMOB 1W5ZA 5ELUA 2OCTA 4WHAA 3M8CA 2GEXA 3NBJA 1STFI 4WWUC 4N6TA 3IPTA 1YNVX 2CWVA 8RNTA 3D5GA 5AI1A 4EW5A 1EA2A 4CDLA 1JKGB 1A67A 2CX1A 3H51A 2KF3A 1K734 1UGHI 3PCRA 3SOYA 5M1AA 3OWSA 3WMDA 4FCJA 1HKXA 3S28A 1ZX2A 5EQLA 3JUPA 1T3BA 4EBGA 1GMRA 2IYJA 3MG2A 3HI7A 4IT7A 1Q9EA 1NB5I 2K3DA 2UUGC 3B8LA 3BNBA 2KAAA 1VQQA 4MMYB 1DYUA 1M1K4 1W6CA 2W9PA 2BO9B 2CWTA 2RSXA 1W2B2 3K0ZA 3GWRA 2C10A 2H0HA 2H0GA 1MNLA 3GSPA 4FMAA 4XBTA 1M9GA 1UCJA 4L8PA 3WOEB 3GZXB 3S67A 1N9EA 1BNFA 1O7MB 3G713 3BNDA 2HMKB 3BB9A 3MKIA 4EYCA 5IW9A 1BUJA 2RNTA 3KN4A 1RN7A 3OWUA 2CFLA 2P0MA 4X2OA 3CPOA 4LSOA 1KQS2 1QJGA 3PCSA 2OOVA 3DY5A 1RGHA 3MG1A 4FMDA 5AYSC 1EG9B 3CCE3 3X41A 4Q53A 1GD3A 3FF0A 4NREA 4BIRA 3MG3A 1X1UA 3N8BA 4LZIA 3AMOA 1B3SA 4HAAA 4XDVA 1VQ63 3K63A 2YFJB 3A5EA 3CPW2 1W6GA 3VSYA 3JUNA 4KFDA 4BTYA 3JVCA 1Q40B 3STDA 1F8NA 3CCU3 1G02A 3EQQB 2Q07A 1CQSA 1VQN3 3EJVA 4N6NB 2CFGA 1O7GB 3EX9A 2MF7A 3MHEA 1E97A 1V57A 5BVBA 2Y73A 3G6E3 2OQEC 3LOYA 5CF1A 3S27A 1O7PB 1IVXA 4IPBA 3V92A 3A76A 1PU4A 5G1LA 3MWZA 1PFPA 2OTL3 1C54A 1RN4A 3GZBA 1AVLA 4HZBB 3F14A 1VQK3 2GXFA 3S5CA 4OVMA 5D81A 1TU5A 1FGTA 1DE3A 1SARA 1OUNA 4N6OB 3X42A 1IU7A 4WP5A 2P38A 4DKIA 2HMOB 1TRPA 2CK3H 1BNJA 1GOYA 1WMOA 2RBIA 3KKGA 5AYRB 3DMCA 1VQO3 1OHSA 1YVBI 3L0RA 1LNIA 6GSPA 1AV4A 2HMNB 3JUQA 1UI8A 2W0QA 4FCMA 2GU1A 3V99A 1S5AA 4HM0B 1BGSA 1DVCA 1ROVA 2XFSA 3SX1A 3WDGB 2CIUA 1W01A 1K8A4 5CF2A 3NHXA 7STDA 2CX0A 2XGLA 1O7HB 2AAEA 1BSBA 2Z7AA 3EC9A 4X2HA 1YJ93 5BXQA 3RGAA 1YGEA 2IA7A 3JUMA 1FGOA 2P05A 3NV0B 3J7Yd 3CCJ3 3D4AA 1YJN3 3OWYA 1V58A 1HU9A 2LYXA 3AGNA 3EF8A 1UUWB 2STDA 3B4PA 1SJWA
chains in the Genus database with same CATH topology
1X1XA 5HOHA 2F56A 1X1WA 2F5MA 3WHOA 1BRGA 1B20A 1TTOA 1RCLA 1RGFA 1GSPA 1BVIA 1YNVX 1UCLA 3URPA 8RNTA 3D5GA 1B2MA 1B2UA 9RNTA 1YGWA 1RDSA 2KF3A 1RGGA 2BU4A 1BIRA 1IYYA 1RGEA 1I70A 1LOWA 1RHLA 1GOUA 2BIRA 1RMSA 1A2PA 1GMRA 2GSPA 1Q9EA 1YVSA 4GHOA 2KAAA 1JBRA 1I2EA 1BRIA 1BOXA 4BU4A 2KF6A 1BNIA 2KF4A 1BSDA 1FW7A 1BU4A 3GSPA 1BNRA 1UCJA 2KF5A 3WR2A 1PYLA 1I2GA 1BNFA 1FZUA 1HZ1A 4RNTA 1RSNA 1BUJA 2RNTA 1LOYA 3D5IA 1R4YA 1RNTA 1BSAA 1JBTA 1I0VA 3HOHA 1TRQA 1B2ZA 1RGHA 1BNEA 3AHWA 1BRKA 1DETA 2HOHA 1JBSA 4BIRA 3BU4A 1X1UA 1B3SA 4HAAA 1RNBA 1PY3A 3DGYA 1RCKA 3A5EA 2F5WA 1X1YA 1BANA 1BRNL 1BSCA 4GSPA 1G02A 1I2FA 3Q3FA 1I0XA 1I3IA 1LOVA 1FUSA 1T2HA 1BRJA 1RGKA 1BAOA 1BRSA 3BIRA 1T2IA 1B27A 1ZGXA 1GOVA 2F4YA 1RLSA 1BNGA 1RTUA 5BIRA 5BU4A 2C4BA 3AHSA 1C54A 1UCIA 1RN4A 3RNTA 1LRAA 1I3FA 1B2SA 1HYFA 1FYSA 1RGLA 2AADA 2ZA4A 1SARA 1DE3A 2SARA 2RBIA 1TRPA 1BNJA 1GOYA 5GSPA 1LNIA 1AQZA 6GSPA 1GMQA 4J5GA 5RNTA 1BSEA 1B2XA 1FUTA 1BGSA 1CH0A 1I8VA 7RNTA 3SYUA 6RNTA 1B21A 1MGRA 3KCHA 2AAEA 1BSBA 1MGWA 4J5KA 1BNSA 1AY7A 1RGAA 4HOHA 3D4AA 1RN1A 1GMPA 1RGCA 7GSPA 1BRHA 3AGNA 3DH2A 3AGOA 1UCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1X A;  5HOH A;  2F56 A;  1X1W A;  2F5M A;  3WHO A;  1BRG A;  1B20 A;  1TTO A;  1RCL A;  1RGF A;  1GSP A;  1BVI A;  1YNV X;  1UCL A;  3URP A;  8RNT A;  3D5G A;  1B2M A;  1B2U A;  9RNT A;  1YGW A;  1RDS A;  2KF3 A;  1RGG A;  2BU4 A;  1BIR A;  1IYY A;  1RGE A;  1I70 A;  1LOW A;  1RHL A;  1GOU A;  2BIR A;  1RMS A;  1A2P A;  1GMR A;  2GSP A;  1Q9E A;  1YVS A;  4GHO A;  2KAA A;  1JBR A;  1I2E A;  1BRI A;  1BOX A;  4BU4 A;  2KF6 A;  1BNI A;  2KF4 A;  1BSD A;  1FW7 A;  1BU4 A;  3GSP A;  1BNR A;  1UCJ A;  2KF5 A;  3WR2 A;  1PYL A;  1I2G A;  1BNF A;  1FZU A;  1HZ1 A;  4RNT A;  1RSN A;  1BUJ A;  2RNT A;  1LOY A;  3D5I A;  1R4Y A;  1RNT A;  1BSA A;  1JBT A;  1I0V A;  3HOH A;  1TRQ A;  1B2Z A;  1RGH A;  1BNE A;  3AHW A;  1BRK A;  1DET A;  2HOH A;  1JBS A;  4BIR A;  3BU4 A;  1X1U A;  1B3S A;  4HAA A;  1RNB A;  1PY3 A;  3DGY A;  1RCK A;  3A5E A;  2F5W A;  1X1Y A;  1BAN A;  1BRN L;  1BSC A;  4GSP A;  1G02 A;  1I2F A;  3Q3F A;  1I0X A;  1I3I A;  1LOV A;  1FUS A;  1T2H A;  1BRJ A;  1RGK A;  1BAO A;  1BRS A;  3BIR A;  1T2I A;  1B27 A;  1ZGX A;  1GOV A;  2F4Y A;  1RLS A;  1BNG A;  1RTU A;  5BIR A;  5BU4 A;  2C4B A;  3AHS A;  1C54 A;  1UCI A;  1RN4 A;  3RNT A;  1LRA A;  1I3F A;  1B2S A;  1HYF A;  1FYS A;  1RGL A;  2AAD A;  2ZA4 A;  1SAR A;  1DE3 A;  2SAR A;  2RBI A;  1TRP A;  1BNJ A;  1GOY A;  5GSP A;  1LNI A;  1AQZ A;  6GSP A;  1GMQ A;  4J5G A;  5RNT A;  1BSE A;  1B2X A;  1FUT A;  1BGS A;  1CH0 A;  1I8V A;  7RNT A;  3SYU A;  6RNT A;  1B21 A;  1MGR A;  3KCH A;  2AAE A;  1BSB A;  1MGW A;  4J5K A;  1BNS A;  1AY7 A;  1RGA A;  4HOH A;  3D4A A;  1RN1 A;  1GMP A;  1RGC A;  7GSP A;  1BRH A;  3AGN A;  3DH2 A;  3AGO A;  1UCK A; 
#chains in the Genus database with same CATH topology
 3F7X A;  5M18 A;  4N6U A;  3WHO A;  1BRG A;  1B20 A;  3GZY B;  5JPP A;  4KVH A;  1GSP A;  1WMP A;  2YFL B;  1YJW 3;  1EQK A;  3X40 A;  2B1X B;  3URP A;  1W2Z A;  3EE1 A;  4NPB A;  1YGW A;  3WA3 A;  4STD A;  1VQP 3;  4OK0 A;  1V74 A;  1VQL 3;  3SVA A;  1G0T A;  1OF5 A;  1RDS A;  2BMR B;  1O7W B;  3LML A;  1U5O A;  1R4C A;  2W2C A;  3CD6 3;  5IG5 A;  1EKM A;  1JB2 A;  3K9M C;  1YVS A;  2WOF A;  5DRE A;  1OPY A;  3PXM A;  4GHO A;  1N8R 4;  1OAC A;  3CCM 3;  2OTJ 3;  3DUK A;  3CU3 A;  2W56 B;  3LTB A;  2KF6 A;  1NB3 I;  3Q90 A;  4BTX A;  3CNM A;  1OCV A;  4R9K A;  1YIJ 3;  1BSD A;  1ISK A;  1FW7 A;  1J2B A;  1BU4 A;  1BNR A;  1C7H A;  1GY5 A;  2HMM B;  1KD1 4;  2F86 B;  1I2G A;  2W6J H;  1LOX A;  1OHO A;  3FCS B;  1HZ1 A;  2OWP A;  4RNT A;  4QWT A;  3FLJ A;  4AKY A;  3UJM A;  3GAX A;  3DGM A;  3LT9 A;  4KT3 B;  5IG4 A;  1R4Y A;  3S29 A;  1OGZ A;  1VQ7 3;  1A2V A;  2BT3 A;  4O8S A;  1OGX A;  2KCD A;  2D42 A;  1BUQ A;  3F8X A;  2FXT A;  3EN1 B;  4XBX A;  4WFO A;  1SPU A;  5HGR A;  3FZW A;  5FW5 A;  4BTW A;  1STD A;  3LTA A;  1MOL A;  4ORL A;  5AII A;  2CFK A;  1ULJ B;  1Y4K A;  1RNB A;  1LXE A;  1RCK A;  3DGY A;  1N8Q A;  1X1Y A;  1BAN A;  1K41 A;  1WMN A;  3DGL A;  2RCD A;  1BSC A;  3UNL A;  2IUK A;  1JN5 B;  4ZM8 A;  4GSP A;  5IEP A;  2QA4 3;  2W9Q A;  1I2F A;  2C11 A;  3FH1 A;  4KZ1 A;  2IUJ A;  1IVV A;  1NNV A;  1T2H A;  1BRJ A;  1BRS A;  1TJD A;  1Q42 A;  3BIR A;  3PS8 A;  2IY2 A;  2O9U X;  1ZGX A;  3QRD A;  4K1U A;  1RLS A;  3F8H A;  3VGN A;  1EEJ A;  5BU4 A;  3HII A;  3EN8 A;  2C4B A;  3AHS A;  2BNG A;  6STD A;  1UCI A;  2W56 A;  2WOH A;  1LRA A;  1QAF A;  2KRT A;  1Z1S A;  2R4I A;  3LT8 A;  3KSP A;  1NJI 4;  4XBY A;  1IV9 A;  3NQZ A;  1JNQ A;  2SAR A;  2WGO A;  1ULI B;  1EUI C;  2XRX B;  3EBT A;  2PZV A;  2CC3 A;  4ILF A;  4OUQ A;  3UL6 A;  1GMQ A;  2M7O A;  4I4K A;  1JKG A;  5RNT A;  1O7N B;  2XSH B;  1B2X A;  2ML5 A;  1JZO A;  4FCZ A;  1IVW A;  5I97 A;  1I8V A;  1CEW I;  5AIH A;  3SYU A;  1DVD A;  4RZM A;  1TP6 A;  2YX9 A;  2LQV A;  1MWR A;  1MGR A;  1UDI I;  4KFE A;  1M90 4;  4GB5 A;  3KCH A;  4MMZ B;  1E3R A;  1UUV B;  3NBR A;  1G96 A;  4LEH A;  1BNS A;  4GL6 A;  1RJO A;  1Q7H A;  1US1 A;  3ZG5 A;  4HM6 B;  4J9A A;  5TGN A;  4L8O A;  5EVH A;  1FA3 A;  4FMC A;  1BRH A;  3U1W A;  3DH2 A;  3F9S A;  1DMQ A;  3OX9 A;  3K7C A;  2O3O A;  2W04 A;  5HOH A;  1IT7 A;  3CC4 3;  1AVK A;  3HK4 A;  3KSE D;  1TTO A;  2J8X B;  4R1K A;  4MJD A;  1RGF A;  2WGQ A;  2MC8 A;  1BVI A;  2XSO B;  4MEI A;  1E3V A;  1UCL A;  4G1M B;  1WQL B;  3LTD A;  5A0O B;  3EBY A;  2ZDJ A;  4JRF A;  5LC7 A;  5AIF A;  2CFD A;  3DZL A;  2INX A;  1RGG A;  2B24 B;  3G8Z A;  1GD4 A;  1BIR A;  1T5Y A;  1RGE A;  5CLK A;  3ZG0 A;  1UGI A;  1RHL A;  3PGB A;  4KFF A;  2UX0 A;  2Z76 A;  3WOF B;  5AEW B;  2BMQ B;  1VQ5 3;  1Q40 A;  2RGQ A;  3LYG A;  1OHP A;  2A15 A;  5KP4 A;  1YHQ 3;  1JBR A;  4FMB A;  1BRI A;  4N6M A;  1BOX A;  5IEO A;  1IK3 A;  1VQ8 3;  1BNI A;  1JB4 A;  3FG4 A;  2XR8 B;  3Q1C A;  2Z77 A;  1RRH A;  2L4V A;  2CG0 A;  2QEX 3;  3WR2 A;  5D83 A;  4XB5 A;  1U8C B;  4RBN A;  1LQM B;  4FR9 A;  4AEQ A;  3ER7 A;  3F40 A;  2CH9 A;  2CW9 A;  1RSN A;  3BLZ A;  2CWU A;  1UUG B;  2R41 A;  1RKY A;  2XH9 A;  5IEN A;  3CC7 3;  3CCL 3;  1LOY A;  4MMX B;  3D5I A;  2WO0 A;  4AKZ A;  5JPU A;  1JBT A;  3D3L A;  5STD A;  3PZW A;  3HOH A;  1TRQ A;  1B2Z A;  2OOV C;  1BNE A;  1SQW A;  3AHW A;  1BRK A;  2HOH A;  1JBS A;  2Z6B A;  3FG1 A;  3H3H A;  2UGI A;  3BU4 A;  4XDW A;  3FG3 A;  3T0U A;  4HM7 B;  2K54 A;  1PY3 A;  2BMO B;  2XFT A;  2L1S A;  3EB8 A;  1A2K A;  2SBL A;  3RDE A;  1BRN L;  1D6U A;  3NX0 A;  4O2H A;  4RNZ A;  3CCS 3;  3GRD A;  1K9M 4;  2XF3 A;  2QIY A;  2F99 A;  3HX8 A;  2K0M A;  4RNY A;  1I0X A;  1I3I A;  1LOV A;  2GBW B;  2V1L A;  3CCV 3;  1BAO A;  4HKV B;  1T2I A;  1JRQ A;  3NV0 A;  2OQE A;  3HIG A;  4BL3 A;  4WYK B;  1GOV A;  1TIJ A;  1W6Y A;  1Q86 4;  3RGR A;  1QAK A;  1D6Y A;  1LVN A;  1KC8 4;  1M1X B;  1NDO B;  3RNT A;  3D79 A;  4BL2 A;  3X3X A;  4HM1 B;  1I3F A;  4HM3 B;  5G1K A;  2JQ5 A;  1HYF A;  1FYS A;  1MWU A;  2AAD A;  2P09 A;  1AR0 A;  3FF2 A;  1GS3 A;  3JUO A;  5GSP A;  1IQ8 A;  1VQ9 3;  3QK9 A;  5ELJ A;  4HM5 B;  1IT8 A;  1QMA A;  2YFI B;  3NBB A;  4J5G A;  4XM4 A;  5KP1 A;  1TUH A;  5LC6 A;  2H0I A;  4L7K A;  5CK6 A;  1UI7 A;  1W7C A;  3EHC A;  4K90 B;  5KP3 A;  3NUV A;  7RNT A;  4CPK A;  4I5Q A;  6RNT A;  1IDP A;  3I55 3;  3HZP A;  1GYB A;  5IG0 A;  4JF8 A;  3UB1 A;  3TDG A;  1L5G B;  4HVN A;  4J5K A;  1UW1 A;  3FGY A;  4PEJ A;  1AY7 A;  4N6V 0;  1RGA A;  2IMJ A;  1RN1 A;  1GMP A;  2E2T A;  1KSI A;  4EXR A;  1VQM 3;  2HML B;  3CME 3;  1UCK A;  1X1X A;  2F56 A;  2I9W A;  1X1W A;  4HYZ A;  3U97 A;  2CFW A;  5D82 A;  2JDI H;  1RCL A;  4WYK A;  2ZHX B;  4LGQ A;  4HJL B;  3B4O A;  2E2U A;  1B2M A;  1IV7 A;  1MWS A;  1CYV A;  1B2U A;  4R9L A;  3VF1 A;  3B7C A;  9RNT A;  3FKA A;  3NXJ A;  3T8N A;  5IER A;  1D6Z A;  1NWW A;  4CJN A;  2BU4 A;  1GY6 A;  3PYJ A;  1IYY A;  1I70 A;  4LMI A;  1VQ4 3;  4EC6 A;  1LOW A;  1FGM A;  1GOU A;  2BIR A;  3N9H A;  4H3U A;  1RMS A;  1A2P A;  1YIT 3;  2CG1 A;  2GSP A;  1JJ2 2;  4R80 A;  3OW2 2;  1Q82 4;  1ROA A;  3WA2 X;  1ASK A;  5FGO A;  1I2E A;  1JN5 A;  3IMA B;  3BNC A;  4NHF A;  1OH0 A;  2CKF B;  5DRV A;  1CYU A;  4BU4 A;  1QVG 2;  2BHM A;  5JBS A;  2KF4 A;  1KWI A;  2D1W A;  1ZS7 A;  4LYL B;  1N5P A;  3D9R A;  3DGN A;  4U13 A;  1N5H A;  1SIH A;  2KF5 A;  5M19 A;  1PYL A;  3Q2P A;  1Q81 4;  3E99 A;  4HM8 B;  5AIG A;  3T8U A;  3SOA A;  1FZU A;  4TX4 A;  3KII A;  3UL5 A;  4N6L A;  1WTH A;  2P0X A;  3ZFZ A;  4HM4 B;  1FUW A;  1DMN A;  3ROB A;  3LZA A;  3SLU A;  1RNT A;  1BSA A;  3I56 3;  4H61 A;  1I0V A;  3LTC A;  1SII A;  3CCQ 3;  1IQX A;  3G0K A;  2W03 A;  3KZT A;  1Q7Y 4;  1YI2 3;  1QVF 2;  1OF5 B;  3BNE A;  1DET A;  4HM2 B;  3DXO A;  1NO3 A;  3G4S 3;  4O3V A;  5IG3 A;  3ECF A;  3CMA 3;  3N54 B;  3CXC 2;  2F5W A;  3V98 A;  3G16 A;  3KE7 A;  1S72 3;  2XEP A;  3K5T A;  1W4N A;  1FGQ A;  1IQY A;  1WNH A;  3LXU X;  5IF6 A;  3I0Y A;  4K1V A;  3Q3F A;  3KFQ C;  2QGU A;  1FUS A;  1IVU A;  1TFK A;  4R4K A;  3DM8 A;  3FSD A;  1RGK A;  5EEO A;  1QAL A;  3GZR A;  2GEY A;  4HZ9 B;  1GY7 A;  1B27 A;  3IJE B;  1A90 A;  2E2V A;  2F4Y A;  1RTU A;  1BNG A;  3X3Z A;  1LNH A;  5BIR A;  1LQG C;  4O02 B;  5G2G A;  8CHO A;  4N3V A;  1K28 A;  1VZZ A;  2XGN A;  1B2S A;  2PNC A;  1RGL A;  1JZD A;  2F98 A;  2ZA4 A;  3CC2 3;  2FGT A;  3MSO A;  1DMM A;  1NU3 A;  2Y74 A;  2GU3 A;  3F7S A;  3CCR 3;  1RRL A;  2CHC A;  3SED A;  1N9J A;  1AQZ A;  1JB5 A;  3CNX A;  2ML6 A;  3OXA A;  3LH4 A;  1BSE A;  3NQY A;  1FUT A;  3DGO A;  1CH0 A;  4J8T A;  1MWT A;  1B21 A;  1FGR A;  3X3Y A;  3NM2 A;  4HBR A;  3SXX A;  4CCV A;  5AEU B;  1MGW A;  3OV4 A;  3MPH A;  1TFO A;  1JV2 B;  1W02 A;  2GBX B;  2HMJ B;  4HOH A;  3MYT A;  4K61 A;  2KXG A;  1W00 A;  1ZO2 A;  4EV5 A;  1RGC A;  7GSP A;  3WOD G;  3O8Y A;  3ALA A;  4EV2 A;  2RFR A;  2ZL8 A;  3AGO A;  5CXO A;  4IIA A;  3NM7 A;  2F5M A;  2FNQ A;  3AMO B;  1W5Z A;  5ELU A;  2OCT A;  4WHA A;  3M8C A;  2GEX A;  3NBJ A;  1STF I;  4WWU C;  4N6T A;  3IPT A;  1YNV X;  2CWV A;  8RNT A;  3D5G A;  5AI1 A;  4EW5 A;  1EA2 A;  4CDL A;  1JKG B;  1A67 A;  2CX1 A;  3H51 A;  2KF3 A;  1K73 4;  1UGH I;  3PCR A;  3SOY A;  5M1A A;  3OWS A;  3WMD A;  4FCJ A;  1HKX A;  3S28 A;  1ZX2 A;  5EQL A;  3JUP A;  1T3B A;  4EBG A;  1GMR A;  2IYJ A;  3MG2 A;  3HI7 A;  4IT7 A;  1Q9E A;  1NB5 I;  2K3D A;  2UUG C;  3B8L A;  3BNB A;  2KAA A;  1VQQ A;  4MMY B;  1DYU A;  1M1K 4;  1W6C A;  2W9P A;  2BO9 B;  2CWT A;  2RSX A;  1W2B 2;  3K0Z A;  3GWR A;  2C10 A;  2H0H A;  2H0G A;  1MNL A;  3GSP A;  4FMA A;  4XBT A;  1M9G A;  1UCJ A;  4L8P A;  3WOE B;  3GZX B;  3S67 A;  1N9E A;  1BNF A;  1O7M B;  3G71 3;  3BND A;  2HMK B;  3BB9 A;  3MKI A;  4EYC A;  5IW9 A;  1BUJ A;  2RNT A;  3KN4 A;  1RN7 A;  3OWU A;  2CFL A;  2P0M A;  4X2O A;  3CPO A;  4LSO A;  1KQS 2;  1QJG A;  3PCS A;  2OOV A;  3DY5 A;  1RGH A;  3MG1 A;  4FMD A;  5AYS C;  1EG9 B;  3CCE 3;  3X41 A;  4Q53 A;  1GD3 A;  3FF0 A;  4NRE A;  4BIR A;  3MG3 A;  1X1U A;  3N8B A;  4LZI A;  3AMO A;  1B3S A;  4HAA A;  4XDV A;  1VQ6 3;  3K63 A;  2YFJ B;  3A5E A;  3CPW 2;  1W6G A;  3VSY A;  3JUN A;  4KFD A;  4BTY A;  3JVC A;  1Q40 B;  3STD A;  1F8N A;  3CCU 3;  1G02 A;  3EQQ B;  2Q07 A;  1CQS A;  1VQN 3;  3EJV A;  4N6N B;  2CFG A;  1O7G B;  3EX9 A;  2MF7 A;  3MHE A;  1E97 A;  1V57 A;  5BVB A;  2Y73 A;  3G6E 3;  2OQE C;  3LOY A;  5CF1 A;  3S27 A;  1O7P B;  1IVX A;  4IPB A;  3V92 A;  3A76 A;  1PU4 A;  5G1L A;  3MWZ A;  1PFP A;  2OTL 3;  1C54 A;  1RN4 A;  3GZB A;  1AVL A;  4HZB B;  3F14 A;  1VQK 3;  2GXF A;  3S5C A;  4OVM A;  5D81 A;  1TU5 A;  1FGT A;  1DE3 A;  1SAR A;  1OUN A;  4N6O B;  3X42 A;  1IU7 A;  4WP5 A;  2P38 A;  4DKI A;  2HMO B;  1TRP A;  2CK3 H;  1BNJ A;  1GOY A;  1WMO A;  2RBI A;  3KKG A;  5AYR B;  3DMC A;  1VQO 3;  1OHS A;  1YVB I;  3L0R A;  1LNI A;  6GSP A;  1AV4 A;  2HMN B;  3JUQ A;  1UI8 A;  2W0Q A;  4FCM A;  2GU1 A;  3V99 A;  1S5A A;  4HM0 B;  1BGS A;  1DVC A;  1ROV A;  2XFS A;  3SX1 A;  3WDG B;  2CIU A;  1W01 A;  1K8A 4;  5CF2 A;  3NHX A;  7STD A;  2CX0 A;  2XGL A;  1O7H B;  2AAE A;  1BSB A;  2Z7A A;  3EC9 A;  4X2H A;  1YJ9 3;  5BXQ A;  3RGA A;  1YGE A;  2IA7 A;  3JUM A;  1FGO A;  2P05 A;  3NV0 B;  3J7Y d;  3CCJ 3;  3D4A A;  1YJN 3;  3OWY A;  1V58 A;  1HU9 A;  2LYX A;  3AGN A;  3EF8 A;  1UUW B;  2STD A;  3B4P A;  1SJW A; 
#chains in the Genus database with same CATH homology
 1X1X A;  5HOH A;  2F56 A;  1X1W A;  2F5M A;  3WHO A;  1BRG A;  1B20 A;  1TTO A;  1RCL A;  1RGF A;  1GSP A;  1BVI A;  1YNV X;  1UCL A;  3URP A;  8RNT A;  3D5G A;  1B2M A;  1B2U A;  9RNT A;  1YGW A;  1RDS A;  2KF3 A;  1RGG A;  2BU4 A;  1BIR A;  1IYY A;  1RGE A;  1I70 A;  1LOW A;  1RHL A;  1GOU A;  2BIR A;  1RMS A;  1A2P A;  1GMR A;  2GSP A;  1Q9E A;  1YVS A;  4GHO A;  2KAA A;  1JBR A;  1I2E A;  1BRI A;  1BOX A;  4BU4 A;  2KF6 A;  1BNI A;  2KF4 A;  1BSD A;  1FW7 A;  1BU4 A;  3GSP A;  1BNR A;  1UCJ A;  2KF5 A;  3WR2 A;  1PYL A;  1I2G A;  1BNF A;  1FZU A;  1HZ1 A;  4RNT A;  1RSN A;  1BUJ A;  2RNT A;  1LOY A;  3D5I A;  1R4Y A;  1RNT A;  1BSA A;  1JBT A;  1I0V A;  3HOH A;  1TRQ A;  1B2Z A;  1RGH A;  1BNE A;  3AHW A;  1BRK A;  1DET A;  2HOH A;  1JBS A;  4BIR A;  3BU4 A;  1X1U A;  1B3S A;  4HAA A;  1RNB A;  1PY3 A;  3DGY A;  1RCK A;  3A5E A;  2F5W A;  1X1Y A;  1BAN A;  1BRN L;  1BSC A;  4GSP A;  1G02 A;  1I2F A;  3Q3F A;  1I0X A;  1I3I A;  1LOV A;  1FUS A;  1T2H A;  1BRJ A;  1RGK A;  1BAO A;  1BRS A;  3BIR A;  1T2I A;  1B27 A;  1ZGX A;  1GOV A;  2F4Y A;  1RLS A;  1BNG A;  1RTU A;  5BIR A;  5BU4 A;  2C4B A;  3AHS A;  1C54 A;  1UCI A;  1RN4 A;  3RNT A;  1LRA A;  1I3F A;  1B2S A;  1HYF A;  1FYS A;  1RGL A;  2AAD A;  2ZA4 A;  1SAR A;  1DE3 A;  2SAR A;  2RBI A;  1TRP A;  1BNJ A;  1GOY A;  5GSP A;  1LNI A;  1AQZ A;  6GSP A;  1GMQ A;  4J5G A;  5RNT A;  1BSE A;  1B2X A;  1FUT A;  1BGS A;  1CH0 A;  1I8V A;  7RNT A;  3SYU A;  6RNT A;  1B21 A;  1MGR A;  3KCH A;  2AAE A;  1BSB A;  1MGW A;  4J5K A;  1BNS A;  1AY7 A;  1RGA A;  4HOH A;  3D4A A;  1RN1 A;  1GMP A;  1RGC A;  7GSP A;  1BRH A;  3AGN A;  3DH2 A;  3AGO A;  1UCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...