1BRKA

Barnase mutant with ile 96 replaced by ala
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLAYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brkA00
1BIRA 3GSPA 1AQZA 4RNTA 1GMRA 1I3IA 2F4YA 1DETA 1BGSA 1FW7A 2KAAA 1BNGA 1RGKA 1BAOA 4BIRA 1RGEA 4GHOA 1UCJA 1C54A 1TTOA 1BRJA 1I3FA 4HOHA 1RHLA 8RNTA 2AADA 1RGHA 3AHWA 5RNTA 1GMPA 1I70A 2KF5A 1SARA 1JBSA 1BANA 1G02A 5GSPA 1BRIA 1RTUA 2GSPA 1YVSA 1BVIA 1RMSA 1JBRA 1LOWA 1FUTA 1BRKA 1YGWA 2F5MA 1CH0A 1HYFA 1I0XA 2RNTA 1BNFA 7GSPA 1RGCA 1BOXA 1X1WA 1RGGA 1LOVA 1GSPA 1RGFA 1BSBA 1RGLA 3HOHA 1BSEA 2C4BA 1B2MA 2KF6A 2KF3A 1RNTA 3AGNA 1HZ1A 1I2GA 3BU4A 1GOYA 6RNTA 1UCIA 3D5GA 7RNTA 1A2PA 1PY3A 1YNVX 1B2XA 1RN1A 1RSNA 1TRPA 1B21A 1FYSA 1GOUA 1MGRA 1FUSA 3AGOA 3SYUA 1JBTA 2RBIA 3KCHA 1MGWA 1LRAA 1I0VA 5BU4A 1LNIA 2F5WA 1AY7A 4J5GA 4BU4A 3URPA 1X1XA 3RNTA 1BRNL 1ZGXA 1X1YA 5HOHA 1B27A 3AHSA 1B2SA 2BIRA 1RLSA 1T2IA 4GSPA 3BIRA 1BNJA 1I2EA 2SARA 2HOHA 2F56A 1BNSA 3Q3FA 1PYLA 1GOVA 3DH2A 1TRQA 2BU4A 1RNBA 1GMQA 3DGYA 1BU4A 2ZA4A 3WR2A 1DE3A 1BNEA 1BSAA 1RCKA 1BNRA 1BSDA 1UCLA 1BNIA 1IYYA 3A5EA 1FZUA 1X1UA 9RNTA 1RCLA 1RDSA 1RGAA 1Q9EA 2AAEA 3D4AA 1B2ZA 3WHOA 1B2UA 4HAAA 1BUJA 4J5KA 1I2FA 1I8VA 2KF4A 1B20A 1BSCA 5BIRA 1BRSA 1BRHA 1R4YA 1BRGA 3D5IA 1RN4A 6GSPA 1LOYA 1B3SA 1T2HA 1UCKA
chains in the Genus database with same CATH superfamily
4N6TA 1ZO2A 1BIRA 1QMAA 2JQ5A 4L7KA 3N9HA 4L8PA 2H0HA 1AQZA 3T8UA 1A67A 1MWUA 1OF5B 1W6YA 3OX9A 1DETA 1W2B2 2M7OA 4O02B 1OF5A 3NQYA 3CPOA 1JRQA 3QRDA 1TIJA 1IV7A 1LQMB 1ZX2A 2KAAA 5LC6A 1LNHA 2CG1A 3FF0A 3B7CA 1VQK3 4MEIA 3CCU3 3UNLA 1C54A 3KKGA 1SIHA 4N6OB 1I3FA 1RHLA 1IK3A 2AADA 4O8SA 1GY7A 3AHWA 1YIJ3 1I70A 4EC6A 1PU4A 1SARA 1O7HB 3T0UA 4CPKA 1E3RA 3JUOA 1G02A 4LZIA 1N9EA 3X3XA 1RTUA 1RN7A 5M1AA 3WOEB 5JBSA 2OCTA 5IG0A 2STDA 4PEJA 1BVIA 1JBRA 2C11A 1FUTA 3EBYA 4K1VA 1HYFA 1GY6A 3T8NA 1EQKA 4WP5A 1IVVA 1DMNA 2W03A 2W0QA 1N8R4 4HKVB 1LVNA 1J2BA 3MHEA 5JPUA 3WA3A 1Q864 2E2UA 1BSBA 4KFEA 1OHOA 2OOVC 2C4BA 2H0GA 2KF3A 3FG1A 4CCVA 4J9AA 5KP3A 3VSYA 1QVG2 4KVHA 1GOYA 1JKGB 3CU3A 2B1XB 3N8BA 7RNTA 2YFLB 3B4PA 1RKYA 3LT9A 1JKGA 3LOYA 3FF2A 1UW1A 5AIFA 2K0MA 1FGRA 4HM1B 1ULIB 1TRPA 4RNZA 3K5TA 1VQO3 1B21A 3MG3A 1IV9A 1MGRA 1AR0A 2RCDA 3AGOA 4FR9A 4R1KA 1TJDA 1YJN3 3HIGA 3ZG5A 4Q53A 2BT3A 3D79A 1V58A 2UUGC 2XFSA 3X41A 1MNLA 2XF3A 5IG4A 2J8XB 4HBRA 2B24B 1MWRA 4N6NB 3URPA 5AEUB 4LYLB 3NM7A 1KQS2 1FA3A 4HM7B 1FGMA 1SQWA 1T3BA 2W9QA 1UUWB 5HOHA 3WODG 3I553 1B27A 3AHSA 3DM8A 4OVMA 2WGOA 4KFFA 3WOFB 3NBJA 4GB5A 5HGRA 2CX1A 2W04A 3KSED 3CPW2 4XDWA 3Q1CA 1ROVA 1TFKA 2KXGA 2HOHA 3DXOA 1IU7A 1GYBA 1JN5B 3ER7A 4U13A 2LQVA 2CW9A 3DH2A 1UUVB 1GY5A 1GD4A 3DGYA 2BNGA 3K0ZA 1G96A 5DREA 1MWSA 3A5EA 3GZXB 2CFWA 1RCLA 2CFDA 1VQ83 1RGAA 2GU3A 2YFIB 1Q9EA 2AAEA 2D1WA 4FCJA 2H0IA 1M1K4 1NU3A 1B2UA 3NQZA 3A76A 5AI1A 3S28A 4J5KA 2CK3H 1EEJA 1W02A 6STDA 1F8NA 1VQQA 2KF4A 4HM3B 1B20A 3EF8A 3ALAA 1BRHA 3GZYB 1NB5I 1N8QA 1EA2A 3WA2X 3CCJ3 3EJVA 1RN4A 1NDOB 1LOYA 3F9SA 1O7PB 1BUQA 1UCKA 1GD3A 3KFQC 5FW5A 3KZTA 1NO3A 2F4YA 2RFRA 3CC23 2KRTA 4O3VA 1KWIA 1V57A 1UGIA 3NXJA 1YHQ3 4NPBA 2P05A 3SXXA 3ZG0A 1BAOA 1M9GA 1RGEA 3EB8A 4DKIA 2QIYA 3G4S3 3GRDA 4XBTA 2L4VA 3V99A 1TTOA 1BRJA 4HOHA 3RGRA 2CHCA 2PNCA 2XRXB 1TU5A 3FLJA 2IUJA 1M1XB 2UX0A 2GEYA 3CMA3 4FCMA 3LMLA 2W6JH 1D6YA 2O9UX 1UI8A 2YFJB 3PS8A 3J7Yd 1S723 2CWVA 2R41A 5GSPA 2PZVA 3UL5A 3MSOA 2BMQB 2GSPA 2CWTA 3KN4A 1YVSA 4K1UA 5AIIA 2QEX3 1UUGB 3UB1A 4N3VA 1CH0A 2XGLA 2XH9A 2XGNA 4EW5A 1AVKA 1BNFA 1RRHA 1X1WA 5LC7A 4HVNA 4QWTA 2OQEA 3V98A 1RGGA 4BTXA 1VQM3 1RGLA 3D3LA 4HM0B 4X2HA 2INXA 2FGTA 1Q824 1ROAA 3OV4A 4XM4A 3CCV3 1JZOA 1B2MA 3BU4A 3K63A 4RNYA 5IF6A 4XBXA 1ASKA 4NREA 5BVBA 6RNTA 3PXMA 1IQ8A 3D5GA 1YNVX 1QAFA 4HJLB 2BMRB 3IJEB 4EYCA 3CME3 1YJW3 2GEXA 1FYSA 5M18A 1HU9A 3G16A 1A2VA 3CNXA 1FUSA 3FG4A 1FGTA 3DZLA 3Q90A 2GXFA 2CIUA 5CXOA 4H3UA 2QA43 3MKIA 3DGLA 1N9JA 1ZS7A 5BU4A 5G1KA 2F5WA 3F8XA 4R9KA 3NM2A 4XB5A 1X1XA 2HMNB 4O2HA 3RNTA 1BRNL 1ZGXA 1Y4KA 1W6CA 1YGEA 4EV2A 5STDA 3LYGA 1B2SA 4FMDA 1O7GB 1T2IA 3DUKA 3B8LA 1LQGC 1W2ZA 1V74A 3CNMA 4AKZA 1DMMA 1R4CA 3NBRA 1BNJA 2ML6A 1WMPA 4G1MB 5ELUA 1GOVA 2IA7A 3CCL3 1IVWA 3DGOA 1GMQA 1DE3A 1BSAA 3IPTA 1BNRA 1BSDA 2ZL8A 1UCLA 1BNIA 1VZZA 3OWYA 3F8HA 1X1UA 4IIAA 2E2TA 1K734 1Q40B 3UJMA 1NNVA 1W01A 1IVUA 1WNHA 3NX0A 4BTYA 2HMJB 1Q40A 1B2ZA 2IYJA 2HMOB 2XEPA 3D4AA 3GZBA 4HAAA 1I2FA 2ML5A 5IG3A 1UDII 4FMBA 3ZFZA 1EUIC 2Y74A 2CX0A 3U97A 3ROBA 5AYSC 4BL3A 3WR2A 1BSCA 2K54A 3OXAA 1BRSA 4XDVA 1W00A 4HM8B 2HMLB 4EV5A 3HIIA 2F99A 1VQN3 1W7CA 1IT7A 3SOAA 1JN5A 1IQXA 1WMNA 4N6LA 5IENA 4RZMA 4RNTA 1GMRA 5FGOA 1I3IA 5IG5A 3HI7A 4LEHA 1Q7Y4 3EBTA 2XFTA 4NHFA 2I9WA 4HM2B 2XR8B 1NB3I 3S5CA 4MMYB 4FMAA 1BNGA 1RGKA 3MG2A 3GZRA 5D82A 1KC84 4N6V0 4GHOA 1UCJA 2E2VA 1QVF2 5EQLA 5D83A 8RNTA 1SJWA 3PCRA 1FGQA 4KT3B 2W56B 1RGHA 3BB9A 3PYJA 4R9LA 5CF1A 5RNTA 2KF5A 2W56A 4IPBA 3G713 3CCM3 3I0YA 3DGMA 2GU1A 1JBSA 2HMMB 4CDLA 4I5QA 1JNQA 1D6ZA 4K61A 4LMIA 2F98A 3BNEA 1LOWA 1UI7A 1OH0A 1WTHA 1JV2B 1FGOA 2HMKB 4MJDA 4AEQA 3M8CA 3GWRA 1RGCA 3BNDA 4HM5B 1VQL3 3JVCA 1LOVA 1RGFA 1MOLA 4XBYA 4JF8A 2P38A 2MC8A 3HOHA 2K3DA 3DMCA 3S29A 1VQ43 1TFOA 1JB2A 1S5AA 2KF6A 1RNTA 3AGNA 3D9RA 1HZ1A 2OQEC 3EQQB 3FCSB 3GAXA 3RDEA 1OGZA 1OUNA 3STDA 1T5YA 1YVBI 2OTJ3 4HM6B 1W5ZA 5I97A 1A2PA 5KP4A 1RN1A 1RSNA 3LTBA 2CH9A 2IY2A 3LH4A 2P0XA 2QGUA 2RSXA 5BXQA 5CLKA 1O7WB 3SYUA 1JBTA 5IERA 2Z77A 3VGNA 2IUKA 1MGWA 3NBBA 1PFPA 3L0RA 4AKYA 1RRLA 5KP1A 1LNIA 4IT7A 2UGIA 1AY7A 4J5GA 4BU4A 1VQ73 1C7HA 1LOXA 1US1A 2Z7AA 4ORLA 4STDA 2CFGA 1X1YA 1JZDA 2LYXA 3LT8A 2BIRA 3TDGA 3I563 2SBLA 3LXUX 1RLSA 3MG1A 3QK9A 4GSPA 3WDGB 1K9M4 4MMXB 1L5GB 3Q2PA 3BIRA 4LGQA 2FXTA 5AEWB 1ISKA 5CK6A 5G1LA 3DGNA 3X40A 3Q3FA 2JDIH 1PYLA 2F86B 1SPUA 3BNCA 1K8A4 4RBNA 1VQ63 1TP6A 1OACA 3MWZA 3K7CA 5ELJA 1FZUA 2YX9A 9RNTA 1Q814 5CF2A 3FGYA 4FCZA 7STDA 2CKFB 1CEWI 1K41A 1EKMA 1WMOA 1U8CB 1JB4A 4WFOA 3U1WA 2P09A 3X42A 1I8VA 3SX1A 1A2KA 1N5HA 1SIIA 1U5OA 3E99A 4HYZA 1O7NB 3G8ZA 1KD14 1LXEA 2FNQA 3LTAA 3PCSA 1IVXA 3D5IA 4WHAA 4N6MA 5M19A 4J8TA 1W4NA 4HZBB 3VF1A 3F40A 3MYTA 2GBXB 3EX9A 1B3SA 3SLUA 1T2HA 1MWTA 2BHMA 3FZWA 3FH1A 3H3HA 1IT8A 2IMJA 4EBGA 3GSPA 5DRVA 3CD63 1GS3A 1NWWA 4L8OA 1CYUA 2GBWB 2CG0A 4CJNA 3KIIA 3RGAA 1BGSA 1QJGA 1FW7A 1VQP3 1CYVA 3CXC2 3ECFA 4BIRA 2WGQA 3X3YA 2BMOB 4KFDA 2R4IA 2CWUA 1UGHI 1STFI 5G2GA 1CQSA 2W2CA 8CHOA 1Z1SA 3F7XA 1IQYA 5AYRB 3JUMA 1G0TA 1GMPA 4ZM8A 4HZ9B 3MPHA 1BANA 1K28A 3PGBA 1ULJB 1O7MB 1BRIA 5JPPA 2Z6BA 1DYUA 1TUHA 4HM4B 2O3OA 2WOFA 4K90B 1RMSA 4X2OA 4R4KA 1VQ93 2F5MA 1BRKA 1YGWA 2MF7A 3O8YA 3NV0B 1DVDA 1I0XA 3AMOB 1A90A 2OOVA 3NV0A 3B4OA 2RNTA 3AMOA 3SVAA 7GSPA 3F14A 1BOXA 1STDA 5A0OB 1DMQA 1GSPA 4FMCA 1OHSA 1VQ53 2OWPA 1E97A 3EHCA 1BSEA 2OTL3 3CCR3 4GL6A 3S27A 1NJI4 1I2GA 3DY5A 1N5PA 3CCQ3 2Y73A 5IEPA 1AVLA 1UCIA 1PY3A 1DVCA 1B2XA 3WMDA 4WWUC 3BLZA 1D6UA 1YI23 1E3VA 4ILFA 4TX4A 3KSPA 1FUWA 3JUNA 5IEOA 1GOUA 2XSOB 3SEDA 3CCS3 1HKXA 3G6E3 2RBIA 3FG3A 3G0KA 3KCHA 1LRAA 2CFKA 3OWUA 1I0VA 2Q07A 1KSIA 4KZ1A 3SOYA 4EXRA 3LZAA 1RJOA 1M904 5EVHA 3OW22 2BO9B 2XSHB 2CFLA 3EN1B 1Q42A 2A15A 3HZPA 2CC3A 5AIHA 2D42A 3CC73 1OCVA 3EN8A 3CC43 2RGQA 4LSOA 2SARA 1I2EA 4JRFA 3UL6A 5IW9A 1AV4A 1W6GA 3HK4A 3LTDA 2F56A 1BNSA 4MMZB 2WOHA 3FSDA 3OWSA 4N6UA 4WYKB 1RNBA 1TRQA 2BU4A 5TGNA 3V92A 3F7SA 2C10A 4WYKA 1BU4A 2ZA4A 3PZWA 3EC9A 1BNEA 3S67A 1RCKA 1EG9B 2ZDJA 1QALA 1YJ93 2P0MA 1IYYA 1QAKA 1RDSA 3HX8A 3LTCA 1OHPA 1Q7HA 4OUQA 5EEOA 1OPYA 3JUQA 3WHOA 1IDPA 4BL2A 1BUJA 3NUVA 1JJ22 1WQLB 2KCDA 2WO0A 4I4KA 1OGXA 4R80A 5AIGA 4BTWA 3K9MC 3BNBA 2Z76A 3FKAA 3KE7A 4H61A 3CCE3 3H51A 1YIT3 2L1SA 5BIRA 4OK0A 1R4YA 1BRGA 2ZHXB 1JB5A 3IMAB 3NHXA 3N54B 5D81A 2W9PA 6GSPA 3X3ZA 3EE1A 3JUPA 2V1LA
chains in the Genus database with same CATH topology
1BIRA 3GSPA 1AQZA 4RNTA 1GMRA 1I3IA 2F4YA 1DETA 1BGSA 1FW7A 2KAAA 1BNGA 1RGKA 1BAOA 4BIRA 1RGEA 4GHOA 1UCJA 1C54A 1TTOA 1BRJA 1I3FA 4HOHA 1RHLA 8RNTA 2AADA 1RGHA 3AHWA 5RNTA 1GMPA 1I70A 2KF5A 1SARA 1JBSA 1BANA 1G02A 5GSPA 1BRIA 1RTUA 2GSPA 1YVSA 1BVIA 1RMSA 1JBRA 1LOWA 1FUTA 1BRKA 1YGWA 2F5MA 1CH0A 1HYFA 1I0XA 2RNTA 1BNFA 7GSPA 1RGCA 1BOXA 1X1WA 1RGGA 1LOVA 1GSPA 1RGFA 1BSBA 1RGLA 3HOHA 1BSEA 2C4BA 1B2MA 2KF6A 2KF3A 1RNTA 3AGNA 1HZ1A 1I2GA 3BU4A 1GOYA 6RNTA 1UCIA 3D5GA 7RNTA 1A2PA 1PY3A 1YNVX 1B2XA 1RN1A 1RSNA 1TRPA 1B21A 1FYSA 1GOUA 1MGRA 1FUSA 3AGOA 3SYUA 1JBTA 2RBIA 3KCHA 1MGWA 1LRAA 1I0VA 5BU4A 1LNIA 2F5WA 1AY7A 4J5GA 4BU4A 3URPA 1X1XA 3RNTA 1BRNL 1ZGXA 1X1YA 5HOHA 1B27A 3AHSA 1B2SA 2BIRA 1RLSA 1T2IA 4GSPA 3BIRA 1BNJA 1I2EA 2SARA 2HOHA 2F56A 1BNSA 3Q3FA 1PYLA 1GOVA 3DH2A 1TRQA 2BU4A 1RNBA 1GMQA 3DGYA 1BU4A 2ZA4A 3WR2A 1DE3A 1BNEA 1BSAA 1RCKA 1BNRA 1BSDA 1UCLA 1BNIA 1IYYA 3A5EA 1FZUA 1X1UA 9RNTA 1RCLA 1RDSA 1RGAA 1Q9EA 2AAEA 3D4AA 1B2ZA 3WHOA 1B2UA 4HAAA 1BUJA 4J5KA 1I2FA 1I8VA 2KF4A 1B20A 1BSCA 5BIRA 1BRSA 1BRHA 1R4YA 1BRGA 3D5IA 1RN4A 6GSPA 1LOYA 1B3SA 1T2HA 1UCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIR A;  3GSP A;  1AQZ A;  4RNT A;  1GMR A;  1I3I A;  2F4Y A;  1DET A;  1BGS A;  1FW7 A;  2KAA A;  1BNG A;  1RGK A;  1BAO A;  4BIR A;  1RGE A;  4GHO A;  1UCJ A;  1C54 A;  1TTO A;  1BRJ A;  1I3F A;  4HOH A;  1RHL A;  8RNT A;  2AAD A;  1RGH A;  3AHW A;  5RNT A;  1GMP A;  1I70 A;  2KF5 A;  1SAR A;  1JBS A;  1BAN A;  1G02 A;  5GSP A;  1BRI A;  1RTU A;  2GSP A;  1YVS A;  1BVI A;  1RMS A;  1JBR A;  1LOW A;  1FUT A;  1BRK A;  1YGW A;  2F5M A;  1CH0 A;  1HYF A;  1I0X A;  2RNT A;  1BNF A;  7GSP A;  1RGC A;  1BOX A;  1X1W A;  1RGG A;  1LOV A;  1GSP A;  1RGF A;  1BSB A;  1RGL A;  3HOH A;  1BSE A;  2C4B A;  1B2M A;  2KF6 A;  2KF3 A;  1RNT A;  3AGN A;  1HZ1 A;  1I2G A;  3BU4 A;  1GOY A;  6RNT A;  1UCI A;  3D5G A;  7RNT A;  1A2P A;  1PY3 A;  1YNV X;  1B2X A;  1RN1 A;  1RSN A;  1TRP A;  1B21 A;  1FYS A;  1GOU A;  1MGR A;  1FUS A;  3AGO A;  3SYU A;  1JBT A;  2RBI A;  3KCH A;  1MGW A;  1LRA A;  1I0V A;  5BU4 A;  1LNI A;  2F5W A;  1AY7 A;  4J5G A;  4BU4 A;  3URP A;  1X1X A;  3RNT A;  1BRN L;  1ZGX A;  1X1Y A;  5HOH A;  1B27 A;  3AHS A;  1B2S A;  2BIR A;  1RLS A;  1T2I A;  4GSP A;  3BIR A;  1BNJ A;  1I2E A;  2SAR A;  2HOH A;  2F56 A;  1BNS A;  3Q3F A;  1PYL A;  1GOV A;  3DH2 A;  1TRQ A;  2BU4 A;  1RNB A;  1GMQ A;  3DGY A;  1BU4 A;  2ZA4 A;  3WR2 A;  1DE3 A;  1BNE A;  1BSA A;  1RCK A;  1BNR A;  1BSD A;  1UCL A;  1BNI A;  1IYY A;  3A5E A;  1FZU A;  1X1U A;  9RNT A;  1RCL A;  1RDS A;  1RGA A;  1Q9E A;  2AAE A;  3D4A A;  1B2Z A;  3WHO A;  1B2U A;  4HAA A;  1BUJ A;  4J5K A;  1I2F A;  1I8V A;  2KF4 A;  1B20 A;  1BSC A;  5BIR A;  1BRS A;  1BRH A;  1R4Y A;  1BRG A;  3D5I A;  1RN4 A;  6GSP A;  1LOY A;  1B3S A;  1T2H A;  1UCK A; 
#chains in the Genus database with same CATH topology
 4N6T A;  1ZO2 A;  1BIR A;  1QMA A;  2JQ5 A;  4L7K A;  3N9H A;  4L8P A;  2H0H A;  1AQZ A;  3T8U A;  1A67 A;  1MWU A;  1OF5 B;  1W6Y A;  3OX9 A;  1DET A;  1W2B 2;  2M7O A;  4O02 B;  1OF5 A;  3NQY A;  3CPO A;  1JRQ A;  3QRD A;  1TIJ A;  1IV7 A;  1LQM B;  1ZX2 A;  2KAA A;  5LC6 A;  1LNH A;  2CG1 A;  3FF0 A;  3B7C A;  1VQK 3;  4MEI A;  3CCU 3;  3UNL A;  1C54 A;  3KKG A;  1SIH A;  4N6O B;  1I3F A;  1RHL A;  1IK3 A;  2AAD A;  4O8S A;  1GY7 A;  3AHW A;  1YIJ 3;  1I70 A;  4EC6 A;  1PU4 A;  1SAR A;  1O7H B;  3T0U A;  4CPK A;  1E3R A;  3JUO A;  1G02 A;  4LZI A;  1N9E A;  3X3X A;  1RTU A;  1RN7 A;  5M1A A;  3WOE B;  5JBS A;  2OCT A;  5IG0 A;  2STD A;  4PEJ A;  1BVI A;  1JBR A;  2C11 A;  1FUT A;  3EBY A;  4K1V A;  1HYF A;  1GY6 A;  3T8N A;  1EQK A;  4WP5 A;  1IVV A;  1DMN A;  2W03 A;  2W0Q A;  1N8R 4;  4HKV B;  1LVN A;  1J2B A;  3MHE A;  5JPU A;  3WA3 A;  1Q86 4;  2E2U A;  1BSB A;  4KFE A;  1OHO A;  2OOV C;  2C4B A;  2H0G A;  2KF3 A;  3FG1 A;  4CCV A;  4J9A A;  5KP3 A;  3VSY A;  1QVG 2;  4KVH A;  1GOY A;  1JKG B;  3CU3 A;  2B1X B;  3N8B A;  7RNT A;  2YFL B;  3B4P A;  1RKY A;  3LT9 A;  1JKG A;  3LOY A;  3FF2 A;  1UW1 A;  5AIF A;  2K0M A;  1FGR A;  4HM1 B;  1ULI B;  1TRP A;  4RNZ A;  3K5T A;  1VQO 3;  1B21 A;  3MG3 A;  1IV9 A;  1MGR A;  1AR0 A;  2RCD A;  3AGO A;  4FR9 A;  4R1K A;  1TJD A;  1YJN 3;  3HIG A;  3ZG5 A;  4Q53 A;  2BT3 A;  3D79 A;  1V58 A;  2UUG C;  2XFS A;  3X41 A;  1MNL A;  2XF3 A;  5IG4 A;  2J8X B;  4HBR A;  2B24 B;  1MWR A;  4N6N B;  3URP A;  5AEU B;  4LYL B;  3NM7 A;  1KQS 2;  1FA3 A;  4HM7 B;  1FGM A;  1SQW A;  1T3B A;  2W9Q A;  1UUW B;  5HOH A;  3WOD G;  3I55 3;  1B27 A;  3AHS A;  3DM8 A;  4OVM A;  2WGO A;  4KFF A;  3WOF B;  3NBJ A;  4GB5 A;  5HGR A;  2CX1 A;  2W04 A;  3KSE D;  3CPW 2;  4XDW A;  3Q1C A;  1ROV A;  1TFK A;  2KXG A;  2HOH A;  3DXO A;  1IU7 A;  1GYB A;  1JN5 B;  3ER7 A;  4U13 A;  2LQV A;  2CW9 A;  3DH2 A;  1UUV B;  1GY5 A;  1GD4 A;  3DGY A;  2BNG A;  3K0Z A;  1G96 A;  5DRE A;  1MWS A;  3A5E A;  3GZX B;  2CFW A;  1RCL A;  2CFD A;  1VQ8 3;  1RGA A;  2GU3 A;  2YFI B;  1Q9E A;  2AAE A;  2D1W A;  4FCJ A;  2H0I A;  1M1K 4;  1NU3 A;  1B2U A;  3NQZ A;  3A76 A;  5AI1 A;  3S28 A;  4J5K A;  2CK3 H;  1EEJ A;  1W02 A;  6STD A;  1F8N A;  1VQQ A;  2KF4 A;  4HM3 B;  1B20 A;  3EF8 A;  3ALA A;  1BRH A;  3GZY B;  1NB5 I;  1N8Q A;  1EA2 A;  3WA2 X;  3CCJ 3;  3EJV A;  1RN4 A;  1NDO B;  1LOY A;  3F9S A;  1O7P B;  1BUQ A;  1UCK A;  1GD3 A;  3KFQ C;  5FW5 A;  3KZT A;  1NO3 A;  2F4Y A;  2RFR A;  3CC2 3;  2KRT A;  4O3V A;  1KWI A;  1V57 A;  1UGI A;  3NXJ A;  1YHQ 3;  4NPB A;  2P05 A;  3SXX A;  3ZG0 A;  1BAO A;  1M9G A;  1RGE A;  3EB8 A;  4DKI A;  2QIY A;  3G4S 3;  3GRD A;  4XBT A;  2L4V A;  3V99 A;  1TTO A;  1BRJ A;  4HOH A;  3RGR A;  2CHC A;  2PNC A;  2XRX B;  1TU5 A;  3FLJ A;  2IUJ A;  1M1X B;  2UX0 A;  2GEY A;  3CMA 3;  4FCM A;  3LML A;  2W6J H;  1D6Y A;  2O9U X;  1UI8 A;  2YFJ B;  3PS8 A;  3J7Y d;  1S72 3;  2CWV A;  2R41 A;  5GSP A;  2PZV A;  3UL5 A;  3MSO A;  2BMQ B;  2GSP A;  2CWT A;  3KN4 A;  1YVS A;  4K1U A;  5AII A;  2QEX 3;  1UUG B;  3UB1 A;  4N3V A;  1CH0 A;  2XGL A;  2XH9 A;  2XGN A;  4EW5 A;  1AVK A;  1BNF A;  1RRH A;  1X1W A;  5LC7 A;  4HVN A;  4QWT A;  2OQE A;  3V98 A;  1RGG A;  4BTX A;  1VQM 3;  1RGL A;  3D3L A;  4HM0 B;  4X2H A;  2INX A;  2FGT A;  1Q82 4;  1ROA A;  3OV4 A;  4XM4 A;  3CCV 3;  1JZO A;  1B2M A;  3BU4 A;  3K63 A;  4RNY A;  5IF6 A;  4XBX A;  1ASK A;  4NRE A;  5BVB A;  6RNT A;  3PXM A;  1IQ8 A;  3D5G A;  1YNV X;  1QAF A;  4HJL B;  2BMR B;  3IJE B;  4EYC A;  3CME 3;  1YJW 3;  2GEX A;  1FYS A;  5M18 A;  1HU9 A;  3G16 A;  1A2V A;  3CNX A;  1FUS A;  3FG4 A;  1FGT A;  3DZL A;  3Q90 A;  2GXF A;  2CIU A;  5CXO A;  4H3U A;  2QA4 3;  3MKI A;  3DGL A;  1N9J A;  1ZS7 A;  5BU4 A;  5G1K A;  2F5W A;  3F8X A;  4R9K A;  3NM2 A;  4XB5 A;  1X1X A;  2HMN B;  4O2H A;  3RNT A;  1BRN L;  1ZGX A;  1Y4K A;  1W6C A;  1YGE A;  4EV2 A;  5STD A;  3LYG A;  1B2S A;  4FMD A;  1O7G B;  1T2I A;  3DUK A;  3B8L A;  1LQG C;  1W2Z A;  1V74 A;  3CNM A;  4AKZ A;  1DMM A;  1R4C A;  3NBR A;  1BNJ A;  2ML6 A;  1WMP A;  4G1M B;  5ELU A;  1GOV A;  2IA7 A;  3CCL 3;  1IVW A;  3DGO A;  1GMQ A;  1DE3 A;  1BSA A;  3IPT A;  1BNR A;  1BSD A;  2ZL8 A;  1UCL A;  1BNI A;  1VZZ A;  3OWY A;  3F8H A;  1X1U A;  4IIA A;  2E2T A;  1K73 4;  1Q40 B;  3UJM A;  1NNV A;  1W01 A;  1IVU A;  1WNH A;  3NX0 A;  4BTY A;  2HMJ B;  1Q40 A;  1B2Z A;  2IYJ A;  2HMO B;  2XEP A;  3D4A A;  3GZB A;  4HAA A;  1I2F A;  2ML5 A;  5IG3 A;  1UDI I;  4FMB A;  3ZFZ A;  1EUI C;  2Y74 A;  2CX0 A;  3U97 A;  3ROB A;  5AYS C;  4BL3 A;  3WR2 A;  1BSC A;  2K54 A;  3OXA A;  1BRS A;  4XDV A;  1W00 A;  4HM8 B;  2HML B;  4EV5 A;  3HII A;  2F99 A;  1VQN 3;  1W7C A;  1IT7 A;  3SOA A;  1JN5 A;  1IQX A;  1WMN A;  4N6L A;  5IEN A;  4RZM A;  4RNT A;  1GMR A;  5FGO A;  1I3I A;  5IG5 A;  3HI7 A;  4LEH A;  1Q7Y 4;  3EBT A;  2XFT A;  4NHF A;  2I9W A;  4HM2 B;  2XR8 B;  1NB3 I;  3S5C A;  4MMY B;  4FMA A;  1BNG A;  1RGK A;  3MG2 A;  3GZR A;  5D82 A;  1KC8 4;  4N6V 0;  4GHO A;  1UCJ A;  2E2V A;  1QVF 2;  5EQL A;  5D83 A;  8RNT A;  1SJW A;  3PCR A;  1FGQ A;  4KT3 B;  2W56 B;  1RGH A;  3BB9 A;  3PYJ A;  4R9L A;  5CF1 A;  5RNT A;  2KF5 A;  2W56 A;  4IPB A;  3G71 3;  3CCM 3;  3I0Y A;  3DGM A;  2GU1 A;  1JBS A;  2HMM B;  4CDL A;  4I5Q A;  1JNQ A;  1D6Z A;  4K61 A;  4LMI A;  2F98 A;  3BNE A;  1LOW A;  1UI7 A;  1OH0 A;  1WTH A;  1JV2 B;  1FGO A;  2HMK B;  4MJD A;  4AEQ A;  3M8C A;  3GWR A;  1RGC A;  3BND A;  4HM5 B;  1VQL 3;  3JVC A;  1LOV A;  1RGF A;  1MOL A;  4XBY A;  4JF8 A;  2P38 A;  2MC8 A;  3HOH A;  2K3D A;  3DMC A;  3S29 A;  1VQ4 3;  1TFO A;  1JB2 A;  1S5A A;  2KF6 A;  1RNT A;  3AGN A;  3D9R A;  1HZ1 A;  2OQE C;  3EQQ B;  3FCS B;  3GAX A;  3RDE A;  1OGZ A;  1OUN A;  3STD A;  1T5Y A;  1YVB I;  2OTJ 3;  4HM6 B;  1W5Z A;  5I97 A;  1A2P A;  5KP4 A;  1RN1 A;  1RSN A;  3LTB A;  2CH9 A;  2IY2 A;  3LH4 A;  2P0X A;  2QGU A;  2RSX A;  5BXQ A;  5CLK A;  1O7W B;  3SYU A;  1JBT A;  5IER A;  2Z77 A;  3VGN A;  2IUK A;  1MGW A;  3NBB A;  1PFP A;  3L0R A;  4AKY A;  1RRL A;  5KP1 A;  1LNI A;  4IT7 A;  2UGI A;  1AY7 A;  4J5G A;  4BU4 A;  1VQ7 3;  1C7H A;  1LOX A;  1US1 A;  2Z7A A;  4ORL A;  4STD A;  2CFG A;  1X1Y A;  1JZD A;  2LYX A;  3LT8 A;  2BIR A;  3TDG A;  3I56 3;  2SBL A;  3LXU X;  1RLS A;  3MG1 A;  3QK9 A;  4GSP A;  3WDG B;  1K9M 4;  4MMX B;  1L5G B;  3Q2P A;  3BIR A;  4LGQ A;  2FXT A;  5AEW B;  1ISK A;  5CK6 A;  5G1L A;  3DGN A;  3X40 A;  3Q3F A;  2JDI H;  1PYL A;  2F86 B;  1SPU A;  3BNC A;  1K8A 4;  4RBN A;  1VQ6 3;  1TP6 A;  1OAC A;  3MWZ A;  3K7C A;  5ELJ A;  1FZU A;  2YX9 A;  9RNT A;  1Q81 4;  5CF2 A;  3FGY A;  4FCZ A;  7STD A;  2CKF B;  1CEW I;  1K41 A;  1EKM A;  1WMO A;  1U8C B;  1JB4 A;  4WFO A;  3U1W A;  2P09 A;  3X42 A;  1I8V A;  3SX1 A;  1A2K A;  1N5H A;  1SII A;  1U5O A;  3E99 A;  4HYZ A;  1O7N B;  3G8Z A;  1KD1 4;  1LXE A;  2FNQ A;  3LTA A;  3PCS A;  1IVX A;  3D5I A;  4WHA A;  4N6M A;  5M19 A;  4J8T A;  1W4N A;  4HZB B;  3VF1 A;  3F40 A;  3MYT A;  2GBX B;  3EX9 A;  1B3S A;  3SLU A;  1T2H A;  1MWT A;  2BHM A;  3FZW A;  3FH1 A;  3H3H A;  1IT8 A;  2IMJ A;  4EBG A;  3GSP A;  5DRV A;  3CD6 3;  1GS3 A;  1NWW A;  4L8O A;  1CYU A;  2GBW B;  2CG0 A;  4CJN A;  3KII A;  3RGA A;  1BGS A;  1QJG A;  1FW7 A;  1VQP 3;  1CYV A;  3CXC 2;  3ECF A;  4BIR A;  2WGQ A;  3X3Y A;  2BMO B;  4KFD A;  2R4I A;  2CWU A;  1UGH I;  1STF I;  5G2G A;  1CQS A;  2W2C A;  8CHO A;  1Z1S A;  3F7X A;  1IQY A;  5AYR B;  3JUM A;  1G0T A;  1GMP A;  4ZM8 A;  4HZ9 B;  3MPH A;  1BAN A;  1K28 A;  3PGB A;  1ULJ B;  1O7M B;  1BRI A;  5JPP A;  2Z6B A;  1DYU A;  1TUH A;  4HM4 B;  2O3O A;  2WOF A;  4K90 B;  1RMS A;  4X2O A;  4R4K A;  1VQ9 3;  2F5M A;  1BRK A;  1YGW A;  2MF7 A;  3O8Y A;  3NV0 B;  1DVD A;  1I0X A;  3AMO B;  1A90 A;  2OOV A;  3NV0 A;  3B4O A;  2RNT A;  3AMO A;  3SVA A;  7GSP A;  3F14 A;  1BOX A;  1STD A;  5A0O B;  1DMQ A;  1GSP A;  4FMC A;  1OHS A;  1VQ5 3;  2OWP A;  1E97 A;  3EHC A;  1BSE A;  2OTL 3;  3CCR 3;  4GL6 A;  3S27 A;  1NJI 4;  1I2G A;  3DY5 A;  1N5P A;  3CCQ 3;  2Y73 A;  5IEP A;  1AVL A;  1UCI A;  1PY3 A;  1DVC A;  1B2X A;  3WMD A;  4WWU C;  3BLZ A;  1D6U A;  1YI2 3;  1E3V A;  4ILF A;  4TX4 A;  3KSP A;  1FUW A;  3JUN A;  5IEO A;  1GOU A;  2XSO B;  3SED A;  3CCS 3;  1HKX A;  3G6E 3;  2RBI A;  3FG3 A;  3G0K A;  3KCH A;  1LRA A;  2CFK A;  3OWU A;  1I0V A;  2Q07 A;  1KSI A;  4KZ1 A;  3SOY A;  4EXR A;  3LZA A;  1RJO A;  1M90 4;  5EVH A;  3OW2 2;  2BO9 B;  2XSH B;  2CFL A;  3EN1 B;  1Q42 A;  2A15 A;  3HZP A;  2CC3 A;  5AIH A;  2D42 A;  3CC7 3;  1OCV A;  3EN8 A;  3CC4 3;  2RGQ A;  4LSO A;  2SAR A;  1I2E A;  4JRF A;  3UL6 A;  5IW9 A;  1AV4 A;  1W6G A;  3HK4 A;  3LTD A;  2F56 A;  1BNS A;  4MMZ B;  2WOH A;  3FSD A;  3OWS A;  4N6U A;  4WYK B;  1RNB A;  1TRQ A;  2BU4 A;  5TGN A;  3V92 A;  3F7S A;  2C10 A;  4WYK A;  1BU4 A;  2ZA4 A;  3PZW A;  3EC9 A;  1BNE A;  3S67 A;  1RCK A;  1EG9 B;  2ZDJ A;  1QAL A;  1YJ9 3;  2P0M A;  1IYY A;  1QAK A;  1RDS A;  3HX8 A;  3LTC A;  1OHP A;  1Q7H A;  4OUQ A;  5EEO A;  1OPY A;  3JUQ A;  3WHO A;  1IDP A;  4BL2 A;  1BUJ A;  3NUV A;  1JJ2 2;  1WQL B;  2KCD A;  2WO0 A;  4I4K A;  1OGX A;  4R80 A;  5AIG A;  4BTW A;  3K9M C;  3BNB A;  2Z76 A;  3FKA A;  3KE7 A;  4H61 A;  3CCE 3;  3H51 A;  1YIT 3;  2L1S A;  5BIR A;  4OK0 A;  1R4Y A;  1BRG A;  2ZHX B;  1JB5 A;  3IMA B;  3NHX A;  3N54 B;  5D81 A;  2W9P A;  6GSP A;  3X3Z A;  3EE1 A;  3JUP A;  2V1L A; 
#chains in the Genus database with same CATH homology
 1BIR A;  3GSP A;  1AQZ A;  4RNT A;  1GMR A;  1I3I A;  2F4Y A;  1DET A;  1BGS A;  1FW7 A;  2KAA A;  1BNG A;  1RGK A;  1BAO A;  4BIR A;  1RGE A;  4GHO A;  1UCJ A;  1C54 A;  1TTO A;  1BRJ A;  1I3F A;  4HOH A;  1RHL A;  8RNT A;  2AAD A;  1RGH A;  3AHW A;  5RNT A;  1GMP A;  1I70 A;  2KF5 A;  1SAR A;  1JBS A;  1BAN A;  1G02 A;  5GSP A;  1BRI A;  1RTU A;  2GSP A;  1YVS A;  1BVI A;  1RMS A;  1JBR A;  1LOW A;  1FUT A;  1BRK A;  1YGW A;  2F5M A;  1CH0 A;  1HYF A;  1I0X A;  2RNT A;  1BNF A;  7GSP A;  1RGC A;  1BOX A;  1X1W A;  1RGG A;  1LOV A;  1GSP A;  1RGF A;  1BSB A;  1RGL A;  3HOH A;  1BSE A;  2C4B A;  1B2M A;  2KF6 A;  2KF3 A;  1RNT A;  3AGN A;  1HZ1 A;  1I2G A;  3BU4 A;  1GOY A;  6RNT A;  1UCI A;  3D5G A;  7RNT A;  1A2P A;  1PY3 A;  1YNV X;  1B2X A;  1RN1 A;  1RSN A;  1TRP A;  1B21 A;  1FYS A;  1GOU A;  1MGR A;  1FUS A;  3AGO A;  3SYU A;  1JBT A;  2RBI A;  3KCH A;  1MGW A;  1LRA A;  1I0V A;  5BU4 A;  1LNI A;  2F5W A;  1AY7 A;  4J5G A;  4BU4 A;  3URP A;  1X1X A;  3RNT A;  1BRN L;  1ZGX A;  1X1Y A;  5HOH A;  1B27 A;  3AHS A;  1B2S A;  2BIR A;  1RLS A;  1T2I A;  4GSP A;  3BIR A;  1BNJ A;  1I2E A;  2SAR A;  2HOH A;  2F56 A;  1BNS A;  3Q3F A;  1PYL A;  1GOV A;  3DH2 A;  1TRQ A;  2BU4 A;  1RNB A;  1GMQ A;  3DGY A;  1BU4 A;  2ZA4 A;  3WR2 A;  1DE3 A;  1BNE A;  1BSA A;  1RCK A;  1BNR A;  1BSD A;  1UCL A;  1BNI A;  1IYY A;  3A5E A;  1FZU A;  1X1U A;  9RNT A;  1RCL A;  1RDS A;  1RGA A;  1Q9E A;  2AAE A;  3D4A A;  1B2Z A;  3WHO A;  1B2U A;  4HAA A;  1BUJ A;  4J5K A;  1I2F A;  1I8V A;  2KF4 A;  1B20 A;  1BSC A;  5BIR A;  1BRS A;  1BRH A;  1R4Y A;  1BRG A;  3D5I A;  1RN4 A;  6GSP A;  1LOY A;  1B3S A;  1T2H A;  1UCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...