4WYKB

Structure of the lrr and ntf2-like domains of nxf1 complexed with nxt1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
138
structure length
138
Chain Sequence
b'SVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nuclear RNA export factor 1
publication title The principal mRNA nuclear export factor NXF1:NXT1 forms a symmetric binding platform that facilitates export of retroviral CTE-RNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 37
structure length 138
sequence length 138
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4wykB00
1W02A 3A76A 1QMAA 1EA2A 5DRVA 1BUQA 1TUHA 3FZWA 4LMIA 6STDA 3KE7A 5CXOA 2IMJA 3GZYB 2XR8B 2YFIB 1JKGA 4HZBB 3F8HA 5JPUA 4HJLB 1K41A 1GY5A 4OVMA 3HK4A 3GZBA 1OUNA 1OCVA 3FKAA 4XBYA 3VSYA 2UX0A 4L8OA 3EHCA 2R4IA 4HM3B 3G8ZA 1WQLB 4X2OA 3K0ZA 2GBWB 3MG1A 3EN1B 4HVNA 1GYBA 5CLKA 1JKGB 1EG9B 2HMJB 2HMMB 3EN8A 1DMQA 4HM0B 3H51A 3ROBA 1OHPA 2B1XB 1OH0A 3NBRA 3NV0A 4LEHA 2STDA 5FW5A 2F86B 2I9WA 4LGQA 4X2HA 4U13A 2RCDA 5BVBA 1HKXA 3NHXA 4GB5A 3MYTA 5G2GA 5JPPA 4J8TA 1ULIB 4H3UA 1AR0A 1C7HA 5CK6A 3MHEA 1OF5B 3FLJA 1E3VA 5IG3A 1O7HB 5CF2A 1JN5B 3FGYA 3SEDA 1SJWA 3UNLA 3F7XA 2F99A 3F8XA 1Q42A 2HMKB 4HZ9B 3FF2A 3GWRA 3T8UA 4HKVB 3EBYA 3NUVA 3DMCA 3UJMA 5AIIA 1O7MB 1OGZA 5KP1A 5IF6A 3KSPA 4XBTA 3MG3A 8CHOA 2GEYA 1ULJB 1GS3A 2XSHB 5IEPA 4L7KA 4FCJA 5AEWB 1ISKA 2K54A 1OHSA 2INXA 3K7CA 5IERA 1NDOB 3OX9A 3RGRA 2CKFB 3DM8A 3MG2A 3CNXA 3F9SA 2XRXB 1U5OA 4Q53A 4XB5A 2BMOB 2BMQB 5AIFA 4FCMA 5CF1A 2Z7AA 4R9KA 3OWSA 3OV4A 1STDA 3B8LA 2YFLB 2Z76A 3E99A 4IIAA 4L8PA 4WYKA 3CU3A 4WP5A 2BMRB 4I4KA 4CDLA 4HM2B 3EC9A 7STDA 3FH1A 3BLZA 3WMDA 5IG5A 4HM1B 2HMNB 3LYGA 1GY6A 1NWWA 3CPOA 4ORLA 4XDWA 3B7CA 1A2KA 1DMMA 3FSDA 1JB4A 2JQ5A 3GZXB 3F40A 5KP4A 1W01A 1OGXA 4WYKB 3I0YA 5D81A 4OUQA 1ZO2A 4R1KA 1GY7A 3B4OA 3STDA 4PEJA 3HZPA 3BB9A 2GEXA 3FF0A 3NV0B 3HX8A 4RZMA 2HMLB 3CNMA 4HM5B 3DXOA 3H3HA 3ECFA 1Q40A 4HM4B 4KVHA 1E97A 4XM4A 3OWUA 3KKGA 4K1VA 3EQQB 3JUPA 1E3RA 4N3VA 1JB2A 3S5CA 5AEUB 1Z1SA 1O7WB 3NXJA 2XSOB 4WWUC 5IENA 4STDA 5EVHA 1Q40B 2RGQA 2F98A 5DREA 3IPTA 3EF8A 1O7PB 3NM2A 3LZAA 3F7SA 1W6YA 1IDPA 5AI1A 1UUVB 1ZX2A 2QGUA 1W00A 1ASKA 3EBTA 1QJGA 3JUOA 3DUKA 2Z77A 5HGRA 5TGNA 5IEOA 5STDA 2A15A 5AIHA 1VZZA 3RGAA 2QIYA 2PZVA 3SOAA 3JUMA 3GZRA 2OWPA 3OWYA 3M8CA 5BXQA 2RFRA 3EX9A 4K1UA 4HM7B 1OF5A 3JUQA 5IG0A 5IG4A 5D82A 1S5AA 2GXFA 1OPYA 1JN5A 2YFJB 2B24B 3JUNA 1NU3A 5KP3A 5AIGA 4HM8B 3G16A 1JB5A 4HM6B 3D9RA 3MKIA 2W2CA 3SOYA 1DMNA 3VGNA 4MJDA 3DZLA 4XDVA 2BNGA 1UUWB 3Q90A 4J9AA 1OHOA 3G0KA 3KZTA 1O7NB 3MSOA 3B4PA 3T8NA 2CHCA 3ER7A 5D83A 1TP6A 3OXAA 2GBXB 1CQSA 3GRDA 3EJVA 2HMOB 4R9LA 1O7GB 4XBXA 3F14A
chains in the Genus database with same CATH superfamily
1V58A 3NBJA 1W02A 1I70A 2BT3A 2YX9A 3A76A 1QMAA 3NQZA 4ZM8A 3SXXA 1BRGA 1EA2A 5ELUA 3D3LA 5DRVA 1VQ83 2KF4A 3K5TA 1BUQA 1TUHA 4O3VA 2CWTA 3I553 1N8R4 3FZWA 4LMIA 2K0MA 2W9QA 2ZL8A 1B27A 5A0OB 6STDA 3CCL3 3KE7A 5CXOA 3LT8A 2IMJA 1X1XA 1GD3A 2WOFA 2XR8B 3GZYB 2PNCA 1JKGA 2YFIB 4HZBB 3V92A 1VQP3 3N8BA 2P0MA 3F8HA 1MGWA 1IVVA 1F8NA 5JPUA 2XGLA 4HJLB 2CC3A 1K41A 1GY5A 4JF8A 1SPUA 4OVMA 2K3DA 3BNCA 3HIGA 1YHQ3 3CCR3 3HK4A 5AYRB 1DETA 3AHSA 3GZBA 1VQ43 1OUNA 2KXGA 1STFI 1TJDA 1N9EA 1OCVA 2W03A 1VQ73 4EC6A 1IVXA 3FKAA 4WHAA 4XBYA 3U1WA 3VSYA 1BNEA 3WR2A 2UX0A 4L8OA 3EHCA 4JRFA 4RNTA 1K734 1N9JA 2R4IA 3NM7A 4HM3B 3G8ZA 2IA7A 2O3OA 1A2PA 3DY5A 1UI8A 2W9PA 4IPBA 1IT7A 1WQLB 2ZA4A 1MNLA 4X2OA 3WA3A 2ML6A 3K0ZA 2WGQA 3G4S3 2GBWB 4EXRA 1A2VA 3QK9A 4BU4A 1MWSA 3MG1A 1I0XA 3EN1B 4HVNA 5HOHA 4GL6A 1GYBA 1I2GA 5CLKA 1JKGB 1UGHI 1BSEA 1BRIA 1EG9B 2L1SA 2CG0A 2HMJB 2HMMB 1DMQA 3EN8A 4FMBA 4HM0B 3CME3 1JZDA 3UL6A 1KSIA 5I97A 1GD4A 1BNIA 1I3IA 1JNQA 1WMPA 3UL5A 2CW9A 2ZDJA 3FG1A 3H51A 1BRNL 4BTWA 3ROBA 2O9UX 1EKMA 3IJEB 4K61A 1OHPA 3BNBA 2B1XB 1PFPA 1OH0A 3L0RA 3NQYA 1BNFA 3RNTA 3CMA3 1G02A 1GMRA 3NBRA 1LOYA 3NV0A 3WA2X 2P0XA 4N6NB 4LEHA 3D5IA 1W7CA 4KFDA 2STDA 5FW5A 2M7OA 2F86B 2P38A 2I9WA 1B2ZA 2BHMA 1D6YA 4LGQA 1BNSA 2CFGA 2E2UA 3IMAB 3LXUX 4X2HA 3KFQC 4U13A 3LT9A 1B20A 2RCDA 5BVBA 2CIUA 4RNYA 1HKXA 3NHXA 1CYVA 1RGLA 2MF7A 4GB5A 1FUWA 3MYTA 5RNTA 5G2GA 5JPPA 1Q824 4GSPA 1IYYA 4J8TA 3U97A 1RNTA 4KFEA 3EB8A 1RTUA 2WOHA 1ULIB 2W56A 3VF1A 1JRQA 4H3UA 1AR0A 1C7HA 2GU3A 2P05A 1T3BA 1MGRA 5CK6A 3MHEA 1YGWA 2F56A 1OF5B 2KF5A 1BGSA 3FLJA 1LQMB 1BANA 1E3VA 5IG3A 3HOHA 1Q7HA 4NREA 2KF3A 1CH0A 1BU4A 1O7HB 1IK3A 4N6LA 3FG4A 3Q2PA 1JN5B 3FGYA 3SEDA 1SJWA 1UI7A 2CG1A 3SLUA 3UNLA 3F7XA 2F99A 3F8XA 5BU4A 1Q42A 2HMKB 4HZ9B 1WTHA 3CCM3 2IUJA 3FF2A 1T2HA 3GWRA 3T8UA 5LC7A 3UB1A 1VQK3 2H0HA 4HKVB 3EBYA 2L4VA 3NUVA 2D1WA 3DMCA 3UJMA 1W4NA 3DGOA 1GMQA 2OCTA 3WOFB 1DE3A 2CFWA 1IV7A 5AIIA 1LVNA 1TIJA 2W0QA 4FMDA 4IT7A 1O7MB 1OGZA 5KP1A 1A90A 3X3XA 5IF6A 1WMOA 3SVAA 3KSPA 4XBTA 1VQL3 3LOYA 3MG3A 8CHOA 1RGCA 1LXEA 2GEYA 3BU4A 1IU7A 3LTDA 1B2SA 1X1YA 1YNVX 2SARA 2XFSA 1ULJB 2CFKA 1GS3A 1ROAA 4QWTA 3CCE3 2XSHB 1I8VA 3CC23 1VQQA 3NX0A 1YVBI 3AMOA 5IEPA 4L7KA 4EV5A 2OTJ3 2AADA 4FCJA 3NBBA 3WOEB 5AEWB 2Y73A 1T2IA 2LQVA 2KAAA 1ISKA 2K54A 1D6UA 1FA3A 5ELJA 1OHSA 2INXA 3K7CA 5IERA 1NDOB 2Q07A 3OX9A 3RGRA 4DKIA 2CKFB 1RN7A 1BNRA 3DM8A 1U8CB 4EW5A 2F5MA 1TFOA 3MG2A 1RHLA 4TX4A 3CNXA 3X3ZA 3ZG0A 1Q814 1UCKA 1FGRA 1R4CA 3LH4A 3F9SA 1NB3I 1W5ZA 1IV9A 1X1UA 2IUKA 5AYSC 3BNDA 3CPW2 1V74A 3QRDA 5G1LA 4AEQA 1FGTA 3X42A 3PS8A 2XRXB 1M1K4 1U5OA 4MMYB 3WODG 1NJI4 2HOHA 3CCQ3 4Q53A 1YI23 4XB5A 2FNQA 2BMOB 1K9M4 2Z6BA 1B3SA 2BMQB 5AIFA 4FCMA 5CF1A 1LOVA 2Z7AA 3DGMA 4HOHA 3URPA 2OTL3 3DGNA 1BNJA 1J2BA 3KCHA 3PCSA 4R9KA 1BSAA 3OWSA 3OV4A 2V1LA 3AMOB 1STDA 3B8LA 2R41A 2YFLB 2Z76A 3E99A 4IIAA 3V99A 1NB5I 2KCDA 4L8PA 4WYKA 3CU3A 4WP5A 1TFKA 2BMRB 2H0IA 1ZS7A 4I4KA 3I563 1I3FA 1LNHA 4CDLA 2W6JH 3CCS3 1FGMA 3WDGB 1GOYA 1FZUA 1UW1A 4HM2B 1Q864 1NO3A 2SBLA 5CF2A 2GU1A 3OW22 3EC9A 1KWIA 1V57A 7STDA 1YJW3 1FYSA 3FH1A 3BLZA 2MC8A 1EQKA 1IQXA 1BAOA 3PCRA 3WMDA 1RRHA 5IG5A 3JVCA 2HMNB 3D4AA 1RGHA 4HM1B 4R80A 1FUSA 1HU9A 2E2TA 3O8YA 3LYGA 4N6UA 1BSBA 1GY6A 1NWWA 1BRSA 1MOLA 3CPOA 4K90B 4ORLA 4XDWA 1AVKA 3B7CA 1QAKA 5M1AA 1A2KA 1DMMA 3BIRA 3FSDA 1JB4A 1UCJA 3KIIA 5EEOA 5M18A 1A67A 2JQ5A 4I5QA 3GZXB 4N6MA 2CX0A 1IQ8A 3EE1A 1MWRA 3F40A 3X40A 5KP4A 1M1XB 1W01A 1LOWA 1LQGC 1OGXA 1RGEA 4WYKB 4NHFA 1UGIA 3I0YA 5D81A 1IVWA 1RDSA 4OUQA 1VQM3 1ZO2A 1GMPA 3K63A 1MWUA 4FMAA 1GY7A 2P09A 3B4OA 1W6CA 2LYXA 2W04A 4FR9A 4R1KA 4O02B 3STDA 3ALAA 4PEJA 3HZPA 3LMLA 9RNTA 3BB9A 2GEXA 1WNHA 3AGNA 3FF0A 1M904 3NV0B 1EUIC 3HX8A 4RZMA 2E2VA 3T0UA 1BIRA 2HMLB 2IYJA 4H61A 3LTCA 2C10A 2ML5A 3CNMA 4HM5B 1RLSA 3DH2A 1UCLA 1YJ93 3DGLA 1JBTA 1RCKA 2C11A 3DXOA 1HYFA 1M9GA 3A5EA 5EQLA 1RJOA 3H3HA 1LRAA 1BNGA 2OOVA 3D5GA 1YJN3 3ECFA 2KF6A 3KSED 1Q40A 4J5GA 3X3YA 4HM4B 4KVHA 3S28A 1E97A 4XM4A 1VQN3 2W56B 4N6OB 3FG3A 1BSDA 2F4YA 1L5GB 3OWUA 1B21A 4BL3A 1RKYA 3KKGA 1K28A 4K1VA 5JBSA 1KD14 3EQQB 2ZHXB 3JUPA 2QA43 1E3RA 4N3VA 3G713 1RGAA 3LTBA 1TRQA 2D42A 1JB2A 2F5WA 1T5YA 1MWTA 1QALA 3S5CA 3GAXA 5AEUB 1Z1SA 3AGOA 1W2B2 1O7WB 1YIJ3 3NXJA 1JJ22 2XSOB 1DYUA 4R4KA 4WWUC 4EBGA 1JBSA 5IENA 1JV2B 1B2UA 4KT3B 4WFOA 3PZWA 4STDA 1UCIA 1RCLA 3WHOA 3RDEA 5EVHA 1RMSA 1KQS2 1FGOA 1Q40B 3S27A 8RNTA 2RGQA 2F98A 5DREA 4FCZA 2CWVA 1IVUA 1ROVA 2RNTA 3CXC2 3CCJ3 3N54B 2WGOA 3N9HA 1VQO3 3HIIA 3IPTA 7RNTA 3EF8A 1O7PB 3NM2A 1RN4A 3LZAA 3F7SA 4MMXB 3Q1CA 1BRJA 2CFDA 1W6YA 1IDPA 5AI1A 2OOVC 4RNZA 1UUVB 1ZX2A 5BIRA 1G96A 3PYJA 1UDII 2QGUA 2FXTA 4KZ1A 4EV2A 1W00A 5LC6A 1UUGB 2XF3A 1B2MA 1LOXA 1S723 1ASKA 1GOVA 3EBTA 2OQEA 3S67A 1QJGA 3JUOA 3DUKA 2Z77A 4KFFA 4RBNA 5HGRA 5TGNA 2UGIA 2XGNA 1KC84 7GSPA 1DVDA 1RRLA 3ZFZA 5IEOA 3CCU3 1N8QA 5STDA 4BTXA 2A15A 5AIHA 3X41A 1IQYA 5FGOA 4NPBA 1K8A4 5M19A 3KN4A 4BL2A 1SARA 1VZZA 1I0VA 1RGFA 3RGAA 2QIYA 1EEJA 4G1MB 3TDGA 1QVF2 1FGQA 1RSNA 2PZVA 4FMCA 4HYZA 4CPKA 3FCSB 1BOXA 2BU4A 1OACA 3SOAA 3JUMA 3MPHA 4HBRA 1NNVA 1FW7A 4CCVA 1AVLA 3GZRA 2OWPA 6RNTA 3CC43 1VQ63 3OWYA 5G1KA 1W6GA 3M8CA 1N5PA 4O8SA 4EYCA 3PXMA 3G6E3 4BIRA 5BXQA 1IT8A 1C54A 2GSPA 3J7Yd 2RFRA 2BIRA 1X1WA 1PYLA 3EX9A 1AY7A 4K1UA 3HI7A 4HM7B 1OF5A 2J8XB 1AQZA 1US1A 2C4BA 3JUQA 4LSOA 5D82A 5IG0A 3SYUA 4AKZA 5IG4A 1S5AA 2GXFA 2AAEA 1BSCA 4ILFA 1OPYA 3LTAA 2XH9A 1SQWA 1JN5A 1RNBA 4LYLB 2YFJB 3Q3FA 4MEIA 4LZIA 4N6TA 5IW9A 2B24B 1G0TA 1CYUA 1VQ53 2CK3H 3JUNA 1FUTA 1NU3A 1JZOA 2CX1A 2OQEC 5KP3A 5AIGA 2XEPA 4HM8B 3BNEA 3D79A 3G16A 1JB5A 4HM6B 3D9RA 2RBIA 3MKIA 3PGBA 1RN1A 1SIHA 1DMNA 2W2CA 1I2EA 3SOYA 3VGNA 3S29A 1BUJA 4HAAA 4MJDA 1D6ZA 3DZLA 4XDVA 2BNGA 2IY2A 1BRKA 1QAFA 1UUWB 1VQ93 4OK0A 2H0GA 3AHWA 1PU4A 1YGEA 3Q90A 2JDIH 1W2ZA 4BTYA 1HZ1A 1N5HA 1PY3A 1BRHA 1AV4A 4J9AA 1OHOA 1RGGA 2CH9A 2UUGC 1BVIA 1DVCA 1LNIA 3G0KA 2XFTA 1RGKA 3K9MC 3KZTA 4GHOA 1O7NB 1YVSA 1CEWI 3V98A 4J5KA 3MSOA 1Q7Y4 1QVG2 1JBRA 1GOUA 3SX1A 4N6V0 1TRPA 1WMNA 1SIIA 3CCV3 3B4PA 3T8NA 1TTOA 2CHCA 1TU5A 1Q9EA 3ER7A 5D83A 1TP6A 4O2HA 3GSPA 5GSPA 1ZGXA 1Y4KA 2KRTA 3CD63 3DGYA 3OXAA 2GBXB 1CQSA 2Y74A 4MMZB 3CC73 1R4YA 2BO9B 3EJVA 3GRDA 3ZG5A 2CWUA 2HMOB 2RSXA 4R9LA 4CJNA 6GSPA 1YIT3 1O7GB 2FGTA 4XBXA 2WO0A 1I2FA 1B2XA 3F14A 1GSPA 4AKYA 3MWZA 2CFLA 2QEX3
chains in the Genus database with same CATH topology
3NBJA 1W02A 2YX9A 2BT3A 3A76A 1QMAA 3NQZA 4ZM8A 3SXXA 1EA2A 5ELUA 3D3LA 5DRVA 1VQ83 3K5TA 1BUQA 1TUHA 4O3VA 2CWTA 3I553 1N8R4 3FZWA 4LMIA 2K0MA 2W9QA 2ZL8A 6STDA 5A0OB 3CCL3 3KE7A 5CXOA 3LT8A 2IMJA 1GD3A 2WOFA 2XR8B 3GZYB 2PNCA 1JKGA 2YFIB 4HZBB 3V92A 1VQP3 3N8BA 2P0MA 3F8HA 1IVVA 1F8NA 5JPUA 2XGLA 4HJLB 2CC3A 1K41A 1GY5A 4JF8A 1SPUA 4OVMA 3BNCA 3HIGA 1YHQ3 3CCR3 3HK4A 5AYRB 1VQ43 3GZBA 1OUNA 2KXGA 1STFI 1N9EA 1OCVA 2W03A 1VQ73 4EC6A 1IVXA 3FKAA 4WHAA 4XBYA 3U1WA 3VSYA 2UX0A 4L8OA 3EHCA 4JRFA 1K734 1N9JA 2R4IA 3NM7A 4HM3B 3G8ZA 2IA7A 2O3OA 3DY5A 1UI8A 2W9PA 4IPBA 1IT7A 1WQLB 1MNLA 4X2OA 3WA3A 2ML6A 3K0ZA 2WGQA 3G4S3 2GBWB 4EXRA 1A2VA 3QK9A 3MG1A 3EN1B 4HVNA 4GL6A 1GYBA 5CLKA 1JKGB 1EG9B 2CG0A 2HMJB 2HMMB 1DMQA 3EN8A 4FMBA 4HM0B 3CME3 3UL6A 1KSIA 5I97A 1GD4A 3UL5A 1JNQA 1WMPA 2CW9A 2ZDJA 3FG1A 3H51A 4BTWA 3ROBA 2O9UX 1EKMA 3IJEB 4K61A 1OHPA 3BNBA 2B1XB 1PFPA 1OH0A 3L0RA 3NQYA 3CMA3 3NBRA 3NV0A 3WA2X 2P0XA 4N6NB 4LEHA 1W7CA 4KFDA 2STDA 5FW5A 2M7OA 2F86B 2P38A 2I9WA 2BHMA 1D6YA 4LGQA 2CFGA 2E2UA 3IMAB 3LXUX 4X2HA 3KFQC 4U13A 3LT9A 2RCDA 5BVBA 2CIUA 4RNYA 1HKXA 3NHXA 1CYVA 2MF7A 4GB5A 1FUWA 3MYTA 5G2GA 5JPPA 1Q824 4J8TA 3U97A 4KFEA 3EB8A 2WOHA 1ULIB 2W56A 3VF1A 1JRQA 4H3UA 1AR0A 1C7HA 2GU3A 2P05A 5CK6A 3MHEA 1OF5B 3FLJA 1E3VA 5IG3A 4NREA 1O7HB 1IK3A 4N6LA 3FG4A 3Q2PA 1JN5B 3FGYA 3SEDA 1SJWA 1UI7A 2CG1A 3SLUA 3UNLA 3F7XA 2F99A 3F8XA 1Q42A 2HMKB 4HZ9B 1WTHA 3CCM3 2IUJA 3FF2A 3GWRA 3T8UA 5LC7A 3UB1A 1VQK3 4HKVB 3EBYA 2L4VA 3NUVA 2D1WA 3DMCA 3UJMA 1W4NA 3DGOA 2OCTA 3WOFB 2CFWA 1IV7A 5AIIA 1LVNA 1TIJA 2W0QA 4FMDA 4IT7A 1O7MB 1OGZA 5KP1A 1A90A 3X3XA 5IF6A 1WMOA 3SVAA 3KSPA 4XBTA 1VQL3 3LOYA 3MG3A 8CHOA 1LXEA 2GEYA 3LTDA 1IU7A 2XFSA 1ULJB 2CFKA 1GS3A 1ROAA 4QWTA 3CCE3 2XSHB 3CC23 3NX0A 1YVBI 3AMOA 5IEPA 4L7KA 4EV5A 2OTJ3 4FCJA 3WOEB 3NBBA 5AEWB 2Y73A 2LQVA 1ISKA 2K54A 1D6UA 1FA3A 5ELJA 1OHSA 2INXA 3K7CA 5IERA 1NDOB 2Q07A 3OX9A 3RGRA 2CKFB 1RN7A 3DM8A 1U8CB 1TFOA 3MG2A 4TX4A 3CNXA 3X3ZA 1Q814 1FGRA 1R4CA 3LH4A 3F9SA 1NB3I 1W5ZA 1IV9A 2IUKA 5AYSC 3BNDA 3CPW2 1V74A 3QRDA 4AEQA 1FGTA 3X42A 3PS8A 2XRXB 1M1K4 1U5OA 4MMYB 3WODG 1NJI4 3CCQ3 4Q53A 1YI23 4XB5A 2FNQA 2BMOB 1K9M4 2Z6BA 2BMQB 5AIFA 4FCMA 5CF1A 2Z7AA 3DGMA 2OTL3 3DGNA 1J2BA 4R9KA 3PCSA 3OWSA 3OV4A 2V1LA 3AMOB 1STDA 3B8LA 2YFLB 2Z76A 3E99A 4IIAA 3V99A 1NB5I 2KCDA 4L8PA 4WYKA 3CU3A 4WP5A 1TFKA 2BMRB 4I4KA 3I563 1LNHA 4CDLA 2W6JH 3CCS3 1FGMA 3WDGB 1UW1A 4HM2B 1Q864 1NO3A 2SBLA 5CF2A 2GU1A 3OW22 3EC9A 1KWIA 7STDA 1YJW3 3FH1A 2MC8A 3BLZA 1EQKA 1IQXA 3PCRA 3WMDA 5IG5A 1RRHA 3JVCA 2HMNB 4HM1B 4R80A 3O8YA 1HU9A 2E2TA 4N6UA 3LYGA 1GY6A 1NWWA 1MOLA 3CPOA 4K90B 4ORLA 4XDWA 1AVKA 3B7CA 1QAKA 1A2KA 1DMMA 3FSDA 3KIIA 1JB4A 5EEOA 1A67A 2JQ5A 3GZXB 4N6MA 1IQ8A 3EE1A 3F40A 3X40A 5KP4A 1M1XB 1W01A 1OGXA 4WYKB 4NHFA 3I0YA 5D81A 1IVWA 1VQM3 4OUQA 1ZO2A 3K63A 4FMAA 4R1KA 1GY7A 2P09A 3B4OA 1W6CA 2LYXA 2W04A 4FR9A 3STDA 4O02B 3ALAA 4PEJA 3HZPA 3LMLA 3BB9A 2GEXA 1WNHA 3FF0A 1M904 3NV0B 3HX8A 4RZMA 2E2VA 3T0UA 4H61A 2HMLB 3LTCA 2C10A 2ML5A 3CNMA 4HM5B 1YJ93 3DGLA 2C11A 3DXOA 1M9GA 5EQLA 1RJOA 3H3HA 2OOVA 1YJN3 3ECFA 3KSED 1Q40A 3X3YA 4HM4B 4KVHA 3S28A 1E97A 4XM4A 1VQN3 2W56B 4N6OB 3FG3A 1L5GB 3OWUA 1RKYA 3KKGA 1K28A 4K1VA 5JBSA 1KD14 3EQQB 3JUPA 2QA43 1E3RA 4N3VA 3G713 3LTBA 2D42A 1JB2A 1T5YA 1QALA 3S5CA 3GAXA 5AEUB 1Z1SA 1W2B2 1O7WB 1YIJ3 3NXJA 1JJ22 2XSOB 1DYUA 4R4KA 4WWUC 4EBGA 5IENA 1JV2B 4WFOA 3PZWA 4STDA 3RDEA 5EVHA 1KQS2 1FGOA 1Q40B 3S27A 2RGQA 2F98A 5DREA 4FCZA 2CWVA 1IVUA 1ROVA 3CCJ3 3CXC2 3N54B 2WGOA 3N9HA 3HIIA 3IPTA 3EF8A 1O7PB 3NM2A 3LZAA 3F7SA 4MMXB 3Q1CA 2CFDA 1W6YA 1IDPA 5AI1A 2OOVC 4RNZA 1UUVB 1ZX2A 1G96A 3PYJA 2QGUA 4KZ1A 2FXTA 4EV2A 1W00A 5LC6A 2XF3A 1LOXA 1S723 1ASKA 3EBTA 2OQEA 3S67A 1QJGA 3JUOA 3DUKA 2Z77A 4KFFA 4RBNA 5HGRA 5TGNA 2XGNA 1DVDA 1KC84 1RRLA 5IEOA 3CCU3 1N8QA 5STDA 4BTXA 2A15A 5AIHA 3X41A 1IQYA 5FGOA 1K8A4 3KN4A 1VZZA 3RGAA 2QIYA 4G1MB 3TDGA 1QVF2 1FGQA 2PZVA 4FMCA 4HYZA 3FCSB 1OACA 3SOAA 3JUMA 3MPHA 4HBRA 4CCVA 1AVLA 3GZRA 2OWPA 3CC43 1VQ63 3OWYA 1W6GA 3M8CA 1N5PA 4O8SA 4EYCA 3PXMA 3G6E3 5BXQA 1IT8A 2RFRA 3EX9A 4K1UA 3HI7A 4HM7B 1OF5A 1US1A 3JUQA 5IG0A 4LSOA 5D82A 4AKZA 5IG4A 1VQO3 1S5AA 2GXFA 1OPYA 3LTAA 2XH9A 1SQWA 1JN5A 2YFJB 4MEIA 4LZIA 4N6TA 5IW9A 2B24B 1CYUA 1VQ53 2CK3H 3JUNA 1NU3A 2OQEC 5KP3A 5AIGA 2XEPA 4HM8B 3BNEA 3G16A 1JB5A 4HM6B 3D9RA 3MKIA 3PGBA 2W2CA 1SIHA 1DMNA 3SOYA 3VGNA 3S29A 4MJDA 1D6ZA 3DZLA 4XDVA 2BNGA 1QAFA 1UUWB 1VQ93 4OK0A 1PU4A 1YGEA 3Q90A 2JDIH 1W2ZA 4BTYA 1N5HA 1AV4A 4J9AA 1OHOA 2CH9A 3K9MC 1DVCA 3G0KA 2XFTA 3KZTA 1O7NB 3V98A 1CEWI 1Q7Y4 3MSOA 1QVG2 3SX1A 4N6V0 1WMNA 1SIIA 3CCV3 3B4PA 3T8NA 1TU5A 2CHCA 3ER7A 5D83A 1TP6A 4O2HA 1Y4KA 3CD63 2KRTA 3OXAA 2GBXB 1CQSA 2Y74A 4MMZB 3CC73 3GRDA 2BO9B 3EJVA 3J7Yd 2CWUA 2HMOB 2RSXA 4R9LA 1YIT3 1O7GB 2FGTA 4XBXA 2WO0A 4AKYA 3F14A 3MWZA 2CFLA 2QEX3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W02 A;  3A76 A;  1QMA A;  1EA2 A;  5DRV A;  1BUQ A;  1TUH A;  3FZW A;  4LMI A;  6STD A;  3KE7 A;  5CXO A;  2IMJ A;  3GZY B;  2XR8 B;  2YFI B;  1JKG A;  4HZB B;  3F8H A;  5JPU A;  4HJL B;  1K41 A;  1GY5 A;  4OVM A;  3HK4 A;  3GZB A;  1OUN A;  1OCV A;  3FKA A;  4XBY A;  3VSY A;  2UX0 A;  4L8O A;  3EHC A;  2R4I A;  4HM3 B;  3G8Z A;  1WQL B;  4X2O A;  3K0Z A;  2GBW B;  3MG1 A;  3EN1 B;  4HVN A;  1GYB A;  5CLK A;  1JKG B;  1EG9 B;  2HMJ B;  2HMM B;  3EN8 A;  1DMQ A;  4HM0 B;  3H51 A;  3ROB A;  1OHP A;  2B1X B;  1OH0 A;  3NBR A;  3NV0 A;  4LEH A;  2STD A;  5FW5 A;  2F86 B;  2I9W A;  4LGQ A;  4X2H A;  4U13 A;  2RCD A;  5BVB A;  1HKX A;  3NHX A;  4GB5 A;  3MYT A;  5G2G A;  5JPP A;  4J8T A;  1ULI B;  4H3U A;  1AR0 A;  1C7H A;  5CK6 A;  3MHE A;  1OF5 B;  3FLJ A;  1E3V A;  5IG3 A;  1O7H B;  5CF2 A;  1JN5 B;  3FGY A;  3SED A;  1SJW A;  3UNL A;  3F7X A;  2F99 A;  3F8X A;  1Q42 A;  2HMK B;  4HZ9 B;  3FF2 A;  3GWR A;  3T8U A;  4HKV B;  3EBY A;  3NUV A;  3DMC A;  3UJM A;  5AII A;  1O7M B;  1OGZ A;  5KP1 A;  5IF6 A;  3KSP A;  4XBT A;  3MG3 A;  8CHO A;  2GEY A;  1ULJ B;  1GS3 A;  2XSH B;  5IEP A;  4L7K A;  4FCJ A;  5AEW B;  1ISK A;  2K54 A;  1OHS A;  2INX A;  3K7C A;  5IER A;  1NDO B;  3OX9 A;  3RGR A;  2CKF B;  3DM8 A;  3MG2 A;  3CNX A;  3F9S A;  2XRX B;  1U5O A;  4Q53 A;  4XB5 A;  2BMO B;  2BMQ B;  5AIF A;  4FCM A;  5CF1 A;  2Z7A A;  4R9K A;  3OWS A;  3OV4 A;  1STD A;  3B8L A;  2YFL B;  2Z76 A;  3E99 A;  4IIA A;  4L8P A;  4WYK A;  3CU3 A;  4WP5 A;  2BMR B;  4I4K A;  4CDL A;  4HM2 B;  3EC9 A;  7STD A;  3FH1 A;  3BLZ A;  3WMD A;  5IG5 A;  4HM1 B;  2HMN B;  3LYG A;  1GY6 A;  1NWW A;  3CPO A;  4ORL A;  4XDW A;  3B7C A;  1A2K A;  1DMM A;  3FSD A;  1JB4 A;  2JQ5 A;  3GZX B;  3F40 A;  5KP4 A;  1W01 A;  1OGX A;  4WYK B;  3I0Y A;  5D81 A;  4OUQ A;  1ZO2 A;  4R1K A;  1GY7 A;  3B4O A;  3STD A;  4PEJ A;  3HZP A;  3BB9 A;  2GEX A;  3FF0 A;  3NV0 B;  3HX8 A;  4RZM A;  2HML B;  3CNM A;  4HM5 B;  3DXO A;  3H3H A;  3ECF A;  1Q40 A;  4HM4 B;  4KVH A;  1E97 A;  4XM4 A;  3OWU A;  3KKG A;  4K1V A;  3EQQ B;  3JUP A;  1E3R A;  4N3V A;  1JB2 A;  3S5C A;  5AEU B;  1Z1S A;  1O7W B;  3NXJ A;  2XSO B;  4WWU C;  5IEN A;  4STD A;  5EVH A;  1Q40 B;  2RGQ A;  2F98 A;  5DRE A;  3IPT A;  3EF8 A;  1O7P B;  3NM2 A;  3LZA A;  3F7S A;  1W6Y A;  1IDP A;  5AI1 A;  1UUV B;  1ZX2 A;  2QGU A;  1W00 A;  1ASK A;  3EBT A;  1QJG A;  3JUO A;  3DUK A;  2Z77 A;  5HGR A;  5TGN A;  5IEO A;  5STD A;  2A15 A;  5AIH A;  1VZZ A;  3RGA A;  2QIY A;  2PZV A;  3SOA A;  3JUM A;  3GZR A;  2OWP A;  3OWY A;  3M8C A;  5BXQ A;  2RFR A;  3EX9 A;  4K1U A;  4HM7 B;  1OF5 A;  3JUQ A;  5IG0 A;  5IG4 A;  5D82 A;  1S5A A;  2GXF A;  1OPY A;  1JN5 A;  2YFJ B;  2B24 B;  3JUN A;  1NU3 A;  5KP3 A;  5AIG A;  4HM8 B;  3G16 A;  1JB5 A;  4HM6 B;  3D9R A;  3MKI A;  2W2C A;  3SOY A;  1DMN A;  3VGN A;  4MJD A;  3DZL A;  4XDV A;  2BNG A;  1UUW B;  3Q90 A;  4J9A A;  1OHO A;  3G0K A;  3KZT A;  1O7N B;  3MSO A;  3B4P A;  3T8N A;  2CHC A;  3ER7 A;  5D83 A;  1TP6 A;  3OXA A;  2GBX B;  1CQS A;  3GRD A;  3EJV A;  2HMO B;  4R9L A;  1O7G B;  4XBX A;  3F14 A; 
#chains in the Genus database with same CATH topology
 1V58 A;  3NBJ A;  1W02 A;  1I70 A;  2BT3 A;  2YX9 A;  3A76 A;  1QMA A;  3NQZ A;  4ZM8 A;  3SXX A;  1BRG A;  1EA2 A;  5ELU A;  3D3L A;  5DRV A;  1VQ8 3;  2KF4 A;  3K5T A;  1BUQ A;  1TUH A;  4O3V A;  2CWT A;  3I55 3;  1N8R 4;  3FZW A;  4LMI A;  2K0M A;  2W9Q A;  2ZL8 A;  1B27 A;  5A0O B;  6STD A;  3CCL 3;  3KE7 A;  5CXO A;  3LT8 A;  2IMJ A;  1X1X A;  1GD3 A;  2WOF A;  2XR8 B;  3GZY B;  2PNC A;  1JKG A;  2YFI B;  4HZB B;  3V92 A;  1VQP 3;  3N8B A;  2P0M A;  3F8H A;  1MGW A;  1IVV A;  1F8N A;  5JPU A;  2XGL A;  4HJL B;  2CC3 A;  1K41 A;  1GY5 A;  4JF8 A;  1SPU A;  4OVM A;  2K3D A;  3BNC A;  3HIG A;  1YHQ 3;  3CCR 3;  3HK4 A;  5AYR B;  1DET A;  3AHS A;  3GZB A;  1VQ4 3;  1OUN A;  2KXG A;  1STF I;  1TJD A;  1N9E A;  1OCV A;  2W03 A;  1VQ7 3;  4EC6 A;  1IVX A;  3FKA A;  4WHA A;  4XBY A;  3U1W A;  3VSY A;  1BNE A;  3WR2 A;  2UX0 A;  4L8O A;  3EHC A;  4JRF A;  4RNT A;  1K73 4;  1N9J A;  2R4I A;  3NM7 A;  4HM3 B;  3G8Z A;  2IA7 A;  2O3O A;  1A2P A;  3DY5 A;  1UI8 A;  2W9P A;  4IPB A;  1IT7 A;  1WQL B;  2ZA4 A;  1MNL A;  4X2O A;  3WA3 A;  2ML6 A;  3K0Z A;  2WGQ A;  3G4S 3;  2GBW B;  4EXR A;  1A2V A;  3QK9 A;  4BU4 A;  1MWS A;  3MG1 A;  1I0X A;  3EN1 B;  4HVN A;  5HOH A;  4GL6 A;  1GYB A;  1I2G A;  5CLK A;  1JKG B;  1UGH I;  1BSE A;  1BRI A;  1EG9 B;  2L1S A;  2CG0 A;  2HMJ B;  2HMM B;  1DMQ A;  3EN8 A;  4FMB A;  4HM0 B;  3CME 3;  1JZD A;  3UL6 A;  1KSI A;  5I97 A;  1GD4 A;  1BNI A;  1I3I A;  1JNQ A;  1WMP A;  3UL5 A;  2CW9 A;  2ZDJ A;  3FG1 A;  3H51 A;  1BRN L;  4BTW A;  3ROB A;  2O9U X;  1EKM A;  3IJE B;  4K61 A;  1OHP A;  3BNB A;  2B1X B;  1PFP A;  1OH0 A;  3L0R A;  3NQY A;  1BNF A;  3RNT A;  3CMA 3;  1G02 A;  1GMR A;  3NBR A;  1LOY A;  3NV0 A;  3WA2 X;  2P0X A;  4N6N B;  4LEH A;  3D5I A;  1W7C A;  4KFD A;  2STD A;  5FW5 A;  2M7O A;  2F86 B;  2P38 A;  2I9W A;  1B2Z A;  2BHM A;  1D6Y A;  4LGQ A;  1BNS A;  2CFG A;  2E2U A;  3IMA B;  3LXU X;  4X2H A;  3KFQ C;  4U13 A;  3LT9 A;  1B20 A;  2RCD A;  5BVB A;  2CIU A;  4RNY A;  1HKX A;  3NHX A;  1CYV A;  1RGL A;  2MF7 A;  4GB5 A;  1FUW A;  3MYT A;  5RNT A;  5G2G A;  5JPP A;  1Q82 4;  4GSP A;  1IYY A;  4J8T A;  3U97 A;  1RNT A;  4KFE A;  3EB8 A;  1RTU A;  2WOH A;  1ULI B;  2W56 A;  3VF1 A;  1JRQ A;  4H3U A;  1AR0 A;  1C7H A;  2GU3 A;  2P05 A;  1T3B A;  1MGR A;  5CK6 A;  3MHE A;  1YGW A;  2F56 A;  1OF5 B;  2KF5 A;  1BGS A;  3FLJ A;  1LQM B;  1BAN A;  1E3V A;  5IG3 A;  3HOH A;  1Q7H A;  4NRE A;  2KF3 A;  1CH0 A;  1BU4 A;  1O7H B;  1IK3 A;  4N6L A;  3FG4 A;  3Q2P A;  1JN5 B;  3FGY A;  3SED A;  1SJW A;  1UI7 A;  2CG1 A;  3SLU A;  3UNL A;  3F7X A;  2F99 A;  3F8X A;  5BU4 A;  1Q42 A;  2HMK B;  4HZ9 B;  1WTH A;  3CCM 3;  2IUJ A;  3FF2 A;  1T2H A;  3GWR A;  3T8U A;  5LC7 A;  3UB1 A;  1VQK 3;  2H0H A;  4HKV B;  3EBY A;  2L4V A;  3NUV A;  2D1W A;  3DMC A;  3UJM A;  1W4N A;  3DGO A;  1GMQ A;  2OCT A;  3WOF B;  1DE3 A;  2CFW A;  1IV7 A;  5AII A;  1LVN A;  1TIJ A;  2W0Q A;  4FMD A;  4IT7 A;  1O7M B;  1OGZ A;  5KP1 A;  1A90 A;  3X3X A;  5IF6 A;  1WMO A;  3SVA A;  3KSP A;  4XBT A;  1VQL 3;  3LOY A;  3MG3 A;  8CHO A;  1RGC A;  1LXE A;  2GEY A;  3BU4 A;  1IU7 A;  3LTD A;  1B2S A;  1X1Y A;  1YNV X;  2SAR A;  2XFS A;  1ULJ B;  2CFK A;  1GS3 A;  1ROA A;  4QWT A;  3CCE 3;  2XSH B;  1I8V A;  3CC2 3;  1VQQ A;  3NX0 A;  1YVB I;  3AMO A;  5IEP A;  4L7K A;  4EV5 A;  2OTJ 3;  2AAD A;  4FCJ A;  3NBB A;  3WOE B;  5AEW B;  2Y73 A;  1T2I A;  2LQV A;  2KAA A;  1ISK A;  2K54 A;  1D6U A;  1FA3 A;  5ELJ A;  1OHS A;  2INX A;  3K7C A;  5IER A;  1NDO B;  2Q07 A;  3OX9 A;  3RGR A;  4DKI A;  2CKF B;  1RN7 A;  1BNR A;  3DM8 A;  1U8C B;  4EW5 A;  2F5M A;  1TFO A;  3MG2 A;  1RHL A;  4TX4 A;  3CNX A;  3X3Z A;  3ZG0 A;  1Q81 4;  1UCK A;  1FGR A;  1R4C A;  3LH4 A;  3F9S A;  1NB3 I;  1W5Z A;  1IV9 A;  1X1U A;  2IUK A;  5AYS C;  3BND A;  3CPW 2;  1V74 A;  3QRD A;  5G1L A;  4AEQ A;  1FGT A;  3X42 A;  3PS8 A;  2XRX B;  1M1K 4;  1U5O A;  4MMY B;  3WOD G;  1NJI 4;  2HOH A;  3CCQ 3;  4Q53 A;  1YI2 3;  4XB5 A;  2FNQ A;  2BMO B;  1K9M 4;  2Z6B A;  1B3S A;  2BMQ B;  5AIF A;  4FCM A;  5CF1 A;  1LOV A;  2Z7A A;  3DGM A;  4HOH A;  3URP A;  2OTL 3;  3DGN A;  1BNJ A;  1J2B A;  3KCH A;  3PCS A;  4R9K A;  1BSA A;  3OWS A;  3OV4 A;  2V1L A;  3AMO B;  1STD A;  3B8L A;  2R41 A;  2YFL B;  2Z76 A;  3E99 A;  4IIA A;  3V99 A;  1NB5 I;  2KCD A;  4L8P A;  4WYK A;  3CU3 A;  4WP5 A;  1TFK A;  2BMR B;  2H0I A;  1ZS7 A;  4I4K A;  3I56 3;  1I3F A;  1LNH A;  4CDL A;  2W6J H;  3CCS 3;  1FGM A;  3WDG B;  1GOY A;  1FZU A;  1UW1 A;  4HM2 B;  1Q86 4;  1NO3 A;  2SBL A;  5CF2 A;  2GU1 A;  3OW2 2;  3EC9 A;  1KWI A;  1V57 A;  7STD A;  1YJW 3;  1FYS A;  3FH1 A;  3BLZ A;  2MC8 A;  1EQK A;  1IQX A;  1BAO A;  3PCR A;  3WMD A;  1RRH A;  5IG5 A;  3JVC A;  2HMN B;  3D4A A;  1RGH A;  4HM1 B;  4R80 A;  1FUS A;  1HU9 A;  2E2T A;  3O8Y A;  3LYG A;  4N6U A;  1BSB A;  1GY6 A;  1NWW A;  1BRS A;  1MOL A;  3CPO A;  4K90 B;  4ORL A;  4XDW A;  1AVK A;  3B7C A;  1QAK A;  5M1A A;  1A2K A;  1DMM A;  3BIR A;  3FSD A;  1JB4 A;  1UCJ A;  3KII A;  5EEO A;  5M18 A;  1A67 A;  2JQ5 A;  4I5Q A;  3GZX B;  4N6M A;  2CX0 A;  1IQ8 A;  3EE1 A;  1MWR A;  3F40 A;  3X40 A;  5KP4 A;  1M1X B;  1W01 A;  1LOW A;  1LQG C;  1OGX A;  1RGE A;  4WYK B;  4NHF A;  1UGI A;  3I0Y A;  5D81 A;  1IVW A;  1RDS A;  4OUQ A;  1VQM 3;  1ZO2 A;  1GMP A;  3K63 A;  1MWU A;  4FMA A;  1GY7 A;  2P09 A;  3B4O A;  1W6C A;  2LYX A;  2W04 A;  4FR9 A;  4R1K A;  4O02 B;  3STD A;  3ALA A;  4PEJ A;  3HZP A;  3LML A;  9RNT A;  3BB9 A;  2GEX A;  1WNH A;  3AGN A;  3FF0 A;  1M90 4;  3NV0 B;  1EUI C;  3HX8 A;  4RZM A;  2E2V A;  3T0U A;  1BIR A;  2HML B;  2IYJ A;  4H61 A;  3LTC A;  2C10 A;  2ML5 A;  3CNM A;  4HM5 B;  1RLS A;  3DH2 A;  1UCL A;  1YJ9 3;  3DGL A;  1JBT A;  1RCK A;  2C11 A;  3DXO A;  1HYF A;  1M9G A;  3A5E A;  5EQL A;  1RJO A;  3H3H A;  1LRA A;  1BNG A;  2OOV A;  3D5G A;  1YJN 3;  3ECF A;  2KF6 A;  3KSE D;  1Q40 A;  4J5G A;  3X3Y A;  4HM4 B;  4KVH A;  3S28 A;  1E97 A;  4XM4 A;  1VQN 3;  2W56 B;  4N6O B;  3FG3 A;  1BSD A;  2F4Y A;  1L5G B;  3OWU A;  1B21 A;  4BL3 A;  1RKY A;  3KKG A;  1K28 A;  4K1V A;  5JBS A;  1KD1 4;  3EQQ B;  2ZHX B;  3JUP A;  2QA4 3;  1E3R A;  4N3V A;  3G71 3;  1RGA A;  3LTB A;  1TRQ A;  2D42 A;  1JB2 A;  2F5W A;  1T5Y A;  1MWT A;  1QAL A;  3S5C A;  3GAX A;  5AEU B;  1Z1S A;  3AGO A;  1W2B 2;  1O7W B;  1YIJ 3;  3NXJ A;  1JJ2 2;  2XSO B;  1DYU A;  4R4K A;  4WWU C;  4EBG A;  1JBS A;  5IEN A;  1JV2 B;  1B2U A;  4KT3 B;  4WFO A;  3PZW A;  4STD A;  1UCI A;  1RCL A;  3WHO A;  3RDE A;  5EVH A;  1RMS A;  1KQS 2;  1FGO A;  1Q40 B;  3S27 A;  8RNT A;  2RGQ A;  2F98 A;  5DRE A;  4FCZ A;  2CWV A;  1IVU A;  1ROV A;  2RNT A;  3CXC 2;  3CCJ 3;  3N54 B;  2WGO A;  3N9H A;  1VQO 3;  3HII A;  3IPT A;  7RNT A;  3EF8 A;  1O7P B;  3NM2 A;  1RN4 A;  3LZA A;  3F7S A;  4MMX B;  3Q1C A;  1BRJ A;  2CFD A;  1W6Y A;  1IDP A;  5AI1 A;  2OOV C;  4RNZ A;  1UUV B;  1ZX2 A;  5BIR A;  1G96 A;  3PYJ A;  1UDI I;  2QGU A;  2FXT A;  4KZ1 A;  4EV2 A;  1W00 A;  5LC6 A;  1UUG B;  2XF3 A;  1B2M A;  1LOX A;  1S72 3;  1ASK A;  1GOV A;  3EBT A;  2OQE A;  3S67 A;  1QJG A;  3JUO A;  3DUK A;  2Z77 A;  4KFF A;  4RBN A;  5HGR A;  5TGN A;  2UGI A;  2XGN A;  1KC8 4;  7GSP A;  1DVD A;  1RRL A;  3ZFZ A;  5IEO A;  3CCU 3;  1N8Q A;  5STD A;  4BTX A;  2A15 A;  5AIH A;  3X41 A;  1IQY A;  5FGO A;  4NPB A;  1K8A 4;  5M19 A;  3KN4 A;  4BL2 A;  1SAR A;  1VZZ A;  1I0V A;  1RGF A;  3RGA A;  2QIY A;  1EEJ A;  4G1M B;  3TDG A;  1QVF 2;  1FGQ A;  1RSN A;  2PZV A;  4FMC A;  4HYZ A;  4CPK A;  3FCS B;  1BOX A;  2BU4 A;  1OAC A;  3SOA A;  3JUM A;  3MPH A;  4HBR A;  1NNV A;  1FW7 A;  4CCV A;  1AVL A;  3GZR A;  2OWP A;  6RNT A;  3CC4 3;  1VQ6 3;  3OWY A;  5G1K A;  1W6G A;  3M8C A;  1N5P A;  4O8S A;  4EYC A;  3PXM A;  3G6E 3;  4BIR A;  5BXQ A;  1IT8 A;  1C54 A;  2GSP A;  3J7Y d;  2RFR A;  2BIR A;  1X1W A;  1PYL A;  3EX9 A;  1AY7 A;  4K1U A;  3HI7 A;  4HM7 B;  1OF5 A;  2J8X B;  1AQZ A;  1US1 A;  2C4B A;  3JUQ A;  4LSO A;  5D82 A;  5IG0 A;  3SYU A;  4AKZ A;  5IG4 A;  1S5A A;  2GXF A;  2AAE A;  1BSC A;  4ILF A;  1OPY A;  3LTA A;  2XH9 A;  1SQW A;  1JN5 A;  1RNB A;  4LYL B;  2YFJ B;  3Q3F A;  4MEI A;  4LZI A;  4N6T A;  5IW9 A;  2B24 B;  1G0T A;  1CYU A;  1VQ5 3;  2CK3 H;  3JUN A;  1FUT A;  1NU3 A;  1JZO A;  2CX1 A;  2OQE C;  5KP3 A;  5AIG A;  2XEP A;  4HM8 B;  3BNE A;  3D79 A;  3G16 A;  1JB5 A;  4HM6 B;  3D9R A;  2RBI A;  3MKI A;  3PGB A;  1RN1 A;  1SIH A;  1DMN A;  2W2C A;  1I2E A;  3SOY A;  3VGN A;  3S29 A;  1BUJ A;  4HAA A;  4MJD A;  1D6Z A;  3DZL A;  4XDV A;  2BNG A;  2IY2 A;  1BRK A;  1QAF A;  1UUW B;  1VQ9 3;  4OK0 A;  2H0G A;  3AHW A;  1PU4 A;  1YGE A;  3Q90 A;  2JDI H;  1W2Z A;  4BTY A;  1HZ1 A;  1N5H A;  1PY3 A;  1BRH A;  1AV4 A;  4J9A A;  1OHO A;  1RGG A;  2CH9 A;  2UUG C;  1BVI A;  1DVC A;  1LNI A;  3G0K A;  2XFT A;  1RGK A;  3K9M C;  3KZT A;  4GHO A;  1O7N B;  1YVS A;  1CEW I;  3V98 A;  4J5K A;  3MSO A;  1Q7Y 4;  1QVG 2;  1JBR A;  1GOU A;  3SX1 A;  4N6V 0;  1TRP A;  1WMN A;  1SII A;  3CCV 3;  3B4P A;  3T8N A;  1TTO A;  2CHC A;  1TU5 A;  1Q9E A;  3ER7 A;  5D83 A;  1TP6 A;  4O2H A;  3GSP A;  5GSP A;  1ZGX A;  1Y4K A;  2KRT A;  3CD6 3;  3DGY A;  3OXA A;  2GBX B;  1CQS A;  2Y74 A;  4MMZ B;  3CC7 3;  1R4Y A;  2BO9 B;  3EJV A;  3GRD A;  3ZG5 A;  2CWU A;  2HMO B;  2RSX A;  4R9L A;  4CJN A;  6GSP A;  1YIT 3;  1O7G B;  2FGT A;  4XBX A;  2WO0 A;  1I2F A;  1B2X A;  3F14 A;  1GSP A;  4AKY A;  3MWZ A;  2CFL A;  2QEX 3; 
#chains in the Genus database with same CATH homology
 3NBJ A;  1W02 A;  2YX9 A;  2BT3 A;  3A76 A;  1QMA A;  3NQZ A;  4ZM8 A;  3SXX A;  1EA2 A;  5ELU A;  3D3L A;  5DRV A;  1VQ8 3;  3K5T A;  1BUQ A;  1TUH A;  4O3V A;  2CWT A;  3I55 3;  1N8R 4;  3FZW A;  4LMI A;  2K0M A;  2W9Q A;  2ZL8 A;  6STD A;  5A0O B;  3CCL 3;  3KE7 A;  5CXO A;  3LT8 A;  2IMJ A;  1GD3 A;  2WOF A;  2XR8 B;  3GZY B;  2PNC A;  1JKG A;  2YFI B;  4HZB B;  3V92 A;  1VQP 3;  3N8B A;  2P0M A;  3F8H A;  1IVV A;  1F8N A;  5JPU A;  2XGL A;  4HJL B;  2CC3 A;  1K41 A;  1GY5 A;  4JF8 A;  1SPU A;  4OVM A;  3BNC A;  3HIG A;  1YHQ 3;  3CCR 3;  3HK4 A;  5AYR B;  1VQ4 3;  3GZB A;  1OUN A;  2KXG A;  1STF I;  1N9E A;  1OCV A;  2W03 A;  1VQ7 3;  4EC6 A;  1IVX A;  3FKA A;  4WHA A;  4XBY A;  3U1W A;  3VSY A;  2UX0 A;  4L8O A;  3EHC A;  4JRF A;  1K73 4;  1N9J A;  2R4I A;  3NM7 A;  4HM3 B;  3G8Z A;  2IA7 A;  2O3O A;  3DY5 A;  1UI8 A;  2W9P A;  4IPB A;  1IT7 A;  1WQL B;  1MNL A;  4X2O A;  3WA3 A;  2ML6 A;  3K0Z A;  2WGQ A;  3G4S 3;  2GBW B;  4EXR A;  1A2V A;  3QK9 A;  3MG1 A;  3EN1 B;  4HVN A;  4GL6 A;  1GYB A;  5CLK A;  1JKG B;  1EG9 B;  2CG0 A;  2HMJ B;  2HMM B;  1DMQ A;  3EN8 A;  4FMB A;  4HM0 B;  3CME 3;  3UL6 A;  1KSI A;  5I97 A;  1GD4 A;  3UL5 A;  1JNQ A;  1WMP A;  2CW9 A;  2ZDJ A;  3FG1 A;  3H51 A;  4BTW A;  3ROB A;  2O9U X;  1EKM A;  3IJE B;  4K61 A;  1OHP A;  3BNB A;  2B1X B;  1PFP A;  1OH0 A;  3L0R A;  3NQY A;  3CMA 3;  3NBR A;  3NV0 A;  3WA2 X;  2P0X A;  4N6N B;  4LEH A;  1W7C A;  4KFD A;  2STD A;  5FW5 A;  2M7O A;  2F86 B;  2P38 A;  2I9W A;  2BHM A;  1D6Y A;  4LGQ A;  2CFG A;  2E2U A;  3IMA B;  3LXU X;  4X2H A;  3KFQ C;  4U13 A;  3LT9 A;  2RCD A;  5BVB A;  2CIU A;  4RNY A;  1HKX A;  3NHX A;  1CYV A;  2MF7 A;  4GB5 A;  1FUW A;  3MYT A;  5G2G A;  5JPP A;  1Q82 4;  4J8T A;  3U97 A;  4KFE A;  3EB8 A;  2WOH A;  1ULI B;  2W56 A;  3VF1 A;  1JRQ A;  4H3U A;  1AR0 A;  1C7H A;  2GU3 A;  2P05 A;  5CK6 A;  3MHE A;  1OF5 B;  3FLJ A;  1E3V A;  5IG3 A;  4NRE A;  1O7H B;  1IK3 A;  4N6L A;  3FG4 A;  3Q2P A;  1JN5 B;  3FGY A;  3SED A;  1SJW A;  1UI7 A;  2CG1 A;  3SLU A;  3UNL A;  3F7X A;  2F99 A;  3F8X A;  1Q42 A;  2HMK B;  4HZ9 B;  1WTH A;  3CCM 3;  2IUJ A;  3FF2 A;  3GWR A;  3T8U A;  5LC7 A;  3UB1 A;  1VQK 3;  4HKV B;  3EBY A;  2L4V A;  3NUV A;  2D1W A;  3DMC A;  3UJM A;  1W4N A;  3DGO A;  2OCT A;  3WOF B;  2CFW A;  1IV7 A;  5AII A;  1LVN A;  1TIJ A;  2W0Q A;  4FMD A;  4IT7 A;  1O7M B;  1OGZ A;  5KP1 A;  1A90 A;  3X3X A;  5IF6 A;  1WMO A;  3SVA A;  3KSP A;  4XBT A;  1VQL 3;  3LOY A;  3MG3 A;  8CHO A;  1LXE A;  2GEY A;  3LTD A;  1IU7 A;  2XFS A;  1ULJ B;  2CFK A;  1GS3 A;  1ROA A;  4QWT A;  3CCE 3;  2XSH B;  3CC2 3;  3NX0 A;  1YVB I;  3AMO A;  5IEP A;  4L7K A;  4EV5 A;  2OTJ 3;  4FCJ A;  3WOE B;  3NBB A;  5AEW B;  2Y73 A;  2LQV A;  1ISK A;  2K54 A;  1D6U A;  1FA3 A;  5ELJ A;  1OHS A;  2INX A;  3K7C A;  5IER A;  1NDO B;  2Q07 A;  3OX9 A;  3RGR A;  2CKF B;  1RN7 A;  3DM8 A;  1U8C B;  1TFO A;  3MG2 A;  4TX4 A;  3CNX A;  3X3Z A;  1Q81 4;  1FGR A;  1R4C A;  3LH4 A;  3F9S A;  1NB3 I;  1W5Z A;  1IV9 A;  2IUK A;  5AYS C;  3BND A;  3CPW 2;  1V74 A;  3QRD A;  4AEQ A;  1FGT A;  3X42 A;  3PS8 A;  2XRX B;  1M1K 4;  1U5O A;  4MMY B;  3WOD G;  1NJI 4;  3CCQ 3;  4Q53 A;  1YI2 3;  4XB5 A;  2FNQ A;  2BMO B;  1K9M 4;  2Z6B A;  2BMQ B;  5AIF A;  4FCM A;  5CF1 A;  2Z7A A;  3DGM A;  2OTL 3;  3DGN A;  1J2B A;  4R9K A;  3PCS A;  3OWS A;  3OV4 A;  2V1L A;  3AMO B;  1STD A;  3B8L A;  2YFL B;  2Z76 A;  3E99 A;  4IIA A;  3V99 A;  1NB5 I;  2KCD A;  4L8P A;  4WYK A;  3CU3 A;  4WP5 A;  1TFK A;  2BMR B;  4I4K A;  3I56 3;  1LNH A;  4CDL A;  2W6J H;  3CCS 3;  1FGM A;  3WDG B;  1UW1 A;  4HM2 B;  1Q86 4;  1NO3 A;  2SBL A;  5CF2 A;  2GU1 A;  3OW2 2;  3EC9 A;  1KWI A;  7STD A;  1YJW 3;  3FH1 A;  2MC8 A;  3BLZ A;  1EQK A;  1IQX A;  3PCR A;  3WMD A;  5IG5 A;  1RRH A;  3JVC A;  2HMN B;  4HM1 B;  4R80 A;  3O8Y A;  1HU9 A;  2E2T A;  4N6U A;  3LYG A;  1GY6 A;  1NWW A;  1MOL A;  3CPO A;  4K90 B;  4ORL A;  4XDW A;  1AVK A;  3B7C A;  1QAK A;  1A2K A;  1DMM A;  3FSD A;  3KII A;  1JB4 A;  5EEO A;  1A67 A;  2JQ5 A;  3GZX B;  4N6M A;  1IQ8 A;  3EE1 A;  3F40 A;  3X40 A;  5KP4 A;  1M1X B;  1W01 A;  1OGX A;  4WYK B;  4NHF A;  3I0Y A;  5D81 A;  1IVW A;  1VQM 3;  4OUQ A;  1ZO2 A;  3K63 A;  4FMA A;  4R1K A;  1GY7 A;  2P09 A;  3B4O A;  1W6C A;  2LYX A;  2W04 A;  4FR9 A;  3STD A;  4O02 B;  3ALA A;  4PEJ A;  3HZP A;  3LML A;  3BB9 A;  2GEX A;  1WNH A;  3FF0 A;  1M90 4;  3NV0 B;  3HX8 A;  4RZM A;  2E2V A;  3T0U A;  4H61 A;  2HML B;  3LTC A;  2C10 A;  2ML5 A;  3CNM A;  4HM5 B;  1YJ9 3;  3DGL A;  2C11 A;  3DXO A;  1M9G A;  5EQL A;  1RJO A;  3H3H A;  2OOV A;  1YJN 3;  3ECF A;  3KSE D;  1Q40 A;  3X3Y A;  4HM4 B;  4KVH A;  3S28 A;  1E97 A;  4XM4 A;  1VQN 3;  2W56 B;  4N6O B;  3FG3 A;  1L5G B;  3OWU A;  1RKY A;  3KKG A;  1K28 A;  4K1V A;  5JBS A;  1KD1 4;  3EQQ B;  3JUP A;  2QA4 3;  1E3R A;  4N3V A;  3G71 3;  3LTB A;  2D42 A;  1JB2 A;  1T5Y A;  1QAL A;  3S5C A;  3GAX A;  5AEU B;  1Z1S A;  1W2B 2;  1O7W B;  1YIJ 3;  3NXJ A;  1JJ2 2;  2XSO B;  1DYU A;  4R4K A;  4WWU C;  4EBG A;  5IEN A;  1JV2 B;  4WFO A;  3PZW A;  4STD A;  3RDE A;  5EVH A;  1KQS 2;  1FGO A;  1Q40 B;  3S27 A;  2RGQ A;  2F98 A;  5DRE A;  4FCZ A;  2CWV A;  1IVU A;  1ROV A;  3CCJ 3;  3CXC 2;  3N54 B;  2WGO A;  3N9H A;  3HII A;  3IPT A;  3EF8 A;  1O7P B;  3NM2 A;  3LZA A;  3F7S A;  4MMX B;  3Q1C A;  2CFD A;  1W6Y A;  1IDP A;  5AI1 A;  2OOV C;  4RNZ A;  1UUV B;  1ZX2 A;  1G96 A;  3PYJ A;  2QGU A;  4KZ1 A;  2FXT A;  4EV2 A;  1W00 A;  5LC6 A;  2XF3 A;  1LOX A;  1S72 3;  1ASK A;  3EBT A;  2OQE A;  3S67 A;  1QJG A;  3JUO A;  3DUK A;  2Z77 A;  4KFF A;  4RBN A;  5HGR A;  5TGN A;  2XGN A;  1DVD A;  1KC8 4;  1RRL A;  5IEO A;  3CCU 3;  1N8Q A;  5STD A;  4BTX A;  2A15 A;  5AIH A;  3X41 A;  1IQY A;  5FGO A;  1K8A 4;  3KN4 A;  1VZZ A;  3RGA A;  2QIY A;  4G1M B;  3TDG A;  1QVF 2;  1FGQ A;  2PZV A;  4FMC A;  4HYZ A;  3FCS B;  1OAC A;  3SOA A;  3JUM A;  3MPH A;  4HBR A;  4CCV A;  1AVL A;  3GZR A;  2OWP A;  3CC4 3;  1VQ6 3;  3OWY A;  1W6G A;  3M8C A;  1N5P A;  4O8S A;  4EYC A;  3PXM A;  3G6E 3;  5BXQ A;  1IT8 A;  2RFR A;  3EX9 A;  4K1U A;  3HI7 A;  4HM7 B;  1OF5 A;  1US1 A;  3JUQ A;  5IG0 A;  4LSO A;  5D82 A;  4AKZ A;  5IG4 A;  1VQO 3;  1S5A A;  2GXF A;  1OPY A;  3LTA A;  2XH9 A;  1SQW A;  1JN5 A;  2YFJ B;  4MEI A;  4LZI A;  4N6T A;  5IW9 A;  2B24 B;  1CYU A;  1VQ5 3;  2CK3 H;  3JUN A;  1NU3 A;  2OQE C;  5KP3 A;  5AIG A;  2XEP A;  4HM8 B;  3BNE A;  3G16 A;  1JB5 A;  4HM6 B;  3D9R A;  3MKI A;  3PGB A;  2W2C A;  1SIH A;  1DMN A;  3SOY A;  3VGN A;  3S29 A;  4MJD A;  1D6Z A;  3DZL A;  4XDV A;  2BNG A;  1QAF A;  1UUW B;  1VQ9 3;  4OK0 A;  1PU4 A;  1YGE A;  3Q90 A;  2JDI H;  1W2Z A;  4BTY A;  1N5H A;  1AV4 A;  4J9A A;  1OHO A;  2CH9 A;  3K9M C;  1DVC A;  3G0K A;  2XFT A;  3KZT A;  1O7N B;  3V98 A;  1CEW I;  1Q7Y 4;  3MSO A;  1QVG 2;  3SX1 A;  4N6V 0;  1WMN A;  1SII A;  3CCV 3;  3B4P A;  3T8N A;  1TU5 A;  2CHC A;  3ER7 A;  5D83 A;  1TP6 A;  4O2H A;  1Y4K A;  3CD6 3;  2KRT A;  3OXA A;  2GBX B;  1CQS A;  2Y74 A;  4MMZ B;  3CC7 3;  3GRD A;  2BO9 B;  3EJV A;  3J7Y d;  2CWU A;  2HMO B;  2RSX A;  4R9L A;  1YIT 3;  1O7G B;  2FGT A;  4XBX A;  2WO0 A;  4AKY A;  3F14 A;  3MWZ A;  2CFL A;  2QEX 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...