4WYKB

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
SVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 138
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykB00
3FLJA 3JUNA 3MSOA 2BMQB 1JN5A 1TP6A 7STDA 4ORLA 2K54A 4J8TA 4WYKB 3F40A 3LZAA 3FF2A 3B4PA 2A15A 3F14A 3NBRA 1W02A 1E97A 2F86B 4LEHA 2CKFB 3A76A 1E3RA 5CLKA 3MKIA 3EHCA 3SEDA 2JQ5A 2HMOB 3OWYA 3DMCA 8CHOA 2XSOB 2HMMB 3CPOA 3GWRA 2F99A 5EVHA 3G16A 3MHEA 1O7GB 3HK4A 3IPTA 2OWPA 5CF1A 2YFLB 2STDA 1U5OA 1W01A 1Z1SA 4R9LA 3DM8A 3DXOA 1NWWA 2YFIB 2BMOB 4LMIA 2HMNB 5AEUB 5DRVA 3GRDA 3D9RA 1OF5B 3F9SA 5DREA 1GY6A 3JUOA 4KVHA 3H3HA 3E99A 4L8OA 1OGZA 1O7WB 4HM1B 4XBTA 5CK6A 1E3VA 2GEXA 5JPPA 1NDOB 1O7NB 1Q40A 3KZTA 2HMKB 5IENA 5FW5A 5AI1A 2XSHB 3SOAA 4GB5A 3ER7A 4U13A 4I4KA 2Z7AA 1IDPA 3JUPA 4HM2B 4HM6B 4OVMA 4HZBB 1W6YA 4HM3B 3MG2A 3FSDA 3EN8A 1OGXA 3G8ZA 4XDWA 2UX0A 3B8LA 3H51A 3Q90A 1DMMA 3UNLA 2HMLB 5IERA 5G2GA 3BLZA 5KP3A 3EF8A 5IG3A 3VSYA 3F7SA 3ECFA 1CQSA 4FCJA 5JPUA 2RFRA 1OPYA 3G0KA 5IEOA 3B4OA 4R1KA 2XRXB 5IF6A 2QIYA 1JKGB 2BNGA 1ULIB 3F8HA 3EQQB 4WP5A 1HKXA 2GBXB 5KP1A 4XDVA 4HZ9B 3M8CA 2QGUA 3FGYA 3NV0A 1DMQA 2B1XB 3HX8A 1A2KA 2W2CA 1JN5B 3FKAA 5IG5A 1OCVA 1OHSA 1JB5A 5D82A 3F8XA 4Q53A 5D81A 2GBWB 3BB9A 3DUKA 4HM5B 4HKVB 3CU3A 1GS3A 4H3UA 4WYKA 1DMNA 6STDA 1UUWB 3CNMA 3OWSA 2Z77A 1Q42A 5IG0A 3B7CA 2RGQA 3GZYB 2INXA 3MYTA 1ZX2A 1OHPA 3NUVA 3KE7A 5STDA 2B24B 5KP4A 5TGNA 3WMDA 2GXFA 4L7KA 3MG3A 1AR0A 2I9WA 4XBXA 3F7XA 4STDA 4X2HA 3LYGA 1TUHA 4WWUC 1EA2A 3MG1A 3EBYA 4PEJA 4CDLA 5IG4A 2PZVA 1EG9B 3K7CA 5AIGA 3OWUA 4K1UA 4XM4A 3I0YA 3GZRA 5AIHA 3OX9A 1JB4A 3EC9A 4IIAA 4K1VA 4FCMA 3RGRA 5AIFA 1ULJB 1WQLB 1OF5A 4LGQA 1UUVB 1Q40B 3HZPA 3NXJA 5IEPA 4HVNA 2XR8B 4XB5A 3ROBA 5HGRA 3VGNA 4HM7B 3EN1B 4HM4B 1C7HA 2Z76A 4N3VA 3EX9A 5D83A 1BUQA 3KKGA 3S5CA 4HJLB 3JUMA 3JUQA 1ZO2A 2RCDA 1OHOA 4L8PA 4MJDA 2GEYA 1W00A 2CHCA 1GY7A 5BVBA 3UJMA 2IMJA 2BMRB 1NU3A 3NHXA 3FF0A 4J9AA 3EBTA 1VZZA 4R9KA 3FZWA 4XBYA 5AIIA 4X2OA 1O7MB 3GZXB 3K0ZA 3OXAA 2R4IA 1JB2A 1QMAA 4RZMA 3CNXA 1GYBA 3NM2A 5AEWB 3DZLA 5CF2A 3FH1A 1OH0A 1O7HB 3T8UA 4OUQA 3OV4A 1STDA 1ISKA 5CXOA 2YFJB 1JKGA 3NV0B 3SOYA 4HM8B 3KSPA 1OUNA 2HMJB 3STDA 1GY5A 3GZBA 5BXQA 1S5AA 4HM0B 1O7PB 1ASKA 2F98A 1K41A 1QJGA 3T8NA 3EJVA 3RGAA 1SJWA
chains in the Genus database with same CATH superfamily
1FYSA 3V92A 2F5MA 3FLJA 3JUNA 3G6E3 2ZDJA 3G4S3 1D6UA 3DGYA 1WMNA 1I0VA 2K0MA 3MSOA 2QA43 1RJOA 3WDGB 4BU4A 1LXEA 2BMQB 2ML5A 1WMPA 2SARA 3KN4A 1JN5A 1TP6A 7STDA 4ORLA 6GSPA 2K54A 4J8TA 4KFEA 3UL5A 2AAEA 1BRKA 4WYKB 2RBIA 3F40A 1AV4A 3LZAA 3RDEA 1IVXA 3FF2A 2GU1A 3B4PA 1UCJA 3LMLA 1K734 1IT7A 2A15A 3WODG 4IT7A 1YIT3 1R4YA 1NB5I 3F14A 5G1LA 1GD4A 3CXC2 3X42A 3NBRA 1W02A 3MPHA 1E97A 1CEWI 2F86B 4LEHA 4N6MA 3S28A 2CKFB 4O02B 1PYLA 2W6JH 3A76A 2CG1A 1MWRA 2H0GA 1B2ZA 1E3RA 2C4BA 5CLKA 1RNTA 6RNTA 1YVSA 3D5GA 3HOHA 3MKIA 3EHCA 3SEDA 1DVDA 1BSDA 2WOFA 3DGOA 2JQ5A 2XGLA 1VQP3 1AVLA 1IK3A 1IQYA 2HMOB 3KSED 1NJI4 1YI23 1RNBA 1HYFA 2IUJA 3OWYA 5BIRA 3N9HA 1V57A 3DMCA 8CHOA 1RCLA 2LQVA 1LNIA 2XGNA 1RGLA 4KFDA 4MMYB 1LNHA 2XSOB 4EV2A 2JDIH 2HMMB 1TIJA 3CPOA 4O8SA 1RHLA 1IV9A 3GWRA 2F99A 1LOYA 2ML6A 1W6CA 4FMBA 5BU4A 5EVHA 2CH9A 5LC6A 3G16A 1X1YA 3MHEA 1RGCA 4HYZA 1F8NA 1O7GB 4GSPA 3HK4A 4OK0A 2MF7A 3BNCA 3IPTA 1KD14 2OWPA 1MWTA 2O9UX 5CF1A 2L1SA 2YFLB 2WGQA 4HAAA 2STDA 1U5OA 4EXRA 1W01A 1Z1SA 4R9LA 4EBGA 3DH2A 4BTYA 5ELUA 2BU4A 1I3FA 3DM8A 1BUJA 1LQMB 1V58A 1VQK3 1BNJA 1YJN3 3DXOA 1CH0A 1NWWA 2Q07A 5GSPA 3BU4A 3ALAA 1STFI 2CFDA 1RTUA 2YFIB 2BMOB 4LMIA 2HMNB 2OQEC 3ZG5A 5AEUB 1MNLA 5DRVA 3CD63 3G713 4FMCA 3J7Yd 1C54A 3GRDA 3D9RA 2HOHA 1OF5B 3AGOA 5G1KA 5FGOA 3F9SA 3LTDA 1N5HA 1RGEA 3CCV3 3CC73 5DREA 1Q7Y4 7GSPA 2C10A 2W03A 2BHMA 1JRQA 1BNFA 2F5WA 3SYUA 2CFWA 3CCL3 1T2HA 2W56A 1EQKA 1GY6A 2MC8A 3JUOA 4KVHA 1BRGA 3E99A 3H3HA 4L8OA 1AQZA 1OGZA 3UB1A 2D42A 1TRQA 2CC3A 1O7WB 2D1WA 5M18A 1E3VA 4HM1B 1GOYA 4XBTA 2GEXA 5CK6A 4AKYA 5JPPA 2QEX3 1FA3A 2L4VA 1NDOB 4EC6A 1NNVA 1O7NB 3X3ZA 3BIRA 1D6YA 1Q40A 3KZTA 2C11A 1A67A 2HMKB 3N8BA 2M7OA 4FR9A 5FW5A 5IENA 1BNSA 1BIRA 5AI1A 3X3XA 2XSHB 3SOAA 1M1K4 2KF6A 4GB5A 4FCZA 4QWTA 3ER7A 1JJ22 4U13A 3A5EA 3CMA3 4I4KA 2Z7AA 1IDPA 2E2TA 2BO9B 3JUPA 4HM2B 4EW5A 4HM6B 1W5ZA 4H61A 4N6UA 4OVMA 1ROVA 2IYJA 4HZBB 3SLUA 3D3LA 1W6YA 2WGOA 2KAAA 3BNBA 1JZDA 3PGBA 4N6OB 4HM3B 4EYCA 3LT8A 3FSDA 3MG2A 1YJ93 4O3VA 1BGSA 3X41A 4GL6A 1I2EA 4LSOA 3EN8A 3BNDA 1A90A 1OGXA 3G8ZA 1VQ93 2W04A 4XDWA 3CC43 2UX0A 1RRHA 1JBTA 1GMRA 3B8LA 1B3SA 2O3OA 2KCDA 1A2PA 3H51A 3Q90A 3ZFZA 3WOFB 1DMMA 2CWUA 3UNLA 2HMLB 4BTXA 5IERA 5JBSA 3PYJA 1VQ73 5G2GA 2W9PA 3BLZA 1M9GA 3EF8A 5KP3A 5IG3A 4RNTA 3VSYA 4AEQA 1BNGA 1I3IA 1N5PA 3F7SA 4R80A 2IA7A 3IJEB 3ECFA 1CQSA 1LOVA 1SIHA 2E2UA 2LYXA 3Q3FA 4FCJA 2YX9A 4DKIA 1MWSA 1DYUA 5JPUA 2RFRA 1VQ43 1OPYA 1RGAA 1UGHI 1WTHA 3GSPA 3G0KA 1YVBI 1KWIA 4KZ1A 3AHWA 3LTCA 3NQYA 2W0QA 3K5TA 5IEOA 1BRNL 4HBRA 3B4OA 1W6GA 3T0UA 4R1KA 2XRXB 3AMOB 5IF6A 1IYYA 2J8XB 3D5IA 3ZG0A 1EUIC 2QIYA 1UCLA 1VQM3 1QAKA 1B2UA 2V1LA 1JKGB 1GOUA 2OOVA 1I2GA 3NQZA 3URPA 2BNGA 1U8CB 1VQO3 1ULIB 1BANA 3F8HA 3EB8A 3GAXA 1YGEA 2Y73A 2WO0A 4MMZB 3KCHA 1RDSA 1LVNA 2FGTA 3EQQB 4WP5A 1FGOA 1HKXA 1K28A 1V74A 2GBXB 2FNQA 4TX4A 5KP1A 1FZUA 1SQWA 2IY2A 4XDVA 1YNVX 4HZ9B 3M8CA 4ZM8A 2KF5A 2QGUA 1YJW3 1BRIA 1LOXA 3HIIA 3KIIA 3SX1A 2CG0A 3FGYA 1TJDA 3NV0A 1DMQA 2B1XB 3V99A 1RLSA 4WFOA 3U97A 3HX8A 1A2KA 1KSIA 1TRPA 3LOYA 1RN1A 1EKMA 2GU3A 2W2CA 5I97A 2CFLA 1BAOA 1FGTA 1JN5B 3FKAA 4JRFA 5IG5A 1OCVA 3FCSB 3NM7A 2XFSA 3O8YA 1OHSA 1IVVA 1NO3A 5LC7A 9RNTA 1JB5A 1D6ZA 1SIIA 3HI7A 4NREA 5D82A 2CWVA 1I2FA 3NBBA 3CC23 3WA2X 3F8XA 3QRDA 3LT9A 4Q53A 1IVWA 1VQ63 2CX1A 1YIJ3 1BVIA 1MGWA 1TFOA 1UCIA 1RMSA 5D81A 1QVG2 2GBWB 3PS8A 1AY7A 3BB9A 2BT3A 2Y74A 3Q1CA 3CCJ3 2F4YA 2BIRA 3DUKA 3MWZA 4HM5B 4HKVB 4KFFA 2W9QA 3KFQC 1FUTA 3CU3A 3U1WA 3CCQ3 1GS3A 3FG1A 4H3UA 1DMNA 4WYKA 6STDA 2WOHA 1FW7A 1UUWB 3CNMA 3OWSA 5AYSC 1TTOA 3DGNA 2Z77A 1Q42A 2P0MA 1KC84 3S67A 1VQL3 1WNHA 1Q9EA 1RGKA 1VQN3 5IG0A 3B7CA 2RGQA 3D4AA 1OACA 3GZYB 3NBJA 4KT3B 1MGRA 1DE3A 2INXA 1PFPA 1Y4KA 1MOLA 1ZS7A 1RKYA 1J2BA 2P38A 3CCE3 3MYTA 1RGFA 1ZX2A 5HOHA 3JVCA 1OHPA 1RGHA 3NUVA 3KE7A 2OTL3 1LQGC 2RNTA 1UI7A 2B24B 5STDA 1AVKA 3WA3A 1CYUA 5KP4A 1BRSA 3WR2A 1YHQ3 1BOXA 1ROAA 5TGNA 2XF3A 3WMDA 1VQQA 2CFGA 2GXFA 4L7KA 1T3BA 2KF3A 3MG3A 3TDGA 1AR0A 2I9WA 4LYLB 2ZHXB 1B27A 3HIGA 4FMAA 3K63A 4XBXA 3F7XA 4STDA 4X2HA 1W7CA 3LYGA 1TUHA 4WWUC 1M904 1QALA 1EA2A 1QAFA 3MG1A 2P09A 3S29A 4J5KA 3EBYA 3EE1A 1BNEA 4PEJA 4CDLA 2F56A 3WOEB 1YGWA 3X40A 5IG4A 4RNYA 3X3YA 1CYVA 2PZVA 1EG9B 3AHSA 3K7CA 5AIGA 1Q864 3V98A 1N8QA 3LTBA 3OWUA 4CPKA 4BIRA 4K1UA 4XM4A 1RCKA 2CW9A 3IMAB 3I0YA 2ZL8A 4BTWA 2AADA 1FUWA 3GZRA 5M19A 1DVCA 1PY3A 5AIHA 1TU5A 1I0XA 3OX9A 2KXGA 1BSEA 1JB4A 1GMPA 3L0RA 5A0OB 4ILFA 2P0XA 4I5QA 8RNTA 1FGMA 3EC9A 1US1A 4IIAA 4O2HA 1G02A 2W56B 4K1VA 3PCRA 3RNTA 2UUGC 4FCMA 1FGQA 2CWTA 1G0TA 1Q7HA 1IT8A 5AIFA 1TFKA 2CIUA 1ULJB 2CFKA 3RGRA 4CCVA 3CCR3 1JBRA 2OQEA 1WQLB 1OF5A 4LGQA 3I553 2XEPA 3DY5A 1B2MA 4CJNA 4LZIA 1EEJA 2OTJ3 1Q814 4NHFA 2E2VA 4R4KA 1L5GB 1I70A 1UUVB 1Q40B 3FG4A 3HZPA 1W2ZA 3NXJA 5IEPA 4HVNA 2XR8B 4N6TA 4XB5A 3UL6A 3VF1A 4BL3A 3LH4A 3ROBA 3CCS3 5HGRA 1PU4A 3VGNA 2RSXA 1N9EA 2IUKA 3EN1B 3Q2PA 4HM4B 4HM7B 5EEOA 3DGMA 1C7HA 1HU9A 3QK9A 2CX0A 1LOWA 1IVUA 4J5GA 1LRAA 2Z76A 1BSCA 4N3VA 4IPBA 1VQ83 3EX9A 1T5YA 2OCTA 1SARA 2GSPA 3DGLA 5D83A 1UUGB 2H0HA 1W2B2 1JBSA 3PCSA 3CME3 1UI8A 4K61A 1BUQA 1HZ1A 3PXMA 4RNZA 1FUSA 1GD3A 3KKGA 4HJLB 3S5CA 2PNCA 3WHOA 1BU4A 3FG3A 1S723 1W4NA 4NPBA 3JUMA 3JUQA 1ZO2A 2RCDA 1OHOA 1SPUA 4L8PA 1DETA 4MJDA 2GEYA 1RN7A 1UDII 3D79A 1W00A 4N6LA 4K90B 1UW1A 2SBLA 2FXTA 2CHCA 3SVAA 1GY7A 5BVBA 1N9JA 3CCM3 1X1XA 4RBNA 3BNEA 2IMJA 3UJMA 4MEIA 2BMRB 1I8VA 1NU3A 4G1MB 5IW9A 1Q824 1BNIA 3NHXA 1IU7A 1BSBA 1RRLA 3LXUX 3FF0A 1UCKA 3NX0A 5RNTA 3CPW2 3AGNA 4J9AA 1B21A 2R41A 3EBTA 5M1AA 4HOHA 1VZZA 4R9KA 1NB3I 5ELJA 3FZWA 1GMQA 1BRJA 1R4CA 1X1UA 1BSAA 2P05A 1G96A 2KRTA 1A2VA 4XBYA 1RN4A 3N54B 1IV7A 5AIIA 1GOVA 4X2OA 4N6V0 1O7MB 1JNQA 2OOVC 1BRHA 2XFTA 2K3DA 4BL2A 1MWUA 3GZXB 3K0ZA 1JV2B 1IQXA 1VQ53 3OXAA 2R4IA 1JB2A 2ZA4A 1RSNA 1QMAA 1ZGXA 4RZMA 4JF8A 1T2IA 1GYBA 3CNXA 3S27A 3NM2A 1M1XB 3DZLA 5AEWB 5CF2A 1WMOA 3SXXA 3FH1A 4WHAA 1UGIA 1QVF2 3AMOA 4FMDA 1RGGA 1OH0A 3PZWA 4EV5A 3CCU3 1O7HB 3T8UA 1JZOA 4OUQA 5AYRB 3OV4A 1STDA 1ISKA 1K8A4 2H0IA 1JKGA 2YFJB 3NV0B 1B2XA 4HM8B 5CXOA 3K9MC 3SOYA 1K9M4 1KQS2 3KSPA 1OUNA 2HMJB 3STDA 1X1WA 2KF4A 1GY5A 1B20A 2XH9A 1FGRA 2CK3H 1B2SA 3GZBA 4GHOA 2UGIA 3OW22 1GSPA 5BXQA 2Z6BA 1N8R4 1BNRA 1S5AA 4HM0B 4AKZA 3LTAA 4MMXB 4N6NB 1O7PB 1ASKA 2F98A 5EQLA 1IQ8A 1K41A 1QJGA 3T8NA 7RNTA 3EJVA 3I563 3RGAA 1SJWA
chains in the Genus database with same CATH topology
3V92A 3FLJA 3JUNA 3G6E3 2ZDJA 3G4S3 1D6UA 3MSOA 1WMNA 2K0MA 2QA43 1RJOA 3WDGB 1LXEA 2BMQB 2ML5A 1WMPA 3KN4A 1JN5A 1TP6A 7STDA 4ORLA 2K54A 4J8TA 4KFEA 3UL5A 4WYKB 3F40A 1AV4A 3LZAA 3RDEA 1IVXA 3FF2A 2GU1A 3B4PA 3LMLA 1K734 1IT7A 2A15A 3WODG 4IT7A 1YIT3 1NB5I 3F14A 1GD4A 3CXC2 3X42A 3NBRA 1W02A 3MPHA 1E97A 1CEWI 2F86B 4LEHA 4N6MA 3S28A 2CKFB 4O02B 2W6JH 3A76A 2CG1A 1E3RA 5CLKA 3MKIA 3EHCA 3SEDA 1DVDA 2WOFA 3DGOA 2JQ5A 2XGLA 1VQP3 1AVLA 1IK3A 1IQYA 2HMOB 3KSED 1NJI4 1YI23 2IUJA 3OWYA 3N9HA 3DMCA 8CHOA 2LQVA 2XGNA 4KFDA 4MMYB 1LNHA 2XSOB 4EV2A 2JDIH 2HMMB 1TIJA 3CPOA 4O8SA 1IV9A 3GWRA 2F99A 2ML6A 1W6CA 4FMBA 5EVHA 2CH9A 5LC6A 3G16A 3MHEA 4HYZA 1F8NA 1O7GB 3HK4A 4OK0A 2MF7A 3BNCA 3IPTA 1KD14 2OWPA 2O9UX 5CF1A 2YFLB 2WGQA 2STDA 1U5OA 4EXRA 1W01A 1Z1SA 4R9LA 4EBGA 4BTYA 5ELUA 3DM8A 1VQK3 1YJN3 3DXOA 1NWWA 2Q07A 3ALAA 1STFI 2CFDA 2YFIB 2BMOB 4LMIA 2HMNB 2OQEC 5AEUB 1MNLA 5DRVA 3CD63 3G713 4FMCA 3J7Yd 3GRDA 3D9RA 1OF5B 5FGOA 3F9SA 3LTDA 1N5HA 3CCV3 3CC73 5DREA 1Q7Y4 2C10A 2W03A 2BHMA 1JRQA 2CFWA 3CCL3 2W56A 1EQKA 1GY6A 2MC8A 3JUOA 4KVHA 3H3HA 3E99A 4L8OA 1OGZA 3UB1A 2D42A 2CC3A 1O7WB 2D1WA 1E3VA 4HM1B 4XBTA 5CK6A 2GEXA 4AKYA 5JPPA 2QEX3 1FA3A 2L4VA 1NDOB 4EC6A 1O7NB 3X3ZA 1D6YA 1Q40A 3KZTA 2C11A 1A67A 2HMKB 3N8BA 2M7OA 4FR9A 5FW5A 5IENA 5AI1A 3X3XA 2XSHB 3SOAA 1M1K4 4GB5A 4FCZA 4QWTA 3ER7A 1JJ22 4U13A 3CMA3 4I4KA 2Z7AA 1IDPA 2E2TA 2BO9B 3JUPA 4HM2B 4HM6B 1W5ZA 4H61A 4N6UA 4OVMA 1ROVA 4HZBB 3SLUA 3D3LA 1W6YA 2WGOA 3BNBA 3PGBA 4N6OB 4HM3B 4EYCA 3LT8A 3FSDA 3MG2A 1YJ93 4O3VA 3X41A 4GL6A 4LSOA 3EN8A 3BNDA 1A90A 1OGXA 3G8ZA 1VQ93 2W04A 4XDWA 3CC43 2UX0A 1RRHA 3B8LA 2O3OA 2KCDA 3H51A 3Q90A 3WOFB 1DMMA 2CWUA 3UNLA 2HMLB 4BTXA 5IERA 5JBSA 3PYJA 1VQ73 5G2GA 2W9PA 3BLZA 1M9GA 3EF8A 5KP3A 5IG3A 3VSYA 4AEQA 1N5PA 4R80A 3F7SA 2IA7A 3IJEB 3ECFA 1CQSA 1SIHA 2E2UA 2LYXA 4FCJA 2YX9A 1DYUA 5JPUA 2RFRA 1VQ43 1OPYA 1WTHA 3G0KA 1YVBI 1KWIA 4KZ1A 3LTCA 3NQYA 2W0QA 3K5TA 5IEOA 4HBRA 3B4OA 1W6GA 3T0UA 4R1KA 2XRXB 3AMOB 5IF6A 2QIYA 1VQM3 1QAKA 2V1LA 1JKGB 2OOVA 3NQZA 2BNGA 1U8CB 1VQO3 1ULIB 3F8HA 3EB8A 3GAXA 1YGEA 2Y73A 2WO0A 4MMZB 1LVNA 2FGTA 3EQQB 4WP5A 1FGOA 1HKXA 1K28A 1V74A 2GBXB 2FNQA 4TX4A 5KP1A 4XDVA 1SQWA 4HZ9B 3M8CA 4ZM8A 2QGUA 1YJW3 1LOXA 3HIIA 3KIIA 3SX1A 2CG0A 3FGYA 3NV0A 1DMQA 2B1XB 3V99A 4WFOA 3U97A 3HX8A 1A2KA 1KSIA 3LOYA 1EKMA 2GU3A 2W2CA 5I97A 2CFLA 1FGTA 1JN5B 3FKAA 4JRFA 5IG5A 1OCVA 3FCSB 3NM7A 2XFSA 3O8YA 1OHSA 1IVVA 1NO3A 5LC7A 1JB5A 1D6ZA 1SIIA 3HI7A 4NREA 5D82A 2CWVA 3NBBA 3CC23 3WA2X 3F8XA 3QRDA 3LT9A 4Q53A 1IVWA 1VQ63 1YIJ3 1TFOA 5D81A 1QVG2 2GBWB 3PS8A 3BB9A 2BT3A 2Y74A 3Q1CA 3CCJ3 3DUKA 3MWZA 4HM5B 4HKVB 4KFFA 2W9QA 3KFQC 3CU3A 3U1WA 3CCQ3 1GS3A 3FG1A 4H3UA 1DMNA 4WYKA 6STDA 2WOHA 1UUWB 3CNMA 3OWSA 5AYSC 3DGNA 2Z77A 1Q42A 2P0MA 1KC84 3S67A 1VQL3 1WNHA 1VQN3 5IG0A 3B7CA 2RGQA 1OACA 3GZYB 3NBJA 2INXA 1PFPA 1Y4KA 1MOLA 1RKYA 1J2BA 2P38A 3CCE3 3MYTA 1ZX2A 3JVCA 1OHPA 3NUVA 3KE7A 2OTL3 5STDA 1UI7A 2B24B 3WA3A 1AVKA 1CYUA 5KP4A 1YHQ3 1ROAA 5TGNA 2XF3A 3WMDA 2GXFA 2CFGA 4L7KA 3MG3A 3TDGA 1AR0A 2I9WA 3HIGA 4XBXA 4FMAA 3K63A 3F7XA 4STDA 4X2HA 1W7CA 3LYGA 1TUHA 4WWUC 1M904 1QALA 1EA2A 1QAFA 3MG1A 2P09A 3S29A 3EBYA 3EE1A 4PEJA 4CDLA 3WOEB 3X40A 5IG4A 4RNYA 3X3YA 1CYVA 2PZVA 1EG9B 3K7CA 5AIGA 1Q864 3V98A 1N8QA 3LTBA 3OWUA 4K1UA 4XM4A 2CW9A 3IMAB 3I0YA 2ZL8A 4BTWA 1FUWA 3GZRA 1DVCA 5AIHA 1TU5A 3OX9A 2KXGA 1JB4A 3L0RA 5A0OB 2P0XA 1FGMA 3EC9A 1US1A 4IIAA 4O2HA 2W56B 4K1VA 3PCRA 4FCMA 1FGQA 2CWTA 3RGRA 1IT8A 5AIFA 1TFKA 2CIUA 1ULJB 2CFKA 4CCVA 3CCR3 2OQEA 1WQLB 1OF5A 4LGQA 3I553 2XEPA 3DY5A 4LZIA 2OTJ3 1Q814 4NHFA 2E2VA 4R4KA 1L5GB 1UUVB 1Q40B 3FG4A 3HZPA 1W2ZA 3NXJA 5IEPA 4HVNA 2XR8B 4N6TA 4XB5A 3UL6A 3VF1A 3LH4A 3ROBA 3CCS3 5HGRA 1PU4A 3VGNA 2RSXA 1N9EA 2IUKA 3EN1B 3Q2PA 4HM4B 4HM7B 5EEOA 3DGMA 1C7HA 1HU9A 3QK9A 1IVUA 2Z76A 4N3VA 4IPBA 1VQ83 3EX9A 1T5YA 2OCTA 3DGLA 5D83A 1W2B2 3PCSA 3CME3 1UI8A 4K61A 1BUQA 3PXMA 4RNZA 1GD3A 3KKGA 3S5CA 4HJLB 2PNCA 3FG3A 1S723 1W4NA 3JUMA 3JUQA 1ZO2A 2RCDA 1OHOA 1SPUA 4L8PA 4MJDA 2GEYA 1RN7A 1W00A 4N6LA 4K90B 1UW1A 2SBLA 2FXTA 2CHCA 3SVAA 1GY7A 5BVBA 1N9JA 3CCM3 4RBNA 3BNEA 2IMJA 3UJMA 4MEIA 2BMRB 4G1MB 1NU3A 5IW9A 1Q824 3NHXA 1IU7A 1RRLA 3LXUX 3FF0A 3NX0A 3CPW2 4J9AA 3EBTA 1VZZA 4R9KA 1NB3I 5ELJA 3FZWA 1R4CA 2P05A 1G96A 2KRTA 1A2VA 4XBYA 3N54B 5AIIA 1IV7A 4X2OA 4N6V0 1O7MB 1JNQA 2OOVC 2XFTA 3GZXB 3K0ZA 1JV2B 1IQXA 1VQ53 3OXAA 2R4IA 1JB2A 1QMAA 4RZMA 4JF8A 3CNXA 1GYBA 3S27A 3NM2A 1M1XB 3DZLA 5AEWB 5CF2A 1WMOA 3SXXA 3FH1A 4WHAA 1QVF2 3AMOA 4FMDA 1OH0A 3PZWA 4EV5A 3CCU3 1O7HB 3T8UA 4OUQA 5AYRB 3OV4A 1STDA 1ISKA 1K8A4 2YFJB 1JKGA 3NV0B 4HM8B 5CXOA 3SOYA 1K9M4 3K9MC 1KQS2 3KSPA 1OUNA 2HMJB 3STDA 1GY5A 2XH9A 2CK3H 1FGRA 3OW22 3GZBA 5BXQA 2Z6BA 1N8R4 1S5AA 4HM0B 4AKZA 3LTAA 4MMXB 4N6NB 1O7PB 1ASKA 2F98A 5EQLA 1IQ8A 1K41A 1QJGA 3T8NA 3EJVA 3I563 3RGAA 1SJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FLJ A;  3JUN A;  3MSO A;  2BMQ B;  1JN5 A;  1TP6 A;  7STD A;  4ORL A;  2K54 A;  4J8T A;  4WYK B;  3F40 A;  3LZA A;  3FF2 A;  3B4P A;  2A15 A;  3F14 A;  3NBR A;  1W02 A;  1E97 A;  2F86 B;  4LEH A;  2CKF B;  3A76 A;  1E3R A;  5CLK A;  3MKI A;  3EHC A;  3SED A;  2JQ5 A;  2HMO B;  3OWY A;  3DMC A;  8CHO A;  2XSO B;  2HMM B;  3CPO A;  3GWR A;  2F99 A;  5EVH A;  3G16 A;  3MHE A;  1O7G B;  3HK4 A;  3IPT A;  2OWP A;  5CF1 A;  2YFL B;  2STD A;  1U5O A;  1W01 A;  1Z1S A;  4R9L A;  3DM8 A;  3DXO A;  1NWW A;  2YFI B;  2BMO B;  4LMI A;  2HMN B;  5AEU B;  5DRV A;  3GRD A;  3D9R A;  1OF5 B;  3F9S A;  5DRE A;  1GY6 A;  3JUO A;  4KVH A;  3H3H A;  3E99 A;  4L8O A;  1OGZ A;  1O7W B;  4HM1 B;  4XBT A;  5CK6 A;  1E3V A;  2GEX A;  5JPP A;  1NDO B;  1O7N B;  1Q40 A;  3KZT A;  2HMK B;  5IEN A;  5FW5 A;  5AI1 A;  2XSH B;  3SOA A;  4GB5 A;  3ER7 A;  4U13 A;  4I4K A;  2Z7A A;  1IDP A;  3JUP A;  4HM2 B;  4HM6 B;  4OVM A;  4HZB B;  1W6Y A;  4HM3 B;  3MG2 A;  3FSD A;  3EN8 A;  1OGX A;  3G8Z A;  4XDW A;  2UX0 A;  3B8L A;  3H51 A;  3Q90 A;  1DMM A;  3UNL A;  2HML B;  5IER A;  5G2G A;  3BLZ A;  5KP3 A;  3EF8 A;  5IG3 A;  3VSY A;  3F7S A;  3ECF A;  1CQS A;  4FCJ A;  5JPU A;  2RFR A;  1OPY A;  3G0K A;  5IEO A;  3B4O A;  4R1K A;  2XRX B;  5IF6 A;  2QIY A;  1JKG B;  2BNG A;  1ULI B;  3F8H A;  3EQQ B;  4WP5 A;  1HKX A;  2GBX B;  5KP1 A;  4XDV A;  4HZ9 B;  3M8C A;  2QGU A;  3FGY A;  3NV0 A;  1DMQ A;  2B1X B;  3HX8 A;  1A2K A;  2W2C A;  1JN5 B;  3FKA A;  5IG5 A;  1OCV A;  1OHS A;  1JB5 A;  5D82 A;  3F8X A;  4Q53 A;  5D81 A;  2GBW B;  3BB9 A;  3DUK A;  4HM5 B;  4HKV B;  3CU3 A;  1GS3 A;  4H3U A;  4WYK A;  1DMN A;  6STD A;  1UUW B;  3CNM A;  3OWS A;  2Z77 A;  1Q42 A;  5IG0 A;  3B7C A;  2RGQ A;  3GZY B;  2INX A;  3MYT A;  1ZX2 A;  1OHP A;  3NUV A;  3KE7 A;  5STD A;  2B24 B;  5KP4 A;  5TGN A;  3WMD A;  2GXF A;  4L7K A;  3MG3 A;  1AR0 A;  2I9W A;  4XBX A;  3F7X A;  4STD A;  4X2H A;  3LYG A;  1TUH A;  4WWU C;  1EA2 A;  3MG1 A;  3EBY A;  4PEJ A;  4CDL A;  5IG4 A;  2PZV A;  1EG9 B;  3K7C A;  5AIG A;  3OWU A;  4K1U A;  4XM4 A;  3I0Y A;  3GZR A;  5AIH A;  3OX9 A;  1JB4 A;  3EC9 A;  4IIA A;  4K1V A;  4FCM A;  3RGR A;  5AIF A;  1ULJ B;  1WQL B;  1OF5 A;  4LGQ A;  1UUV B;  1Q40 B;  3HZP A;  3NXJ A;  5IEP A;  4HVN A;  2XR8 B;  4XB5 A;  3ROB A;  5HGR A;  3VGN A;  4HM7 B;  3EN1 B;  4HM4 B;  1C7H A;  2Z76 A;  4N3V A;  3EX9 A;  5D83 A;  1BUQ A;  3KKG A;  3S5C A;  4HJL B;  3JUM A;  3JUQ A;  1ZO2 A;  2RCD A;  1OHO A;  4L8P A;  4MJD A;  2GEY A;  1W00 A;  2CHC A;  1GY7 A;  5BVB A;  3UJM A;  2IMJ A;  2BMR B;  1NU3 A;  3NHX A;  3FF0 A;  4J9A A;  3EBT A;  1VZZ A;  4R9K A;  3FZW A;  4XBY A;  5AII A;  4X2O A;  1O7M B;  3GZX B;  3K0Z A;  3OXA A;  2R4I A;  1JB2 A;  1QMA A;  4RZM A;  3CNX A;  1GYB A;  3NM2 A;  5AEW B;  3DZL A;  5CF2 A;  3FH1 A;  1OH0 A;  1O7H B;  3T8U A;  4OUQ A;  3OV4 A;  1STD A;  1ISK A;  5CXO A;  2YFJ B;  1JKG A;  3NV0 B;  3SOY A;  4HM8 B;  3KSP A;  1OUN A;  2HMJ B;  3STD A;  1GY5 A;  3GZB A;  5BXQ A;  1S5A A;  4HM0 B;  1O7P B;  1ASK A;  2F98 A;  1K41 A;  1QJG A;  3T8N A;  3EJV A;  3RGA A;  1SJW A; 
#chains in the Genus database with same CATH topology
 1FYS A;  3V92 A;  2F5M A;  3FLJ A;  3JUN A;  3G6E 3;  2ZDJ A;  3G4S 3;  1D6U A;  3DGY A;  1WMN A;  1I0V A;  2K0M A;  3MSO A;  2QA4 3;  1RJO A;  3WDG B;  4BU4 A;  1LXE A;  2BMQ B;  2ML5 A;  1WMP A;  2SAR A;  3KN4 A;  1JN5 A;  1TP6 A;  7STD A;  4ORL A;  6GSP A;  2K54 A;  4J8T A;  4KFE A;  3UL5 A;  2AAE A;  1BRK A;  4WYK B;  2RBI A;  3F40 A;  1AV4 A;  3LZA A;  3RDE A;  1IVX A;  3FF2 A;  2GU1 A;  3B4P A;  1UCJ A;  3LML A;  1K73 4;  1IT7 A;  2A15 A;  3WOD G;  4IT7 A;  1YIT 3;  1R4Y A;  1NB5 I;  3F14 A;  5G1L A;  1GD4 A;  3CXC 2;  3X42 A;  3NBR A;  1W02 A;  3MPH A;  1E97 A;  1CEW I;  2F86 B;  4LEH A;  4N6M A;  3S28 A;  2CKF B;  4O02 B;  1PYL A;  2W6J H;  3A76 A;  2CG1 A;  1MWR A;  2H0G A;  1B2Z A;  1E3R A;  2C4B A;  5CLK A;  1RNT A;  6RNT A;  1YVS A;  3D5G A;  3HOH A;  3MKI A;  3EHC A;  3SED A;  1DVD A;  1BSD A;  2WOF A;  3DGO A;  2JQ5 A;  2XGL A;  1VQP 3;  1AVL A;  1IK3 A;  1IQY A;  2HMO B;  3KSE D;  1NJI 4;  1YI2 3;  1RNB A;  1HYF A;  2IUJ A;  3OWY A;  5BIR A;  3N9H A;  1V57 A;  3DMC A;  8CHO A;  1RCL A;  2LQV A;  1LNI A;  2XGN A;  1RGL A;  4KFD A;  4MMY B;  1LNH A;  2XSO B;  4EV2 A;  2JDI H;  2HMM B;  1TIJ A;  3CPO A;  4O8S A;  1RHL A;  1IV9 A;  3GWR A;  2F99 A;  1LOY A;  2ML6 A;  1W6C A;  4FMB A;  5BU4 A;  5EVH A;  2CH9 A;  5LC6 A;  3G16 A;  1X1Y A;  3MHE A;  1RGC A;  4HYZ A;  1F8N A;  1O7G B;  4GSP A;  3HK4 A;  4OK0 A;  2MF7 A;  3BNC A;  3IPT A;  1KD1 4;  2OWP A;  1MWT A;  2O9U X;  5CF1 A;  2L1S A;  2YFL B;  2WGQ A;  4HAA A;  2STD A;  1U5O A;  4EXR A;  1W01 A;  1Z1S A;  4R9L A;  4EBG A;  3DH2 A;  4BTY A;  5ELU A;  2BU4 A;  1I3F A;  3DM8 A;  1BUJ A;  1LQM B;  1V58 A;  1VQK 3;  1BNJ A;  1YJN 3;  3DXO A;  1CH0 A;  1NWW A;  2Q07 A;  5GSP A;  3BU4 A;  3ALA A;  1STF I;  2CFD A;  1RTU A;  2YFI B;  2BMO B;  4LMI A;  2HMN B;  2OQE C;  3ZG5 A;  5AEU B;  1MNL A;  5DRV A;  3CD6 3;  3G71 3;  4FMC A;  3J7Y d;  1C54 A;  3GRD A;  3D9R A;  2HOH A;  1OF5 B;  3AGO A;  5G1K A;  5FGO A;  3F9S A;  3LTD A;  1N5H A;  1RGE A;  3CCV 3;  3CC7 3;  5DRE A;  1Q7Y 4;  7GSP A;  2C10 A;  2W03 A;  2BHM A;  1JRQ A;  1BNF A;  2F5W A;  3SYU A;  2CFW A;  3CCL 3;  1T2H A;  2W56 A;  1EQK A;  1GY6 A;  2MC8 A;  3JUO A;  4KVH A;  1BRG A;  3E99 A;  3H3H A;  4L8O A;  1AQZ A;  1OGZ A;  3UB1 A;  2D42 A;  1TRQ A;  2CC3 A;  1O7W B;  2D1W A;  5M18 A;  1E3V A;  4HM1 B;  1GOY A;  4XBT A;  2GEX A;  5CK6 A;  4AKY A;  5JPP A;  2QEX 3;  1FA3 A;  2L4V A;  1NDO B;  4EC6 A;  1NNV A;  1O7N B;  3X3Z A;  3BIR A;  1D6Y A;  1Q40 A;  3KZT A;  2C11 A;  1A67 A;  2HMK B;  3N8B A;  2M7O A;  4FR9 A;  5FW5 A;  5IEN A;  1BNS A;  1BIR A;  5AI1 A;  3X3X A;  2XSH B;  3SOA A;  1M1K 4;  2KF6 A;  4GB5 A;  4FCZ A;  4QWT A;  3ER7 A;  1JJ2 2;  4U13 A;  3A5E A;  3CMA 3;  4I4K A;  2Z7A A;  1IDP A;  2E2T A;  2BO9 B;  3JUP A;  4HM2 B;  4EW5 A;  4HM6 B;  1W5Z A;  4H61 A;  4N6U A;  4OVM A;  1ROV A;  2IYJ A;  4HZB B;  3SLU A;  3D3L A;  1W6Y A;  2WGO A;  2KAA A;  3BNB A;  1JZD A;  3PGB A;  4N6O B;  4HM3 B;  4EYC A;  3LT8 A;  3FSD A;  3MG2 A;  1YJ9 3;  4O3V A;  1BGS A;  3X41 A;  4GL6 A;  1I2E A;  4LSO A;  3EN8 A;  3BND A;  1A90 A;  1OGX A;  3G8Z A;  1VQ9 3;  2W04 A;  4XDW A;  3CC4 3;  2UX0 A;  1RRH A;  1JBT A;  1GMR A;  3B8L A;  1B3S A;  2O3O A;  2KCD A;  1A2P A;  3H51 A;  3Q90 A;  3ZFZ A;  3WOF B;  1DMM A;  2CWU A;  3UNL A;  2HML B;  4BTX A;  5IER A;  5JBS A;  3PYJ A;  1VQ7 3;  5G2G A;  2W9P A;  3BLZ A;  1M9G A;  3EF8 A;  5KP3 A;  5IG3 A;  4RNT A;  3VSY A;  4AEQ A;  1BNG A;  1I3I A;  1N5P A;  3F7S A;  4R80 A;  2IA7 A;  3IJE B;  3ECF A;  1CQS A;  1LOV A;  1SIH A;  2E2U A;  2LYX A;  3Q3F A;  4FCJ A;  2YX9 A;  4DKI A;  1MWS A;  1DYU A;  5JPU A;  2RFR A;  1VQ4 3;  1OPY A;  1RGA A;  1UGH I;  1WTH A;  3GSP A;  3G0K A;  1YVB I;  1KWI A;  4KZ1 A;  3AHW A;  3LTC A;  3NQY A;  2W0Q A;  3K5T A;  5IEO A;  1BRN L;  4HBR A;  3B4O A;  1W6G A;  3T0U A;  4R1K A;  2XRX B;  3AMO B;  5IF6 A;  1IYY A;  2J8X B;  3D5I A;  3ZG0 A;  1EUI C;  2QIY A;  1UCL A;  1VQM 3;  1QAK A;  1B2U A;  2V1L A;  1JKG B;  1GOU A;  2OOV A;  1I2G A;  3NQZ A;  3URP A;  2BNG A;  1U8C B;  1VQO 3;  1ULI B;  1BAN A;  3F8H A;  3EB8 A;  3GAX A;  1YGE A;  2Y73 A;  2WO0 A;  4MMZ B;  3KCH A;  1RDS A;  1LVN A;  2FGT A;  3EQQ B;  4WP5 A;  1FGO A;  1HKX A;  1K28 A;  1V74 A;  2GBX B;  2FNQ A;  4TX4 A;  5KP1 A;  1FZU A;  1SQW A;  2IY2 A;  4XDV A;  1YNV X;  4HZ9 B;  3M8C A;  4ZM8 A;  2KF5 A;  2QGU A;  1YJW 3;  1BRI A;  1LOX A;  3HII A;  3KII A;  3SX1 A;  2CG0 A;  3FGY A;  1TJD A;  3NV0 A;  1DMQ A;  2B1X B;  3V99 A;  1RLS A;  4WFO A;  3U97 A;  3HX8 A;  1A2K A;  1KSI A;  1TRP A;  3LOY A;  1RN1 A;  1EKM A;  2GU3 A;  2W2C A;  5I97 A;  2CFL A;  1BAO A;  1FGT A;  1JN5 B;  3FKA A;  4JRF A;  5IG5 A;  1OCV A;  3FCS B;  3NM7 A;  2XFS A;  3O8Y A;  1OHS A;  1IVV A;  1NO3 A;  5LC7 A;  9RNT A;  1JB5 A;  1D6Z A;  1SII A;  3HI7 A;  4NRE A;  5D82 A;  2CWV A;  1I2F A;  3NBB A;  3CC2 3;  3WA2 X;  3F8X A;  3QRD A;  3LT9 A;  4Q53 A;  1IVW A;  1VQ6 3;  2CX1 A;  1YIJ 3;  1BVI A;  1MGW A;  1TFO A;  1UCI A;  1RMS A;  5D81 A;  1QVG 2;  2GBW B;  3PS8 A;  1AY7 A;  3BB9 A;  2BT3 A;  2Y74 A;  3Q1C A;  3CCJ 3;  2F4Y A;  2BIR A;  3DUK A;  3MWZ A;  4HM5 B;  4HKV B;  4KFF A;  2W9Q A;  3KFQ C;  1FUT A;  3CU3 A;  3U1W A;  3CCQ 3;  1GS3 A;  3FG1 A;  4H3U A;  1DMN A;  4WYK A;  6STD A;  2WOH A;  1FW7 A;  1UUW B;  3CNM A;  3OWS A;  5AYS C;  1TTO A;  3DGN A;  2Z77 A;  1Q42 A;  2P0M A;  1KC8 4;  3S67 A;  1VQL 3;  1WNH A;  1Q9E A;  1RGK A;  1VQN 3;  5IG0 A;  3B7C A;  2RGQ A;  3D4A A;  1OAC A;  3GZY B;  3NBJ A;  4KT3 B;  1MGR A;  1DE3 A;  2INX A;  1PFP A;  1Y4K A;  1MOL A;  1ZS7 A;  1RKY A;  1J2B A;  2P38 A;  3CCE 3;  3MYT A;  1RGF A;  1ZX2 A;  5HOH A;  3JVC A;  1OHP A;  1RGH A;  3NUV A;  3KE7 A;  2OTL 3;  1LQG C;  2RNT A;  1UI7 A;  2B24 B;  5STD A;  1AVK A;  3WA3 A;  1CYU A;  5KP4 A;  1BRS A;  3WR2 A;  1YHQ 3;  1BOX A;  1ROA A;  5TGN A;  2XF3 A;  3WMD A;  1VQQ A;  2CFG A;  2GXF A;  4L7K A;  1T3B A;  2KF3 A;  3MG3 A;  3TDG A;  1AR0 A;  2I9W A;  4LYL B;  2ZHX B;  1B27 A;  3HIG A;  4FMA A;  3K63 A;  4XBX A;  3F7X A;  4STD A;  4X2H A;  1W7C A;  3LYG A;  1TUH A;  4WWU C;  1M90 4;  1QAL A;  1EA2 A;  1QAF A;  3MG1 A;  2P09 A;  3S29 A;  4J5K A;  3EBY A;  3EE1 A;  1BNE A;  4PEJ A;  4CDL A;  2F56 A;  3WOE B;  1YGW A;  3X40 A;  5IG4 A;  4RNY A;  3X3Y A;  1CYV A;  2PZV A;  1EG9 B;  3AHS A;  3K7C A;  5AIG A;  1Q86 4;  3V98 A;  1N8Q A;  3LTB A;  3OWU A;  4CPK A;  4BIR A;  4K1U A;  4XM4 A;  1RCK A;  2CW9 A;  3IMA B;  3I0Y A;  2ZL8 A;  4BTW A;  2AAD A;  1FUW A;  3GZR A;  5M19 A;  1DVC A;  1PY3 A;  5AIH A;  1TU5 A;  1I0X A;  3OX9 A;  2KXG A;  1BSE A;  1JB4 A;  1GMP A;  3L0R A;  5A0O B;  4ILF A;  2P0X A;  4I5Q A;  8RNT A;  1FGM A;  3EC9 A;  1US1 A;  4IIA A;  4O2H A;  1G02 A;  2W56 B;  4K1V A;  3PCR A;  3RNT A;  2UUG C;  4FCM A;  1FGQ A;  2CWT A;  1G0T A;  1Q7H A;  1IT8 A;  5AIF A;  1TFK A;  2CIU A;  1ULJ B;  2CFK A;  3RGR A;  4CCV A;  3CCR 3;  1JBR A;  2OQE A;  1WQL B;  1OF5 A;  4LGQ A;  3I55 3;  2XEP A;  3DY5 A;  1B2M A;  4CJN A;  4LZI A;  1EEJ A;  2OTJ 3;  1Q81 4;  4NHF A;  2E2V A;  4R4K A;  1L5G B;  1I70 A;  1UUV B;  1Q40 B;  3FG4 A;  3HZP A;  1W2Z A;  3NXJ A;  5IEP A;  4HVN A;  2XR8 B;  4N6T A;  4XB5 A;  3UL6 A;  3VF1 A;  4BL3 A;  3LH4 A;  3ROB A;  3CCS 3;  5HGR A;  1PU4 A;  3VGN A;  2RSX A;  1N9E A;  2IUK A;  3EN1 B;  3Q2P A;  4HM4 B;  4HM7 B;  5EEO A;  3DGM A;  1C7H A;  1HU9 A;  3QK9 A;  2CX0 A;  1LOW A;  1IVU A;  4J5G A;  1LRA A;  2Z76 A;  1BSC A;  4N3V A;  4IPB A;  1VQ8 3;  3EX9 A;  1T5Y A;  2OCT A;  1SAR A;  2GSP A;  3DGL A;  5D83 A;  1UUG B;  2H0H A;  1W2B 2;  1JBS A;  3PCS A;  3CME 3;  1UI8 A;  4K61 A;  1BUQ A;  1HZ1 A;  3PXM A;  4RNZ A;  1FUS A;  1GD3 A;  3KKG A;  4HJL B;  3S5C A;  2PNC A;  3WHO A;  1BU4 A;  3FG3 A;  1S72 3;  1W4N A;  4NPB A;  3JUM A;  3JUQ A;  1ZO2 A;  2RCD A;  1OHO A;  1SPU A;  4L8P A;  1DET A;  4MJD A;  2GEY A;  1RN7 A;  1UDI I;  3D79 A;  1W00 A;  4N6L A;  4K90 B;  1UW1 A;  2SBL A;  2FXT A;  2CHC A;  3SVA A;  1GY7 A;  5BVB A;  1N9J A;  3CCM 3;  1X1X A;  4RBN A;  3BNE A;  2IMJ A;  3UJM A;  4MEI A;  2BMR B;  1I8V A;  1NU3 A;  4G1M B;  5IW9 A;  1Q82 4;  1BNI A;  3NHX A;  1IU7 A;  1BSB A;  1RRL A;  3LXU X;  3FF0 A;  1UCK A;  3NX0 A;  5RNT A;  3CPW 2;  3AGN A;  4J9A A;  1B21 A;  2R41 A;  3EBT A;  5M1A A;  4HOH A;  1VZZ A;  4R9K A;  1NB3 I;  5ELJ A;  3FZW A;  1GMQ A;  1BRJ A;  1R4C A;  1X1U A;  1BSA A;  2P05 A;  1G96 A;  2KRT A;  1A2V A;  4XBY A;  1RN4 A;  3N54 B;  1IV7 A;  5AII A;  1GOV A;  4X2O A;  4N6V 0;  1O7M B;  1JNQ A;  2OOV C;  1BRH A;  2XFT A;  2K3D A;  4BL2 A;  1MWU A;  3GZX B;  3K0Z A;  1JV2 B;  1IQX A;  1VQ5 3;  3OXA A;  2R4I A;  1JB2 A;  2ZA4 A;  1RSN A;  1QMA A;  1ZGX A;  4RZM A;  4JF8 A;  1T2I A;  1GYB A;  3CNX A;  3S27 A;  3NM2 A;  1M1X B;  3DZL A;  5AEW B;  5CF2 A;  1WMO A;  3SXX A;  3FH1 A;  4WHA A;  1UGI A;  1QVF 2;  3AMO A;  4FMD A;  1RGG A;  1OH0 A;  3PZW A;  4EV5 A;  3CCU 3;  1O7H B;  3T8U A;  1JZO A;  4OUQ A;  5AYR B;  3OV4 A;  1STD A;  1ISK A;  1K8A 4;  2H0I A;  1JKG A;  2YFJ B;  3NV0 B;  1B2X A;  4HM8 B;  5CXO A;  3K9M C;  3SOY A;  1K9M 4;  1KQS 2;  3KSP A;  1OUN A;  2HMJ B;  3STD A;  1X1W A;  2KF4 A;  1GY5 A;  1B20 A;  2XH9 A;  1FGR A;  2CK3 H;  1B2S A;  3GZB A;  4GHO A;  2UGI A;  3OW2 2;  1GSP A;  5BXQ A;  2Z6B A;  1N8R 4;  1BNR A;  1S5A A;  4HM0 B;  4AKZ A;  3LTA A;  4MMX B;  4N6N B;  1O7P B;  1ASK A;  2F98 A;  5EQL A;  1IQ8 A;  1K41 A;  1QJG A;  3T8N A;  7RNT A;  3EJV A;  3I56 3;  3RGA A;  1SJW A; 
#chains in the Genus database with same CATH homology
 3V92 A;  3FLJ A;  3JUN A;  3G6E 3;  2ZDJ A;  3G4S 3;  1D6U A;  3MSO A;  1WMN A;  2K0M A;  2QA4 3;  1RJO A;  3WDG B;  1LXE A;  2BMQ B;  2ML5 A;  1WMP A;  3KN4 A;  1JN5 A;  1TP6 A;  7STD A;  4ORL A;  2K54 A;  4J8T A;  4KFE A;  3UL5 A;  4WYK B;  3F40 A;  1AV4 A;  3LZA A;  3RDE A;  1IVX A;  3FF2 A;  2GU1 A;  3B4P A;  3LML A;  1K73 4;  1IT7 A;  2A15 A;  3WOD G;  4IT7 A;  1YIT 3;  1NB5 I;  3F14 A;  1GD4 A;  3CXC 2;  3X42 A;  3NBR A;  1W02 A;  3MPH A;  1E97 A;  1CEW I;  2F86 B;  4LEH A;  4N6M A;  3S28 A;  2CKF B;  4O02 B;  2W6J H;  3A76 A;  2CG1 A;  1E3R A;  5CLK A;  3MKI A;  3EHC A;  3SED A;  1DVD A;  2WOF A;  3DGO A;  2JQ5 A;  2XGL A;  1VQP 3;  1AVL A;  1IK3 A;  1IQY A;  2HMO B;  3KSE D;  1NJI 4;  1YI2 3;  2IUJ A;  3OWY A;  3N9H A;  3DMC A;  8CHO A;  2LQV A;  2XGN A;  4KFD A;  4MMY B;  1LNH A;  2XSO B;  4EV2 A;  2JDI H;  2HMM B;  1TIJ A;  3CPO A;  4O8S A;  1IV9 A;  3GWR A;  2F99 A;  2ML6 A;  1W6C A;  4FMB A;  5EVH A;  2CH9 A;  5LC6 A;  3G16 A;  3MHE A;  4HYZ A;  1F8N A;  1O7G B;  3HK4 A;  4OK0 A;  2MF7 A;  3BNC A;  3IPT A;  1KD1 4;  2OWP A;  2O9U X;  5CF1 A;  2YFL B;  2WGQ A;  2STD A;  1U5O A;  4EXR A;  1W01 A;  1Z1S A;  4R9L A;  4EBG A;  4BTY A;  5ELU A;  3DM8 A;  1VQK 3;  1YJN 3;  3DXO A;  1NWW A;  2Q07 A;  3ALA A;  1STF I;  2CFD A;  2YFI B;  2BMO B;  4LMI A;  2HMN B;  2OQE C;  5AEU B;  1MNL A;  5DRV A;  3CD6 3;  3G71 3;  4FMC A;  3J7Y d;  3GRD A;  3D9R A;  1OF5 B;  5FGO A;  3F9S A;  3LTD A;  1N5H A;  3CCV 3;  3CC7 3;  5DRE A;  1Q7Y 4;  2C10 A;  2W03 A;  2BHM A;  1JRQ A;  2CFW A;  3CCL 3;  2W56 A;  1EQK A;  1GY6 A;  2MC8 A;  3JUO A;  4KVH A;  3H3H A;  3E99 A;  4L8O A;  1OGZ A;  3UB1 A;  2D42 A;  2CC3 A;  1O7W B;  2D1W A;  1E3V A;  4HM1 B;  4XBT A;  5CK6 A;  2GEX A;  4AKY A;  5JPP A;  2QEX 3;  1FA3 A;  2L4V A;  1NDO B;  4EC6 A;  1O7N B;  3X3Z A;  1D6Y A;  1Q40 A;  3KZT A;  2C11 A;  1A67 A;  2HMK B;  3N8B A;  2M7O A;  4FR9 A;  5FW5 A;  5IEN A;  5AI1 A;  3X3X A;  2XSH B;  3SOA A;  1M1K 4;  4GB5 A;  4FCZ A;  4QWT A;  3ER7 A;  1JJ2 2;  4U13 A;  3CMA 3;  4I4K A;  2Z7A A;  1IDP A;  2E2T A;  2BO9 B;  3JUP A;  4HM2 B;  4HM6 B;  1W5Z A;  4H61 A;  4N6U A;  4OVM A;  1ROV A;  4HZB B;  3SLU A;  3D3L A;  1W6Y A;  2WGO A;  3BNB A;  3PGB A;  4N6O B;  4HM3 B;  4EYC A;  3LT8 A;  3FSD A;  3MG2 A;  1YJ9 3;  4O3V A;  3X41 A;  4GL6 A;  4LSO A;  3EN8 A;  3BND A;  1A90 A;  1OGX A;  3G8Z A;  1VQ9 3;  2W04 A;  4XDW A;  3CC4 3;  2UX0 A;  1RRH A;  3B8L A;  2O3O A;  2KCD A;  3H51 A;  3Q90 A;  3WOF B;  1DMM A;  2CWU A;  3UNL A;  2HML B;  4BTX A;  5IER A;  5JBS A;  3PYJ A;  1VQ7 3;  5G2G A;  2W9P A;  3BLZ A;  1M9G A;  3EF8 A;  5KP3 A;  5IG3 A;  3VSY A;  4AEQ A;  1N5P A;  4R80 A;  3F7S A;  2IA7 A;  3IJE B;  3ECF A;  1CQS A;  1SIH A;  2E2U A;  2LYX A;  4FCJ A;  2YX9 A;  1DYU A;  5JPU A;  2RFR A;  1VQ4 3;  1OPY A;  1WTH A;  3G0K A;  1YVB I;  1KWI A;  4KZ1 A;  3LTC A;  3NQY A;  2W0Q A;  3K5T A;  5IEO A;  4HBR A;  3B4O A;  1W6G A;  3T0U A;  4R1K A;  2XRX B;  3AMO B;  5IF6 A;  2QIY A;  1VQM 3;  1QAK A;  2V1L A;  1JKG B;  2OOV A;  3NQZ A;  2BNG A;  1U8C B;  1VQO 3;  1ULI B;  3F8H A;  3EB8 A;  3GAX A;  1YGE A;  2Y73 A;  2WO0 A;  4MMZ B;  1LVN A;  2FGT A;  3EQQ B;  4WP5 A;  1FGO A;  1HKX A;  1K28 A;  1V74 A;  2GBX B;  2FNQ A;  4TX4 A;  5KP1 A;  4XDV A;  1SQW A;  4HZ9 B;  3M8C A;  4ZM8 A;  2QGU A;  1YJW 3;  1LOX A;  3HII A;  3KII A;  3SX1 A;  2CG0 A;  3FGY A;  3NV0 A;  1DMQ A;  2B1X B;  3V99 A;  4WFO A;  3U97 A;  3HX8 A;  1A2K A;  1KSI A;  3LOY A;  1EKM A;  2GU3 A;  2W2C A;  5I97 A;  2CFL A;  1FGT A;  1JN5 B;  3FKA A;  4JRF A;  5IG5 A;  1OCV A;  3FCS B;  3NM7 A;  2XFS A;  3O8Y A;  1OHS A;  1IVV A;  1NO3 A;  5LC7 A;  1JB5 A;  1D6Z A;  1SII A;  3HI7 A;  4NRE A;  5D82 A;  2CWV A;  3NBB A;  3CC2 3;  3WA2 X;  3F8X A;  3QRD A;  3LT9 A;  4Q53 A;  1IVW A;  1VQ6 3;  1YIJ 3;  1TFO A;  5D81 A;  1QVG 2;  2GBW B;  3PS8 A;  3BB9 A;  2BT3 A;  2Y74 A;  3Q1C A;  3CCJ 3;  3DUK A;  3MWZ A;  4HM5 B;  4HKV B;  4KFF A;  2W9Q A;  3KFQ C;  3CU3 A;  3U1W A;  3CCQ 3;  1GS3 A;  3FG1 A;  4H3U A;  1DMN A;  4WYK A;  6STD A;  2WOH A;  1UUW B;  3CNM A;  3OWS A;  5AYS C;  3DGN A;  2Z77 A;  1Q42 A;  2P0M A;  1KC8 4;  3S67 A;  1VQL 3;  1WNH A;  1VQN 3;  5IG0 A;  3B7C A;  2RGQ A;  1OAC A;  3GZY B;  3NBJ A;  2INX A;  1PFP A;  1Y4K A;  1MOL A;  1RKY A;  1J2B A;  2P38 A;  3CCE 3;  3MYT A;  1ZX2 A;  3JVC A;  1OHP A;  3NUV A;  3KE7 A;  2OTL 3;  5STD A;  1UI7 A;  2B24 B;  3WA3 A;  1AVK A;  1CYU A;  5KP4 A;  1YHQ 3;  1ROA A;  5TGN A;  2XF3 A;  3WMD A;  2GXF A;  2CFG A;  4L7K A;  3MG3 A;  3TDG A;  1AR0 A;  2I9W A;  3HIG A;  4XBX A;  4FMA A;  3K63 A;  3F7X A;  4STD A;  4X2H A;  1W7C A;  3LYG A;  1TUH A;  4WWU C;  1M90 4;  1QAL A;  1EA2 A;  1QAF A;  3MG1 A;  2P09 A;  3S29 A;  3EBY A;  3EE1 A;  4PEJ A;  4CDL A;  3WOE B;  3X40 A;  5IG4 A;  4RNY A;  3X3Y A;  1CYV A;  2PZV A;  1EG9 B;  3K7C A;  5AIG A;  1Q86 4;  3V98 A;  1N8Q A;  3LTB A;  3OWU A;  4K1U A;  4XM4 A;  2CW9 A;  3IMA B;  3I0Y A;  2ZL8 A;  4BTW A;  1FUW A;  3GZR A;  1DVC A;  5AIH A;  1TU5 A;  3OX9 A;  2KXG A;  1JB4 A;  3L0R A;  5A0O B;  2P0X A;  1FGM A;  3EC9 A;  1US1 A;  4IIA A;  4O2H A;  2W56 B;  4K1V A;  3PCR A;  4FCM A;  1FGQ A;  2CWT A;  3RGR A;  1IT8 A;  5AIF A;  1TFK A;  2CIU A;  1ULJ B;  2CFK A;  4CCV A;  3CCR 3;  2OQE A;  1WQL B;  1OF5 A;  4LGQ A;  3I55 3;  2XEP A;  3DY5 A;  4LZI A;  2OTJ 3;  1Q81 4;  4NHF A;  2E2V A;  4R4K A;  1L5G B;  1UUV B;  1Q40 B;  3FG4 A;  3HZP A;  1W2Z A;  3NXJ A;  5IEP A;  4HVN A;  2XR8 B;  4N6T A;  4XB5 A;  3UL6 A;  3VF1 A;  3LH4 A;  3ROB A;  3CCS 3;  5HGR A;  1PU4 A;  3VGN A;  2RSX A;  1N9E A;  2IUK A;  3EN1 B;  3Q2P A;  4HM4 B;  4HM7 B;  5EEO A;  3DGM A;  1C7H A;  1HU9 A;  3QK9 A;  1IVU A;  2Z76 A;  4N3V A;  4IPB A;  1VQ8 3;  3EX9 A;  1T5Y A;  2OCT A;  3DGL A;  5D83 A;  1W2B 2;  3PCS A;  3CME 3;  1UI8 A;  4K61 A;  1BUQ A;  3PXM A;  4RNZ A;  1GD3 A;  3KKG A;  3S5C A;  4HJL B;  2PNC A;  3FG3 A;  1S72 3;  1W4N A;  3JUM A;  3JUQ A;  1ZO2 A;  2RCD A;  1OHO A;  1SPU A;  4L8P A;  4MJD A;  2GEY A;  1RN7 A;  1W00 A;  4N6L A;  4K90 B;  1UW1 A;  2SBL A;  2FXT A;  2CHC A;  3SVA A;  1GY7 A;  5BVB A;  1N9J A;  3CCM 3;  4RBN A;  3BNE A;  2IMJ A;  3UJM A;  4MEI A;  2BMR B;  4G1M B;  1NU3 A;  5IW9 A;  1Q82 4;  3NHX A;  1IU7 A;  1RRL A;  3LXU X;  3FF0 A;  3NX0 A;  3CPW 2;  4J9A A;  3EBT A;  1VZZ A;  4R9K A;  1NB3 I;  5ELJ A;  3FZW A;  1R4C A;  2P05 A;  1G96 A;  2KRT A;  1A2V A;  4XBY A;  3N54 B;  5AII A;  1IV7 A;  4X2O A;  4N6V 0;  1O7M B;  1JNQ A;  2OOV C;  2XFT A;  3GZX B;  3K0Z A;  1JV2 B;  1IQX A;  1VQ5 3;  3OXA A;  2R4I A;  1JB2 A;  1QMA A;  4RZM A;  4JF8 A;  3CNX A;  1GYB A;  3S27 A;  3NM2 A;  1M1X B;  3DZL A;  5AEW B;  5CF2 A;  1WMO A;  3SXX A;  3FH1 A;  4WHA A;  1QVF 2;  3AMO A;  4FMD A;  1OH0 A;  3PZW A;  4EV5 A;  3CCU 3;  1O7H B;  3T8U A;  4OUQ A;  5AYR B;  3OV4 A;  1STD A;  1ISK A;  1K8A 4;  2YFJ B;  1JKG A;  3NV0 B;  4HM8 B;  5CXO A;  3SOY A;  1K9M 4;  3K9M C;  1KQS 2;  3KSP A;  1OUN A;  2HMJ B;  3STD A;  1GY5 A;  2XH9 A;  2CK3 H;  1FGR A;  3OW2 2;  3GZB A;  5BXQ A;  2Z6B A;  1N8R 4;  1S5A A;  4HM0 B;  4AKZ A;  3LTA A;  4MMX B;  4N6N B;  1O7P B;  1ASK A;  2F98 A;  5EQL A;  1IQ8 A;  1K41 A;  1QJG A;  3T8N A;  3EJV A;  3I56 3;  3RGA A;  1SJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...