1BRKA

Barnase mutant with ile 96 replaced by ala
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLAYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brkA00
1C54A 2RBIA 4HAAA 1RCLA 3HOHA 1ZGXA 3DH2A 1BRGA 1BRSA 1RLSA 3D4AA 1FUTA 1GMRA 1BOXA 1PYLA 1LOWA 3D5IA 1MGRA 1UCIA 5GSPA 9RNTA 1DE3A 3AHWA 1X1XA 1B27A 4RNTA 1SARA 1UCJA 1LNIA 4GHOA 1BIRA 4HOHA 1BNRA 1HZ1A 1I0VA 1TTOA 1JBTA 1RGHA 1BRJA 1I2GA 1B2ZA 1BVIA 3A5EA 1FYSA 1AQZA 1FZUA 1RHLA 7RNTA 1FW7A 1BNIA 1GOUA 1BGSA 3BU4A 1RGGA 1BSCA 1I3FA 3RNTA 1RSNA 1GMQA 1UCKA 2HOHA 2KF4A 3AGNA 6GSPA 3D5GA 1GOVA 1BSBA 1G02A 2AADA 1R4YA 1UCLA 4BU4A 1RGAA 1B2UA 1DETA 2ZA4A 1I3IA 3WR2A 2C4BA 2KAAA 1RGKA 1BNJA 1I8VA 1BANA 1BNEA 2KF5A 2BIRA 2KF3A 1RGLA 1HYFA 2F4YA 3AHSA 3KCHA 1FUSA 1BNFA 5BIRA 1BUJA 3WHOA 7GSPA 3AGOA 1AY7A 1YGWA 1I70A 2KF6A 3DGYA 4GSPA 1RGCA 1TRPA 2F5MA 1RMSA 6RNTA 1RN1A 1TRQA 1PY3A 5RNTA 1A2PA 3BIRA 1X1WA 1RDSA 2F56A 3URPA 1GSPA 1BNSA 1BNGA 1BAOA 2F5WA 1IYYA 5HOHA 1JBRA 1YVSA 1GOYA 1I2FA 1B3SA 1LOVA 2RNTA 1T2IA 3SYUA 1BRNL 2GSPA 1JBSA 1B21A 1I2EA 1I0XA 1LOYA 1RCKA 3GSPA 1RGEA 4J5KA 1BU4A 1BSEA 1B2SA 8RNTA 5BU4A 3Q3FA 1Q9EA 1RGFA 1B20A 1LRAA 1X1YA 1X1UA 1BRHA 1B2XA 2SARA 1BRKA 1RNBA 2BU4A 4BIRA 1RTUA 2AAEA 1B2MA 1RN4A 1MGWA 1BSDA 1BRIA 1T2HA 1RNTA 1BSAA 1YNVX 1CH0A 1GMPA 4J5GA
chains in the Genus database with same CATH superfamily
1AV4A 3IJEB 3LT8A 5CF1A 1FGQA 1RCLA 3UNLA 3CMA3 3DH2A 1BRGA 1BRSA 1RLSA 1V57A 1FUTA 1GMRA 3UB1A 4AKZA 1KC84 4LGQA 3X42A 1EG9B 1MWSA 3PXMA 4WFOA 4FCZA 1OF5A 2BNGA 4CCVA 1ZS7A 5EEOA 4KVHA 3CCS3 1X1XA 2GXFA 3JUPA 2B24B 2Z76A 3SX1A 2XH9A 4H61A 3LH4A 4HM2B 3EQQB 3VGNA 1W01A 4G1MB 1KWIA 2JDIH 3S67A 1YI23 1K8A4 3QRDA 1JBTA 3OXAA 4MMZB 1BRJA 3FG1A 1B2ZA 1BUQA 5IEOA 1IYYA 4N6OB 1RHLA 2CKFB 3EB8A 1IVUA 1UGIA 4HM6B 4ZM8A 1FW7A 3SOYA 2UGIA 4WHAA 3FSDA 2SBLA 3BNDA 4BTYA 1Q42A 4H3UA 1T5YA 4FCMA 1T3BA 1U5OA 1UCKA 1QAKA 2F98A 2HOHA 4JF8A 1TJDA 2KF4A 3AGNA 3HK4A 1G0TA 6GSPA 3F7SA 2XSHB 2OTL3 1ULIB 4AEQA 1VQ43 2AADA 2GBXB 1DYUA 3G16A 5AYRB 4BU4A 3U1WA 3U97A 5AIGA 1DETA 3WR2A 1I3IA 4FCJA 5EVHA 1W6YA 3DUKA 3GZRA 2KAAA 3CPOA 4WYKB 5CXOA 5HGRA 2H0HA 3PCSA 1RGKA 1Q814 2PNCA 4R9LA 5KP3A 2R4IA 2YFIB 3NBRA 4K1VA 5FW5A 3NM2A 4CPKA 2BO9B 1I8VA 2CFLA 2XRXB 3WDGB 1BANA 2C11A 1BNEA 2E2UA 2W56A 1QVF2 1IDPA 4K90B 2P0XA 3HX8A 1RGLA 1W4NA 2F4YA 3KN4A 3OWSA 5AIHA 5BIRA 2C10A 1N5HA 3WHOA 5I97A 2KCDA 1GD3A 3ECFA 4RBNA 2KF6A 1I70A 1M1XB 1O7HB 3SEDA 1GD4A 1CEWI 1RGCA 3BLZA 3PYJA 4HM0B 4HBRA 6RNTA 2CX1A 1RN1A 1PY3A 3OX9A 5JPPA 1JB5A 1W2ZA 2XEPA 4R9KA 1NB3I 4OVMA 1Z1SA 3T0UA 3H51A 1X1WA 3CCL3 1RDSA 2MF7A 2W2CA 3NQYA 3URPA 1Q40B 1GSPA 3A76A 1BNSA 2CK3H 3K63A 5AIFA 4OUQA 2IYJA 3FGYA 2LYXA 1QVG2 2CWVA 3F9SA 4X2OA 4EV5A 3CCR3 1GOYA 1I2FA 1ISKA 2WGQA 2XR8B 1LOVA 1JZOA 1MWRA 2ZL8A 1JRQA 1RN7A 4HM7B 2OCTA 3F8HA 4LMIA 6STDA 1I2EA 3F14A 5IG5A 3GSPA 3D3LA 1IT7A 1B2SA 2W9PA 4L8OA 2IUJA 5BU4A 4Q53A 4NPBA 1N8QA 2Z7AA 3I0YA 1E97A 2OWPA 1Q7Y4 2K54A 3O8YA 3J7Yd 2CWTA 1N8R4 1B2MA 3KKGA 3LYGA 1OGZA 5A0OB 1VQK3 3EF8A 1BRIA 1S5AA 2CH9A 1T2HA 3BB9A 3NXJA 2LQVA 1QMAA 2BT3A 2ZHXB 4NHFA 4J5GA 4HJLB 2P05A 1CH0A 2ML6A 2L1SA 3PZWA 1SQWA 3LTAA 2XF3A 4FR9A 1AVKA 2F99A 1JZDA 1TU5A 8CHOA 2STDA 4FMDA 5AEUB 3NBJA 1D6UA 2ZDJA 1K41A 2UX0A 1MGRA 3FKAA 1VQQA 4HZBB 3RGAA 4BTWA 9RNTA 2P0MA 4WYKA 2WGOA 1UW1A 5IENA 1NWWA 1LNIA 2A15A 1HZ1A 1I0VA 1TTOA 5IF6A 3WOEB 1UUWB 1FGTA 4GB5A 1I2GA 3FCSB 3UJMA 2I9WA 1A2VA 1TFOA 5CK6A 1AQZA 2Z77A 2E2VA 1ROAA 3KSED 3RGRA 1NB5I 3LXUX 2CG0A 1BNIA 2W6JH 3IPTA 3X41A 4O2HA 3I553 2YX9A 4BL2A 3GAXA 2XSOB 4N6V0 1V74A 1RSNA 3RNTA 1GY7A 1STDA 1GMQA 3DGMA 3CME3 3T8NA 4HKVB 3S28A 1CQSA 2O9UX 2W0QA 1O7MB 2L4VA 2Y74A 4HM8B 3G6E3 3CCQ3 2FGTA 3JVCA 4EV2A 1GY6A 3D5GA 3QK9A 1G02A 5IW9A 1UCLA 1OCVA 1RGAA 4XDVA 1Q40A 3FG3A 3DGLA 3FLJA 3SVAA 1OACA 5JPUA 2YFJB 1OPYA 1Y4KA 5BXQA 3MPHA 3EX9A 1RRHA 3CNMA 3GZXB 4BTXA 5KP4A 3OWUA 3H3HA 3KCHA 1FUSA 3N9HA 4JRFA 1TUHA 5IG3A 7GSPA 5JBSA 4O3VA 1N9EA 1YIJ3 1YGEA 3NHXA 1YGWA 3DGYA 3GRDA 1VQ73 3N54B 5LC7A 3NUVA 1TRPA 1KSIA 5TGNA 3X3YA 5EQLA 1RMSA 1FGOA 4N6UA 4CDLA 2CFWA 1NJI4 2K0MA 3CD63 3CCV3 4DKIA 1VQ83 1JKGB 2KRTA 2F86B 1A2PA 1W7CA 1KD14 5M1AA 1EKMA 1RJOA 3HI7A 4R4KA 3WA2X 4PEJA 2B1XB 5ELUA 3DMCA 3EBYA 2F5WA 1UDII 1NU3A 3FF2A 5ELJA 5HOHA 1JBRA 4WWUC 4MMYB 3K7CA 4EW5A 1YVSA 2H0GA 3B7CA 3B4PA 1W2B2 3EN8A 2XFSA 1L5GB 1BRNL 3JUNA 1SJWA 1MOLA 2GSPA 4KT3B 1B21A 1OUNA 2WOFA 1RCKA 2BMQB 4LYLB 7STDA 2GEYA 2QEX3 1M904 8RNTA 2O3OA 1B20A 1LRAA 4HVNA 2WOHA 3FH1A 4AKYA 3CC43 4FMAA 1RNBA 4KFFA 4XDWA 4L8PA 3SXXA 3ZFZA 2GU1A 2HMJB 3HIIA 2P09A 2GEXA 2K3DA 3JUOA 3RDEA 3NM7A 1QJGA 3Q90A 3BNCA 4ILFA 1CYUA 1YNVX 1FGMA 1S723 2CX0A 2IA7A 2RFRA 4N6NB 3HZPA 3G4S3 1C54A 4NREA 1DVDA 5IERA 1ZGXA 3NV0B 1BOXA 4U13A 1Q824 1LOWA 1IVXA 2XFTA 1CYVA 3MHEA 1J2BA 1VZZA 3D5IA 1O7WB 2RCDA 4CJNA 1VQO3 3V99A 1D6ZA 1UCIA 3EHCA 2W04A 1WMOA 1EUIC 1B27A 1LXEA 2FNQA 2YFLB 1SARA 1IQXA 3WODG 1HKXA 3X40A 1BIRA 3F8XA 4HOHA 1BNRA 2IMJA 3FG4A 5FGOA 4EXRA 3B4OA 3A5EA 2V1LA 3EBTA 1DMMA 1FYSA 1WMNA 1OHSA 2W03A 4LSOA 1JJ22 1JNQA 2Y73A 1GOUA 1RGGA 4IT7A 3PS8A 3EJVA 5IG4A 1W00A 4EYCA 1V58A 3PCRA 1EQKA 2CC3A 3EN1B 3SOAA 5AYSC 2INXA 2OQEA 2OOVA 1JKGA 1WMPA 1GOVA 4R80A 2ML5A 4N6MA 1B2UA 2P38A 2ZA4A 2HMNB 4IPBA 3KZTA 3WA3A 3CPW2 1IVWA 2HMKB 3LTDA 1W5ZA 1A67A 3CCU3 4FMBA 1BNJA 1E3VA 3KIIA 3DM8A 2CHCA 5M18A 1JV2B 3JUQA 2KF3A 1HYFA 1IU7A 1E3RA 4RNZA 1BNFA 1BUJA 3UL5A 3NQZA 1VQ93 4RNYA 2D42A 3GWRA 1R4CA 1FUWA 3SLUA 1M9GA 3G8ZA 3S27A 1JB4A 1VQL3 2HMMB 1AR0A 1O7GB 5G2GA 1LNHA 3AMOB 3DGNA 4XBYA 1TRQA 2R41A 1STFI 3WOFB 1F8NA 1O7PB 3NBBA 3ER7A 4I5QA 4LEHA 2QGUA 2F56A 1QAFA 1TP6A 1UUGB 2OQEC 2OOVC 1BNGA 1MWTA 3E99A 3TDGA 4EC6A 3GZBA 5AEWB 3D79A 3VF1A 4N6TA 1K734 4STDA 3B8LA 2H0IA 2RNTA 3KE7A 1T2IA 5G1LA 1ASKA 3T8UA 3CXC2 1YHQ3 3S5CA 1YJW3 1DMQA 2FXTA 3NV0A 3F7XA 1JBSA 1I0XA 1LOYA 1W6CA 4TX4A 1YIT3 2CW9A 2GBWB 1HU9A 1N9JA 1RGEA 2BMOB 2CWUA 2HMOB 3D9RA 2IY2A 1BSEA 4J5KA 4MJDA 4L7KA 4ORLA 3LMLA 3PGBA 1U8CB 2BMRB 2Q07A 1X1YA 1X1UA 2QIYA 1BRHA 3X3XA 4R1KA 3F40A 4XBTA 1IV9A 1BRKA 1RTUA 1RN4A 1VQN3 4KFDA 3I563 1W02A 5D82A 1IVVA 3V92A 1M1K4 2BHMA 5D83A 3CC23 1GYBA 5AIIA 1JN5A 1W6GA 4J8TA 4KZ1A 4EBGA 1US1A 1ULJB 1NDOB 1IV7A 5LC6A 2RSXA 4O8SA 5IEPA 4MEIA 1VQ53 5CLKA 2RBIA 1A2KA 4HAAA 1UI8A 3HOHA 4XBXA 3VSYA 1GS3A 4WP5A 4X2HA 3D4AA 3OV4A 4LZIA 2HMLB 1MNLA 1PYLA 4HYZA 3UL6A 4BL3A 1N5PA 1K28A 1UUVB 3MWZA 4K1UA 3ZG0A 3DZLA 3LOYA 3DGOA 1DE3A 3FZWA 5GSPA 1UGHI 3AHWA 3BNEA 4RNTA 1PFPA 2IUKA 3L0RA 5G1KA 3M8CA 2E2TA 1LQGC 1UCJA 3X3ZA 4GHOA 5AI1A 3K9MC 1RGHA 3Q1CA 4XM4A 1BVIA 2CIUA 3JUMA 1PU4A 1FZUA 2J8XB 7RNTA 1D6YA 2M7OA 3EC9A 3NX0A 1BGSA 1RRLA 1ZO2A 1VQP3 3BU4A 1BSCA 2QA43 1I3FA 1YJ93 5D81A 3G713 3K0ZA 2OTJ3 1IK3A 4QWTA 1LOXA 3AMOA 1IT8A 3MKIA 1EA2A 1LVNA 3HIGA 5BVBA 1JB2A 5M19A 1BSBA 1SPUA 1AVLA 1OF5B 1R4YA 2XGNA 3G0KA 3LT9A 4MMXB 3MG1A 2CFGA 2CG1A 4I4KA 1Q7HA 1Q864 5STDA 2C4BA 2JQ5A 2XGLA 3FF0A 3DY5A 4O02B 5DREA 1KQS2 1DMNA 3K5TA 1OH0A 3LTBA 4HM5B 2KF5A 4HZ9B 2BIRA 5CF2A 4N6LA 1K9M4 2UUGC 3AHSA 1JN5B 1TIJA 4GL6A 3STDA 1EEJA 3AGOA 3ALAA 3Q2PA 1AY7A 2CFDA 4GSPA 1DVCA 3CCJ3 1A90A 3KSPA 1IQYA 1SIIA 2CFKA 3EE1A 3CC73 2F5MA 4OK0A 1ROVA 3CCE3 4RZMA 4J9AA 1IQ8A 1LQMB 4K61A 4HM4B 2PZVA 5RNTA 3BIRA 3KFQC 3GZYB 3ROBA 3CCM3 1WNHA 4KFEA 1YVBI 1BAOA 5DRVA 3S29A 4N3VA 3N8BA 2MC8A 1QALA 1B3SA 2W56B 1NO3A 3MYTA 4XB5A 3WMDA 5KP1A 4HM1B 2W9QA 3SYUA 1GY5A 1G96A 2D1WA 3CU3A 2RGQA 3LZAA 1FGRA 2WO0A 1C7HA 3DXOA 3MSOA 1O7NB 1UI7A 3IMAB 1BU4A 3BNBA 3Q3FA 1Q9EA 1RGFA 3ZG5A 1OHOA 3CNXA 5IG0A 1VQM3 1B2XA 4FMCA 3OW22 1FA3A 3V98A 3MG2A 1VQ63 2SARA 4IIAA 1MWUA 2BU4A 4BIRA 2AAEA 1RKYA 1OGXA 1MGWA 1BSDA 1ZX2A 3MG3A 1OHPA 1NNVA 2GU3A 1SIHA 1TFKA 1WQLB 4HM3B 2Z6BA 3OWYA 1WTHA 3LTCA 1RNTA 1BSAA 2KXGA 1GMPA 1YJN3
chains in the Genus database with same CATH topology
1C54A 2RBIA 4HAAA 1RCLA 3HOHA 1ZGXA 3DH2A 1BRGA 1BRSA 1RLSA 3D4AA 1FUTA 1GMRA 1BOXA 1PYLA 1LOWA 3D5IA 1MGRA 1UCIA 5GSPA 9RNTA 1DE3A 3AHWA 1X1XA 1B27A 4RNTA 1SARA 1UCJA 1LNIA 4GHOA 1BIRA 4HOHA 1BNRA 1HZ1A 1I0VA 1TTOA 1JBTA 1RGHA 1BRJA 1I2GA 1B2ZA 1BVIA 3A5EA 1FYSA 1AQZA 1FZUA 1RHLA 7RNTA 1FW7A 1BNIA 1GOUA 1BGSA 3BU4A 1RGGA 1BSCA 1I3FA 3RNTA 1RSNA 1GMQA 1UCKA 2HOHA 2KF4A 3AGNA 6GSPA 3D5GA 1GOVA 1BSBA 1G02A 2AADA 1R4YA 1UCLA 4BU4A 1RGAA 1B2UA 1DETA 2ZA4A 1I3IA 3WR2A 2C4BA 2KAAA 1RGKA 1BNJA 1I8VA 1BANA 1BNEA 2KF5A 2BIRA 2KF3A 1RGLA 1HYFA 2F4YA 3AHSA 3KCHA 1FUSA 1BNFA 5BIRA 1BUJA 3WHOA 7GSPA 3AGOA 1AY7A 1YGWA 1I70A 2KF6A 3DGYA 4GSPA 1RGCA 1TRPA 2F5MA 1RMSA 6RNTA 1RN1A 1TRQA 1PY3A 5RNTA 1A2PA 3BIRA 1X1WA 1RDSA 2F56A 3URPA 1GSPA 1BNSA 1BNGA 1BAOA 2F5WA 1IYYA 5HOHA 1JBRA 1YVSA 1GOYA 1I2FA 1B3SA 1LOVA 2RNTA 1T2IA 3SYUA 1BRNL 2GSPA 1JBSA 1B21A 1I2EA 1I0XA 1LOYA 1RCKA 3GSPA 1RGEA 4J5KA 1BU4A 1BSEA 1B2SA 8RNTA 5BU4A 3Q3FA 1Q9EA 1RGFA 1B20A 1LRAA 1X1YA 1X1UA 1BRHA 1B2XA 2SARA 1BRKA 1RNBA 2BU4A 4BIRA 1RTUA 2AAEA 1B2MA 1RN4A 1MGWA 1BSDA 1BRIA 1T2HA 1RNTA 1BSAA 1YNVX 1CH0A 1GMPA 4J5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C54 A;  2RBI A;  4HAA A;  1RCL A;  3HOH A;  1ZGX A;  3DH2 A;  1BRG A;  1BRS A;  1RLS A;  3D4A A;  1FUT A;  1GMR A;  1BOX A;  1PYL A;  1LOW A;  3D5I A;  1MGR A;  1UCI A;  5GSP A;  9RNT A;  1DE3 A;  3AHW A;  1X1X A;  1B27 A;  4RNT A;  1SAR A;  1UCJ A;  1LNI A;  4GHO A;  1BIR A;  4HOH A;  1BNR A;  1HZ1 A;  1I0V A;  1TTO A;  1JBT A;  1RGH A;  1BRJ A;  1I2G A;  1B2Z A;  1BVI A;  3A5E A;  1FYS A;  1AQZ A;  1FZU A;  1RHL A;  7RNT A;  1FW7 A;  1BNI A;  1GOU A;  1BGS A;  3BU4 A;  1RGG A;  1BSC A;  1I3F A;  3RNT A;  1RSN A;  1GMQ A;  1UCK A;  2HOH A;  2KF4 A;  3AGN A;  6GSP A;  3D5G A;  1GOV A;  1BSB A;  1G02 A;  2AAD A;  1R4Y A;  1UCL A;  4BU4 A;  1RGA A;  1B2U A;  1DET A;  2ZA4 A;  1I3I A;  3WR2 A;  2C4B A;  2KAA A;  1RGK A;  1BNJ A;  1I8V A;  1BAN A;  1BNE A;  2KF5 A;  2BIR A;  2KF3 A;  1RGL A;  1HYF A;  2F4Y A;  3AHS A;  3KCH A;  1FUS A;  1BNF A;  5BIR A;  1BUJ A;  3WHO A;  7GSP A;  3AGO A;  1AY7 A;  1YGW A;  1I70 A;  2KF6 A;  3DGY A;  4GSP A;  1RGC A;  1TRP A;  2F5M A;  1RMS A;  6RNT A;  1RN1 A;  1TRQ A;  1PY3 A;  5RNT A;  1A2P A;  3BIR A;  1X1W A;  1RDS A;  2F56 A;  3URP A;  1GSP A;  1BNS A;  1BNG A;  1BAO A;  2F5W A;  1IYY A;  5HOH A;  1JBR A;  1YVS A;  1GOY A;  1I2F A;  1B3S A;  1LOV A;  2RNT A;  1T2I A;  3SYU A;  1BRN L;  2GSP A;  1JBS A;  1B21 A;  1I2E A;  1I0X A;  1LOY A;  1RCK A;  3GSP A;  1RGE A;  4J5K A;  1BU4 A;  1BSE A;  1B2S A;  8RNT A;  5BU4 A;  3Q3F A;  1Q9E A;  1RGF A;  1B20 A;  1LRA A;  1X1Y A;  1X1U A;  1BRH A;  1B2X A;  2SAR A;  1BRK A;  1RNB A;  2BU4 A;  4BIR A;  1RTU A;  2AAE A;  1B2M A;  1RN4 A;  1MGW A;  1BSD A;  1BRI A;  1T2H A;  1RNT A;  1BSA A;  1YNV X;  1CH0 A;  1GMP A;  4J5G A; 
#chains in the Genus database with same CATH topology
 1AV4 A;  3IJE B;  3LT8 A;  5CF1 A;  1FGQ A;  1RCL A;  3UNL A;  3CMA 3;  3DH2 A;  1BRG A;  1BRS A;  1RLS A;  1V57 A;  1FUT A;  1GMR A;  3UB1 A;  4AKZ A;  1KC8 4;  4LGQ A;  3X42 A;  1EG9 B;  1MWS A;  3PXM A;  4WFO A;  4FCZ A;  1OF5 A;  2BNG A;  4CCV A;  1ZS7 A;  5EEO A;  4KVH A;  3CCS 3;  1X1X A;  2GXF A;  3JUP A;  2B24 B;  2Z76 A;  3SX1 A;  2XH9 A;  4H61 A;  3LH4 A;  4HM2 B;  3EQQ B;  3VGN A;  1W01 A;  4G1M B;  1KWI A;  2JDI H;  3S67 A;  1YI2 3;  1K8A 4;  3QRD A;  1JBT A;  3OXA A;  4MMZ B;  1BRJ A;  3FG1 A;  1B2Z A;  1BUQ A;  5IEO A;  1IYY A;  4N6O B;  1RHL A;  2CKF B;  3EB8 A;  1IVU A;  1UGI A;  4HM6 B;  4ZM8 A;  1FW7 A;  3SOY A;  2UGI A;  4WHA A;  3FSD A;  2SBL A;  3BND A;  4BTY A;  1Q42 A;  4H3U A;  1T5Y A;  4FCM A;  1T3B A;  1U5O A;  1UCK A;  1QAK A;  2F98 A;  2HOH A;  4JF8 A;  1TJD A;  2KF4 A;  3AGN A;  3HK4 A;  1G0T A;  6GSP A;  3F7S A;  2XSH B;  2OTL 3;  1ULI B;  4AEQ A;  1VQ4 3;  2AAD A;  2GBX B;  1DYU A;  3G16 A;  5AYR B;  4BU4 A;  3U1W A;  3U97 A;  5AIG A;  1DET A;  3WR2 A;  1I3I A;  4FCJ A;  5EVH A;  1W6Y A;  3DUK A;  3GZR A;  2KAA A;  3CPO A;  4WYK B;  5CXO A;  5HGR A;  2H0H A;  3PCS A;  1RGK A;  1Q81 4;  2PNC A;  4R9L A;  5KP3 A;  2R4I A;  2YFI B;  3NBR A;  4K1V A;  5FW5 A;  3NM2 A;  4CPK A;  2BO9 B;  1I8V A;  2CFL A;  2XRX B;  3WDG B;  1BAN A;  2C11 A;  1BNE A;  2E2U A;  2W56 A;  1QVF 2;  1IDP A;  4K90 B;  2P0X A;  3HX8 A;  1RGL A;  1W4N A;  2F4Y A;  3KN4 A;  3OWS A;  5AIH A;  5BIR A;  2C10 A;  1N5H A;  3WHO A;  5I97 A;  2KCD A;  1GD3 A;  3ECF A;  4RBN A;  2KF6 A;  1I70 A;  1M1X B;  1O7H B;  3SED A;  1GD4 A;  1CEW I;  1RGC A;  3BLZ A;  3PYJ A;  4HM0 B;  4HBR A;  6RNT A;  2CX1 A;  1RN1 A;  1PY3 A;  3OX9 A;  5JPP A;  1JB5 A;  1W2Z A;  2XEP A;  4R9K A;  1NB3 I;  4OVM A;  1Z1S A;  3T0U A;  3H51 A;  1X1W A;  3CCL 3;  1RDS A;  2MF7 A;  2W2C A;  3NQY A;  3URP A;  1Q40 B;  1GSP A;  3A76 A;  1BNS A;  2CK3 H;  3K63 A;  5AIF A;  4OUQ A;  2IYJ A;  3FGY A;  2LYX A;  1QVG 2;  2CWV A;  3F9S A;  4X2O A;  4EV5 A;  3CCR 3;  1GOY A;  1I2F A;  1ISK A;  2WGQ A;  2XR8 B;  1LOV A;  1JZO A;  1MWR A;  2ZL8 A;  1JRQ A;  1RN7 A;  4HM7 B;  2OCT A;  3F8H A;  4LMI A;  6STD A;  1I2E A;  3F14 A;  5IG5 A;  3GSP A;  3D3L A;  1IT7 A;  1B2S A;  2W9P A;  4L8O A;  2IUJ A;  5BU4 A;  4Q53 A;  4NPB A;  1N8Q A;  2Z7A A;  3I0Y A;  1E97 A;  2OWP A;  1Q7Y 4;  2K54 A;  3O8Y A;  3J7Y d;  2CWT A;  1N8R 4;  1B2M A;  3KKG A;  3LYG A;  1OGZ A;  5A0O B;  1VQK 3;  3EF8 A;  1BRI A;  1S5A A;  2CH9 A;  1T2H A;  3BB9 A;  3NXJ A;  2LQV A;  1QMA A;  2BT3 A;  2ZHX B;  4NHF A;  4J5G A;  4HJL B;  2P05 A;  1CH0 A;  2ML6 A;  2L1S A;  3PZW A;  1SQW A;  3LTA A;  2XF3 A;  4FR9 A;  1AVK A;  2F99 A;  1JZD A;  1TU5 A;  8CHO A;  2STD A;  4FMD A;  5AEU B;  3NBJ A;  1D6U A;  2ZDJ A;  1K41 A;  2UX0 A;  1MGR A;  3FKA A;  1VQQ A;  4HZB B;  3RGA A;  4BTW A;  9RNT A;  2P0M A;  4WYK A;  2WGO A;  1UW1 A;  5IEN A;  1NWW A;  1LNI A;  2A15 A;  1HZ1 A;  1I0V A;  1TTO A;  5IF6 A;  3WOE B;  1UUW B;  1FGT A;  4GB5 A;  1I2G A;  3FCS B;  3UJM A;  2I9W A;  1A2V A;  1TFO A;  5CK6 A;  1AQZ A;  2Z77 A;  2E2V A;  1ROA A;  3KSE D;  3RGR A;  1NB5 I;  3LXU X;  2CG0 A;  1BNI A;  2W6J H;  3IPT A;  3X41 A;  4O2H A;  3I55 3;  2YX9 A;  4BL2 A;  3GAX A;  2XSO B;  4N6V 0;  1V74 A;  1RSN A;  3RNT A;  1GY7 A;  1STD A;  1GMQ A;  3DGM A;  3CME 3;  3T8N A;  4HKV B;  3S28 A;  1CQS A;  2O9U X;  2W0Q A;  1O7M B;  2L4V A;  2Y74 A;  4HM8 B;  3G6E 3;  3CCQ 3;  2FGT A;  3JVC A;  4EV2 A;  1GY6 A;  3D5G A;  3QK9 A;  1G02 A;  5IW9 A;  1UCL A;  1OCV A;  1RGA A;  4XDV A;  1Q40 A;  3FG3 A;  3DGL A;  3FLJ A;  3SVA A;  1OAC A;  5JPU A;  2YFJ B;  1OPY A;  1Y4K A;  5BXQ A;  3MPH A;  3EX9 A;  1RRH A;  3CNM A;  3GZX B;  4BTX A;  5KP4 A;  3OWU A;  3H3H A;  3KCH A;  1FUS A;  3N9H A;  4JRF A;  1TUH A;  5IG3 A;  7GSP A;  5JBS A;  4O3V A;  1N9E A;  1YIJ 3;  1YGE A;  3NHX A;  1YGW A;  3DGY A;  3GRD A;  1VQ7 3;  3N54 B;  5LC7 A;  3NUV A;  1TRP A;  1KSI A;  5TGN A;  3X3Y A;  5EQL A;  1RMS A;  1FGO A;  4N6U A;  4CDL A;  2CFW A;  1NJI 4;  2K0M A;  3CD6 3;  3CCV 3;  4DKI A;  1VQ8 3;  1JKG B;  2KRT A;  2F86 B;  1A2P A;  1W7C A;  1KD1 4;  5M1A A;  1EKM A;  1RJO A;  3HI7 A;  4R4K A;  3WA2 X;  4PEJ A;  2B1X B;  5ELU A;  3DMC A;  3EBY A;  2F5W A;  1UDI I;  1NU3 A;  3FF2 A;  5ELJ A;  5HOH A;  1JBR A;  4WWU C;  4MMY B;  3K7C A;  4EW5 A;  1YVS A;  2H0G A;  3B7C A;  3B4P A;  1W2B 2;  3EN8 A;  2XFS A;  1L5G B;  1BRN L;  3JUN A;  1SJW A;  1MOL A;  2GSP A;  4KT3 B;  1B21 A;  1OUN A;  2WOF A;  1RCK A;  2BMQ B;  4LYL B;  7STD A;  2GEY A;  2QEX 3;  1M90 4;  8RNT A;  2O3O A;  1B20 A;  1LRA A;  4HVN A;  2WOH A;  3FH1 A;  4AKY A;  3CC4 3;  4FMA A;  1RNB A;  4KFF A;  4XDW A;  4L8P A;  3SXX A;  3ZFZ A;  2GU1 A;  2HMJ B;  3HII A;  2P09 A;  2GEX A;  2K3D A;  3JUO A;  3RDE A;  3NM7 A;  1QJG A;  3Q90 A;  3BNC A;  4ILF A;  1CYU A;  1YNV X;  1FGM A;  1S72 3;  2CX0 A;  2IA7 A;  2RFR A;  4N6N B;  3HZP A;  3G4S 3;  1C54 A;  4NRE A;  1DVD A;  5IER A;  1ZGX A;  3NV0 B;  1BOX A;  4U13 A;  1Q82 4;  1LOW A;  1IVX A;  2XFT A;  1CYV A;  3MHE A;  1J2B A;  1VZZ A;  3D5I A;  1O7W B;  2RCD A;  4CJN A;  1VQO 3;  3V99 A;  1D6Z A;  1UCI A;  3EHC A;  2W04 A;  1WMO A;  1EUI C;  1B27 A;  1LXE A;  2FNQ A;  2YFL B;  1SAR A;  1IQX A;  3WOD G;  1HKX A;  3X40 A;  1BIR A;  3F8X A;  4HOH A;  1BNR A;  2IMJ A;  3FG4 A;  5FGO A;  4EXR A;  3B4O A;  3A5E A;  2V1L A;  3EBT A;  1DMM A;  1FYS A;  1WMN A;  1OHS A;  2W03 A;  4LSO A;  1JJ2 2;  1JNQ A;  2Y73 A;  1GOU A;  1RGG A;  4IT7 A;  3PS8 A;  3EJV A;  5IG4 A;  1W00 A;  4EYC A;  1V58 A;  3PCR A;  1EQK A;  2CC3 A;  3EN1 B;  3SOA A;  5AYS C;  2INX A;  2OQE A;  2OOV A;  1JKG A;  1WMP A;  1GOV A;  4R80 A;  2ML5 A;  4N6M A;  1B2U A;  2P38 A;  2ZA4 A;  2HMN B;  4IPB A;  3KZT A;  3WA3 A;  3CPW 2;  1IVW A;  2HMK B;  3LTD A;  1W5Z A;  1A67 A;  3CCU 3;  4FMB A;  1BNJ A;  1E3V A;  3KII A;  3DM8 A;  2CHC A;  5M18 A;  1JV2 B;  3JUQ A;  2KF3 A;  1HYF A;  1IU7 A;  1E3R A;  4RNZ A;  1BNF A;  1BUJ A;  3UL5 A;  3NQZ A;  1VQ9 3;  4RNY A;  2D42 A;  3GWR A;  1R4C A;  1FUW A;  3SLU A;  1M9G A;  3G8Z A;  3S27 A;  1JB4 A;  1VQL 3;  2HMM B;  1AR0 A;  1O7G B;  5G2G A;  1LNH A;  3AMO B;  3DGN A;  4XBY A;  1TRQ A;  2R41 A;  1STF I;  3WOF B;  1F8N A;  1O7P B;  3NBB A;  3ER7 A;  4I5Q A;  4LEH A;  2QGU A;  2F56 A;  1QAF A;  1TP6 A;  1UUG B;  2OQE C;  2OOV C;  1BNG A;  1MWT A;  3E99 A;  3TDG A;  4EC6 A;  3GZB A;  5AEW B;  3D79 A;  3VF1 A;  4N6T A;  1K73 4;  4STD A;  3B8L A;  2H0I A;  2RNT A;  3KE7 A;  1T2I A;  5G1L A;  1ASK A;  3T8U A;  3CXC 2;  1YHQ 3;  3S5C A;  1YJW 3;  1DMQ A;  2FXT A;  3NV0 A;  3F7X A;  1JBS A;  1I0X A;  1LOY A;  1W6C A;  4TX4 A;  1YIT 3;  2CW9 A;  2GBW B;  1HU9 A;  1N9J A;  1RGE A;  2BMO B;  2CWU A;  2HMO B;  3D9R A;  2IY2 A;  1BSE A;  4J5K A;  4MJD A;  4L7K A;  4ORL A;  3LML A;  3PGB A;  1U8C B;  2BMR B;  2Q07 A;  1X1Y A;  1X1U A;  2QIY A;  1BRH A;  3X3X A;  4R1K A;  3F40 A;  4XBT A;  1IV9 A;  1BRK A;  1RTU A;  1RN4 A;  1VQN 3;  4KFD A;  3I56 3;  1W02 A;  5D82 A;  1IVV A;  3V92 A;  1M1K 4;  2BHM A;  5D83 A;  3CC2 3;  1GYB A;  5AII A;  1JN5 A;  1W6G A;  4J8T A;  4KZ1 A;  4EBG A;  1US1 A;  1ULJ B;  1NDO B;  1IV7 A;  5LC6 A;  2RSX A;  4O8S A;  5IEP A;  4MEI A;  1VQ5 3;  5CLK A;  2RBI A;  1A2K A;  4HAA A;  1UI8 A;  3HOH A;  4XBX A;  3VSY A;  1GS3 A;  4WP5 A;  4X2H A;  3D4A A;  3OV4 A;  4LZI A;  2HML B;  1MNL A;  1PYL A;  4HYZ A;  3UL6 A;  4BL3 A;  1N5P A;  1K28 A;  1UUV B;  3MWZ A;  4K1U A;  3ZG0 A;  3DZL A;  3LOY A;  3DGO A;  1DE3 A;  3FZW A;  5GSP A;  1UGH I;  3AHW A;  3BNE A;  4RNT A;  1PFP A;  2IUK A;  3L0R A;  5G1K A;  3M8C A;  2E2T A;  1LQG C;  1UCJ A;  3X3Z A;  4GHO A;  5AI1 A;  3K9M C;  1RGH A;  3Q1C A;  4XM4 A;  1BVI A;  2CIU A;  3JUM A;  1PU4 A;  1FZU A;  2J8X B;  7RNT A;  1D6Y A;  2M7O A;  3EC9 A;  3NX0 A;  1BGS A;  1RRL A;  1ZO2 A;  1VQP 3;  3BU4 A;  1BSC A;  2QA4 3;  1I3F A;  1YJ9 3;  5D81 A;  3G71 3;  3K0Z A;  2OTJ 3;  1IK3 A;  4QWT A;  1LOX A;  3AMO A;  1IT8 A;  3MKI A;  1EA2 A;  1LVN A;  3HIG A;  5BVB A;  1JB2 A;  5M19 A;  1BSB A;  1SPU A;  1AVL A;  1OF5 B;  1R4Y A;  2XGN A;  3G0K A;  3LT9 A;  4MMX B;  3MG1 A;  2CFG A;  2CG1 A;  4I4K A;  1Q7H A;  1Q86 4;  5STD A;  2C4B A;  2JQ5 A;  2XGL A;  3FF0 A;  3DY5 A;  4O02 B;  5DRE A;  1KQS 2;  1DMN A;  3K5T A;  1OH0 A;  3LTB A;  4HM5 B;  2KF5 A;  4HZ9 B;  2BIR A;  5CF2 A;  4N6L A;  1K9M 4;  2UUG C;  3AHS A;  1JN5 B;  1TIJ A;  4GL6 A;  3STD A;  1EEJ A;  3AGO A;  3ALA A;  3Q2P A;  1AY7 A;  2CFD A;  4GSP A;  1DVC A;  3CCJ 3;  1A90 A;  3KSP A;  1IQY A;  1SII A;  2CFK A;  3EE1 A;  3CC7 3;  2F5M A;  4OK0 A;  1ROV A;  3CCE 3;  4RZM A;  4J9A A;  1IQ8 A;  1LQM B;  4K61 A;  4HM4 B;  2PZV A;  5RNT A;  3BIR A;  3KFQ C;  3GZY B;  3ROB A;  3CCM 3;  1WNH A;  4KFE A;  1YVB I;  1BAO A;  5DRV A;  3S29 A;  4N3V A;  3N8B A;  2MC8 A;  1QAL A;  1B3S A;  2W56 B;  1NO3 A;  3MYT A;  4XB5 A;  3WMD A;  5KP1 A;  4HM1 B;  2W9Q A;  3SYU A;  1GY5 A;  1G96 A;  2D1W A;  3CU3 A;  2RGQ A;  3LZA A;  1FGR A;  2WO0 A;  1C7H A;  3DXO A;  3MSO A;  1O7N B;  1UI7 A;  3IMA B;  1BU4 A;  3BNB A;  3Q3F A;  1Q9E A;  1RGF A;  3ZG5 A;  1OHO A;  3CNX A;  5IG0 A;  1VQM 3;  1B2X A;  4FMC A;  3OW2 2;  1FA3 A;  3V98 A;  3MG2 A;  1VQ6 3;  2SAR A;  4IIA A;  1MWU A;  2BU4 A;  4BIR A;  2AAE A;  1RKY A;  1OGX A;  1MGW A;  1BSD A;  1ZX2 A;  3MG3 A;  1OHP A;  1NNV A;  2GU3 A;  1SIH A;  1TFK A;  1WQL B;  4HM3 B;  2Z6B A;  3OWY A;  1WTH A;  3LTC A;  1RNT A;  1BSA A;  2KXG A;  1GMP A;  1YJN 3; 
#chains in the Genus database with same CATH homology
 1C54 A;  2RBI A;  4HAA A;  1RCL A;  3HOH A;  1ZGX A;  3DH2 A;  1BRG A;  1BRS A;  1RLS A;  3D4A A;  1FUT A;  1GMR A;  1BOX A;  1PYL A;  1LOW A;  3D5I A;  1MGR A;  1UCI A;  5GSP A;  9RNT A;  1DE3 A;  3AHW A;  1X1X A;  1B27 A;  4RNT A;  1SAR A;  1UCJ A;  1LNI A;  4GHO A;  1BIR A;  4HOH A;  1BNR A;  1HZ1 A;  1I0V A;  1TTO A;  1JBT A;  1RGH A;  1BRJ A;  1I2G A;  1B2Z A;  1BVI A;  3A5E A;  1FYS A;  1AQZ A;  1FZU A;  1RHL A;  7RNT A;  1FW7 A;  1BNI A;  1GOU A;  1BGS A;  3BU4 A;  1RGG A;  1BSC A;  1I3F A;  3RNT A;  1RSN A;  1GMQ A;  1UCK A;  2HOH A;  2KF4 A;  3AGN A;  6GSP A;  3D5G A;  1GOV A;  1BSB A;  1G02 A;  2AAD A;  1R4Y A;  1UCL A;  4BU4 A;  1RGA A;  1B2U A;  1DET A;  2ZA4 A;  1I3I A;  3WR2 A;  2C4B A;  2KAA A;  1RGK A;  1BNJ A;  1I8V A;  1BAN A;  1BNE A;  2KF5 A;  2BIR A;  2KF3 A;  1RGL A;  1HYF A;  2F4Y A;  3AHS A;  3KCH A;  1FUS A;  1BNF A;  5BIR A;  1BUJ A;  3WHO A;  7GSP A;  3AGO A;  1AY7 A;  1YGW A;  1I70 A;  2KF6 A;  3DGY A;  4GSP A;  1RGC A;  1TRP A;  2F5M A;  1RMS A;  6RNT A;  1RN1 A;  1TRQ A;  1PY3 A;  5RNT A;  1A2P A;  3BIR A;  1X1W A;  1RDS A;  2F56 A;  3URP A;  1GSP A;  1BNS A;  1BNG A;  1BAO A;  2F5W A;  1IYY A;  5HOH A;  1JBR A;  1YVS A;  1GOY A;  1I2F A;  1B3S A;  1LOV A;  2RNT A;  1T2I A;  3SYU A;  1BRN L;  2GSP A;  1JBS A;  1B21 A;  1I2E A;  1I0X A;  1LOY A;  1RCK A;  3GSP A;  1RGE A;  4J5K A;  1BU4 A;  1BSE A;  1B2S A;  8RNT A;  5BU4 A;  3Q3F A;  1Q9E A;  1RGF A;  1B20 A;  1LRA A;  1X1Y A;  1X1U A;  1BRH A;  1B2X A;  2SAR A;  1BRK A;  1RNB A;  2BU4 A;  4BIR A;  1RTU A;  2AAE A;  1B2M A;  1RN4 A;  1MGW A;  1BSD A;  1BRI A;  1T2H A;  1RNT A;  1BSA A;  1YNV X;  1CH0 A;  1GMP A;  4J5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...