1BRKA

Barnase mutant with ile 96 replaced by ala
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLAYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
molecule keywords BARNASE
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brkA00
1RN4A 1BANA 1X1YA 1BGSA 3SYUA 2RNTA 1C54A 1B3SA 1RSNA 1RGCA 1I2GA 2AADA 1BAOA 1X1UA 1BNGA 3HOHA 1BRGA 1GMRA 1YVSA 1X1WA 1PYLA 1AQZA 2KF6A 2KF3A 3Q3FA 1HZ1A 1BIRA 1LOWA 1BRNL 1BSDA 1YGWA 1BNFA 1BSBA 3BIRA 5RNTA 4HAAA 3URPA 1BSEA 1FW7A 1G02A 4GHOA 2KF5A 1UCLA 1JBTA 1A2PA 3WHOA 2F5MA 2RBIA 1T2IA 7GSPA 9RNTA 4BU4A 6GSPA 1RCLA 1BUJA 1BSCA 1T2HA 1X1XA 1IYYA 3AGNA 1B21A 1JBRA 1B27A 1GOUA 1LRAA 2KF4A 1BVIA 3DGYA 4GSPA 4J5KA 1RGLA 1I0XA 5HOHA 3KCHA 1FUTA 4RNTA 1MGWA 1RGAA 1RTUA 1RN1A 2GSPA 1TRQA 1RGHA 1BOXA 2BIRA 1PY3A 1DETA 2F4YA 1FZUA 1RNBA 1TTOA 1BRKA 1RGEA 1YNVX 1BSAA 8RNTA 1I3IA 1GOVA 1GMQA 3D5IA 1FUSA 3A5EA 1DE3A 2BU4A 1Q9EA 1I0VA 1I2FA 1I70A 2C4BA 3DH2A 1RHLA 1BNIA 3GSPA 1CH0A 1UCIA 1LNIA 1ZGXA 1B20A 6RNTA 1GSPA 1B2UA 1BRHA 1I8VA 1RDSA 3D4AA 2AAEA 1UCKA 1AY7A 1RMSA 1BNEA 4BIRA 3D5GA 3BU4A 1B2SA 1BU4A 1GMPA 1MGRA 1BNJA 2HOHA 3AHSA 1JBSA 4HOHA 1B2XA 7RNTA 1BNSA 1BRJA 1GOYA 3WR2A 1RLSA 1RGFA 4J5GA 2F5WA 2F56A 5BU4A 1HYFA 1BRSA 2ZA4A 1I3FA 5BIRA 1SARA 2SARA 1BRIA 1RGGA 3AGOA 1TRPA 1BNRA 1LOVA 1I2EA 2KAAA 1FYSA 1RNTA 1R4YA 1LOYA 1B2MA 1B2ZA 3AHWA 5GSPA 3RNTA 1RCKA 1UCJA 1RGKA
chains in the Genus database with same CATH superfamily
3OWSA 3SYUA 1OF5B 2RNTA 3NBRA 1BUQA 1B3SA 1HKXA 4HVNA 3DGOA 5AEUB 5AYSC 3E99A 3HOHA 1YJN3 2KF6A 1AQZA 3LT9A 3Q3FA 1RJOA 4KFDA 2BT3A 4LZIA 3K63A 1YGWA 1U5OA 2FXTA 4R4KA 1JRQA 1NO3A 1YGEA 2UUGC 3CNXA 4WHAA 5ELJA 5RNTA 4BTYA 2YFIB 2CWUA 4BL3A 5LC6A 1FW7A 2OTJ3 1IVUA 2BO9B 4RBNA 1FGTA 1OACA 1JBTA 4CCVA 1EA2A 1TP6A 2K0MA 4IT7A 4QWTA 1T2IA 7GSPA 4KFFA 1EKMA 4BU4A 5STDA 3BNCA 2FNQA 3KKGA 3A76A 1JZOA 1MWUA 1JBRA 3FGYA 3T8NA 1SJWA 5CLKA 1KD14 2JDIH 3O8YA 2KF4A 3PXMA 3DGYA 4FCJA 5JBSA 3QK9A 5EEOA 1RGLA 2GXFA 1TFKA 2HMKB 3BNBA 1VQK3 3HX8A 1J2BA 1RTUA 4FMAA 4J8TA 5AYRB 1D6ZA 3OX9A 2CFGA 1TRQA 2CFKA 2HMMB 5AIGA 3FZWA 4LGQA 1W4NA 2OOVC 1OGXA 1W6GA 4L8PA 4RNZA 4WFOA 4IPBA 1IT8A 1I3IA 1GOVA 1A67A 1OGZA 5IENA 4CDLA 3OV4A 2CFDA 3Q90A 3ZFZA 1VQ63 3VSYA 3V99A 3K0ZA 3V92A 4FMBA 4RNYA 2CH9A 1DVCA 1O7NB 2GEXA 1KSIA 2P38A 2XSOB 3GSPA 1PFPA 1UCIA 3CCL3 1B20A 4FCZA 3F14A 2OQEA 2YX9A 3FF0A 1TIJA 1US1A 3RDEA 3PZWA 1CQSA 2AAEA 4MMZB 1JB2A 1IVVA 3AMOA 1MWRA 1RMSA 1Y4KA 1C7HA 1B2SA 4N6LA 2XFSA 1GY6A 3DM8A 1GMPA 1MGRA 3WOFB 1Q824 1ZO2A 5D81A 1HU9A 4O3VA 3CCR3 1IQXA 1RRHA 3CC23 1EUIC 1JB5A 3F9SA 1L5GB 1TFOA 3WA3A 1K8A4 2CG1A 5TGNA 4J5GA 2D1WA 3K9MC 1BRSA 1IVWA 3GRDA 3GAXA 1VQQA 4K61A 5G1LA 1UUVB 2CK3H 2SARA 3BLZA 2K54A 3KZTA 1LQGC 1SIIA 3IPTA 1JZDA 5AIHA 2QA43 1BNRA 1A90A 1UGHI 5HGRA 2WO0A 1FGMA 1MNLA 1RNTA 3G8ZA 1IQ8A 4OUQA 1LOYA 3S28A 1B2MA 1B2ZA 1YIJ3 1LQMB 1RCKA 3IMAB 1UCJA 4FMDA 4FMCA 5D82A 2CKFB 3F8HA 5FW5A 1X1YA 1W02A 4PEJA 1AVKA 4MMXB 3U1WA 4AKYA 1RRLA 3FKAA 1VQP3 4R9KA 1QAKA 3EHCA 2CW9A 2AADA 4XDWA 3NHXA 2BMOB 3ER7A 1IK3A 1GMRA 1Z1SA 3UL6A 3NX0A 3CMA3 2MC8A 1UI7A 1MWSA 4OK0A 4EBGA 1M1XB 2MF7A 3HZPA 4R80A 1LOWA 1OUNA 2XR8B 4XDVA 5CK6A 3SXXA 3EBYA 1BNFA 2RCDA 1D6UA 2V1LA 1BSBA 3BIRA 3GZYB 3CXC2 1JJ22 3NBBA 2HMOB 1BSEA 4XM4A 3URPA 1T3BA 4N3VA 4DKIA 5JPUA 3LXUX 3D9RA 2WOFA 5CF1A 2W56A 3GZXB 4XBXA 4HM8B 3CCQ3 2BNGA 1QMAA 4R1KA 2CG0A 3NQZA 4Q53A 1M1K4 3X42A 3GWRA 9RNTA 3PS8A 2P09A 2W04A 1BSCA 1T2HA 2Q07A 1IYYA 3AGNA 2W56B 4O2HA 5IG5A 1B27A 1MOLA 1GOUA 1K41A 2JQ5A 2ZHXB 3MG2A 4MJDA 5AEWB 1BVIA 4J5KA 5KP3A 5LC7A 3Q1CA 5HOHA 3KCHA 1OHSA 1FUTA 1F8NA 1QJGA 1UUGB 3H51A 3LMLA 3CPW2 1MGWA 4I4KA 1RGAA 2OTL3 1JB4A 3NM7A 1WMPA 1RGHA 2C10A 2P05A 1BOXA 3D79A 3OWYA 2INXA 1K734 4NHFA 1NU3A 1FZUA 1RNBA 4EYCA 4ILFA 1E97A 3STDA 1JNQA 4KT3B 1BRKA 1RGEA 3N8BA 1TU5A 2F98A 1GMQA 5ELUA 4I5QA 1IQYA 3OXAA 4L7KA 1TUHA 2GU3A 4JF8A 4MMYB 4X2OA 2SBLA 3BB9A 1DMMA 2W2CA 1O7MB 4BL2A 2CFLA 1W01A 3MG3A 1WMOA 3EF8A 4G1MB 1V58A 1G0TA 1IDPA 5AIIA 1QALA 1BRHA 3CNMA 8CHOA 3D4AA 2LYXA 2WGQA 1UW1A 5IEOA 1W2B2 1NJI4 1AY7A 1NDOB 3BU4A 1M904 2PNCA 1QVF2 4WYKB 1BU4A 2R41A 4XBYA 3DZLA 1DMQA 4HOHA 1M9GA 1NWWA 1BNSA 1DYUA 5DRVA 3UNLA 1GOYA 1UDII 4X2HA 1V74A 3WODG 3WR2A 1RLSA 1RGFA 3B8LA 1YIT3 5KP4A 3CC73 3MKIA 1UUWB 1O7PB 1SPUA 2W03A 1JV2B 5CF2A 2Z6BA 1FA3A 3OWUA 4NREA 1Q864 5BIRA 2E2TA 1SARA 3S5CA 3EQQB 1BRIA 3MPHA 2QGUA 2K3DA 1TRPA 2C11A 2M7OA 2XGNA 3FCSB 2FGTA 4K1UA 1RKYA 2KAAA 2QIYA 1ULIB 2Y74A 1YHQ3 1IV7A 1R4YA 2UX0A 3FG4A 2CX0A 3LZAA 1ROVA 1VZZA 1GD4A 3FG3A 4HM5B 5G2GA 3J7Yd 1OCVA 2GEYA 5EQLA 4N6MA 3RGAA 4ZM8A 3GZBA 1VQL3 1RN7A 1O7GB 3UL5A 1RN4A 2HMJB 2XFTA 3QRDA 4XB5A 4K1VA 6STDA 2A15A 2XGLA 4ORLA 3N9HA 1RSNA 1EEJA 1RGCA 3WOEB 1W6YA 5IERA 1I2GA 1Q7Y4 1AV4A 3MG1A 3MYTA 1BNGA 2H0GA 3JUOA 1QAFA 1BRGA 3NUVA 2Z76A 4N6UA 1FUWA 1FGQA 2F99A 1ISKA 5IEPA 3EB8A 3KE7A 1PU4A 1IVXA 2YFJB 4EW5A 3GZRA 1STDA 2J8XB 3CD63 3S27A 3HIIA 5IG0A 3T0UA 3KSPA 2B24B 1JKGB 2W0QA 2KF5A 4H61A 1W6CA 4LMIA 3F40A 1UCLA 3SX1A 3I0YA 1A2PA 3CCJ3 2F5MA 2RBIA 1Q814 4WP5A 2IY2A 1VQN3 2B1XB 2BMRB 2IUKA 3BNDA 4WYKA 6GSPA 1BUJA 1B21A 1G96A 2D42A 2IYJA 3EN8A 1YJ93 1LRAA 2Z7AA 1ASKA 3F7SA 4HM2B 3OW22 1WTHA 3EC9A 3NM2A 1UGIA 2W9QA 2KRTA 1N9JA 3EBTA 1SQWA 2QEX3 3X3XA 1RN1A 2HMLB 1A2KA 2IMJA 3VF1A 4AKZA 5JPPA 1DETA 2CX1A 3I553 1W5ZA 2F4YA 2LQVA 3T8UA 1TTOA 1YNVX 5I97A 4HM0B 1BSAA 3I563 3X3ZA 4K90B 3U97A 2HMNB 8RNTA 4EC6A 3B4PA 3D5IA 4J9AA 3A5EA 3HI7A 5BVBA 3BNEA 3Q2PA 1I0VA 1D6YA 1CYVA 1SIHA 3PCSA 4NPBA 3EE1A 3X40A 7STDA 3DUKA 1I70A 1WQLB 3KIIA 2C4BA 3G6E3 2CHCA 1KQS2 5D83A 1YVBI 1KWIA 1RHLA 1BNIA 1CH0A 4FR9A 1OH0A 2W9PA 2XEPA 1ZGXA 4O02B 3LTDA 4LSOA 1VQ43 1GSPA 3FG1A 3LYGA 3HIGA 2PZVA 1RDSA 3DGNA 3KFQC 1LXEA 3LTBA 5AI1A 1BNEA 4EXRA 3D5GA 1Q7HA 1CYUA 5IW9A 1E3RA 2P0MA 2GBXB 3M8CA 5G1KA 2KCDA 3MHEA 1OPYA 2HOHA 7RNTA 1B2XA 4LEHA 3TDGA 5BXQA 4O8SA 4N6NB 3D3LA 3H3HA 3ECFA 1K28A 2YFLB 1N5HA 2RGQA 2W6JH 3CCV3 1S5AA 4HYZA 4HM7B 4IIAA 5CXOA 1JKGA 2ML6A 2F5WA 1OHPA 1NNVA 2F56A 4HM1B 3SEDA 5AIFA 4TX4A 5BU4A 2ZDJA 2L1SA 4OVMA 1HYFA 1LOXA 4CJNA 2OCTA 3EN1B 2ZA4A 1I3FA 4N6OB 3JUNA 3ZG0A 3SLUA 5EVHA 1WNHA 3JVCA 3VGNA 2H0HA 3AGOA 1MWTA 1GYBA 3CCS3 5KP1A 1LOVA 1I2EA 1FYSA 3JUMA 2BMQB 2H0IA 2BHMA 4GB5A 4JRFA 3LH4A 1DMNA 1IV9A 3DMCA 3X41A 5IG3A 3LT8A 1RGKA 3IJEB 4MEIA 1OHOA 1GY5A 4BTWA 1BANA 2OWPA 1BGSA 4EV2A 1JN5B 2RSXA 3S29A 1C54A 1N5PA 1Q40B 3WMDA 3FH1A 3K7CA 3RGRA 3G0KA 3FF2A 1BAOA 1ZX2A 1X1UA 3CME3 3CCE3 3K5TA 1STFI 1YVSA 1X1WA 1PYLA 2KF3A 3PCRA 1ROAA 3UJMA 1AR0A 3ZG5A 1HZ1A 1JN5A 3ROBA 1BIRA 3AMOB 4HBRA 1BRNL 1BSDA 2CC3A 3HK4A 3FLJA 2ZL8A 1WMNA 1AVLA 3L0RA 1LNHA 4EV5A 4R9LA 4HAAA 1GD3A 4AEQA 3NXJA 5FGOA 1N8R4 1V57A 1T5YA 3SVAA 1G02A 4GHOA 5A0OB 2IA7A 2CWVA 1VQ83 2XH9A 3F8XA 1R4CA 1W2ZA 3MWZA 4KZ1A 4N6TA 1EQKA 3JUPA 3CU3A 4GL6A 3WHOA 1K9M4 1U8CB 2WGOA 3JUQA 3UB1A 1RCLA 4HZ9B 1UI8A 1IU7A 1X1XA 2GBWB 2F86B 2XF3A 4HM4B 4STDA 1IT7A 4GSPA 1I0XA 4HM6B 4XBTA 5DREA 2ML5A 4RNTA 1ZS7A 2GSPA 1W00A 2XSHB 2BIRA 1PY3A 3DGMA 4BTXA 1VQ53 4HZBB 3N54B 1NB5I 3X3YA 1VQM3 5M19A 3EJVA 1LVNA 2STDA 1DE3A 4CPKA 1FUSA 2BU4A 3G16A 1Q9EA 1YJW3 3ALAA 3CCM3 2CIUA 1O7WB 4HJLB 1I2FA 4HM3B 2O9UX 4KFEA 3DH2A 5M18A 3CPOA 3DY5A 1YI23 3DXOA 1LNIA 1Q40A 3DGLA 4RZMA 6RNTA 1GY7A 1TJDA 1VQ93 1B2UA 2OQEC 1I8VA 4WWUC 2RFRA 4H3UA 1A2VA 1UCKA 1QVG2 3CC43 3EX9A 4BIRA 3PYJA 4HKVB 2IUJA 3S67A 1FGOA 2L4VA 2P0XA 1BNJA 3AHSA 1JBSA 1EG9B 2CWTA 1BRJA 2E2UA 1VQ73 2E2VA 3V98A 1S723 3MSOA 1O7HB 3KSED 5M1AA 3NBJA 3KN4A 3LTCA 2I9WA 2O3OA 1Q42A 3WDGB 3LTAA 2XRXB 1W7CA 4FCMA 4LYLB 2OOVA 1KC84 3LOYA 1DVDA 1N9EA 3F7XA 1VQO3 2Z77A 3SOAA 3CCU3 2WOHA 4N6V0 1CEWI 3B4OA 1FGRA 2CFWA 1ULJB 1N8QA 3B7CA 3PGBA 1RGGA 1E3VA 3SOYA 3NV0A 3NQYA 3G713 1NB3I 2UGIA 3G4S3 4KVHA 4U13A 2R4IA 3WA2X 1OF5A 5IF6A 3AHWA 5GSPA 3RNTA 1GS3A 2GU1A 3NV0B 4L8OA 2KXGA 3FSDA 5IG4A 2Y73A
chains in the Genus database with same CATH topology
1RN4A 1BANA 1X1YA 1BGSA 3SYUA 2RNTA 1C54A 1B3SA 1RSNA 1RGCA 1I2GA 2AADA 1BAOA 1X1UA 1BNGA 3HOHA 1BRGA 1GMRA 1YVSA 1X1WA 1PYLA 1AQZA 2KF6A 2KF3A 3Q3FA 1HZ1A 1BIRA 1LOWA 1BRNL 1BSDA 1YGWA 1BNFA 1BSBA 3BIRA 5RNTA 4HAAA 3URPA 1BSEA 1FW7A 1G02A 4GHOA 2KF5A 1UCLA 1JBTA 1A2PA 3WHOA 2F5MA 2RBIA 1T2IA 7GSPA 9RNTA 4BU4A 6GSPA 1RCLA 1BUJA 1BSCA 1T2HA 1X1XA 1IYYA 3AGNA 1B21A 1JBRA 1B27A 1GOUA 1LRAA 2KF4A 1BVIA 3DGYA 4GSPA 4J5KA 1RGLA 1I0XA 5HOHA 3KCHA 1FUTA 4RNTA 1MGWA 1RGAA 1RTUA 1RN1A 2GSPA 1TRQA 1RGHA 1BOXA 2BIRA 1PY3A 1DETA 2F4YA 1FZUA 1RNBA 1TTOA 1BRKA 1RGEA 1YNVX 1BSAA 8RNTA 1I3IA 1GOVA 1GMQA 3D5IA 1FUSA 3A5EA 1DE3A 2BU4A 1Q9EA 1I0VA 1I2FA 1I70A 2C4BA 3DH2A 1RHLA 1BNIA 3GSPA 1CH0A 1UCIA 1LNIA 1ZGXA 1B20A 6RNTA 1GSPA 1B2UA 1BRHA 1I8VA 1RDSA 3D4AA 2AAEA 1UCKA 1AY7A 1RMSA 1BNEA 4BIRA 3D5GA 3BU4A 1B2SA 1BU4A 1GMPA 1MGRA 1BNJA 2HOHA 3AHSA 1JBSA 4HOHA 1B2XA 7RNTA 1BNSA 1BRJA 1GOYA 3WR2A 1RLSA 1RGFA 4J5GA 2F5WA 2F56A 5BU4A 1HYFA 1BRSA 2ZA4A 1I3FA 5BIRA 1SARA 2SARA 1BRIA 1RGGA 3AGOA 1TRPA 1BNRA 1LOVA 1I2EA 2KAAA 1FYSA 1RNTA 1R4YA 1LOYA 1B2MA 1B2ZA 3AHWA 5GSPA 3RNTA 1RCKA 1UCJA 1RGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RN4 A;  1BAN A;  1X1Y A;  1BGS A;  3SYU A;  2RNT A;  1C54 A;  1B3S A;  1RSN A;  1RGC A;  1I2G A;  2AAD A;  1BAO A;  1X1U A;  1BNG A;  3HOH A;  1BRG A;  1GMR A;  1YVS A;  1X1W A;  1PYL A;  1AQZ A;  2KF6 A;  2KF3 A;  3Q3F A;  1HZ1 A;  1BIR A;  1LOW A;  1BRN L;  1BSD A;  1YGW A;  1BNF A;  1BSB A;  3BIR A;  5RNT A;  4HAA A;  3URP A;  1BSE A;  1FW7 A;  1G02 A;  4GHO A;  2KF5 A;  1UCL A;  1JBT A;  1A2P A;  3WHO A;  2F5M A;  2RBI A;  1T2I A;  7GSP A;  9RNT A;  4BU4 A;  6GSP A;  1RCL A;  1BUJ A;  1BSC A;  1T2H A;  1X1X A;  1IYY A;  3AGN A;  1B21 A;  1JBR A;  1B27 A;  1GOU A;  1LRA A;  2KF4 A;  1BVI A;  3DGY A;  4GSP A;  4J5K A;  1RGL A;  1I0X A;  5HOH A;  3KCH A;  1FUT A;  4RNT A;  1MGW A;  1RGA A;  1RTU A;  1RN1 A;  2GSP A;  1TRQ A;  1RGH A;  1BOX A;  2BIR A;  1PY3 A;  1DET A;  2F4Y A;  1FZU A;  1RNB A;  1TTO A;  1BRK A;  1RGE A;  1YNV X;  1BSA A;  8RNT A;  1I3I A;  1GOV A;  1GMQ A;  3D5I A;  1FUS A;  3A5E A;  1DE3 A;  2BU4 A;  1Q9E A;  1I0V A;  1I2F A;  1I70 A;  2C4B A;  3DH2 A;  1RHL A;  1BNI A;  3GSP A;  1CH0 A;  1UCI A;  1LNI A;  1ZGX A;  1B20 A;  6RNT A;  1GSP A;  1B2U A;  1BRH A;  1I8V A;  1RDS A;  3D4A A;  2AAE A;  1UCK A;  1AY7 A;  1RMS A;  1BNE A;  4BIR A;  3D5G A;  3BU4 A;  1B2S A;  1BU4 A;  1GMP A;  1MGR A;  1BNJ A;  2HOH A;  3AHS A;  1JBS A;  4HOH A;  1B2X A;  7RNT A;  1BNS A;  1BRJ A;  1GOY A;  3WR2 A;  1RLS A;  1RGF A;  4J5G A;  2F5W A;  2F56 A;  5BU4 A;  1HYF A;  1BRS A;  2ZA4 A;  1I3F A;  5BIR A;  1SAR A;  2SAR A;  1BRI A;  1RGG A;  3AGO A;  1TRP A;  1BNR A;  1LOV A;  1I2E A;  2KAA A;  1FYS A;  1RNT A;  1R4Y A;  1LOY A;  1B2M A;  1B2Z A;  3AHW A;  5GSP A;  3RNT A;  1RCK A;  1UCJ A;  1RGK A; 
#chains in the Genus database with same CATH topology
 3OWS A;  3SYU A;  1OF5 B;  2RNT A;  3NBR A;  1BUQ A;  1B3S A;  1HKX A;  4HVN A;  3DGO A;  5AEU B;  5AYS C;  3E99 A;  3HOH A;  1YJN 3;  2KF6 A;  1AQZ A;  3LT9 A;  3Q3F A;  1RJO A;  4KFD A;  2BT3 A;  4LZI A;  3K63 A;  1YGW A;  1U5O A;  2FXT A;  4R4K A;  1JRQ A;  1NO3 A;  1YGE A;  2UUG C;  3CNX A;  4WHA A;  5ELJ A;  5RNT A;  4BTY A;  2YFI B;  2CWU A;  4BL3 A;  5LC6 A;  1FW7 A;  2OTJ 3;  1IVU A;  2BO9 B;  4RBN A;  1FGT A;  1OAC A;  1JBT A;  4CCV A;  1EA2 A;  1TP6 A;  2K0M A;  4IT7 A;  4QWT A;  1T2I A;  7GSP A;  4KFF A;  1EKM A;  4BU4 A;  5STD A;  3BNC A;  2FNQ A;  3KKG A;  3A76 A;  1JZO A;  1MWU A;  1JBR A;  3FGY A;  3T8N A;  1SJW A;  5CLK A;  1KD1 4;  2JDI H;  3O8Y A;  2KF4 A;  3PXM A;  3DGY A;  4FCJ A;  5JBS A;  3QK9 A;  5EEO A;  1RGL A;  2GXF A;  1TFK A;  2HMK B;  3BNB A;  1VQK 3;  3HX8 A;  1J2B A;  1RTU A;  4FMA A;  4J8T A;  5AYR B;  1D6Z A;  3OX9 A;  2CFG A;  1TRQ A;  2CFK A;  2HMM B;  5AIG A;  3FZW A;  4LGQ A;  1W4N A;  2OOV C;  1OGX A;  1W6G A;  4L8P A;  4RNZ A;  4WFO A;  4IPB A;  1IT8 A;  1I3I A;  1GOV A;  1A67 A;  1OGZ A;  5IEN A;  4CDL A;  3OV4 A;  2CFD A;  3Q90 A;  3ZFZ A;  1VQ6 3;  3VSY A;  3V99 A;  3K0Z A;  3V92 A;  4FMB A;  4RNY A;  2CH9 A;  1DVC A;  1O7N B;  2GEX A;  1KSI A;  2P38 A;  2XSO B;  3GSP A;  1PFP A;  1UCI A;  3CCL 3;  1B20 A;  4FCZ A;  3F14 A;  2OQE A;  2YX9 A;  3FF0 A;  1TIJ A;  1US1 A;  3RDE A;  3PZW A;  1CQS A;  2AAE A;  4MMZ B;  1JB2 A;  1IVV A;  3AMO A;  1MWR A;  1RMS A;  1Y4K A;  1C7H A;  1B2S A;  4N6L A;  2XFS A;  1GY6 A;  3DM8 A;  1GMP A;  1MGR A;  3WOF B;  1Q82 4;  1ZO2 A;  5D81 A;  1HU9 A;  4O3V A;  3CCR 3;  1IQX A;  1RRH A;  3CC2 3;  1EUI C;  1JB5 A;  3F9S A;  1L5G B;  1TFO A;  3WA3 A;  1K8A 4;  2CG1 A;  5TGN A;  4J5G A;  2D1W A;  3K9M C;  1BRS A;  1IVW A;  3GRD A;  3GAX A;  1VQQ A;  4K61 A;  5G1L A;  1UUV B;  2CK3 H;  2SAR A;  3BLZ A;  2K54 A;  3KZT A;  1LQG C;  1SII A;  3IPT A;  1JZD A;  5AIH A;  2QA4 3;  1BNR A;  1A90 A;  1UGH I;  5HGR A;  2WO0 A;  1FGM A;  1MNL A;  1RNT A;  3G8Z A;  1IQ8 A;  4OUQ A;  1LOY A;  3S28 A;  1B2M A;  1B2Z A;  1YIJ 3;  1LQM B;  1RCK A;  3IMA B;  1UCJ A;  4FMD A;  4FMC A;  5D82 A;  2CKF B;  3F8H A;  5FW5 A;  1X1Y A;  1W02 A;  4PEJ A;  1AVK A;  4MMX B;  3U1W A;  4AKY A;  1RRL A;  3FKA A;  1VQP 3;  4R9K A;  1QAK A;  3EHC A;  2CW9 A;  2AAD A;  4XDW A;  3NHX A;  2BMO B;  3ER7 A;  1IK3 A;  1GMR A;  1Z1S A;  3UL6 A;  3NX0 A;  3CMA 3;  2MC8 A;  1UI7 A;  1MWS A;  4OK0 A;  4EBG A;  1M1X B;  2MF7 A;  3HZP A;  4R80 A;  1LOW A;  1OUN A;  2XR8 B;  4XDV A;  5CK6 A;  3SXX A;  3EBY A;  1BNF A;  2RCD A;  1D6U A;  2V1L A;  1BSB A;  3BIR A;  3GZY B;  3CXC 2;  1JJ2 2;  3NBB A;  2HMO B;  1BSE A;  4XM4 A;  3URP A;  1T3B A;  4N3V A;  4DKI A;  5JPU A;  3LXU X;  3D9R A;  2WOF A;  5CF1 A;  2W56 A;  3GZX B;  4XBX A;  4HM8 B;  3CCQ 3;  2BNG A;  1QMA A;  4R1K A;  2CG0 A;  3NQZ A;  4Q53 A;  1M1K 4;  3X42 A;  3GWR A;  9RNT A;  3PS8 A;  2P09 A;  2W04 A;  1BSC A;  1T2H A;  2Q07 A;  1IYY A;  3AGN A;  2W56 B;  4O2H A;  5IG5 A;  1B27 A;  1MOL A;  1GOU A;  1K41 A;  2JQ5 A;  2ZHX B;  3MG2 A;  4MJD A;  5AEW B;  1BVI A;  4J5K A;  5KP3 A;  5LC7 A;  3Q1C A;  5HOH A;  3KCH A;  1OHS A;  1FUT A;  1F8N A;  1QJG A;  1UUG B;  3H51 A;  3LML A;  3CPW 2;  1MGW A;  4I4K A;  1RGA A;  2OTL 3;  1JB4 A;  3NM7 A;  1WMP A;  1RGH A;  2C10 A;  2P05 A;  1BOX A;  3D79 A;  3OWY A;  2INX A;  1K73 4;  4NHF A;  1NU3 A;  1FZU A;  1RNB A;  4EYC A;  4ILF A;  1E97 A;  3STD A;  1JNQ A;  4KT3 B;  1BRK A;  1RGE A;  3N8B A;  1TU5 A;  2F98 A;  1GMQ A;  5ELU A;  4I5Q A;  1IQY A;  3OXA A;  4L7K A;  1TUH A;  2GU3 A;  4JF8 A;  4MMY B;  4X2O A;  2SBL A;  3BB9 A;  1DMM A;  2W2C A;  1O7M B;  4BL2 A;  2CFL A;  1W01 A;  3MG3 A;  1WMO A;  3EF8 A;  4G1M B;  1V58 A;  1G0T A;  1IDP A;  5AII A;  1QAL A;  1BRH A;  3CNM A;  8CHO A;  3D4A A;  2LYX A;  2WGQ A;  1UW1 A;  5IEO A;  1W2B 2;  1NJI 4;  1AY7 A;  1NDO B;  3BU4 A;  1M90 4;  2PNC A;  1QVF 2;  4WYK B;  1BU4 A;  2R41 A;  4XBY A;  3DZL A;  1DMQ A;  4HOH A;  1M9G A;  1NWW A;  1BNS A;  1DYU A;  5DRV A;  3UNL A;  1GOY A;  1UDI I;  4X2H A;  1V74 A;  3WOD G;  3WR2 A;  1RLS A;  1RGF A;  3B8L A;  1YIT 3;  5KP4 A;  3CC7 3;  3MKI A;  1UUW B;  1O7P B;  1SPU A;  2W03 A;  1JV2 B;  5CF2 A;  2Z6B A;  1FA3 A;  3OWU A;  4NRE A;  1Q86 4;  5BIR A;  2E2T A;  1SAR A;  3S5C A;  3EQQ B;  1BRI A;  3MPH A;  2QGU A;  2K3D A;  1TRP A;  2C11 A;  2M7O A;  2XGN A;  3FCS B;  2FGT A;  4K1U A;  1RKY A;  2KAA A;  2QIY A;  1ULI B;  2Y74 A;  1YHQ 3;  1IV7 A;  1R4Y A;  2UX0 A;  3FG4 A;  2CX0 A;  3LZA A;  1ROV A;  1VZZ A;  1GD4 A;  3FG3 A;  4HM5 B;  5G2G A;  3J7Y d;  1OCV A;  2GEY A;  5EQL A;  4N6M A;  3RGA A;  4ZM8 A;  3GZB A;  1VQL 3;  1RN7 A;  1O7G B;  3UL5 A;  1RN4 A;  2HMJ B;  2XFT A;  3QRD A;  4XB5 A;  4K1V A;  6STD A;  2A15 A;  2XGL A;  4ORL A;  3N9H A;  1RSN A;  1EEJ A;  1RGC A;  3WOE B;  1W6Y A;  5IER A;  1I2G A;  1Q7Y 4;  1AV4 A;  3MG1 A;  3MYT A;  1BNG A;  2H0G A;  3JUO A;  1QAF A;  1BRG A;  3NUV A;  2Z76 A;  4N6U A;  1FUW A;  1FGQ A;  2F99 A;  1ISK A;  5IEP A;  3EB8 A;  3KE7 A;  1PU4 A;  1IVX A;  2YFJ B;  4EW5 A;  3GZR A;  1STD A;  2J8X B;  3CD6 3;  3S27 A;  3HII A;  5IG0 A;  3T0U A;  3KSP A;  2B24 B;  1JKG B;  2W0Q A;  2KF5 A;  4H61 A;  1W6C A;  4LMI A;  3F40 A;  1UCL A;  3SX1 A;  3I0Y A;  1A2P A;  3CCJ 3;  2F5M A;  2RBI A;  1Q81 4;  4WP5 A;  2IY2 A;  1VQN 3;  2B1X B;  2BMR B;  2IUK A;  3BND A;  4WYK A;  6GSP A;  1BUJ A;  1B21 A;  1G96 A;  2D42 A;  2IYJ A;  3EN8 A;  1YJ9 3;  1LRA A;  2Z7A A;  1ASK A;  3F7S A;  4HM2 B;  3OW2 2;  1WTH A;  3EC9 A;  3NM2 A;  1UGI A;  2W9Q A;  2KRT A;  1N9J A;  3EBT A;  1SQW A;  2QEX 3;  3X3X A;  1RN1 A;  2HML B;  1A2K A;  2IMJ A;  3VF1 A;  4AKZ A;  5JPP A;  1DET A;  2CX1 A;  3I55 3;  1W5Z A;  2F4Y A;  2LQV A;  3T8U A;  1TTO A;  1YNV X;  5I97 A;  4HM0 B;  1BSA A;  3I56 3;  3X3Z A;  4K90 B;  3U97 A;  2HMN B;  8RNT A;  4EC6 A;  3B4P A;  3D5I A;  4J9A A;  3A5E A;  3HI7 A;  5BVB A;  3BNE A;  3Q2P A;  1I0V A;  1D6Y A;  1CYV A;  1SIH A;  3PCS A;  4NPB A;  3EE1 A;  3X40 A;  7STD A;  3DUK A;  1I70 A;  1WQL B;  3KII A;  2C4B A;  3G6E 3;  2CHC A;  1KQS 2;  5D83 A;  1YVB I;  1KWI A;  1RHL A;  1BNI A;  1CH0 A;  4FR9 A;  1OH0 A;  2W9P A;  2XEP A;  1ZGX A;  4O02 B;  3LTD A;  4LSO A;  1VQ4 3;  1GSP A;  3FG1 A;  3LYG A;  3HIG A;  2PZV A;  1RDS A;  3DGN A;  3KFQ C;  1LXE A;  3LTB A;  5AI1 A;  1BNE A;  4EXR A;  3D5G A;  1Q7H A;  1CYU A;  5IW9 A;  1E3R A;  2P0M A;  2GBX B;  3M8C A;  5G1K A;  2KCD A;  3MHE A;  1OPY A;  2HOH A;  7RNT A;  1B2X A;  4LEH A;  3TDG A;  5BXQ A;  4O8S A;  4N6N B;  3D3L A;  3H3H A;  3ECF A;  1K28 A;  2YFL B;  1N5H A;  2RGQ A;  2W6J H;  3CCV 3;  1S5A A;  4HYZ A;  4HM7 B;  4IIA A;  5CXO A;  1JKG A;  2ML6 A;  2F5W A;  1OHP A;  1NNV A;  2F56 A;  4HM1 B;  3SED A;  5AIF A;  4TX4 A;  5BU4 A;  2ZDJ A;  2L1S A;  4OVM A;  1HYF A;  1LOX A;  4CJN A;  2OCT A;  3EN1 B;  2ZA4 A;  1I3F A;  4N6O B;  3JUN A;  3ZG0 A;  3SLU A;  5EVH A;  1WNH A;  3JVC A;  3VGN A;  2H0H A;  3AGO A;  1MWT A;  1GYB A;  3CCS 3;  5KP1 A;  1LOV A;  1I2E A;  1FYS A;  3JUM A;  2BMQ B;  2H0I A;  2BHM A;  4GB5 A;  4JRF A;  3LH4 A;  1DMN A;  1IV9 A;  3DMC A;  3X41 A;  5IG3 A;  3LT8 A;  1RGK A;  3IJE B;  4MEI A;  1OHO A;  1GY5 A;  4BTW A;  1BAN A;  2OWP A;  1BGS A;  4EV2 A;  1JN5 B;  2RSX A;  3S29 A;  1C54 A;  1N5P A;  1Q40 B;  3WMD A;  3FH1 A;  3K7C A;  3RGR A;  3G0K A;  3FF2 A;  1BAO A;  1ZX2 A;  1X1U A;  3CME 3;  3CCE 3;  3K5T A;  1STF I;  1YVS A;  1X1W A;  1PYL A;  2KF3 A;  3PCR A;  1ROA A;  3UJM A;  1AR0 A;  3ZG5 A;  1HZ1 A;  1JN5 A;  3ROB A;  1BIR A;  3AMO B;  4HBR A;  1BRN L;  1BSD A;  2CC3 A;  3HK4 A;  3FLJ A;  2ZL8 A;  1WMN A;  1AVL A;  3L0R A;  1LNH A;  4EV5 A;  4R9L A;  4HAA A;  1GD3 A;  4AEQ A;  3NXJ A;  5FGO A;  1N8R 4;  1V57 A;  1T5Y A;  3SVA A;  1G02 A;  4GHO A;  5A0O B;  2IA7 A;  2CWV A;  1VQ8 3;  2XH9 A;  3F8X A;  1R4C A;  1W2Z A;  3MWZ A;  4KZ1 A;  4N6T A;  1EQK A;  3JUP A;  3CU3 A;  4GL6 A;  3WHO A;  1K9M 4;  1U8C B;  2WGO A;  3JUQ A;  3UB1 A;  1RCL A;  4HZ9 B;  1UI8 A;  1IU7 A;  1X1X A;  2GBW B;  2F86 B;  2XF3 A;  4HM4 B;  4STD A;  1IT7 A;  4GSP A;  1I0X A;  4HM6 B;  4XBT A;  5DRE A;  2ML5 A;  4RNT A;  1ZS7 A;  2GSP A;  1W00 A;  2XSH B;  2BIR A;  1PY3 A;  3DGM A;  4BTX A;  1VQ5 3;  4HZB B;  3N54 B;  1NB5 I;  3X3Y A;  1VQM 3;  5M19 A;  3EJV A;  1LVN A;  2STD A;  1DE3 A;  4CPK A;  1FUS A;  2BU4 A;  3G16 A;  1Q9E A;  1YJW 3;  3ALA A;  3CCM 3;  2CIU A;  1O7W B;  4HJL B;  1I2F A;  4HM3 B;  2O9U X;  4KFE A;  3DH2 A;  5M18 A;  3CPO A;  3DY5 A;  1YI2 3;  3DXO A;  1LNI A;  1Q40 A;  3DGL A;  4RZM A;  6RNT A;  1GY7 A;  1TJD A;  1VQ9 3;  1B2U A;  2OQE C;  1I8V A;  4WWU C;  2RFR A;  4H3U A;  1A2V A;  1UCK A;  1QVG 2;  3CC4 3;  3EX9 A;  4BIR A;  3PYJ A;  4HKV B;  2IUJ A;  3S67 A;  1FGO A;  2L4V A;  2P0X A;  1BNJ A;  3AHS A;  1JBS A;  1EG9 B;  2CWT A;  1BRJ A;  2E2U A;  1VQ7 3;  2E2V A;  3V98 A;  1S72 3;  3MSO A;  1O7H B;  3KSE D;  5M1A A;  3NBJ A;  3KN4 A;  3LTC A;  2I9W A;  2O3O A;  1Q42 A;  3WDG B;  3LTA A;  2XRX B;  1W7C A;  4FCM A;  4LYL B;  2OOV A;  1KC8 4;  3LOY A;  1DVD A;  1N9E A;  3F7X A;  1VQO 3;  2Z77 A;  3SOA A;  3CCU 3;  2WOH A;  4N6V 0;  1CEW I;  3B4O A;  1FGR A;  2CFW A;  1ULJ B;  1N8Q A;  3B7C A;  3PGB A;  1RGG A;  1E3V A;  3SOY A;  3NV0 A;  3NQY A;  3G71 3;  1NB3 I;  2UGI A;  3G4S 3;  4KVH A;  4U13 A;  2R4I A;  3WA2 X;  1OF5 A;  5IF6 A;  3AHW A;  5GSP A;  3RNT A;  1GS3 A;  2GU1 A;  3NV0 B;  4L8O A;  2KXG A;  3FSD A;  5IG4 A;  2Y73 A; 
#chains in the Genus database with same CATH homology
 1RN4 A;  1BAN A;  1X1Y A;  1BGS A;  3SYU A;  2RNT A;  1C54 A;  1B3S A;  1RSN A;  1RGC A;  1I2G A;  2AAD A;  1BAO A;  1X1U A;  1BNG A;  3HOH A;  1BRG A;  1GMR A;  1YVS A;  1X1W A;  1PYL A;  1AQZ A;  2KF6 A;  2KF3 A;  3Q3F A;  1HZ1 A;  1BIR A;  1LOW A;  1BRN L;  1BSD A;  1YGW A;  1BNF A;  1BSB A;  3BIR A;  5RNT A;  4HAA A;  3URP A;  1BSE A;  1FW7 A;  1G02 A;  4GHO A;  2KF5 A;  1UCL A;  1JBT A;  1A2P A;  3WHO A;  2F5M A;  2RBI A;  1T2I A;  7GSP A;  9RNT A;  4BU4 A;  6GSP A;  1RCL A;  1BUJ A;  1BSC A;  1T2H A;  1X1X A;  1IYY A;  3AGN A;  1B21 A;  1JBR A;  1B27 A;  1GOU A;  1LRA A;  2KF4 A;  1BVI A;  3DGY A;  4GSP A;  4J5K A;  1RGL A;  1I0X A;  5HOH A;  3KCH A;  1FUT A;  4RNT A;  1MGW A;  1RGA A;  1RTU A;  1RN1 A;  2GSP A;  1TRQ A;  1RGH A;  1BOX A;  2BIR A;  1PY3 A;  1DET A;  2F4Y A;  1FZU A;  1RNB A;  1TTO A;  1BRK A;  1RGE A;  1YNV X;  1BSA A;  8RNT A;  1I3I A;  1GOV A;  1GMQ A;  3D5I A;  1FUS A;  3A5E A;  1DE3 A;  2BU4 A;  1Q9E A;  1I0V A;  1I2F A;  1I70 A;  2C4B A;  3DH2 A;  1RHL A;  1BNI A;  3GSP A;  1CH0 A;  1UCI A;  1LNI A;  1ZGX A;  1B20 A;  6RNT A;  1GSP A;  1B2U A;  1BRH A;  1I8V A;  1RDS A;  3D4A A;  2AAE A;  1UCK A;  1AY7 A;  1RMS A;  1BNE A;  4BIR A;  3D5G A;  3BU4 A;  1B2S A;  1BU4 A;  1GMP A;  1MGR A;  1BNJ A;  2HOH A;  3AHS A;  1JBS A;  4HOH A;  1B2X A;  7RNT A;  1BNS A;  1BRJ A;  1GOY A;  3WR2 A;  1RLS A;  1RGF A;  4J5G A;  2F5W A;  2F56 A;  5BU4 A;  1HYF A;  1BRS A;  2ZA4 A;  1I3F A;  5BIR A;  1SAR A;  2SAR A;  1BRI A;  1RGG A;  3AGO A;  1TRP A;  1BNR A;  1LOV A;  1I2E A;  2KAA A;  1FYS A;  1RNT A;  1R4Y A;  1LOY A;  1B2M A;  1B2Z A;  3AHW A;  5GSP A;  3RNT A;  1RCK A;  1UCJ A;  1RGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...