1BRKA

Barnase mutant with ile 96 replaced by ala
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
108
structure length
108
Chain Sequence
VINTFDGVADYLQTYHKLPDNYITKSEAQALGWVASKGNLADVAPGKSIGGDIFSNREGKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLAYKTTDHYQTFTKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARNASE
publication title Structural and energetic responses to cavity-creating mutations in hydrophobic cores: observation of a buried water molecule and the hydrophilic nature of such hydrophobic cavities.
pubmed doi rcsb
source organism Bacillus amyloliquefaciens
molecule tags Endonuclease
total genus 34
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature ec 3.1.27.-:
pdb deposition date 1995-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1brkA00
4RNTA 1BANA 1B2MA 1BRNL 1JBSA 1HYFA 1UCKA 3KCHA 3SYUA 1BRSA 1X1XA 1BSBA 1BNIA 1BRGA 1RGCA 3GSPA 9RNTA 3BU4A 4BU4A 1FYSA 2KAAA 1BU4A 1RGAA 1RGGA 1RHLA 1RNTA 1BNSA 1BNRA 1FZUA 1BAOA 3DGYA 1RGEA 1RSNA 2F5MA 2KF6A 1GOYA 6GSPA 1R4YA 3Q3FA 1UCJA 3D5IA 3D5GA 1B2UA 1T2HA 1AQZA 1I0VA 2SARA 3HOHA 1B21A 5HOHA 4J5GA 1GOUA 3AHSA 1I3FA 1BSEA 1B2ZA 3RNTA 1X1YA 1YGWA 2KF4A 2KF5A 5RNTA 1I2EA 1B20A 1DETA 2AAEA 1BNEA 1MGWA 4HOHA 1RN4A 2RNTA 1LOYA 1BRHA 1BSDA 2AADA 4BIRA 1IYYA 1I2GA 1BSAA 1TRQA 4GSPA 1Q9EA 1YVSA 1C54A 1DE3A 6RNTA 3AHWA 1RDSA 1B27A 1GMPA 1BNFA 1LOWA 1SARA 1RCLA 2F5WA 1JBTA 1B2XA 1B3SA 1PY3A 1RGKA 1BRKA 5BIRA 1FW7A 2RBIA 1I70A 4HAAA 1FUSA 1MGRA 1GSPA 1GMRA 3D4AA 1GMQA 4GHOA 1I8VA 1I2FA 1GOVA 2GSPA 1RLSA 1HZ1A 3DH2A 1BNJA 3BIRA 7RNTA 3AGOA 3WR2A 1BRJA 3AGNA 1JBRA 1BIRA 1I3IA 1RTUA 3URPA 1LNIA 1UCLA 3A5EA 2F56A 1BNGA 5GSPA 1T2IA 2KF3A 1BVIA 1LOVA 1BUJA 3WHOA 8RNTA 2BU4A 1BGSA 2F4YA 1RGHA 1X1WA 1RNBA 1CH0A 2C4BA 1BOXA 1LRAA 2HOHA 1I0XA 1RGLA 1UCIA 1BSCA 1RMSA 5BU4A 1B2SA 1A2PA 1RN1A 1TRPA 1RCKA 1BRIA 1ZGXA 2BIRA 1TTOA 1YNVX 2ZA4A 1RGFA 1G02A 1FUTA 7GSPA 1PYLA 1AY7A 1X1UA 4J5KA
chains in the Genus database with same CATH superfamily
4JRFA 2IA7A 2OCTA 1JZDA 3KKGA 4HZ9B 1IV7A 3VF1A 2HMLB 3ZG5A 3WODG 2Y74A 2Q07A 4N3VA 1HYFA 4X2HA 1UCKA 3SYUA 1SQWA 1STDA 1IQYA 4FCMA 3K7CA 3UNLA 1VQ43 3BLZA 4O2HA 2E2TA 1CYUA 1E3VA 1BRGA 1RGCA 2SBLA 3GSPA 1V57A 3PS8A 3SEDA 2UX0A 4XBYA 2GEYA 1BU4A 1RNTA 4H61A 1VQ63 1FZUA 1YJN3 1BAOA 4RNYA 1AR0A 2KF6A 4MMXB 1KSIA 4EYCA 3BNDA 3DGMA 1Q824 3Q3FA 4HM1B 1UCJA 3LTCA 1T2HA 1AQZA 2FNQA 3LTAA 3CCJ3 3AHSA 3Q2PA 3GZYB 1BSEA 1FGMA 3OV4A 1YGWA 2LQVA 2KF5A 5AEUB 1DETA 1DMQA 1JKGA 3FF0A 4MMYB 1ISKA 4HOHA 2J8XB 2Z7AA 1FGTA 1WTHA 3MG3A 3G6E3 1WMOA 3S27A 4L8OA 1IT7A 2GEXA 2GXFA 4EV5A 3ER7A 3S5CA 4FR9A 1BSDA 1E97A 2D42A 3HX8A 1BSAA 1TRQA 2ML5A 1U8CB 1W2ZA 1YVSA 4LYLB 1OGXA 1S5AA 2RFRA 2HMNB 1UUWB 2GU1A 3EJVA 1RDSA 4G1MB 3X3ZA 6RNTA 1GMPA 4HKVB 5AIGA 3OW22 1V74A 2F5WA 4N6OB 4R9KA 1YJ93 3JVCA 3K0ZA 3MKIA 1FA3A 1ROVA 3SVAA 4WP5A 1BRKA 1JN5B 3LH4A 2W03A 3F7SA 4HAAA 5IG0A 2CFGA 1GSPA 1GMRA 1EEJA 1WMNA 3FH1A 3V98A 1RRLA 2L4VA 4ZM8A 1KC84 3DH2A 5EQLA 1TU5A 1BNJA 1IK3A 1W7CA 2YFLB 1OHPA 1Q40A 2W6JH 2XFSA 2XF3A 5D82A 5AIFA 3SX1A 1QJGA 3WR2A 3PCRA 3GAXA 4NHFA 1BIRA 1I3IA 1LXEA 2H0HA 3CPW2 2P09A 1SIIA 2CFLA 3JUOA 3LXUX 3URPA 3MG1A 4QWTA 1W00A 1JB5A 1UCLA 1NU3A 1Z1SA 2K54A 3SOAA 1Q7Y4 1JKGB 2R4IA 3UJMA 3E99A 2F56A 3LZAA 3F7XA 3WHOA 3WOEB 1GYBA 1WQLB 3WOFB 4AKZA 2BU4A 1RJOA 2F4YA 3DMCA 2HMKB 4XBTA 1RGHA 3VGNA 2QIYA 2C4BA 1F8NA 1UUGB 1GD4A 1VQQA 5DRVA 2QEX3 4LMIA 1I0XA 1UCIA 1W01A 1NB3I 2Z77A 1LVNA 1DVCA 1TRPA 2BIRA 2L1SA 3MSOA 1TTOA 1YNVX 3F8HA 1RKYA 5IW9A 3S28A 4HM2B 2CWUA 3FKAA 1STFI 4BTYA 2O3OA 3EX9A 1YGEA 3CC43 1S723 3NBJA 1BRNL 1JBSA 4N6LA 5CF1A 1OHSA 2F98A 1AVLA 4I5QA 2BHMA 3T0UA 2QA43 1X1XA 1FGRA 1VQ83 4HM5B 1BSBA 4WHAA 1BNIA 2Z76A 3NXJA 3U1WA 1KWIA 4I4KA 3TDGA 2XFTA 3BU4A 4BTXA 5D83A 1GD3A 4FCZA 4XM4A 3KZTA 4FMBA 2HMJB 3HZPA 1IQ8A 2WGOA 1HKXA 1RGEA 1RSNA 2D1WA 1VQK3 1QVG2 1M904 1GOYA 1M1K4 3IJEB 1IQXA 4LGQA 1DYUA 1R4YA 3MWZA 1BUQA 3LT8A 3NQYA 3JUNA 2CG1A 2BMOB 4EXRA 2CK3H 2SARA 3ALAA 1B21A 3HOHA 3MYTA 3NX0A 1K9M4 1JJ22 1TFOA 1I3FA 1ULJB 3DXOA 1OUNA 2QGUA 3NV0B 1X1YA 2P05A 1I2EA 1JB4A 1B20A 1EKMA 1US1A 1R4CA 1LQGC 1NO3A 4IPBA 1K734 2AAEA 5I97A 1MWUA 3HK4A 3LTDA 4K1UA 1RN4A 2UUGC 4MJDA 4XB5A 4K61A 3ROBA 2K0MA 3A76A 1T5YA 3DUKA 2XGLA 2BO9B 3DM8A 3G713 3J7Yd 2W56A 3CME3 2XSOB 4EW5A 1I2GA 3CXC2 4HJLB 3I553 1Q9EA 4HBRA 3CCU3 2W2CA 4FCJA 3S67A 5IF6A 1QALA 2W04A 3EBYA 3X3YA 3OX9A 3CCE3 5G1KA 1RCLA 5HGRA 2CKFB 3JUQA 5ELJA 1ULIB 3FG3A 1IDPA 1W6GA 1PY3A 5BIRA 2RBIA 1I70A 1MWSA 1ZS7A 1MGRA 4HM8B 4KZ1A 4NPBA 3D4AA 3D3LA 3KIIA 3NM7A 4GHOA 5KP3A 1N5PA 1I2FA 4PEJA 1RLSA 2RCDA 3AMOA 1VQ73 3WA3A 1MNLA 3IMAB 4N6TA 1UUVB 1DMMA 3BIRA 4HM6B 1W2B2 5EEOA 2A15A 3EHCA 4IT7A 5JBSA 5IEPA 1ROAA 1JBRA 1D6YA 3GZXB 4FMCA 5M18A 1N8R4 3EF8A 2BNGA 2XGNA 1U5OA 1VQN3 1RTUA 7STDA 3HIIA 2CFKA 3A5EA 3G0KA 5GSPA 3GZRA 3CCV3 3O8YA 2P0MA 4OVMA 2MC8A 5G2GA 1RRHA 8CHOA 1RNBA 2F99A 1UW1A 3PYJA 2ZL8A 5ELUA 2OTJ3 1BOXA 1K41A 3G8ZA 1LRAA 4FMAA 4L8PA 5M19A 1A2KA 1YHQ3 1N5HA 1O7WB 4BTWA 1IT8A 3NQZA 1O7PB 1LQMB 1RMSA 2CHCA 3SOYA 3B4PA 4LZIA 5BU4A 1QVF2 1RN1A 1IV9A 2ZHXB 4TX4A 4EV2A 1EG9B 1RCKA 1TUHA 1ZGXA 2WO0A 3PZWA 4J9AA 2CX0A 1RGFA 3NHXA 1G02A 2PNCA 1J2BA 1LNHA 3KFQC 7GSPA 3SLUA 3CCM3 2W0QA 1AY7A 4GL6A 3STDA 3ZG0A 1A90A 1Q42A 4RNTA 3V92A 1BANA 3OWYA 3I563 1Q814 1B2MA 1KQS2 3FLJA 3MHEA 3BNBA 3B7CA 3MG2A 3RDEA 3K5TA 3KCHA 1JRQA 1BRSA 2BT3A 4ORLA 1TIJA 3UL6A 4XBXA 3MPHA 1O7NB 3FZWA 1T3BA 2PZVA 4KT3B 1C7HA 4BL2A 2B24B 1RGAA 2O9UX 4HM7B 1RHLA 4R80A 3RGAA 1CYVA 1K8A4 1VQ93 1BNRA 1O7MB 1OF5A 1NNVA 1FGQA 3DGYA 3G4S3 3G16A 2HMMB 3K63A 1E3RA 3F9SA 3BNCA 3N9HA 4LEHA 1WNHA 4N6V0 4K1VA 6GSPA 2CWTA 1JV2B 2GU3A 1B2UA 5HOHA 1I0VA 1JZOA 5IG4A 1DMNA 3RNTA 2LYXA 3QRDA 1QAKA 2KF4A 1IVUA 4HM0B 5IERA 2CC3A 1BNEA 4WYKA 1MGWA 5BXQA 4J5KA 3KSED 2XEPA 3KSPA 3M8CA 3I0YA 4KFEA 1Q40B 4R4KA 2UGIA 4RNZA 1LOYA 2WOHA 3FGYA 1BRHA 2WGQA 3EQQB 4RBNA 2AADA 3NBBA 1ASKA 1RN7A 5CLKA 1IYYA 2JQ5A 4U13A 1JB2A 2IYJA 2HMOB 2IY2A 4JF8A 1C54A 4EBGA 1NB5I 3AHWA 5FGOA 2ML6A 1B27A 1JNQA 1BNFA 2IMJA 3HI7A 1AV4A 1W02A 3DGLA 1O7HB 4K90B 3LMLA 1B2XA 1B3SA 3ZFZA 1RGKA 2CX1A 1G0TA 4O3VA 4AEQA 1VQM3 4HYZA 5JPUA 3F40A 2CFWA 3CC73 3WDGB 3X41A 1N9JA 1M9GA 2E2UA 1I8VA 4MEIA 1UI8A 1OF5B 2GBWB 1GOVA 2GSPA 2CH9A 5EVHA 1IVXA 1O7GB 3D9RA 1MWRA 2INXA 7RNTA 5JPPA 5IG3A 3F8XA 1IU7A 1VQP3 4STDA 3CC23 5AYSC 1FUWA 5KP4A 3H51A 1ZO2A 4EC6A 4KVHA 1VZZA 1IVVA 3QK9A 1LNIA 2C10A 4O02B 1GY5A 2BMQB 4WYKB 3V99A 2Y73A 1WMPA 2MF7A 1W6CA 4KFFA 2FXTA 3U97A 1G96A 3Q1CA 3FF2A 3Q90A 4FMDA 1BGSA 4R9LA 4BL3A 3F14A 1YIT3 3EC9A 1X1WA 1JN5A 3D79A 1CH0A 1D6ZA 3CU3A 3KN4A 1TFKA 5BVBA 1OPYA 3IPTA 3UL5A 4L7KA 2HOHA 4R1KA 5IEOA 2FGTA 2CIUA 3DZLA 1NWWA 2F86B 3CCL3 3OXAA 1B2SA 1A2PA 5D81A 5AEWB 1SIHA 1BRIA 4WWUC 5KP1A 3HIGA 4CDLA 1LOXA 1UDII 5AI1A 5IG5A 1RGGA 1EUIC 1X1UA 2GBXB 5STDA 2IUKA 3LTBA 4OUQA 2KRTA 3FSDA 2Z6BA 3CPOA 3NM2A 4XDVA 3WA2X 2H0IA 1HU9A 3LOYA 2W9QA 4ILFA 2OWPA 3DY5A 3FG1A 2JDIH 1UGIA 3X40A 3B4OA 3EN1B 3OWUA 2K3DA 9RNTA 2W9PA 3X3XA 2P0XA 4BU4A 2W56B 1FYSA 2KAAA 1MWTA 4LSOA 2V1LA 3EE1A 2RSXA 1BNSA 2IUJA 3GWRA 3S29A 2F5MA 4X2OA 1L5GB 1N9EA 5CK6A 1PU4A 3RGRA 3EN8A 3D5IA 2KCDA 3D5GA 4GB5A 4J5GA 1FGOA 2I9WA 1GOUA 2BMRB 2ZDJA 3JUMA 4MMZB 1B2ZA 1GY6A 1N8QA 1SPUA 5RNTA 3CNMA 2C11A 2E2VA 3DGNA 4KFDA 2OOVA 1MOLA 2YFJB 3AMOB 2RNTA 3NBRA 2OTL3 2WOFA 5LC7A 3CMA3 1QAFA 5LC6A 1YIJ3 3CCS3 4N6UA 3BNEA 2CG0A 3NUVA 1Q864 3LYGA 1EA2A 4BIRA 3ECFA 4CPKA 2P38A 2STDA 2XSHB 3GRDA 3K9MC 4GSPA 2XH9A 1W4NA 2RGQA 3OWSA 4HM4B 1VQO3 1CQSA 2OOVC 1M1XB 1Q7HA 1LOWA 1SARA 3LT9A 1VQL3 2YFIB 1JBTA 4XDWA 1UGHI 2M7OA 1YI23 1OHOA 5A0OB 4DKIA 1NJI4 1OGZA 4Q53A 1ZX2A 4NREA 5AYRB 5CF2A 2YX9A 3B8LA 1FW7A 1OACA 3N8BA 3EB8A 1FUSA 3NV0A 1OH0A 4O8SA 5DREA 5FW5A 3T8NA 1A2VA 1GMQA 1VQ53 4N6NB 1GS3A 4RZMA 4HZBB 1TJDA 3FG4A 1HZ1A 3VSYA 4N6MA 5M1AA 3JUPA 1W6YA 1V58A 5AIIA 5TGNA 4J8TA 2CFDA 3AGOA 4HM3B 1K28A 1W5ZA 1BRJA 3AGNA 5AIHA 5IENA 3X42A 3CNXA 1PFPA 1YVBI 3DGOA 3FCSB 2CW9A 4H3UA 4HVNA 1A67A 2XRXB 3PGBA 2OQEA 1QMAA 3UB1A 6STDA 1OCVA 2R41A 3WMDA 3CCQ3 3PCSA 1BNGA 1T2IA 2KF3A 1BVIA 1LOVA 3SXXA 1BUJA 1UI7A 1AVKA 1CEWI 3N54B 8RNTA 3PXMA 4IIAA 3CCR3 2KXGA 3KE7A 1DE3A 3L0RA 1GY7A 2XR8B 3T8UA 4OK0A 2H0GA 4WFOA 1D6UA 3GZBA 1SJWA 1Y4KA 1IVWA 1RGLA 1TP6A 2OQEC 4AKYA 1BSCA 5CXOA 1DVDA 3H3HA 3CD63 4CCVA 2B1XB 1YJW3 3BB9A 2ZA4A 1KD14 1NDOB 1FUTA 5G1LA 4CJNA 1EQKA 3EBTA 1PYLA 2CWVA
chains in the Genus database with same CATH topology
4RNTA 1BANA 1B2MA 1BRNL 1JBSA 1HYFA 1UCKA 3KCHA 3SYUA 1BRSA 1X1XA 1BSBA 1BNIA 1BRGA 1RGCA 3GSPA 9RNTA 3BU4A 4BU4A 1FYSA 2KAAA 1BU4A 1RGAA 1RGGA 1RHLA 1RNTA 1BNSA 1BNRA 1FZUA 1BAOA 3DGYA 1RGEA 1RSNA 2F5MA 2KF6A 1GOYA 6GSPA 1R4YA 3Q3FA 1UCJA 3D5IA 3D5GA 1B2UA 1T2HA 1AQZA 1I0VA 2SARA 3HOHA 1B21A 5HOHA 4J5GA 1GOUA 3AHSA 1I3FA 1BSEA 1B2ZA 3RNTA 1X1YA 1YGWA 2KF4A 2KF5A 5RNTA 1I2EA 1B20A 1DETA 2AAEA 1BNEA 1MGWA 4HOHA 1RN4A 2RNTA 1LOYA 1BRHA 1BSDA 2AADA 4BIRA 1IYYA 1I2GA 1BSAA 1TRQA 4GSPA 1Q9EA 1YVSA 1C54A 1DE3A 6RNTA 3AHWA 1RDSA 1B27A 1GMPA 1BNFA 1LOWA 1SARA 1RCLA 2F5WA 1JBTA 1B2XA 1B3SA 1PY3A 1RGKA 1BRKA 5BIRA 1FW7A 2RBIA 1I70A 4HAAA 1FUSA 1MGRA 1GSPA 1GMRA 3D4AA 1GMQA 4GHOA 1I8VA 1I2FA 1GOVA 2GSPA 1RLSA 1HZ1A 3DH2A 1BNJA 3BIRA 7RNTA 3AGOA 3WR2A 1BRJA 3AGNA 1JBRA 1BIRA 1I3IA 1RTUA 3URPA 1LNIA 1UCLA 3A5EA 2F56A 1BNGA 5GSPA 1T2IA 2KF3A 1BVIA 1LOVA 1BUJA 3WHOA 8RNTA 2BU4A 1BGSA 2F4YA 1RGHA 1X1WA 1RNBA 1CH0A 2C4BA 1BOXA 1LRAA 2HOHA 1I0XA 1RGLA 1UCIA 1BSCA 1RMSA 5BU4A 1B2SA 1A2PA 1RN1A 1TRPA 1RCKA 1BRIA 1ZGXA 2BIRA 1TTOA 1YNVX 2ZA4A 1RGFA 1G02A 1FUTA 7GSPA 1PYLA 1AY7A 1X1UA 4J5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RNT A;  1BAN A;  1B2M A;  1BRN L;  1JBS A;  1HYF A;  1UCK A;  3KCH A;  3SYU A;  1BRS A;  1X1X A;  1BSB A;  1BNI A;  1BRG A;  1RGC A;  3GSP A;  9RNT A;  3BU4 A;  4BU4 A;  1FYS A;  2KAA A;  1BU4 A;  1RGA A;  1RGG A;  1RHL A;  1RNT A;  1BNS A;  1BNR A;  1FZU A;  1BAO A;  3DGY A;  1RGE A;  1RSN A;  2F5M A;  2KF6 A;  1GOY A;  6GSP A;  1R4Y A;  3Q3F A;  1UCJ A;  3D5I A;  3D5G A;  1B2U A;  1T2H A;  1AQZ A;  1I0V A;  2SAR A;  3HOH A;  1B21 A;  5HOH A;  4J5G A;  1GOU A;  3AHS A;  1I3F A;  1BSE A;  1B2Z A;  3RNT A;  1X1Y A;  1YGW A;  2KF4 A;  2KF5 A;  5RNT A;  1I2E A;  1B20 A;  1DET A;  2AAE A;  1BNE A;  1MGW A;  4HOH A;  1RN4 A;  2RNT A;  1LOY A;  1BRH A;  1BSD A;  2AAD A;  4BIR A;  1IYY A;  1I2G A;  1BSA A;  1TRQ A;  4GSP A;  1Q9E A;  1YVS A;  1C54 A;  1DE3 A;  6RNT A;  3AHW A;  1RDS A;  1B27 A;  1GMP A;  1BNF A;  1LOW A;  1SAR A;  1RCL A;  2F5W A;  1JBT A;  1B2X A;  1B3S A;  1PY3 A;  1RGK A;  1BRK A;  5BIR A;  1FW7 A;  2RBI A;  1I70 A;  4HAA A;  1FUS A;  1MGR A;  1GSP A;  1GMR A;  3D4A A;  1GMQ A;  4GHO A;  1I8V A;  1I2F A;  1GOV A;  2GSP A;  1RLS A;  1HZ1 A;  3DH2 A;  1BNJ A;  3BIR A;  7RNT A;  3AGO A;  3WR2 A;  1BRJ A;  3AGN A;  1JBR A;  1BIR A;  1I3I A;  1RTU A;  3URP A;  1LNI A;  1UCL A;  3A5E A;  2F56 A;  1BNG A;  5GSP A;  1T2I A;  2KF3 A;  1BVI A;  1LOV A;  1BUJ A;  3WHO A;  8RNT A;  2BU4 A;  1BGS A;  2F4Y A;  1RGH A;  1X1W A;  1RNB A;  1CH0 A;  2C4B A;  1BOX A;  1LRA A;  2HOH A;  1I0X A;  1RGL A;  1UCI A;  1BSC A;  1RMS A;  5BU4 A;  1B2S A;  1A2P A;  1RN1 A;  1TRP A;  1RCK A;  1BRI A;  1ZGX A;  2BIR A;  1TTO A;  1YNV X;  2ZA4 A;  1RGF A;  1G02 A;  1FUT A;  7GSP A;  1PYL A;  1AY7 A;  1X1U A;  4J5K A; 
#chains in the Genus database with same CATH topology
 4JRF A;  2IA7 A;  2OCT A;  1JZD A;  3KKG A;  4HZ9 B;  1IV7 A;  3VF1 A;  2HML B;  3ZG5 A;  3WOD G;  2Y74 A;  2Q07 A;  4N3V A;  1HYF A;  4X2H A;  1UCK A;  3SYU A;  1SQW A;  1STD A;  1IQY A;  4FCM A;  3K7C A;  3UNL A;  1VQ4 3;  3BLZ A;  4O2H A;  2E2T A;  1CYU A;  1E3V A;  1BRG A;  1RGC A;  2SBL A;  3GSP A;  1V57 A;  3PS8 A;  3SED A;  2UX0 A;  4XBY A;  2GEY A;  1BU4 A;  1RNT A;  4H61 A;  1VQ6 3;  1FZU A;  1YJN 3;  1BAO A;  4RNY A;  1AR0 A;  2KF6 A;  4MMX B;  1KSI A;  4EYC A;  3BND A;  3DGM A;  1Q82 4;  3Q3F A;  4HM1 B;  1UCJ A;  3LTC A;  1T2H A;  1AQZ A;  2FNQ A;  3LTA A;  3CCJ 3;  3AHS A;  3Q2P A;  3GZY B;  1BSE A;  1FGM A;  3OV4 A;  1YGW A;  2LQV A;  2KF5 A;  5AEU B;  1DET A;  1DMQ A;  1JKG A;  3FF0 A;  4MMY B;  1ISK A;  4HOH A;  2J8X B;  2Z7A A;  1FGT A;  1WTH A;  3MG3 A;  3G6E 3;  1WMO A;  3S27 A;  4L8O A;  1IT7 A;  2GEX A;  2GXF A;  4EV5 A;  3ER7 A;  3S5C A;  4FR9 A;  1BSD A;  1E97 A;  2D42 A;  3HX8 A;  1BSA A;  1TRQ A;  2ML5 A;  1U8C B;  1W2Z A;  1YVS A;  4LYL B;  1OGX A;  1S5A A;  2RFR A;  2HMN B;  1UUW B;  2GU1 A;  3EJV A;  1RDS A;  4G1M B;  3X3Z A;  6RNT A;  1GMP A;  4HKV B;  5AIG A;  3OW2 2;  1V74 A;  2F5W A;  4N6O B;  4R9K A;  1YJ9 3;  3JVC A;  3K0Z A;  3MKI A;  1FA3 A;  1ROV A;  3SVA A;  4WP5 A;  1BRK A;  1JN5 B;  3LH4 A;  2W03 A;  3F7S A;  4HAA A;  5IG0 A;  2CFG A;  1GSP A;  1GMR A;  1EEJ A;  1WMN A;  3FH1 A;  3V98 A;  1RRL A;  2L4V A;  4ZM8 A;  1KC8 4;  3DH2 A;  5EQL A;  1TU5 A;  1BNJ A;  1IK3 A;  1W7C A;  2YFL B;  1OHP A;  1Q40 A;  2W6J H;  2XFS A;  2XF3 A;  5D82 A;  5AIF A;  3SX1 A;  1QJG A;  3WR2 A;  3PCR A;  3GAX A;  4NHF A;  1BIR A;  1I3I A;  1LXE A;  2H0H A;  3CPW 2;  2P09 A;  1SII A;  2CFL A;  3JUO A;  3LXU X;  3URP A;  3MG1 A;  4QWT A;  1W00 A;  1JB5 A;  1UCL A;  1NU3 A;  1Z1S A;  2K54 A;  3SOA A;  1Q7Y 4;  1JKG B;  2R4I A;  3UJM A;  3E99 A;  2F56 A;  3LZA A;  3F7X A;  3WHO A;  3WOE B;  1GYB A;  1WQL B;  3WOF B;  4AKZ A;  2BU4 A;  1RJO A;  2F4Y A;  3DMC A;  2HMK B;  4XBT A;  1RGH A;  3VGN A;  2QIY A;  2C4B A;  1F8N A;  1UUG B;  1GD4 A;  1VQQ A;  5DRV A;  2QEX 3;  4LMI A;  1I0X A;  1UCI A;  1W01 A;  1NB3 I;  2Z77 A;  1LVN A;  1DVC A;  1TRP A;  2BIR A;  2L1S A;  3MSO A;  1TTO A;  1YNV X;  3F8H A;  1RKY A;  5IW9 A;  3S28 A;  4HM2 B;  2CWU A;  3FKA A;  1STF I;  4BTY A;  2O3O A;  3EX9 A;  1YGE A;  3CC4 3;  1S72 3;  3NBJ A;  1BRN L;  1JBS A;  4N6L A;  5CF1 A;  1OHS A;  2F98 A;  1AVL A;  4I5Q A;  2BHM A;  3T0U A;  2QA4 3;  1X1X A;  1FGR A;  1VQ8 3;  4HM5 B;  1BSB A;  4WHA A;  1BNI A;  2Z76 A;  3NXJ A;  3U1W A;  1KWI A;  4I4K A;  3TDG A;  2XFT A;  3BU4 A;  4BTX A;  5D83 A;  1GD3 A;  4FCZ A;  4XM4 A;  3KZT A;  4FMB A;  2HMJ B;  3HZP A;  1IQ8 A;  2WGO A;  1HKX A;  1RGE A;  1RSN A;  2D1W A;  1VQK 3;  1QVG 2;  1M90 4;  1GOY A;  1M1K 4;  3IJE B;  1IQX A;  4LGQ A;  1DYU A;  1R4Y A;  3MWZ A;  1BUQ A;  3LT8 A;  3NQY A;  3JUN A;  2CG1 A;  2BMO B;  4EXR A;  2CK3 H;  2SAR A;  3ALA A;  1B21 A;  3HOH A;  3MYT A;  3NX0 A;  1K9M 4;  1JJ2 2;  1TFO A;  1I3F A;  1ULJ B;  3DXO A;  1OUN A;  2QGU A;  3NV0 B;  1X1Y A;  2P05 A;  1I2E A;  1JB4 A;  1B20 A;  1EKM A;  1US1 A;  1R4C A;  1LQG C;  1NO3 A;  4IPB A;  1K73 4;  2AAE A;  5I97 A;  1MWU A;  3HK4 A;  3LTD A;  4K1U A;  1RN4 A;  2UUG C;  4MJD A;  4XB5 A;  4K61 A;  3ROB A;  2K0M A;  3A76 A;  1T5Y A;  3DUK A;  2XGL A;  2BO9 B;  3DM8 A;  3G71 3;  3J7Y d;  2W56 A;  3CME 3;  2XSO B;  4EW5 A;  1I2G A;  3CXC 2;  4HJL B;  3I55 3;  1Q9E A;  4HBR A;  3CCU 3;  2W2C A;  4FCJ A;  3S67 A;  5IF6 A;  1QAL A;  2W04 A;  3EBY A;  3X3Y A;  3OX9 A;  3CCE 3;  5G1K A;  1RCL A;  5HGR A;  2CKF B;  3JUQ A;  5ELJ A;  1ULI B;  3FG3 A;  1IDP A;  1W6G A;  1PY3 A;  5BIR A;  2RBI A;  1I70 A;  1MWS A;  1ZS7 A;  1MGR A;  4HM8 B;  4KZ1 A;  4NPB A;  3D4A A;  3D3L A;  3KII A;  3NM7 A;  4GHO A;  5KP3 A;  1N5P A;  1I2F A;  4PEJ A;  1RLS A;  2RCD A;  3AMO A;  1VQ7 3;  3WA3 A;  1MNL A;  3IMA B;  4N6T A;  1UUV B;  1DMM A;  3BIR A;  4HM6 B;  1W2B 2;  5EEO A;  2A15 A;  3EHC A;  4IT7 A;  5JBS A;  5IEP A;  1ROA A;  1JBR A;  1D6Y A;  3GZX B;  4FMC A;  5M18 A;  1N8R 4;  3EF8 A;  2BNG A;  2XGN A;  1U5O A;  1VQN 3;  1RTU A;  7STD A;  3HII A;  2CFK A;  3A5E A;  3G0K A;  5GSP A;  3GZR A;  3CCV 3;  3O8Y A;  2P0M A;  4OVM A;  2MC8 A;  5G2G A;  1RRH A;  8CHO A;  1RNB A;  2F99 A;  1UW1 A;  3PYJ A;  2ZL8 A;  5ELU A;  2OTJ 3;  1BOX A;  1K41 A;  3G8Z A;  1LRA A;  4FMA A;  4L8P A;  5M19 A;  1A2K A;  1YHQ 3;  1N5H A;  1O7W B;  4BTW A;  1IT8 A;  3NQZ A;  1O7P B;  1LQM B;  1RMS A;  2CHC A;  3SOY A;  3B4P A;  4LZI A;  5BU4 A;  1QVF 2;  1RN1 A;  1IV9 A;  2ZHX B;  4TX4 A;  4EV2 A;  1EG9 B;  1RCK A;  1TUH A;  1ZGX A;  2WO0 A;  3PZW A;  4J9A A;  2CX0 A;  1RGF A;  3NHX A;  1G02 A;  2PNC A;  1J2B A;  1LNH A;  3KFQ C;  7GSP A;  3SLU A;  3CCM 3;  2W0Q A;  1AY7 A;  4GL6 A;  3STD A;  3ZG0 A;  1A90 A;  1Q42 A;  4RNT A;  3V92 A;  1BAN A;  3OWY A;  3I56 3;  1Q81 4;  1B2M A;  1KQS 2;  3FLJ A;  3MHE A;  3BNB A;  3B7C A;  3MG2 A;  3RDE A;  3K5T A;  3KCH A;  1JRQ A;  1BRS A;  2BT3 A;  4ORL A;  1TIJ A;  3UL6 A;  4XBX A;  3MPH A;  1O7N B;  3FZW A;  1T3B A;  2PZV A;  4KT3 B;  1C7H A;  4BL2 A;  2B24 B;  1RGA A;  2O9U X;  4HM7 B;  1RHL A;  4R80 A;  3RGA A;  1CYV A;  1K8A 4;  1VQ9 3;  1BNR A;  1O7M B;  1OF5 A;  1NNV A;  1FGQ A;  3DGY A;  3G4S 3;  3G16 A;  2HMM B;  3K63 A;  1E3R A;  3F9S A;  3BNC A;  3N9H A;  4LEH A;  1WNH A;  4N6V 0;  4K1V A;  6GSP A;  2CWT A;  1JV2 B;  2GU3 A;  1B2U A;  5HOH A;  1I0V A;  1JZO A;  5IG4 A;  1DMN A;  3RNT A;  2LYX A;  3QRD A;  1QAK A;  2KF4 A;  1IVU A;  4HM0 B;  5IER A;  2CC3 A;  1BNE A;  4WYK A;  1MGW A;  5BXQ A;  4J5K A;  3KSE D;  2XEP A;  3KSP A;  3M8C A;  3I0Y A;  4KFE A;  1Q40 B;  4R4K A;  2UGI A;  4RNZ A;  1LOY A;  2WOH A;  3FGY A;  1BRH A;  2WGQ A;  3EQQ B;  4RBN A;  2AAD A;  3NBB A;  1ASK A;  1RN7 A;  5CLK A;  1IYY A;  2JQ5 A;  4U13 A;  1JB2 A;  2IYJ A;  2HMO B;  2IY2 A;  4JF8 A;  1C54 A;  4EBG A;  1NB5 I;  3AHW A;  5FGO A;  2ML6 A;  1B27 A;  1JNQ A;  1BNF A;  2IMJ A;  3HI7 A;  1AV4 A;  1W02 A;  3DGL A;  1O7H B;  4K90 B;  3LML A;  1B2X A;  1B3S A;  3ZFZ A;  1RGK A;  2CX1 A;  1G0T A;  4O3V A;  4AEQ A;  1VQM 3;  4HYZ A;  5JPU A;  3F40 A;  2CFW A;  3CC7 3;  3WDG B;  3X41 A;  1N9J A;  1M9G A;  2E2U A;  1I8V A;  4MEI A;  1UI8 A;  1OF5 B;  2GBW B;  1GOV A;  2GSP A;  2CH9 A;  5EVH A;  1IVX A;  1O7G B;  3D9R A;  1MWR A;  2INX A;  7RNT A;  5JPP A;  5IG3 A;  3F8X A;  1IU7 A;  1VQP 3;  4STD A;  3CC2 3;  5AYS C;  1FUW A;  5KP4 A;  3H51 A;  1ZO2 A;  4EC6 A;  4KVH A;  1VZZ A;  1IVV A;  3QK9 A;  1LNI A;  2C10 A;  4O02 B;  1GY5 A;  2BMQ B;  4WYK B;  3V99 A;  2Y73 A;  1WMP A;  2MF7 A;  1W6C A;  4KFF A;  2FXT A;  3U97 A;  1G96 A;  3Q1C A;  3FF2 A;  3Q90 A;  4FMD A;  1BGS A;  4R9L A;  4BL3 A;  3F14 A;  1YIT 3;  3EC9 A;  1X1W A;  1JN5 A;  3D79 A;  1CH0 A;  1D6Z A;  3CU3 A;  3KN4 A;  1TFK A;  5BVB A;  1OPY A;  3IPT A;  3UL5 A;  4L7K A;  2HOH A;  4R1K A;  5IEO A;  2FGT A;  2CIU A;  3DZL A;  1NWW A;  2F86 B;  3CCL 3;  3OXA A;  1B2S A;  1A2P A;  5D81 A;  5AEW B;  1SIH A;  1BRI A;  4WWU C;  5KP1 A;  3HIG A;  4CDL A;  1LOX A;  1UDI I;  5AI1 A;  5IG5 A;  1RGG A;  1EUI C;  1X1U A;  2GBX B;  5STD A;  2IUK A;  3LTB A;  4OUQ A;  2KRT A;  3FSD A;  2Z6B A;  3CPO A;  3NM2 A;  4XDV A;  3WA2 X;  2H0I A;  1HU9 A;  3LOY A;  2W9Q A;  4ILF A;  2OWP A;  3DY5 A;  3FG1 A;  2JDI H;  1UGI A;  3X40 A;  3B4O A;  3EN1 B;  3OWU A;  2K3D A;  9RNT A;  2W9P A;  3X3X A;  2P0X A;  4BU4 A;  2W56 B;  1FYS A;  2KAA A;  1MWT A;  4LSO A;  2V1L A;  3EE1 A;  2RSX A;  1BNS A;  2IUJ A;  3GWR A;  3S29 A;  2F5M A;  4X2O A;  1L5G B;  1N9E A;  5CK6 A;  1PU4 A;  3RGR A;  3EN8 A;  3D5I A;  2KCD A;  3D5G A;  4GB5 A;  4J5G A;  1FGO A;  2I9W A;  1GOU A;  2BMR B;  2ZDJ A;  3JUM A;  4MMZ B;  1B2Z A;  1GY6 A;  1N8Q A;  1SPU A;  5RNT A;  3CNM A;  2C11 A;  2E2V A;  3DGN A;  4KFD A;  2OOV A;  1MOL A;  2YFJ B;  3AMO B;  2RNT A;  3NBR A;  2OTL 3;  2WOF A;  5LC7 A;  3CMA 3;  1QAF A;  5LC6 A;  1YIJ 3;  3CCS 3;  4N6U A;  3BNE A;  2CG0 A;  3NUV A;  1Q86 4;  3LYG A;  1EA2 A;  4BIR A;  3ECF A;  4CPK A;  2P38 A;  2STD A;  2XSH B;  3GRD A;  3K9M C;  4GSP A;  2XH9 A;  1W4N A;  2RGQ A;  3OWS A;  4HM4 B;  1VQO 3;  1CQS A;  2OOV C;  1M1X B;  1Q7H A;  1LOW A;  1SAR A;  3LT9 A;  1VQL 3;  2YFI B;  1JBT A;  4XDW A;  1UGH I;  2M7O A;  1YI2 3;  1OHO A;  5A0O B;  4DKI A;  1NJI 4;  1OGZ A;  4Q53 A;  1ZX2 A;  4NRE A;  5AYR B;  5CF2 A;  2YX9 A;  3B8L A;  1FW7 A;  1OAC A;  3N8B A;  3EB8 A;  1FUS A;  3NV0 A;  1OH0 A;  4O8S A;  5DRE A;  5FW5 A;  3T8N A;  1A2V A;  1GMQ A;  1VQ5 3;  4N6N B;  1GS3 A;  4RZM A;  4HZB B;  1TJD A;  3FG4 A;  1HZ1 A;  3VSY A;  4N6M A;  5M1A A;  3JUP A;  1W6Y A;  1V58 A;  5AII A;  5TGN A;  4J8T A;  2CFD A;  3AGO A;  4HM3 B;  1K28 A;  1W5Z A;  1BRJ A;  3AGN A;  5AIH A;  5IEN A;  3X42 A;  3CNX A;  1PFP A;  1YVB I;  3DGO A;  3FCS B;  2CW9 A;  4H3U A;  4HVN A;  1A67 A;  2XRX B;  3PGB A;  2OQE A;  1QMA A;  3UB1 A;  6STD A;  1OCV A;  2R41 A;  3WMD A;  3CCQ 3;  3PCS A;  1BNG A;  1T2I A;  2KF3 A;  1BVI A;  1LOV A;  3SXX A;  1BUJ A;  1UI7 A;  1AVK A;  1CEW I;  3N54 B;  8RNT A;  3PXM A;  4IIA A;  3CCR 3;  2KXG A;  3KE7 A;  1DE3 A;  3L0R A;  1GY7 A;  2XR8 B;  3T8U A;  4OK0 A;  2H0G A;  4WFO A;  1D6U A;  3GZB A;  1SJW A;  1Y4K A;  1IVW A;  1RGL A;  1TP6 A;  2OQE C;  4AKY A;  1BSC A;  5CXO A;  1DVD A;  3H3H A;  3CD6 3;  4CCV A;  2B1X B;  1YJW 3;  3BB9 A;  2ZA4 A;  1KD1 4;  1NDO B;  1FUT A;  5G1L A;  4CJN A;  1EQK A;  3EBT A;  1PYL A;  2CWV A; 
#chains in the Genus database with same CATH homology
 4RNT A;  1BAN A;  1B2M A;  1BRN L;  1JBS A;  1HYF A;  1UCK A;  3KCH A;  3SYU A;  1BRS A;  1X1X A;  1BSB A;  1BNI A;  1BRG A;  1RGC A;  3GSP A;  9RNT A;  3BU4 A;  4BU4 A;  1FYS A;  2KAA A;  1BU4 A;  1RGA A;  1RGG A;  1RHL A;  1RNT A;  1BNS A;  1BNR A;  1FZU A;  1BAO A;  3DGY A;  1RGE A;  1RSN A;  2F5M A;  2KF6 A;  1GOY A;  6GSP A;  1R4Y A;  3Q3F A;  1UCJ A;  3D5I A;  3D5G A;  1B2U A;  1T2H A;  1AQZ A;  1I0V A;  2SAR A;  3HOH A;  1B21 A;  5HOH A;  4J5G A;  1GOU A;  3AHS A;  1I3F A;  1BSE A;  1B2Z A;  3RNT A;  1X1Y A;  1YGW A;  2KF4 A;  2KF5 A;  5RNT A;  1I2E A;  1B20 A;  1DET A;  2AAE A;  1BNE A;  1MGW A;  4HOH A;  1RN4 A;  2RNT A;  1LOY A;  1BRH A;  1BSD A;  2AAD A;  4BIR A;  1IYY A;  1I2G A;  1BSA A;  1TRQ A;  4GSP A;  1Q9E A;  1YVS A;  1C54 A;  1DE3 A;  6RNT A;  3AHW A;  1RDS A;  1B27 A;  1GMP A;  1BNF A;  1LOW A;  1SAR A;  1RCL A;  2F5W A;  1JBT A;  1B2X A;  1B3S A;  1PY3 A;  1RGK A;  1BRK A;  5BIR A;  1FW7 A;  2RBI A;  1I70 A;  4HAA A;  1FUS A;  1MGR A;  1GSP A;  1GMR A;  3D4A A;  1GMQ A;  4GHO A;  1I8V A;  1I2F A;  1GOV A;  2GSP A;  1RLS A;  1HZ1 A;  3DH2 A;  1BNJ A;  3BIR A;  7RNT A;  3AGO A;  3WR2 A;  1BRJ A;  3AGN A;  1JBR A;  1BIR A;  1I3I A;  1RTU A;  3URP A;  1LNI A;  1UCL A;  3A5E A;  2F56 A;  1BNG A;  5GSP A;  1T2I A;  2KF3 A;  1BVI A;  1LOV A;  1BUJ A;  3WHO A;  8RNT A;  2BU4 A;  1BGS A;  2F4Y A;  1RGH A;  1X1W A;  1RNB A;  1CH0 A;  2C4B A;  1BOX A;  1LRA A;  2HOH A;  1I0X A;  1RGL A;  1UCI A;  1BSC A;  1RMS A;  5BU4 A;  1B2S A;  1A2P A;  1RN1 A;  1TRP A;  1RCK A;  1BRI A;  1ZGX A;  2BIR A;  1TTO A;  1YNV X;  2ZA4 A;  1RGF A;  1G02 A;  1FUT A;  7GSP A;  1PYL A;  1AY7 A;  1X1U A;  4J5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...