4WYKB

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
SVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 138
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykB00
2B24B 4OUQA 3OWYA 3GZBA 3MSOA 5AIIA 3MG2A 1Q42A 4XDWA 5IG0A 1SJWA 3MG1A 2Z7AA 4L8OA 1GYBA 3I0YA 1E97A 3EN8A 3JUPA 3UNLA 1OF5B 2XSHB 2XSOB 1CQSA 2Z76A 1AR0A 3KZTA 1GY7A 1O7NB 3CPOA 3EQQB 3B8LA 4LMIA 1UUWB 4KVHA 3KE7A 5G2GA 1ISKA 3F9SA 5D82A 3NUVA 5BVBA 4WWUC 2STDA 4R1KA 2OWPA 3IPTA 5AEWB 4XBXA 2HMJB 1ASKA 1VZZA 4STDA 3NBRA 5IEPA 1IDPA 3LZAA 3Q90A 3F14A 1TUHA 2YFJB 2GBWB 1HKXA 1ULIB 3CU3A 4HM7B 5DRVA 2F98A 1OHSA 4WP5A 4RZMA 5JPPA 2BMQB 3GZXB 3B4PA 1W6YA 3A76A 2A15A 2GBXB 4ORLA 1W02A 5JPUA 1JB2A 2HMNB 4K1UA 2XR8B 1ULJB 1JN5B 1Q40B 1W01A 4XM4A 1DMQA 4HM5B 3GRDA 1E3RA 5IF6A 3MG3A 3BB9A 3ER7A 3D9RA 3B4OA 5AIHA 1NWWA 8CHOA 4X2OA 3K0ZA 3HK4A 3JUNA 5DREA 3F8XA 4N3VA 3OV4A 3JUMA 4HM2B 5AEUB 5FW5A 3EHCA 2RCDA 3T8NA 3STDA 5IEOA 2F99A 1QJGA 5AI1A 4WYKB 5CF2A 3EBYA 1EG9B 1DMMA 4HM0B 1O7PB 4R9KA 1OUNA 4J9AA 3DMCA 1OF5A 1NU3A 3RGRA 3HZPA 5KP3A 5STDA 5KP4A 4K1VA 4FCMA 3FF2A 5D81A 3FSDA 1QMAA 3SOYA 3E99A 2BMOB 1BUQA 3FKAA 1WQLB 1NDOB 4LGQA 1TP6A 3DZLA 2PZVA 2HMKB 3GZRA 1ZO2A 3KKGA 2GXFA 3NV0B 4PEJA 3MKIA 1O7GB 1JB4A 4MJDA 4XBTA 3VSYA 1O7WB 1U5OA 5KP1A 2IMJA 4XB5A 3UJMA 2YFLB 3RGAA 2GEXA 1OCVA 2K54A 3F7XA 3FF0A 2HMLB 5IERA 3ROBA 4H3UA 3DXOA 4L7KA 3EJVA 3FGYA 3DUKA 2I9WA 3T8UA 1Z1SA 3B7CA 3F8HA 1STDA 3VGNA 1K41A 4HJLB 3F7SA 5CF1A 1GY6A 1OH0A 1DMNA 3OWUA 4L8PA 3H3HA 3NXJA 1OPYA 1JKGB 3JUOA 1UUVB 4HVNA 4R9LA 5IG5A 6STDA 2XRXB 4FCJA 5AIFA 1C7HA 3DM8A 2HMMB 5IG3A 3HX8A 4HZ9B 4OVMA 1ZX2A 4HM3B 1OHOA 5TGNA 2BMRB 3H51A 1S5AA 4XBYA 1OGZA 4WYKA 3G16A 3EN1B 4Q53A 3OWSA 1GS3A 3GWRA 2F86B 5CXOA 3JUQA 3FH1A 2JQ5A 3OXAA 5BXQA 2R4IA 3G0KA 5IENA 3FLJA 2RFRA 5CK6A 3EX9A 1W00A 4LEHA 2RGQA 3MYTA 1O7HB 5CLKA 4HM6B 3GZYB 4HM4B 4XDVA 2YFIB 3K7CA 4IIAA 5IG4A 7STDA 4U13A 1E3VA 2QIYA 2UX0A 3S5CA 3G8ZA 2QGUA 3CNMA 3NV0A 2INXA 4HM8B 2B1XB 1JB5A 4J8TA 4HM1B 2CKFB 3SEDA 3EBTA 3MHEA 3LYGA 2HMOB 3EF8A 3BLZA 5AIGA 1O7MB 3NM2A 3F40A 1A2KA 4X2HA 3NHXA 4HZBB 1OHPA 1EA2A 4HKVB 2CHCA 5D83A 2GEYA 2Z77A 1JN5A 1Q40A 3ECFA 3SOAA 3KSPA 1GY5A 4I4KA 1OGXA 3FZWA 3EC9A 4GB5A 2W2CA 4CDLA 5EVHA 3WMDA 1JKGA 2BNGA 3CNXA 3OX9A 5HGRA 3M8CA
chains in the Genus database with same CATH superfamily
2K0MA 2B24B 1FA3A 3HIIA 2V1LA 4OUQA 3OWYA 3GZBA 3MSOA 3X3YA 3DH2A 3HIGA 5AIIA 4NREA 1BOXA 1KSIA 1IVVA 1FZUA 1Q42A 3MG2A 1EUIC 3Q1CA 3Q3FA 3AHSA 4HBRA 1IK3A 2XGNA 2WO0A 1VQ63 4XDWA 5IG0A 4OK0A 4AEQA 1SJWA 2CX1A 2F5WA 3MG1A 4N6NB 2Z7AA 3S67A 1LXEA 3D4AA 1W6GA 1MWTA 2WOFA 1YIT3 2QEX3 1RJOA 3NBBA 4R4KA 1YVBI 2KF3A 3PS8A 3EB8A 1GYBA 4L8OA 3I0YA 1IU7A 4BU4A 1E97A 1CEWI 1Q824 3EN8A 2UUGC 5AYRB 3BNCA 1I2FA 2ML6A 1MGRA 1BVIA 1RGFA 3JUPA 1VQO3 3UNLA 1B2SA 1OACA 1OF5B 2XSHB 2XSOB 4QWTA 1CQSA 2Z76A 4WFOA 1AR0A 1T5YA 2J8XB 1IT8A 1LVNA 4IPBA 3KZTA 1DYUA 1ROVA 4R80A 2KF5A 1ZS7A 4EV5A 1GY7A 1O7NB 1RCKA 3CPOA 3EQQB 3B8LA 4LMIA 1T2HA 1RKYA 1UUWB 1A2PA 4KVHA 4LSOA 3DGLA 4RBNA 1I2GA 3KE7A 5G2GA 1D6YA 3LT9A 1LNIA 1ISKA 1UUGB 1R4CA 1BRGA 3F9SA 3SXXA 3MWZA 5D82A 2L1SA 1EKMA 3NUVA 5BVBA 1VQ93 4WWUC 3LT8A 2STDA 4R1KA 4BTYA 2C11A 1BU4A 1YVSA 2CFGA 1BNRA 1PU4A 1RNTA 2OWPA 3IPTA 3WA2X 3MPHA 5AEWB 4XBXA 4RNZA 3V99A 1IVUA 1V57A 2CG0A 1RN7A 2CW9A 2CWUA 2FXTA 1TU5A 2HMJB 1ASKA 1SARA 2PNCA 2CWVA 1AY7A 1UCLA 3CCS3 5LC6A 3S29A 1Q814 1VZZA 5A0OB 4STDA 3NBRA 3UB1A 5IEPA 2H0HA 1IDPA 3LZAA 1LQGC 3I553 1PYLA 2CIUA 3Q90A 3F14A 5I97A 1G96A 1LOXA 1SIHA 2GU3A 3CC43 1RDSA 1TUHA 1HZ1A 2YFJB 2GBWB 3Q2PA 1BRJA 1NB5I 1HKXA 1L5GB 1Q7Y4 1ULIB 3SLUA 4N6V0 3CU3A 1UDII 1V74A 4HM7B 2C4BA 2H0GA 5DRVA 2F98A 1MWSA 2BU4A 6RNTA 1IV9A 3BIRA 5ELJA 5IW9A 1A90A 1OHSA 4WP5A 1W6CA 1GSPA 4WHAA 4RZMA 5JPPA 3PXMA 2P0MA 2HOHA 2BMQB 4JRFA 3GZXB 1FGOA 3B4PA 4IT7A 1WMOA 1EEJA 4JF8A 2W56A 1W6YA 2AAEA 3EE1A 3SX1A 1QVG2 3X42A 4AKYA 3J7Yd 3LTCA 3A76A 2A15A 2GBXB 3CMA3 1VQQA 4ORLA 3CCQ3 2P05A 1C54A 2P38A 1TFOA 1W02A 5JPUA 3WR2A 3G6E3 3NX0A 2RSXA 3V92A 1JB2A 1JZDA 1PFPA 1TRPA 2HMNB 4ZM8A 2OQEC 1BUJA 3SVAA 1IQXA 2XR8B 4K1UA 1ULJB 2FGTA 1JN5B 1Q40B 1W01A 1X1WA 2CFLA 4XM4A 1JV2B 3NBJA 1N8R4 1DMQA 2BT3A 4HM5B 1RN1A 1JBTA 3CCR3 1UI8A 3GRDA 2O9UX 1E3RA 5IF6A 2CK3H 3G4S3 3MG3A 2CH9A 3BB9A 3ER7A 3UL6A 1EQKA 1MWRA 2E2UA 3D9RA 2XEPA 3B4OA 5AIHA 2OTL3 1NWWA 8CHOA 8RNTA 1RSNA 4X2OA 1NO3A 2Y74A 1BSCA 1W2ZA 3K0ZA 3HK4A 1YJN3 1BNFA 1YGEA 1I0XA 3JUNA 1I3FA 3F8XA 4N3VA 5DREA 3CCU3 1N5PA 2XGLA 3OV4A 3JUMA 1UW1A 4HM2B 5AEUB 5FW5A 1BNGA 2RCDA 3DGMA 3EHCA 4ILFA 3T8NA 1VQ73 1BNSA 3STDA 1RMSA 4EYCA 1GOYA 3AHWA 5IEOA 2F99A 1QJGA 1K734 3VF1A 2AADA 5AI1A 4FR9A 3PYJA 1B21A 1Q9EA 3CCV3 4WYKB 2BIRA 1BNEA 2O3OA 4MEIA 5CF2A 3EBYA 1I3IA 2ZHXB 1BSAA 1RGCA 2XH9A 3NM7A 3T0UA 1FUTA 1AQZA 3KIIA 4GSPA 3G713 1EG9B 1DMMA 4HM0B 1O7PB 1TRQA 1UGIA 1A2VA 1OUNA 4J9AA 4R9KA 1VQ83 3DMCA 3N9HA 3PGBA 3ZFZA 1W5ZA 2XFSA 3IJEB 2RNTA 1OF5A 3CCL3 1JNQA 1NU3A 3HZPA 1BSEA 3RGRA 1J2BA 5KP3A 5STDA 3BU4A 2SBLA 2MC8A 3BNDA 4K1VA 4FCMA 5KP4A 1YJW3 3FF2A 3LH4A 1DE3A 5D81A 1B2ZA 2SARA 3NQZA 3FSDA 3U1WA 4BTXA 1QMAA 4LZIA 3SOYA 4EC6A 2ML5A 1SQWA 3ZG5A 3E99A 2BMOB 4BL3A 1BUQA 2KF6A 3FKAA 1WQLB 3CPW2 1ROAA 1NDOB 2P09A 1JBSA 5ELUA 4LGQA 1YJ93 1TTOA 2MF7A 2E2TA 4MMYB 1TP6A 3N8BA 3DZLA 2PZVA 2HMKB 4MMXB 1IV7A 1FGRA 2W03A 1ZGXA 3GZRA 1ZO2A 2Z6BA 3KKGA 3LTDA 2GXFA 3HOHA 1QVF2 1AV4A 3RDEA 4FMBA 3NV0B 1BAOA 1D6ZA 2BHMA 4PEJA 3CXC2 1B2MA 4O02B 1JBRA 3MKIA 1O7GB 4N6MA 1JB4A 2XF3A 2OCTA 2WGOA 4MJDA 4XBTA 3VSYA 2OOVA 1CYVA 2IY2A 1GMRA 1O7WB 3CCE3 1N9JA 1U5OA 5KP1A 1S723 1BNIA 3PCRA 2IMJA 3KSED 4XB5A 3UJMA 5G1LA 2YFLB 1BNJA 1RGAA 4NHFA 1K28A 3RGAA 3URPA 4KFDA 2GEXA 2L4VA 3IMAB 1OCVA 1MOLA 2D1WA 1N5HA 2R41A 1RNBA 4KZ1A 2GU1A 1YI23 1B3SA 2K54A 1STFI 3F7XA 3FF0A 2HMLB 3RNTA 4O8SA 5IERA 3ROBA 3CC73 2F4YA 1LNHA 2YX9A 3AMOA 2LYXA 4H3UA 3DXOA 1YIJ3 1B2UA 4L7KA 2Q07A 3CC23 5BIRA 3EJVA 3FGYA 3LMLA 3DUKA 2I9WA 3L0RA 3T8UA 1Z1SA 3I563 1KD14 1RRLA 3BNBA 1Q864 1DVDA 3B7CA 1QAFA 2KRTA 3F8HA 2WOHA 1STDA 3VGNA 3CME3 1RHLA 1K41A 4HJLB 1RCLA 4AKZA 1K9M4 1AVLA 1N9EA 2IUKA 2ZA4A 1BSBA 1K8A4 2KCDA 1FUSA 3F7SA 9RNTA 3LTAA 4HAAA 5CF1A 3X3ZA 4KFEA 1GY6A 3CD63 1OH0A 1BRKA 1DMNA 2KF4A 1LRAA 1BSDA 3ALAA 3OWUA 4L8PA 3H3HA 3NXJA 3LXUX 1N8QA 1CYUA 1VQ43 1OPYA 4N6LA 4BL2A 1M1XB 1T3BA 4EXRA 1JKGB 4CPKA 1WMPA 2IYJA 3ZG0A 4TX4A 3JUOA 1UUVB 4HVNA 4R9LA 5IG5A 1IQYA 1FGQA 4FMDA 2CX0A 2QA43 4G1MB 4J5GA 4N6TA 1UCKA 6STDA 3KFQC 1I8VA 1YGWA 1US1A 2XRXB 1B27A 4FCJA 5AIFA 1C7HA 5JBSA 1RGKA 1RGHA 1M1K4 1HU9A 3AGOA 3DM8A 2HMMB 5IG3A 1B2XA 1RN4A 3HI7A 3HX8A 1UCJA 4HZ9B 4N6UA 1IQ8A 4OVMA 1ZX2A 4HM3B 1RGEA 3A5EA 1OHOA 3DY5A 3K63A 3WHOA 4DKIA 1Y4KA 2CWTA 4EV2A 1CH0A 3GAXA 5TGNA 2BMRB 1LQMB 3H51A 1S5AA 4XBYA 1IYYA 1HYFA 1OGZA 3FCSB 1FYSA 4WYKA 1JRQA 3G16A 3EN1B 4Q53A 3WDGB 3OWSA 4GL6A 1GS3A 4CJNA 1X1YA 1SPUA 2M7OA 3GWRA 3D5IA 1G02A 3JVCA 1FGTA 1RRHA 3S27A 1W4NA 1VQL3 1RGLA 1FUWA 2F86B 5CXOA 3JUQA 3UL5A 3FH1A 3KN4A 2JDIH 4FMAA 1MNLA 3BNEA 2IA7A 1DVCA 2JQ5A 3OXAA 4KFFA 4KT3B 3K9MC 1G0TA 5BXQA 1A67A 2R4IA 3G0KA 1BRHA 3LOYA 2XFTA 5IENA 1M904 1I2EA 3FLJA 1YHQ3 1GOVA 5EEOA 2RFRA 3D5GA 3FG3A 5CK6A 1D6UA 2W6JH 1AVKA 3X41A 2KXGA 3EX9A 4NPBA 1W00A 1IVXA 4LEHA 2GSPA 3WOEB 2RGQA 5EQLA 1SIIA 2ZDJA 1BRNL 1VQ53 1GOUA 3MYTA 1O7HB 5CLKA 4K90B 2UGIA 4HOHA 1GD3A 3DGOA 4EW5A 3CCM3 1GD4A 3GZYB 4HM6B 2W9PA 1IT7A 4HM4B 2CFDA 2OOVC 3DGYA 4FMCA 4XDVA 1I70A 2YFIB 1TJDA 3K7CA 4EBGA 4IIAA 5IG4A 7STDA 1RGGA 4BIRA 4U13A 1E3VA 2QIYA 2UX0A 5FGOA 2CG1A 3G8ZA 2QGUA 2IUJA 3S5CA 3CNMA 3N54B 1W2B2 3NV0A 3X3XA 2INXA 3S28A 4HM8B 1IVWA 2B1XB 1U8CB 2CC3A 2WGQA 1LOVA 4O2HA 2H0IA 7RNTA 1JB5A 2W04A 1TIJA 1W7CA 1BIRA 2CFKA 4J8TA 1NB3I 1TFKA 4HM1B 2CKFB 4BTWA 1BRSA 1B20A 1PY3A 4RNTA 1RLSA 3SEDA 1KQS2 3EBTA 1FW7A 2F5MA 3MHEA 3LYGA 2D42A 1BANA 2HMOB 1BRIA 1FGMA 1BGSA 3QRDA 1QAKA 3OW22 1JZOA 2E2VA 3EF8A 4FCZA 3QK9A 3PCSA 3BLZA 5AIGA 1O7MB 5HOHA 1YNVX 1QALA 1NNVA 3NM2A 3F40A 1A2KA 1T2IA 3TDGA 2W0QA 3U97A 1LOWA 3WA3A 3K5TA 4X2HA 3AGNA 3NHXA 1KWIA 4GHOA 5GSPA 4MMZB 2K3DA 1UCIA 1WMNA 1KC84 1F8NA 3LTBA 2LQVA 3WODG 3CCJ3 4HZBB 1VQP3 1OHPA 1DETA 3DGNA 5M19A 2W56B 1MWUA 1EA2A 5RNTA 1RTUA 2OTJ3 2F56A 3D3LA 1UI7A 3V98A 4HKVB 3FG4A 2CHCA 1GMQA 1WNHA 5D83A 1VQM3 3AMOB 2GEYA 4N6OB 2BO9B 2Z77A 1JN5A 1Q40A 3ECFA 3SOAA 1GMPA 3WOFB 3KSPA 1GY5A 1V58A 3FG1A 4I4KA 1X1XA 4HYZA 6GSPA 3O8YA 1R4YA 4O3VA 3NQYA 1OGXA 3FZWA 4J5KA 1WTHA 4I5QA 1NJI4 3EC9A 4CCVA 3PZWA 3SYUA 2KAAA 4K61A 5BU4A 7GSPA 1LOYA 3GSPA 1JJ22 4GB5A 2CFWA 2RBIA 2W2CA 1M9GA 3KCHA 1UGHI 4CDLA 1VQK3 2C10A 4H61A 5EVHA 3WMDA 1JKGA 1VQN3 2BNGA 1MGWA 3CNXA 2P0XA 2W9QA 2Y73A 2OQEA 5M18A 3OX9A 2FNQA 5G1KA 1I0VA 1X1UA 4RNYA 4LYLB 5HGRA 5LC7A 5M1AA 3D79A 3M8CA 5AYSC 3X40A 2ZL8A 1Q7HA
chains in the Genus database with same CATH topology
2K0MA 2B24B 1FA3A 3HIIA 2V1LA 4OUQA 3OWYA 3GZBA 3MSOA 3X3YA 3HIGA 5AIIA 4NREA 1KSIA 1IVVA 1Q42A 3MG2A 1IK3A 1J2BA 3Q1CA 4HBRA 2XGNA 2WO0A 1VQ63 4XDWA 5IG0A 4OK0A 4AEQA 1SJWA 3MG1A 4N6NB 2Z7AA 3S67A 1LXEA 1W6GA 2WOFA 1YIT3 2QEX3 1RJOA 3NBBA 4R4KA 1YVBI 3PS8A 4L8OA 3EB8A 1GYBA 3I0YA 1IU7A 1E97A 1CEWI 1Q824 3EN8A 5AYRB 3BNCA 2ML6A 1VQO3 3JUPA 3UNLA 1OACA 1OF5B 2XSHB 2XSOB 4QWTA 1CQSA 2Z76A 4WFOA 1AR0A 1T5YA 1IT8A 1LVNA 4IPBA 3KZTA 1DYUA 1ROVA 4R80A 4EV5A 1GY7A 1O7NB 3CPOA 3EQQB 3B8LA 4LMIA 1RKYA 1UUWB 4KVHA 4LSOA 3DGLA 4RBNA 3KE7A 5G2GA 1D6YA 3LT9A 1ISKA 1R4CA 3F9SA 3SXXA 3MWZA 5D82A 1EKMA 3NUVA 5BVBA 1VQ93 4WWUC 3LT8A 2STDA 4R1KA 4BTYA 2C11A 2CFGA 1PU4A 2OWPA 3IPTA 3WA2X 3MPHA 5AEWB 4XBXA 4RNZA 3V99A 1IVUA 2CG0A 2CW9A 1RN7A 2CWUA 2FXTA 1TU5A 2HMJB 1ASKA 2PNCA 2CWVA 3CCS3 5LC6A 3S29A 1Q814 1VZZA 5A0OB 4STDA 3NBRA 3UB1A 5IEPA 1IDPA 3LZAA 3I553 2CIUA 3Q90A 3F14A 5I97A 1G96A 1LOXA 1SIHA 2GU3A 3CC43 1TUHA 2YFJB 2GBWB 3Q2PA 1NB5I 1HKXA 1L5GB 1Q7Y4 1ULIB 3SLUA 4N6V0 3CU3A 1V74A 4HM7B 5DRVA 2F98A 1IV9A 5ELJA 5IW9A 1A90A 1OHSA 4WP5A 1W6CA 4WHAA 4RZMA 5JPPA 3PXMA 2P0MA 2BMQB 4JRFA 3GZXB 1FGOA 3B4PA 4IT7A 1WMOA 4JF8A 3SX1A 2W56A 1W6YA 3EE1A 1QVG2 3X42A 4AKYA 3J7Yd 3LTCA 3A76A 2A15A 2GBXB 3CMA3 4ORLA 3CCQ3 2P05A 2P38A 1TFOA 1W02A 5JPUA 3G6E3 3NX0A 2RSXA 3V92A 1JB2A 1PFPA 4ZM8A 2HMNB 2OQEC 3SVAA 1IQXA 2XR8B 4K1UA 1ULJB 2FGTA 1JN5B 1Q40B 1W01A 2CFLA 4XM4A 1JV2B 3NBJA 1N8R4 1DMQA 2BT3A 4HM5B 3CCR3 1UI8A 3GRDA 2O9UX 1E3RA 5IF6A 2CK3H 3G4S3 3MG3A 2CH9A 3BB9A 3ER7A 3UL6A 1EQKA 2E2UA 3D9RA 2XEPA 3B4OA 5AIHA 2OTL3 1NWWA 8CHOA 4X2OA 1NO3A 2Y74A 1W2ZA 3K0ZA 3HK4A 1YJN3 3JUNA 1YGEA 5DREA 3CCU3 3F8XA 4N3VA 1N5PA 2XGLA 3OV4A 3JUMA 1UW1A 4HM2B 5AEUB 5FW5A 3DGMA 2RCDA 3EHCA 3T8NA 1VQ73 3STDA 4EYCA 5IEOA 2F99A 1QJGA 1K734 3VF1A 5AI1A 4FR9A 3PYJA 3CCV3 4WYKB 2O3OA 4MEIA 5CF2A 3EBYA 3T0UA 2XH9A 3NM7A 3G713 3KIIA 1EG9B 1DMMA 4HM0B 1O7PB 4R9KA 1A2VA 1OUNA 4J9AA 1VQ83 3DMCA 3N9HA 3PGBA 1W5ZA 2XFSA 3IJEB 1OF5A 3CCL3 1JNQA 1NU3A 3HZPA 3RGRA 5KP3A 5STDA 2MC8A 2SBLA 5KP4A 3BNDA 4K1VA 4FCMA 1YJW3 3FF2A 3LH4A 5D81A 3NQZA 3FSDA 3U1WA 4BTXA 1QMAA 4LZIA 3SOYA 4EC6A 2ML5A 1SQWA 3E99A 2BMOB 1BUQA 3FKAA 3CPW2 1WQLB 1ROAA 1NDOB 2P09A 5ELUA 4LGQA 1YJ93 2MF7A 2E2TA 4MMYB 1TP6A 3N8BA 3DZLA 2PZVA 2HMKB 4MMXB 1IV7A 1FGRA 2W03A 3GZRA 1ZO2A 2Z6BA 3KKGA 3LTDA 2GXFA 1QVF2 1AV4A 3RDEA 4FMBA 3NV0B 1D6ZA 2BHMA 4PEJA 3CXC2 4O02B 3MKIA 1O7GB 4N6MA 1JB4A 2XF3A 2OCTA 2WGOA 4MJDA 4XBTA 3VSYA 2OOVA 1CYVA 1O7WB 3CCE3 1N9JA 1U5OA 5KP1A 1S723 3PCRA 2IMJA 3KSED 4XB5A 3UJMA 2YFLB 4NHFA 1K28A 3RGAA 4KFDA 2GEXA 2L4VA 3IMAB 1OCVA 1MOLA 2D1WA 1N5HA 4KZ1A 2GU1A 1YI23 2K54A 3F7XA 1STFI 3FF0A 2HMLB 4O8SA 5IERA 3ROBA 3CC73 1LNHA 2YX9A 3AMOA 2LYXA 4H3UA 3DXOA 1YIJ3 4L7KA 2Q07A 3CC23 3EJVA 3FGYA 3LMLA 3DUKA 2I9WA 3L0RA 3T8UA 1Z1SA 3I563 1KD14 1RRLA 3BNBA 1Q864 1DVDA 3B7CA 1QAFA 2KRTA 3F8HA 2WOHA 1STDA 3VGNA 3CME3 1K41A 4HJLB 1K9M4 4AKZA 1AVLA 1N9EA 2IUKA 1K8A4 2KCDA 3F7SA 3LTAA 5CF1A 3X3ZA 4KFEA 1GY6A 3CD63 1OH0A 1DMNA 3OWUA 3ALAA 4L8PA 3H3HA 3NXJA 3LXUX 1N8QA 1CYUA 1VQ43 1OPYA 4N6LA 4EXRA 1M1XB 1JKGB 1WMPA 4TX4A 3JUOA 1UUVB 4HVNA 4R9LA 5IG5A 1IQYA 1FGQA 4FMDA 2QA43 4G1MB 4N6TA 6STDA 3KFQC 1US1A 2XRXB 4FCJA 5AIFA 1C7HA 5JBSA 1M1K4 1HU9A 3DM8A 2HMMB 5IG3A 3HX8A 3HI7A 4N6UA 4HZ9B 1IQ8A 4OVMA 1ZX2A 4HM3B 3K63A 1OHOA 3DY5A 1Y4KA 2CWTA 4EV2A 3GAXA 5TGNA 2BMRB 3H51A 1S5AA 4XBYA 1OGZA 3FCSB 4WYKA 1JRQA 3G16A 3EN1B 4Q53A 3WDGB 3OWSA 4GL6A 1GS3A 1SPUA 2M7OA 3GWRA 3JVCA 1FGTA 1RRHA 3S27A 1W4NA 1VQL3 1FUWA 2F86B 5CXOA 3JUQA 3UL5A 3FH1A 3KN4A 2JDIH 4FMAA 1MNLA 3BNEA 2IA7A 1DVCA 2JQ5A 3OXAA 4KFFA 1A67A 3K9MC 5BXQA 2R4IA 3G0KA 3LOYA 2XFTA 5IENA 1M904 3FLJA 1YHQ3 5EEOA 2RFRA 3FG3A 5CK6A 3X41A 1D6UA 2W6JH 1AVKA 2KXGA 3EX9A 1W00A 1IVXA 4LEHA 3WOEB 2RGQA 5EQLA 1SIIA 2ZDJA 1VQ53 3MYTA 1O7HB 5CLKA 4K90B 1GD3A 3DGOA 3CCM3 1GD4A 3GZYB 4HM6B 2W9PA 1IT7A 4HM4B 2CFDA 2OOVC 4XDVA 4FMCA 4EBGA 2YFIB 3K7CA 4IIAA 5IG4A 7STDA 4U13A 1E3VA 2QIYA 2UX0A 5FGOA 2CG1A 3G8ZA 2QGUA 2IUJA 3S5CA 3CNMA 3N54B 1W2B2 3NV0A 3X3XA 2INXA 3S28A 4HM8B 1IVWA 2B1XB 1U8CB 2CC3A 2WGQA 4O2HA 1JB5A 2W04A 1TIJA 1W7CA 2CFKA 4J8TA 1NB3I 1TFKA 4HM1B 2CKFB 4BTWA 1KQS2 3SEDA 3EBTA 3MHEA 3LYGA 2D42A 2HMOB 1FGMA 3QRDA 1QAKA 3OW22 2E2VA 3EF8A 4FCZA 3QK9A 3PCSA 3BLZA 5AIGA 1O7MB 1QALA 3NM2A 3F40A 1A2KA 3TDGA 2W0QA 3U97A 3WA3A 3K5TA 4X2HA 3NHXA 1KWIA 4MMZB 1WMNA 1KC84 1F8NA 3LTBA 2LQVA 3WODG 3CCJ3 4HZBB 1VQP3 1OHPA 3DGNA 2W56B 1EA2A 2OTJ3 3D3LA 1UI7A 3V98A 4HKVB 3FG4A 2CHCA 1WNHA 5D83A 1VQM3 3AMOB 2GEYA 4N6OB 2BO9B 2Z77A 1JN5A 1Q40A 3ECFA 3SOAA 3WOFB 3KSPA 1GY5A 3FG1A 4I4KA 4HYZA 3O8YA 4O3VA 3NQYA 1OGXA 3FZWA 1NJI4 1WTHA 3EC9A 4CCVA 3PZWA 4K61A 1JJ22 4GB5A 2CFWA 2W2CA 1M9GA 4CDLA 1VQK3 2C10A 4H61A 5EVHA 3WMDA 1JKGA 1VQN3 2BNGA 3CNXA 2P0XA 2W9QA 2Y73A 2OQEA 3OX9A 2FNQA 4RNYA 5HGRA 5LC7A 3M8CA 5AYSC 3X40A 2ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B24 B;  4OUQ A;  3OWY A;  3GZB A;  3MSO A;  5AII A;  3MG2 A;  1Q42 A;  4XDW A;  5IG0 A;  1SJW A;  3MG1 A;  2Z7A A;  4L8O A;  1GYB A;  3I0Y A;  1E97 A;  3EN8 A;  3JUP A;  3UNL A;  1OF5 B;  2XSH B;  2XSO B;  1CQS A;  2Z76 A;  1AR0 A;  3KZT A;  1GY7 A;  1O7N B;  3CPO A;  3EQQ B;  3B8L A;  4LMI A;  1UUW B;  4KVH A;  3KE7 A;  5G2G A;  1ISK A;  3F9S A;  5D82 A;  3NUV A;  5BVB A;  4WWU C;  2STD A;  4R1K A;  2OWP A;  3IPT A;  5AEW B;  4XBX A;  2HMJ B;  1ASK A;  1VZZ A;  4STD A;  3NBR A;  5IEP A;  1IDP A;  3LZA A;  3Q90 A;  3F14 A;  1TUH A;  2YFJ B;  2GBW B;  1HKX A;  1ULI B;  3CU3 A;  4HM7 B;  5DRV A;  2F98 A;  1OHS A;  4WP5 A;  4RZM A;  5JPP A;  2BMQ B;  3GZX B;  3B4P A;  1W6Y A;  3A76 A;  2A15 A;  2GBX B;  4ORL A;  1W02 A;  5JPU A;  1JB2 A;  2HMN B;  4K1U A;  2XR8 B;  1ULJ B;  1JN5 B;  1Q40 B;  1W01 A;  4XM4 A;  1DMQ A;  4HM5 B;  3GRD A;  1E3R A;  5IF6 A;  3MG3 A;  3BB9 A;  3ER7 A;  3D9R A;  3B4O A;  5AIH A;  1NWW A;  8CHO A;  4X2O A;  3K0Z A;  3HK4 A;  3JUN A;  5DRE A;  3F8X A;  4N3V A;  3OV4 A;  3JUM A;  4HM2 B;  5AEU B;  5FW5 A;  3EHC A;  2RCD A;  3T8N A;  3STD A;  5IEO A;  2F99 A;  1QJG A;  5AI1 A;  4WYK B;  5CF2 A;  3EBY A;  1EG9 B;  1DMM A;  4HM0 B;  1O7P B;  4R9K A;  1OUN A;  4J9A A;  3DMC A;  1OF5 A;  1NU3 A;  3RGR A;  3HZP A;  5KP3 A;  5STD A;  5KP4 A;  4K1V A;  4FCM A;  3FF2 A;  5D81 A;  3FSD A;  1QMA A;  3SOY A;  3E99 A;  2BMO B;  1BUQ A;  3FKA A;  1WQL B;  1NDO B;  4LGQ A;  1TP6 A;  3DZL A;  2PZV A;  2HMK B;  3GZR A;  1ZO2 A;  3KKG A;  2GXF A;  3NV0 B;  4PEJ A;  3MKI A;  1O7G B;  1JB4 A;  4MJD A;  4XBT A;  3VSY A;  1O7W B;  1U5O A;  5KP1 A;  2IMJ A;  4XB5 A;  3UJM A;  2YFL B;  3RGA A;  2GEX A;  1OCV A;  2K54 A;  3F7X A;  3FF0 A;  2HML B;  5IER A;  3ROB A;  4H3U A;  3DXO A;  4L7K A;  3EJV A;  3FGY A;  3DUK A;  2I9W A;  3T8U A;  1Z1S A;  3B7C A;  3F8H A;  1STD A;  3VGN A;  1K41 A;  4HJL B;  3F7S A;  5CF1 A;  1GY6 A;  1OH0 A;  1DMN A;  3OWU A;  4L8P A;  3H3H A;  3NXJ A;  1OPY A;  1JKG B;  3JUO A;  1UUV B;  4HVN A;  4R9L A;  5IG5 A;  6STD A;  2XRX B;  4FCJ A;  5AIF A;  1C7H A;  3DM8 A;  2HMM B;  5IG3 A;  3HX8 A;  4HZ9 B;  4OVM A;  1ZX2 A;  4HM3 B;  1OHO A;  5TGN A;  2BMR B;  3H51 A;  1S5A A;  4XBY A;  1OGZ A;  4WYK A;  3G16 A;  3EN1 B;  4Q53 A;  3OWS A;  1GS3 A;  3GWR A;  2F86 B;  5CXO A;  3JUQ A;  3FH1 A;  2JQ5 A;  3OXA A;  5BXQ A;  2R4I A;  3G0K A;  5IEN A;  3FLJ A;  2RFR A;  5CK6 A;  3EX9 A;  1W00 A;  4LEH A;  2RGQ A;  3MYT A;  1O7H B;  5CLK A;  4HM6 B;  3GZY B;  4HM4 B;  4XDV A;  2YFI B;  3K7C A;  4IIA A;  5IG4 A;  7STD A;  4U13 A;  1E3V A;  2QIY A;  2UX0 A;  3S5C A;  3G8Z A;  2QGU A;  3CNM A;  3NV0 A;  2INX A;  4HM8 B;  2B1X B;  1JB5 A;  4J8T A;  4HM1 B;  2CKF B;  3SED A;  3EBT A;  3MHE A;  3LYG A;  2HMO B;  3EF8 A;  3BLZ A;  5AIG A;  1O7M B;  3NM2 A;  3F40 A;  1A2K A;  4X2H A;  3NHX A;  4HZB B;  1OHP A;  1EA2 A;  4HKV B;  2CHC A;  5D83 A;  2GEY A;  2Z77 A;  1JN5 A;  1Q40 A;  3ECF A;  3SOA A;  3KSP A;  1GY5 A;  4I4K A;  1OGX A;  3FZW A;  3EC9 A;  4GB5 A;  2W2C A;  4CDL A;  5EVH A;  3WMD A;  1JKG A;  2BNG A;  3CNX A;  3OX9 A;  5HGR A;  3M8C A; 
#chains in the Genus database with same CATH topology
 2K0M A;  2B24 B;  1FA3 A;  3HII A;  2V1L A;  4OUQ A;  3OWY A;  3GZB A;  3MSO A;  3X3Y A;  3DH2 A;  3HIG A;  5AII A;  4NRE A;  1BOX A;  1KSI A;  1IVV A;  1FZU A;  1Q42 A;  3MG2 A;  1EUI C;  3Q1C A;  3Q3F A;  3AHS A;  4HBR A;  1IK3 A;  2XGN A;  2WO0 A;  1VQ6 3;  4XDW A;  5IG0 A;  4OK0 A;  4AEQ A;  1SJW A;  2CX1 A;  2F5W A;  3MG1 A;  4N6N B;  2Z7A A;  3S67 A;  1LXE A;  3D4A A;  1W6G A;  1MWT A;  2WOF A;  1YIT 3;  2QEX 3;  1RJO A;  3NBB A;  4R4K A;  1YVB I;  2KF3 A;  3PS8 A;  3EB8 A;  1GYB A;  4L8O A;  3I0Y A;  1IU7 A;  4BU4 A;  1E97 A;  1CEW I;  1Q82 4;  3EN8 A;  2UUG C;  5AYR B;  3BNC A;  1I2F A;  2ML6 A;  1MGR A;  1BVI A;  1RGF A;  3JUP A;  1VQO 3;  3UNL A;  1B2S A;  1OAC A;  1OF5 B;  2XSH B;  2XSO B;  4QWT A;  1CQS A;  2Z76 A;  4WFO A;  1AR0 A;  1T5Y A;  2J8X B;  1IT8 A;  1LVN A;  4IPB A;  3KZT A;  1DYU A;  1ROV A;  4R80 A;  2KF5 A;  1ZS7 A;  4EV5 A;  1GY7 A;  1O7N B;  1RCK A;  3CPO A;  3EQQ B;  3B8L A;  4LMI A;  1T2H A;  1RKY A;  1UUW B;  1A2P A;  4KVH A;  4LSO A;  3DGL A;  4RBN A;  1I2G A;  3KE7 A;  5G2G A;  1D6Y A;  3LT9 A;  1LNI A;  1ISK A;  1UUG B;  1R4C A;  1BRG A;  3F9S A;  3SXX A;  3MWZ A;  5D82 A;  2L1S A;  1EKM A;  3NUV A;  5BVB A;  1VQ9 3;  4WWU C;  3LT8 A;  2STD A;  4R1K A;  4BTY A;  2C11 A;  1BU4 A;  1YVS A;  2CFG A;  1BNR A;  1PU4 A;  1RNT A;  2OWP A;  3IPT A;  3WA2 X;  3MPH A;  5AEW B;  4XBX A;  4RNZ A;  3V99 A;  1IVU A;  1V57 A;  2CG0 A;  1RN7 A;  2CW9 A;  2CWU A;  2FXT A;  1TU5 A;  2HMJ B;  1ASK A;  1SAR A;  2PNC A;  2CWV A;  1AY7 A;  1UCL A;  3CCS 3;  5LC6 A;  3S29 A;  1Q81 4;  1VZZ A;  5A0O B;  4STD A;  3NBR A;  3UB1 A;  5IEP A;  2H0H A;  1IDP A;  3LZA A;  1LQG C;  3I55 3;  1PYL A;  2CIU A;  3Q90 A;  3F14 A;  5I97 A;  1G96 A;  1LOX A;  1SIH A;  2GU3 A;  3CC4 3;  1RDS A;  1TUH A;  1HZ1 A;  2YFJ B;  2GBW B;  3Q2P A;  1BRJ A;  1NB5 I;  1HKX A;  1L5G B;  1Q7Y 4;  1ULI B;  3SLU A;  4N6V 0;  3CU3 A;  1UDI I;  1V74 A;  4HM7 B;  2C4B A;  2H0G A;  5DRV A;  2F98 A;  1MWS A;  2BU4 A;  6RNT A;  1IV9 A;  3BIR A;  5ELJ A;  5IW9 A;  1A90 A;  1OHS A;  4WP5 A;  1W6C A;  1GSP A;  4WHA A;  4RZM A;  5JPP A;  3PXM A;  2P0M A;  2HOH A;  2BMQ B;  4JRF A;  3GZX B;  1FGO A;  3B4P A;  4IT7 A;  1WMO A;  1EEJ A;  4JF8 A;  2W56 A;  1W6Y A;  2AAE A;  3EE1 A;  3SX1 A;  1QVG 2;  3X42 A;  4AKY A;  3J7Y d;  3LTC A;  3A76 A;  2A15 A;  2GBX B;  3CMA 3;  1VQQ A;  4ORL A;  3CCQ 3;  2P05 A;  1C54 A;  2P38 A;  1TFO A;  1W02 A;  5JPU A;  3WR2 A;  3G6E 3;  3NX0 A;  2RSX A;  3V92 A;  1JB2 A;  1JZD A;  1PFP A;  1TRP A;  2HMN B;  4ZM8 A;  2OQE C;  1BUJ A;  3SVA A;  1IQX A;  2XR8 B;  4K1U A;  1ULJ B;  2FGT A;  1JN5 B;  1Q40 B;  1W01 A;  1X1W A;  2CFL A;  4XM4 A;  1JV2 B;  3NBJ A;  1N8R 4;  1DMQ A;  2BT3 A;  4HM5 B;  1RN1 A;  1JBT A;  3CCR 3;  1UI8 A;  3GRD A;  2O9U X;  1E3R A;  5IF6 A;  2CK3 H;  3G4S 3;  3MG3 A;  2CH9 A;  3BB9 A;  3ER7 A;  3UL6 A;  1EQK A;  1MWR A;  2E2U A;  3D9R A;  2XEP A;  3B4O A;  5AIH A;  2OTL 3;  1NWW A;  8CHO A;  8RNT A;  1RSN A;  4X2O A;  1NO3 A;  2Y74 A;  1BSC A;  1W2Z A;  3K0Z A;  3HK4 A;  1YJN 3;  1BNF A;  1YGE A;  1I0X A;  3JUN A;  1I3F A;  3F8X A;  4N3V A;  5DRE A;  3CCU 3;  1N5P A;  2XGL A;  3OV4 A;  3JUM A;  1UW1 A;  4HM2 B;  5AEU B;  5FW5 A;  1BNG A;  2RCD A;  3DGM A;  3EHC A;  4ILF A;  3T8N A;  1VQ7 3;  1BNS A;  3STD A;  1RMS A;  4EYC A;  1GOY A;  3AHW A;  5IEO A;  2F99 A;  1QJG A;  1K73 4;  3VF1 A;  2AAD A;  5AI1 A;  4FR9 A;  3PYJ A;  1B21 A;  1Q9E A;  3CCV 3;  4WYK B;  2BIR A;  1BNE A;  2O3O A;  4MEI A;  5CF2 A;  3EBY A;  1I3I A;  2ZHX B;  1BSA A;  1RGC A;  2XH9 A;  3NM7 A;  3T0U A;  1FUT A;  1AQZ A;  3KII A;  4GSP A;  3G71 3;  1EG9 B;  1DMM A;  4HM0 B;  1O7P B;  1TRQ A;  1UGI A;  1A2V A;  1OUN A;  4J9A A;  4R9K A;  1VQ8 3;  3DMC A;  3N9H A;  3PGB A;  3ZFZ A;  1W5Z A;  2XFS A;  3IJE B;  2RNT A;  1OF5 A;  3CCL 3;  1JNQ A;  1NU3 A;  3HZP A;  1BSE A;  3RGR A;  1J2B A;  5KP3 A;  5STD A;  3BU4 A;  2SBL A;  2MC8 A;  3BND A;  4K1V A;  4FCM A;  5KP4 A;  1YJW 3;  3FF2 A;  3LH4 A;  1DE3 A;  5D81 A;  1B2Z A;  2SAR A;  3NQZ A;  3FSD A;  3U1W A;  4BTX A;  1QMA A;  4LZI A;  3SOY A;  4EC6 A;  2ML5 A;  1SQW A;  3ZG5 A;  3E99 A;  2BMO B;  4BL3 A;  1BUQ A;  2KF6 A;  3FKA A;  1WQL B;  3CPW 2;  1ROA A;  1NDO B;  2P09 A;  1JBS A;  5ELU A;  4LGQ A;  1YJ9 3;  1TTO A;  2MF7 A;  2E2T A;  4MMY B;  1TP6 A;  3N8B A;  3DZL A;  2PZV A;  2HMK B;  4MMX B;  1IV7 A;  1FGR A;  2W03 A;  1ZGX A;  3GZR A;  1ZO2 A;  2Z6B A;  3KKG A;  3LTD A;  2GXF A;  3HOH A;  1QVF 2;  1AV4 A;  3RDE A;  4FMB A;  3NV0 B;  1BAO A;  1D6Z A;  2BHM A;  4PEJ A;  3CXC 2;  1B2M A;  4O02 B;  1JBR A;  3MKI A;  1O7G B;  4N6M A;  1JB4 A;  2XF3 A;  2OCT A;  2WGO A;  4MJD A;  4XBT A;  3VSY A;  2OOV A;  1CYV A;  2IY2 A;  1GMR A;  1O7W B;  3CCE 3;  1N9J A;  1U5O A;  5KP1 A;  1S72 3;  1BNI A;  3PCR A;  2IMJ A;  3KSE D;  4XB5 A;  3UJM A;  5G1L A;  2YFL B;  1BNJ A;  1RGA A;  4NHF A;  1K28 A;  3RGA A;  3URP A;  4KFD A;  2GEX A;  2L4V A;  3IMA B;  1OCV A;  1MOL A;  2D1W A;  1N5H A;  2R41 A;  1RNB A;  4KZ1 A;  2GU1 A;  1YI2 3;  1B3S A;  2K54 A;  1STF I;  3F7X A;  3FF0 A;  2HML B;  3RNT A;  4O8S A;  5IER A;  3ROB A;  3CC7 3;  2F4Y A;  1LNH A;  2YX9 A;  3AMO A;  2LYX A;  4H3U A;  3DXO A;  1YIJ 3;  1B2U A;  4L7K A;  2Q07 A;  3CC2 3;  5BIR A;  3EJV A;  3FGY A;  3LML A;  3DUK A;  2I9W A;  3L0R A;  3T8U A;  1Z1S A;  3I56 3;  1KD1 4;  1RRL A;  3BNB A;  1Q86 4;  1DVD A;  3B7C A;  1QAF A;  2KRT A;  3F8H A;  2WOH A;  1STD A;  3VGN A;  3CME 3;  1RHL A;  1K41 A;  4HJL B;  1RCL A;  4AKZ A;  1K9M 4;  1AVL A;  1N9E A;  2IUK A;  2ZA4 A;  1BSB A;  1K8A 4;  2KCD A;  1FUS A;  3F7S A;  9RNT A;  3LTA A;  4HAA A;  5CF1 A;  3X3Z A;  4KFE A;  1GY6 A;  3CD6 3;  1OH0 A;  1BRK A;  1DMN A;  2KF4 A;  1LRA A;  1BSD A;  3ALA A;  3OWU A;  4L8P A;  3H3H A;  3NXJ A;  3LXU X;  1N8Q A;  1CYU A;  1VQ4 3;  1OPY A;  4N6L A;  4BL2 A;  1M1X B;  1T3B A;  4EXR A;  1JKG B;  4CPK A;  1WMP A;  2IYJ A;  3ZG0 A;  4TX4 A;  3JUO A;  1UUV B;  4HVN A;  4R9L A;  5IG5 A;  1IQY A;  1FGQ A;  4FMD A;  2CX0 A;  2QA4 3;  4G1M B;  4J5G A;  4N6T A;  1UCK A;  6STD A;  3KFQ C;  1I8V A;  1YGW A;  1US1 A;  2XRX B;  1B27 A;  4FCJ A;  5AIF A;  1C7H A;  5JBS A;  1RGK A;  1RGH A;  1M1K 4;  1HU9 A;  3AGO A;  3DM8 A;  2HMM B;  5IG3 A;  1B2X A;  1RN4 A;  3HI7 A;  3HX8 A;  1UCJ A;  4HZ9 B;  4N6U A;  1IQ8 A;  4OVM A;  1ZX2 A;  4HM3 B;  1RGE A;  3A5E A;  1OHO A;  3DY5 A;  3K63 A;  3WHO A;  4DKI A;  1Y4K A;  2CWT A;  4EV2 A;  1CH0 A;  3GAX A;  5TGN A;  2BMR B;  1LQM B;  3H51 A;  1S5A A;  4XBY A;  1IYY A;  1HYF A;  1OGZ A;  3FCS B;  1FYS A;  4WYK A;  1JRQ A;  3G16 A;  3EN1 B;  4Q53 A;  3WDG B;  3OWS A;  4GL6 A;  1GS3 A;  4CJN A;  1X1Y A;  1SPU A;  2M7O A;  3GWR A;  3D5I A;  1G02 A;  3JVC A;  1FGT A;  1RRH A;  3S27 A;  1W4N A;  1VQL 3;  1RGL A;  1FUW A;  2F86 B;  5CXO A;  3JUQ A;  3UL5 A;  3FH1 A;  3KN4 A;  2JDI H;  4FMA A;  1MNL A;  3BNE A;  2IA7 A;  1DVC A;  2JQ5 A;  3OXA A;  4KFF A;  4KT3 B;  3K9M C;  1G0T A;  5BXQ A;  1A67 A;  2R4I A;  3G0K A;  1BRH A;  3LOY A;  2XFT A;  5IEN A;  1M90 4;  1I2E A;  3FLJ A;  1YHQ 3;  1GOV A;  5EEO A;  2RFR A;  3D5G A;  3FG3 A;  5CK6 A;  1D6U A;  2W6J H;  1AVK A;  3X41 A;  2KXG A;  3EX9 A;  4NPB A;  1W00 A;  1IVX A;  4LEH A;  2GSP A;  3WOE B;  2RGQ A;  5EQL A;  1SII A;  2ZDJ A;  1BRN L;  1VQ5 3;  1GOU A;  3MYT A;  1O7H B;  5CLK A;  4K90 B;  2UGI A;  4HOH A;  1GD3 A;  3DGO A;  4EW5 A;  3CCM 3;  1GD4 A;  3GZY B;  4HM6 B;  2W9P A;  1IT7 A;  4HM4 B;  2CFD A;  2OOV C;  3DGY A;  4FMC A;  4XDV A;  1I70 A;  2YFI B;  1TJD A;  3K7C A;  4EBG A;  4IIA A;  5IG4 A;  7STD A;  1RGG A;  4BIR A;  4U13 A;  1E3V A;  2QIY A;  2UX0 A;  5FGO A;  2CG1 A;  3G8Z A;  2QGU A;  2IUJ A;  3S5C A;  3CNM A;  3N54 B;  1W2B 2;  3NV0 A;  3X3X A;  2INX A;  3S28 A;  4HM8 B;  1IVW A;  2B1X B;  1U8C B;  2CC3 A;  2WGQ A;  1LOV A;  4O2H A;  2H0I A;  7RNT A;  1JB5 A;  2W04 A;  1TIJ A;  1W7C A;  1BIR A;  2CFK A;  4J8T A;  1NB3 I;  1TFK A;  4HM1 B;  2CKF B;  4BTW A;  1BRS A;  1B20 A;  1PY3 A;  4RNT A;  1RLS A;  3SED A;  1KQS 2;  3EBT A;  1FW7 A;  2F5M A;  3MHE A;  3LYG A;  2D42 A;  1BAN A;  2HMO B;  1BRI A;  1FGM A;  1BGS A;  3QRD A;  1QAK A;  3OW2 2;  1JZO A;  2E2V A;  3EF8 A;  4FCZ A;  3QK9 A;  3PCS A;  3BLZ A;  5AIG A;  1O7M B;  5HOH A;  1YNV X;  1QAL A;  1NNV A;  3NM2 A;  3F40 A;  1A2K A;  1T2I A;  3TDG A;  2W0Q A;  3U97 A;  1LOW A;  3WA3 A;  3K5T A;  4X2H A;  3AGN A;  3NHX A;  1KWI A;  4GHO A;  5GSP A;  4MMZ B;  2K3D A;  1UCI A;  1WMN A;  1KC8 4;  1F8N A;  3LTB A;  2LQV A;  3WOD G;  3CCJ 3;  4HZB B;  1VQP 3;  1OHP A;  1DET A;  3DGN A;  5M19 A;  2W56 B;  1MWU A;  1EA2 A;  5RNT A;  1RTU A;  2OTJ 3;  2F56 A;  3D3L A;  1UI7 A;  3V98 A;  4HKV B;  3FG4 A;  2CHC A;  1GMQ A;  1WNH A;  5D83 A;  1VQM 3;  3AMO B;  2GEY A;  4N6O B;  2BO9 B;  2Z77 A;  1JN5 A;  1Q40 A;  3ECF A;  3SOA A;  1GMP A;  3WOF B;  3KSP A;  1GY5 A;  1V58 A;  3FG1 A;  4I4K A;  1X1X A;  4HYZ A;  6GSP A;  3O8Y A;  1R4Y A;  4O3V A;  3NQY A;  1OGX A;  3FZW A;  4J5K A;  1WTH A;  4I5Q A;  1NJI 4;  3EC9 A;  4CCV A;  3PZW A;  3SYU A;  2KAA A;  4K61 A;  5BU4 A;  7GSP A;  1LOY A;  3GSP A;  1JJ2 2;  4GB5 A;  2CFW A;  2RBI A;  2W2C A;  1M9G A;  3KCH A;  1UGH I;  4CDL A;  1VQK 3;  2C10 A;  4H61 A;  5EVH A;  3WMD A;  1JKG A;  1VQN 3;  2BNG A;  1MGW A;  3CNX A;  2P0X A;  2W9Q A;  2Y73 A;  2OQE A;  5M18 A;  3OX9 A;  2FNQ A;  5G1K A;  1I0V A;  1X1U A;  4RNY A;  4LYL B;  5HGR A;  5LC7 A;  5M1A A;  3D79 A;  3M8C A;  5AYS C;  3X40 A;  2ZL8 A;  1Q7H A; 
#chains in the Genus database with same CATH homology
 2K0M A;  2B24 B;  1FA3 A;  3HII A;  2V1L A;  4OUQ A;  3OWY A;  3GZB A;  3MSO A;  3X3Y A;  3HIG A;  5AII A;  4NRE A;  1KSI A;  1IVV A;  1Q42 A;  3MG2 A;  1IK3 A;  1J2B A;  3Q1C A;  4HBR A;  2XGN A;  2WO0 A;  1VQ6 3;  4XDW A;  5IG0 A;  4OK0 A;  4AEQ A;  1SJW A;  3MG1 A;  4N6N B;  2Z7A A;  3S67 A;  1LXE A;  1W6G A;  2WOF A;  1YIT 3;  2QEX 3;  1RJO A;  3NBB A;  4R4K A;  1YVB I;  3PS8 A;  4L8O A;  3EB8 A;  1GYB A;  3I0Y A;  1IU7 A;  1E97 A;  1CEW I;  1Q82 4;  3EN8 A;  5AYR B;  3BNC A;  2ML6 A;  1VQO 3;  3JUP A;  3UNL A;  1OAC A;  1OF5 B;  2XSH B;  2XSO B;  4QWT A;  1CQS A;  2Z76 A;  4WFO A;  1AR0 A;  1T5Y A;  1IT8 A;  1LVN A;  4IPB A;  3KZT A;  1DYU A;  1ROV A;  4R80 A;  4EV5 A;  1GY7 A;  1O7N B;  3CPO A;  3EQQ B;  3B8L A;  4LMI A;  1RKY A;  1UUW B;  4KVH A;  4LSO A;  3DGL A;  4RBN A;  3KE7 A;  5G2G A;  1D6Y A;  3LT9 A;  1ISK A;  1R4C A;  3F9S A;  3SXX A;  3MWZ A;  5D82 A;  1EKM A;  3NUV A;  5BVB A;  1VQ9 3;  4WWU C;  3LT8 A;  2STD A;  4R1K A;  4BTY A;  2C11 A;  2CFG A;  1PU4 A;  2OWP A;  3IPT A;  3WA2 X;  3MPH A;  5AEW B;  4XBX A;  4RNZ A;  3V99 A;  1IVU A;  2CG0 A;  2CW9 A;  1RN7 A;  2CWU A;  2FXT A;  1TU5 A;  2HMJ B;  1ASK A;  2PNC A;  2CWV A;  3CCS 3;  5LC6 A;  3S29 A;  1Q81 4;  1VZZ A;  5A0O B;  4STD A;  3NBR A;  3UB1 A;  5IEP A;  1IDP A;  3LZA A;  3I55 3;  2CIU A;  3Q90 A;  3F14 A;  5I97 A;  1G96 A;  1LOX A;  1SIH A;  2GU3 A;  3CC4 3;  1TUH A;  2YFJ B;  2GBW B;  3Q2P A;  1NB5 I;  1HKX A;  1L5G B;  1Q7Y 4;  1ULI B;  3SLU A;  4N6V 0;  3CU3 A;  1V74 A;  4HM7 B;  5DRV A;  2F98 A;  1IV9 A;  5ELJ A;  5IW9 A;  1A90 A;  1OHS A;  4WP5 A;  1W6C A;  4WHA A;  4RZM A;  5JPP A;  3PXM A;  2P0M A;  2BMQ B;  4JRF A;  3GZX B;  1FGO A;  3B4P A;  4IT7 A;  1WMO A;  4JF8 A;  3SX1 A;  2W56 A;  1W6Y A;  3EE1 A;  1QVG 2;  3X42 A;  4AKY A;  3J7Y d;  3LTC A;  3A76 A;  2A15 A;  2GBX B;  3CMA 3;  4ORL A;  3CCQ 3;  2P05 A;  2P38 A;  1TFO A;  1W02 A;  5JPU A;  3G6E 3;  3NX0 A;  2RSX A;  3V92 A;  1JB2 A;  1PFP A;  4ZM8 A;  2HMN B;  2OQE C;  3SVA A;  1IQX A;  2XR8 B;  4K1U A;  1ULJ B;  2FGT A;  1JN5 B;  1Q40 B;  1W01 A;  2CFL A;  4XM4 A;  1JV2 B;  3NBJ A;  1N8R 4;  1DMQ A;  2BT3 A;  4HM5 B;  3CCR 3;  1UI8 A;  3GRD A;  2O9U X;  1E3R A;  5IF6 A;  2CK3 H;  3G4S 3;  3MG3 A;  2CH9 A;  3BB9 A;  3ER7 A;  3UL6 A;  1EQK A;  2E2U A;  3D9R A;  2XEP A;  3B4O A;  5AIH A;  2OTL 3;  1NWW A;  8CHO A;  4X2O A;  1NO3 A;  2Y74 A;  1W2Z A;  3K0Z A;  3HK4 A;  1YJN 3;  3JUN A;  1YGE A;  5DRE A;  3CCU 3;  3F8X A;  4N3V A;  1N5P A;  2XGL A;  3OV4 A;  3JUM A;  1UW1 A;  4HM2 B;  5AEU B;  5FW5 A;  3DGM A;  2RCD A;  3EHC A;  3T8N A;  1VQ7 3;  3STD A;  4EYC A;  5IEO A;  2F99 A;  1QJG A;  1K73 4;  3VF1 A;  5AI1 A;  4FR9 A;  3PYJ A;  3CCV 3;  4WYK B;  2O3O A;  4MEI A;  5CF2 A;  3EBY A;  3T0U A;  2XH9 A;  3NM7 A;  3G71 3;  3KII A;  1EG9 B;  1DMM A;  4HM0 B;  1O7P B;  4R9K A;  1A2V A;  1OUN A;  4J9A A;  1VQ8 3;  3DMC A;  3N9H A;  3PGB A;  1W5Z A;  2XFS A;  3IJE B;  1OF5 A;  3CCL 3;  1JNQ A;  1NU3 A;  3HZP A;  3RGR A;  5KP3 A;  5STD A;  2MC8 A;  2SBL A;  5KP4 A;  3BND A;  4K1V A;  4FCM A;  1YJW 3;  3FF2 A;  3LH4 A;  5D81 A;  3NQZ A;  3FSD A;  3U1W A;  4BTX A;  1QMA A;  4LZI A;  3SOY A;  4EC6 A;  2ML5 A;  1SQW A;  3E99 A;  2BMO B;  1BUQ A;  3FKA A;  3CPW 2;  1WQL B;  1ROA A;  1NDO B;  2P09 A;  5ELU A;  4LGQ A;  1YJ9 3;  2MF7 A;  2E2T A;  4MMY B;  1TP6 A;  3N8B A;  3DZL A;  2PZV A;  2HMK B;  4MMX B;  1IV7 A;  1FGR A;  2W03 A;  3GZR A;  1ZO2 A;  2Z6B A;  3KKG A;  3LTD A;  2GXF A;  1QVF 2;  1AV4 A;  3RDE A;  4FMB A;  3NV0 B;  1D6Z A;  2BHM A;  4PEJ A;  3CXC 2;  4O02 B;  3MKI A;  1O7G B;  4N6M A;  1JB4 A;  2XF3 A;  2OCT A;  2WGO A;  4MJD A;  4XBT A;  3VSY A;  2OOV A;  1CYV A;  1O7W B;  3CCE 3;  1N9J A;  1U5O A;  5KP1 A;  1S72 3;  3PCR A;  2IMJ A;  3KSE D;  4XB5 A;  3UJM A;  2YFL B;  4NHF A;  1K28 A;  3RGA A;  4KFD A;  2GEX A;  2L4V A;  3IMA B;  1OCV A;  1MOL A;  2D1W A;  1N5H A;  4KZ1 A;  2GU1 A;  1YI2 3;  2K54 A;  3F7X A;  1STF I;  3FF0 A;  2HML B;  4O8S A;  5IER A;  3ROB A;  3CC7 3;  1LNH A;  2YX9 A;  3AMO A;  2LYX A;  4H3U A;  3DXO A;  1YIJ 3;  4L7K A;  2Q07 A;  3CC2 3;  3EJV A;  3FGY A;  3LML A;  3DUK A;  2I9W A;  3L0R A;  3T8U A;  1Z1S A;  3I56 3;  1KD1 4;  1RRL A;  3BNB A;  1Q86 4;  1DVD A;  3B7C A;  1QAF A;  2KRT A;  3F8H A;  2WOH A;  1STD A;  3VGN A;  3CME 3;  1K41 A;  4HJL B;  1K9M 4;  4AKZ A;  1AVL A;  1N9E A;  2IUK A;  1K8A 4;  2KCD A;  3F7S A;  3LTA A;  5CF1 A;  3X3Z A;  4KFE A;  1GY6 A;  3CD6 3;  1OH0 A;  1DMN A;  3OWU A;  3ALA A;  4L8P A;  3H3H A;  3NXJ A;  3LXU X;  1N8Q A;  1CYU A;  1VQ4 3;  1OPY A;  4N6L A;  4EXR A;  1M1X B;  1JKG B;  1WMP A;  4TX4 A;  3JUO A;  1UUV B;  4HVN A;  4R9L A;  5IG5 A;  1IQY A;  1FGQ A;  4FMD A;  2QA4 3;  4G1M B;  4N6T A;  6STD A;  3KFQ C;  1US1 A;  2XRX B;  4FCJ A;  5AIF A;  1C7H A;  5JBS A;  1M1K 4;  1HU9 A;  3DM8 A;  2HMM B;  5IG3 A;  3HX8 A;  3HI7 A;  4N6U A;  4HZ9 B;  1IQ8 A;  4OVM A;  1ZX2 A;  4HM3 B;  3K63 A;  1OHO A;  3DY5 A;  1Y4K A;  2CWT A;  4EV2 A;  3GAX A;  5TGN A;  2BMR B;  3H51 A;  1S5A A;  4XBY A;  1OGZ A;  3FCS B;  4WYK A;  1JRQ A;  3G16 A;  3EN1 B;  4Q53 A;  3WDG B;  3OWS A;  4GL6 A;  1GS3 A;  1SPU A;  2M7O A;  3GWR A;  3JVC A;  1FGT A;  1RRH A;  3S27 A;  1W4N A;  1VQL 3;  1FUW A;  2F86 B;  5CXO A;  3JUQ A;  3UL5 A;  3FH1 A;  3KN4 A;  2JDI H;  4FMA A;  1MNL A;  3BNE A;  2IA7 A;  1DVC A;  2JQ5 A;  3OXA A;  4KFF A;  1A67 A;  3K9M C;  5BXQ A;  2R4I A;  3G0K A;  3LOY A;  2XFT A;  5IEN A;  1M90 4;  3FLJ A;  1YHQ 3;  5EEO A;  2RFR A;  3FG3 A;  5CK6 A;  3X41 A;  1D6U A;  2W6J H;  1AVK A;  2KXG A;  3EX9 A;  1W00 A;  1IVX A;  4LEH A;  3WOE B;  2RGQ A;  5EQL A;  1SII A;  2ZDJ A;  1VQ5 3;  3MYT A;  1O7H B;  5CLK A;  4K90 B;  1GD3 A;  3DGO A;  3CCM 3;  1GD4 A;  3GZY B;  4HM6 B;  2W9P A;  1IT7 A;  4HM4 B;  2CFD A;  2OOV C;  4XDV A;  4FMC A;  4EBG A;  2YFI B;  3K7C A;  4IIA A;  5IG4 A;  7STD A;  4U13 A;  1E3V A;  2QIY A;  2UX0 A;  5FGO A;  2CG1 A;  3G8Z A;  2QGU A;  2IUJ A;  3S5C A;  3CNM A;  3N54 B;  1W2B 2;  3NV0 A;  3X3X A;  2INX A;  3S28 A;  4HM8 B;  1IVW A;  2B1X B;  1U8C B;  2CC3 A;  2WGQ A;  4O2H A;  1JB5 A;  2W04 A;  1TIJ A;  1W7C A;  2CFK A;  4J8T A;  1NB3 I;  1TFK A;  4HM1 B;  2CKF B;  4BTW A;  1KQS 2;  3SED A;  3EBT A;  3MHE A;  3LYG A;  2D42 A;  2HMO B;  1FGM A;  3QRD A;  1QAK A;  3OW2 2;  2E2V A;  3EF8 A;  4FCZ A;  3QK9 A;  3PCS A;  3BLZ A;  5AIG A;  1O7M B;  1QAL A;  3NM2 A;  3F40 A;  1A2K A;  3TDG A;  2W0Q A;  3U97 A;  3WA3 A;  3K5T A;  4X2H A;  3NHX A;  1KWI A;  4MMZ B;  1WMN A;  1KC8 4;  1F8N A;  3LTB A;  2LQV A;  3WOD G;  3CCJ 3;  4HZB B;  1VQP 3;  1OHP A;  3DGN A;  2W56 B;  1EA2 A;  2OTJ 3;  3D3L A;  1UI7 A;  3V98 A;  4HKV B;  3FG4 A;  2CHC A;  1WNH A;  5D83 A;  1VQM 3;  3AMO B;  2GEY A;  4N6O B;  2BO9 B;  2Z77 A;  1JN5 A;  1Q40 A;  3ECF A;  3SOA A;  3WOF B;  3KSP A;  1GY5 A;  3FG1 A;  4I4K A;  4HYZ A;  3O8Y A;  4O3V A;  3NQY A;  1OGX A;  3FZW A;  1NJI 4;  1WTH A;  3EC9 A;  4CCV A;  3PZW A;  4K61 A;  1JJ2 2;  4GB5 A;  2CFW A;  2W2C A;  1M9G A;  4CDL A;  1VQK 3;  2C10 A;  4H61 A;  5EVH A;  3WMD A;  1JKG A;  1VQN 3;  2BNG A;  3CNX A;  2P0X A;  2W9Q A;  2Y73 A;  2OQE A;  3OX9 A;  2FNQ A;  4RNY A;  5HGR A;  5LC7 A;  3M8C A;  5AYS C;  3X40 A;  2ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...