4K90B

Extracellular metalloproteinase from aspergillus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
207
Chain Sequence
b'TVDLNAFRLKSLAKYVNATETVIEAPSPQSYVEVATQHVKMIAPDATFRVVDDHYVGDNGVAHVHFRQTANGLDIDNADFNVNVGKDGKVFSYGNSFYTGQIPSSAALTKRDFSDPVTALKGTTNTLQLPITVDSASSESTKESYVFKGVSGTVSDPKAKLVYFVKDDGTLALAWRVETDIDSNWLLTYIDAKSGEEIHGVVDYVAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Extracellular metalloproteinase mep
publication title A functional and structural study of the major metalloprotease secreted by the pathogenic fungus Aspergillus fumigatus.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
total genus 46
structure length 207
sequence length 215
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k90B00
3NQZA 3NQYA 4K90B
chains in the Genus database with same CATH superfamily
3EC9A 3CCR3 3RGAA 3CCV3 2HMJB 3UJMA 3OWUA 1QAKA 1O7NB 3JUQA 3KIIA 1WQLB 3OX9A 4O02B 4HM7B 1HYFA 4RZMA 2IUKA 4EC6A 2CW9A 2CWVA 1V57A 2B1XB 2YFLB 3GZYB 4N6OB 1YJ93 1JBTA 1RGCA 1X1YA 1K734 2XGNA 1GMQA 1N8QA 4BL2A 1ASKA 4FCMA 2KF4A 1BSAA 1EEJA 1BSBA 2CG0A 2YX9A 2RFRA 2UUGC 2Z76A 4EV2A 3BNEA 2H0GA 3KCHA 3RDEA 1GY7A 2QIYA 4PEJA 1FZUA 3CME3 4KT3B 4O3VA 2FXTA 3QRDA 1VQM3 2BT3A 2K0MA 3LT9A 7STDA 4N6TA 1W02A 1J2BA 1JNQA 3BIRA 4N6UA 1BNFA 1GOYA 5EQLA 1T3BA 2ZHXB 3JUMA 4HM2B 3URPA 1B2MA 1GMRA 3LTCA 1GD4A 5BIRA 4KFDA 2O9UX 3LYGA 4GSPA 1BNGA 3RNTA 1BGSA 2CWUA 1JJ22 2B24B 1YGEA 3PYJA 5D83A 2RBIA 2CH9A 4WP5A 3VF1A 1S5AA 1TUHA 4R9LA 2Y74A 2C10A 1W6YA 3WOEB 4K61A 3K5TA 4DKIA 3U97A 1RGFA 1UGHI 1B2SA 3HK4A 3EB8A 3DXOA 3EF8A 1BNRA 1ZO2A 1RCLA 3GZRA 4LGQA 1FGTA 3BB9A 4RNZA 1VQL3 1YI23 3K9MC 2XF3A 4HM4B 1G0TA 3HIGA 3CC23 3CC43 2AADA 1BU4A 4R1KA 1FUSA 4XBTA 1W7CA 1YIJ3 3T8NA 2CK3H 1L5GB 1RHLA 1VQ93 2XEPA 3LT8A 3A5EA 5JBSA 3D79A 3U1WA 5EVHA 2W0QA 1LQMB 1I8VA 2BIRA 2F86B 2H0HA 2QA43 1NNVA 1K28A 2SBLA 3NX0A 3EN1B 3ZFZA 4AEQA 1IQXA 4R4KA 3PCSA 3A76A 2KCDA 3HI7A 4HYZA 4X2OA 1W2B2 5FGOA 4KFFA 4U13A 5G2GA 5KP4A 5A0OB 4GB5A 3EQQB 1GYBA 2Z77A 4HM8B 3ROBA 1BRKA 3LTDA 1VQ63 1Y4KA 2WOHA 1VQ43 5AIGA 2CFKA 4RNTA 3NQZA 1O7PB 1JN5B 2OQEA 4R9KA 1GMPA 4HM5B 1GY5A 1W6CA 2P38A 4G1MB 3F8HA 5CF1A 1BSCA 1UCJA 3V99A 2Z6BA 1TU5A 2XRXB 4BTYA 1JKGB 1Z1SA 1RCKA 2I9WA 1DMMA 4OVMA 3K63A 1B2UA 3PZWA 3BU4A 2D42A 2ZL8A 4HM1B 5HOHA 3CCJ3 2W2CA 1JN5A 2BNGA 1LOXA 1UW1A 2XH9A 3L0RA 1DVDA 4EXRA 5DREA 3B4PA 1W00A 2IY2A 3D3LA 5M19A 3HIIA 3OWYA 2HMOB 1NB3I 4XDVA 3JUNA 3CCL3 1JKGA 3GRDA 1N5HA 1QALA 1SIIA 3SOYA 2KAAA 3DY5A 3DGLA 3HX8A 1AVLA 1B2ZA 1CH0A 2OQEC 2F98A 3LH4A 3CMA3 1BRJA 3PGBA 2WGOA 5JPUA 1Q7Y4 1ZGXA 2ZDJA 3B8LA 4QWTA 1QVG2 1KWIA 3NM7A 4MEIA 5IF6A 1ROAA 3F40A 3KFQC 1JZDA 2P09A 5AI1A 2ML6A 2R41A 1M904 1BIRA 3UNLA 5D82A 2ZA4A 1BSEA 1W5ZA 3KSPA 1OHSA 1T5YA 3G6E3 1PY3A 1UI8A 4KVHA 1D6YA 3TDGA 3OXAA 5AIFA 1JB2A 3BNBA 1FUWA 3X3ZA 3FH1A 4CPKA 2C11A 1OF5B 2HMKB 1A2VA 3FSDA 1RN4A 1TIJA 3EE1A 3CNMA 4N3VA 2LQVA 1N9JA 2L4VA 1WMOA 3AGNA 3F8XA 3BNDA 1W01A 4LZIA 4EBGA 2D1WA 1MWRA 2GBXB 3DGOA 1Q814 4XDWA 1RKYA 5BU4A 4KZ1A 1IU7A 5LC7A 5CF2A 1VQN3 1MWUA 4IIAA 1K41A 3EX9A 1IVXA 3BNCA 3K0ZA 3MG2A 2BMOB 1BVIA 3N54B 4I5QA 4NREA 4O8SA 3SEDA 3AMOB 3UL5A 3X42A 1NJI4 1RNTA 5JPPA 3PS8A 3WOFB 1UUWB 1ISKA 3NUVA 2E2VA 1NDOB 1KD14 1TFKA 1WMPA 1BNSA 3EBYA 1FGQA 3FKAA 3I553 4NHFA 3WHOA 1Q864 5CXOA 1W4NA 1VQK3 2MC8A 2HMLB 3FG3A 3DM8A 3IPTA 2W56B 4HAAA 1TFOA 3NQYA 3S67A 1PFPA 5HGRA 1NB5I 1YIT3 1CQSA 2E2TA 1O7MB 3AMOA 3FLJA 3F7XA 2QEX3 1E3VA 3LXUX 3X3YA 2CG1A 3X3XA 3CPOA 3GWRA 5IEOA 2IMJA 2WGQA 1OPYA 1YJW3 4K1VA 2KF3A 2BO9B 3FF2A 1IQYA 2KXGA 3ZG5A 1JB5A 1V74A 3STDA 1A90A 1M1K4 1MOLA 4FMDA 1TRQA 1RRHA 2GBWB 1VQO3 2W56A 1IT8A 4ILFA 1D6UA 1Q824 4WHAA 1RGEA 4RBNA 2Q07A 1B3SA 3JUPA 4N6MA 5IG5A 1LOWA 1RDSA 1NO3A 1M1XB 1BRSA 3IMAB 4WYKB 2YFIB 4FCZA 4EYCA 1BNEA 3D5GA 4CJNA 1BRIA 3GZXB 2GSPA 4J5GA 1ZS7A 3MG3A 3ZG0A 1MWSA 1RLSA 1N8R4 2BMRB 3AHSA 2GU1A 2OCTA 2STDA 1GOVA 3S27A 3CNXA 3VGNA 3X41A 2XSHB 1I2EA 2F4YA 3F14A 4I4KA 4XM4A 4WYKA 4XB5A 3JVCA 1VQP3 1DVCA 4L8PA 1FYSA 3EHCA 3MG1A 1DMNA 3D9RA 1VZZA 1W6GA 1K9M4 4FMBA 3KKGA 1R4YA 1I2GA 2CFWA 4HJLB 4BL3A 3N8BA 5G1LA 2GXFA 3FGYA 3O8YA 1U5OA 3CU3A 2W9QA 4L7KA 5IENA 3MKIA 1LQGC 2L1SA 3NXJA 3BLZA 2CX0A 4OUQA 3MPHA 4TX4A 1X1XA 1DMQA 4NPBA 1TRPA 1UCIA 1FGRA 2P0XA 4R80A 4XBXA 1IVVA 5AIIA 1D6ZA 4N6V0 3MHEA 1SPUA 3HOHA 1KC84 2K54A 3LZAA 1EKMA 3CCS3 1IV9A 1I0VA 4HVNA 3S28A 2CFDA 2GEYA 1FGMA 2UGIA 1SJWA 2KF6A 3F9SA 1CEWI 3OWSA 1MGRA 5RNTA 2R4IA 2RNTA 1VQ53 1FA3A 1LXEA 4HM6B 1FW7A 2ML5A 1O7HB 4LYLB 2P0MA 3G713 5M1AA 1EG9B 3CXC2 1C7HA 2BHMA 4MJDA 3G0KA 4IPBA 1M9GA 1F8NA 3WODG 3DZLA 1ZX2A 2IUJA 3SVAA 4AKYA 4EV5A 2F5WA 2QGUA 3GSPA 1OUNA 1RTUA 5EEOA 2P05A 3AGOA 3NV0B 3V98A 4J8TA 1WTHA 3AHWA 1MNLA 4HZBB 1O7WB 3FCSB 3NBBA 2KRTA 4MMZB 1B20A 4KFEA 1IT7A 3JUOA 1TP6A 1ULIB 1WMNA 1B27A 1X1WA 1QVF2 1W2ZA 1JBSA 1JBRA 1OCVA 1DETA 5ELUA 4BU4A 4H3UA 1GOUA 1OACA 4CCVA 3NV0A 5IW9A 4J9AA 2OTL3 1BRNL 2HMNB 1UCLA 4GL6A 4L8OA 3KE7A 2YFJB 4OK0A 1OH0A 3VSYA 3CC73 3PCRA 2MF7A 5AYRB 3Q3FA 1VQ73 1UGIA 3DUKA 3NBRA 1N9EA 2CFGA 5BXQA 1LVNA 1BNJA 3M8CA 1ROVA 1T2IA 1ULJB 6RNTA 4J5KA 1A67A 3Q90A 1OF5A 3D5IA 1BRHA 3ER7A 2CFLA 1STFI 1OGXA 4ORLA 4JRFA 3WA3A 3CD63 3DH2A 1V58A 3I0YA 1MWTA 2PNCA 1A2KA 2JDIH 1YVSA 2RGQA 2HMMB 3MWZA 2OOVA 4WFOA 1IDPA 1YJN3 1UCKA 2RSXA 1IK3A 4FMAA 2J8XB 1UI7A 1JZOA 1AVKA 1TJDA 1QAFA 2E2UA 4MMXB 3OW22 2F56A 3DGMA 4Q53A 5AIHA 3DGYA 3FZWA 7RNTA 1BUJA 3K7CA 2OTJ3 1Q40B 3NHXA 3SOAA 2XSOB 1OHPA 1X1UA 2XFTA 4N6NB 5AYSC 3WMDA 3B4OA 3LTAA 4LMIA 5KP1A 5FW5A 1HZ1A 3FG1A 1AQZA 1US1A 4N6LA 1GY6A 1GSPA 1LOYA 4STDA 3J7Yd 5LC6A 4MMYB 1YHQ3 1DE3A 3HZPA 1B21A 3H51A 3PXMA 1GD3A 1I70A 2WOFA 2W6JH 1VQ83 3ALAA 8RNTA 2INXA 1VQQA 3SYUA 2WO0A 1Q40A 2O3OA 1G02A 2JQ5A 3FG4A 3H3HA 2OOVC 1IVWA 1A2PA 3LMLA 3IJEB 4BTXA 1R4CA 2OWPA 2F99A 4K90B 3EJVA 1UDII 5STDA 5AEWB 1I3FA 3FF0A 1RGGA 1IV7A 3NM2A 1O7GB 3RGRA 1YGWA 1JB4A 2A15A 1C54A 5G1KA 1GS3A 4RNYA 2M7OA 1IQ8A 1OHOA 3E99A 1G96A 3X40A 5TGNA 1I3IA 1OGZA 2RCDA 3DGNA 4FCJA 2IYJA 2CHCA 2XR8B 1QJGA 4EW5A 1HU9A 3G4S3 1BNIA 1UUGB 1FUTA 2Z7AA 1RGKA 1RJOA 4X2HA 4K1UA 5ELJA 7GSPA 5IG0A 3I563 2CX1A 2W9PA 3T8UA 3F7SA 5AEUB 1IYYA 6STDA 1RSNA 4O2HA 4WWUC 1JV2B 3V92A 1NU3A 2IA7A 5IG4A 5D81A 3N9HA 1Q7HA 5IERA 3Q1CA 3B7CA 4BIRA 3CPW2 1MGWA 1LNIA 2BU4A 3Q2PA 1JRQA 1TTOA 2LYXA 1LNHA 2CKFB 2SARA 1Q9EA 4XBYA 1YVBI 1AR0A 5KP3A 3CCM3 5BVBA 1B2XA 1LRAA 6GSPA 1U8CB 3LOYA 5CK6A 1SARA 2KF5A 1SIHA 2BMQB 4HM3B 2W04A 3LTBA 8CHOA 1KQS2 3KN4A 1UUVB 1BRGA 9RNTA 1DYUA 1RGAA 3KZTA 2CC3A 3GAXA 3MYTA 2W03A 4FR9A 4IT7A 3D4AA 4HZ9B 3CCU3 1CYUA 5I97A 3WA2X 1EQKA 1QMAA 1YNVX 1STDA 2CIUA 1T2HA 2V1LA 1RGLA 3NBJA 3SX1A 4LSOA 3UB1A 3WR2A 4AKZA 1N5PA 5M18A 1BUQA 3EN8A 2F5MA 3T0UA 3EBTA 1NWWA 1AV4A 2K3DA 1E97A 1S723 4ZM8A 3SXXA 1E3RA 1BAOA 1HKXA 3WDGB 1IVUA 2C4BA 2PZVA 2XGLA 1KSIA 3GZBA 4HBRA 1RRLA 4HM0B 1Q42A 2FNQA 4LEHA 1I0XA 1RN1A 3DMCA 3CCE3 1EA2A 1SQWA 3G8ZA 3OV4A 4HKVB 1RGHA 1BOXA 1WNHA 3KSED 3MSOA 4JF8A 5CLKA 4FMCA 1RN7A 1CYVA 1PYLA 4GHOA 3S5CA 4BTWA 1BSDA 2CWTA 2XFSA 1LOVA 3ECFA 3G16A 1RNBA 1BANA 1I2FA 4HOHA 3CCQ3 2H0IA 2GU3A 1FGOA 2FGTA 1EUIC 4CDLA 4H61A 5IG3A 1K8A4 1PU4A 5IEPA 5GSPA 2Y73A 3S29A 2HOHA 2UX0A 1RMSA 3QK9A 5DRVA 3UL6A 1AY7A 2AAEA 2GEXA 3SLUA
chains in the Genus database with same CATH topology
3EC9A 3CCR3 3RGAA 3CCV3 2HMJB 3UJMA 3OWUA 1QAKA 1O7NB 3JUQA 3KIIA 1WQLB 3OX9A 4O02B 4HM7B 4RZMA 2IUKA 4EC6A 2CW9A 2CWVA 2B1XB 3GZYB 2YFLB 4N6OB 1YJ93 1K734 2XGNA 1N8QA 1ASKA 4FCMA 2Z76A 4EV2A 2CG0A 2YX9A 2RFRA 3BNEA 3RDEA 1GY7A 2QIYA 4PEJA 3CME3 4O3VA 2FXTA 3QRDA 1VQM3 2BT3A 2K0MA 3LT9A 7STDA 4N6TA 1W02A 1J2BA 1JNQA 4N6UA 5EQLA 3JUMA 4HM2B 3LTCA 1GD4A 4KFDA 2O9UX 3LYGA 1JJ22 2CWUA 2B24B 1YGEA 3PYJA 5D83A 2CH9A 4WP5A 3VF1A 1S5AA 1TUHA 4R9LA 2Y74A 2C10A 1W6YA 3WOEB 4K61A 3K5TA 3U97A 3HK4A 3EB8A 3DXOA 3EF8A 1ZO2A 3GZRA 4LGQA 1FGTA 3BB9A 4RNZA 1VQL3 1YI23 3K9MC 2XF3A 4HM4B 3HIGA 3CC23 3CC43 4R1KA 4XBTA 1W7CA 1YIJ3 3T8NA 2CK3H 1L5GB 1VQ93 2XEPA 3LT8A 5JBSA 3U1WA 5EVHA 2W0QA 2F86B 2QA43 1K28A 2SBLA 3NX0A 3EN1B 4AEQA 1IQXA 4R4KA 3PCSA 3A76A 2KCDA 3HI7A 4HYZA 4X2OA 1W2B2 5FGOA 4KFFA 4U13A 5G2GA 5KP4A 5A0OB 4GB5A 3EQQB 1GYBA 2Z77A 4HM8B 3ROBA 3LTDA 1VQ63 1Y4KA 2WOHA 1VQ43 5AIGA 2CFKA 3NQZA 1O7PB 1JN5B 2OQEA 4R9KA 4HM5B 1GY5A 1W6CA 2P38A 4G1MB 3F8HA 5CF1A 3V99A 2Z6BA 1TU5A 2XRXB 4BTYA 1JKGB 1Z1SA 2I9WA 1DMMA 4OVMA 3K63A 3PZWA 2D42A 2ZL8A 4HM1B 3CCJ3 2W2CA 1JN5A 2BNGA 1LOXA 1UW1A 2XH9A 3L0RA 1DVDA 4EXRA 5DREA 3B4PA 1W00A 3D3LA 3HIIA 3OWYA 2HMOB 1NB3I 4XDVA 3JUNA 3CCL3 1JKGA 3GRDA 1N5HA 1QALA 1SIIA 3SOYA 3DY5A 3DGLA 3HX8A 1AVLA 2OQEC 2F98A 3LH4A 3CMA3 3PGBA 2WGOA 5JPUA 1Q7Y4 2ZDJA 3B8LA 4QWTA 1QVG2 1KWIA 3NM7A 4MEIA 5IF6A 1ROAA 3F40A 3KFQC 2P09A 5AI1A 1M904 2ML6A 3UNLA 5D82A 1W5ZA 3KSPA 1OHSA 1T5YA 1UI8A 4KVHA 1D6YA 3TDGA 3OXAA 5AIFA 1JB2A 3BNBA 1FUWA 3X3ZA 3FH1A 2C11A 1OF5B 2HMKB 1A2VA 3FSDA 4N3VA 1TIJA 3EE1A 3CNMA 2LQVA 1N9JA 2L4VA 1WMOA 3F8XA 3BNDA 1W01A 4LZIA 4EBGA 2D1WA 2GBXB 1Q814 3DGOA 4XDWA 1RKYA 4KZ1A 1IU7A 5LC7A 5CF2A 1VQN3 4IIAA 1K41A 3EX9A 1IVXA 3BNCA 3K0ZA 3MG2A 2BMOB 3N54B 4NREA 4O8SA 3UL5A 3SEDA 3AMOB 3X42A 1NJI4 5JPPA 3PS8A 3WOFB 1UUWB 1ISKA 3NUVA 2E2VA 1NDOB 1KD14 1TFKA 1WMPA 3EBYA 1FGQA 3FKAA 3I553 4NHFA 1Q864 5CXOA 1W4NA 1VQK3 2MC8A 2HMLB 3FG3A 3DM8A 3IPTA 2W56B 1NB5I 1TFOA 3NQYA 3S67A 1PFPA 5HGRA 1YIT3 1CQSA 2E2TA 1O7MB 3AMOA 3FLJA 3F7XA 2QEX3 1E3VA 3LXUX 3X3YA 2CG1A 3X3XA 3CPOA 3GWRA 5IEOA 2IMJA 2WGQA 1OPYA 1YJW3 4K1VA 2BO9B 3FF2A 1IQYA 2KXGA 1JB5A 1V74A 3STDA 1A90A 1M1K4 1MOLA 4FMDA 1VQO3 1RRHA 2GBWB 1Q824 2W56A 1IT8A 1D6UA 4WHAA 4RBNA 2Q07A 3JUPA 4N6MA 5IG5A 1NO3A 1M1XB 3IMAB 4WYKB 2YFIB 4FCZA 4EYCA 3GZXB 3MG3A 1N8R4 2BMRB 2GU1A 2OCTA 2STDA 3S27A 3VGNA 3CNXA 3X41A 2XSHB 3F14A 4I4KA 4XM4A 4WYKA 4XB5A 3JVCA 1VQP3 1DVCA 4L8PA 3EHCA 3MG1A 1DMNA 3D9RA 1VZZA 1W6GA 1K9M4 4FMBA 3KKGA 2CFWA 4HJLB 3N8BA 2GXFA 3FGYA 3O8YA 1U5OA 3CU3A 2W9QA 4L7KA 5IENA 3MKIA 3NXJA 3BLZA 4OUQA 3MPHA 4TX4A 1DMQA 1FGRA 2P0XA 4R80A 4XBXA 1IVVA 5AIIA 1D6ZA 4N6V0 3MHEA 1SPUA 1KC84 2K54A 3LZAA 1EKMA 3CCS3 1IV9A 4HVNA 3S28A 2CFDA 2GEYA 1FGMA 1SJWA 3F9SA 1CEWI 3OWSA 2R4IA 1VQ53 1FA3A 1LXEA 4HM6B 2ML5A 1O7HB 2P0MA 3G713 1EG9B 3CXC2 1C7HA 2BHMA 4MJDA 3G0KA 4IPBA 1M9GA 1F8NA 3WODG 3DZLA 1ZX2A 2IUJA 3SVAA 4AKYA 4EV5A 2QGUA 1OUNA 5EEOA 2P05A 3NV0B 3V98A 4J8TA 1WTHA 4HZBB 1MNLA 4MMZB 1O7WB 3FCSB 3NBBA 2KRTA 4KFEA 1IT7A 3JUOA 1TP6A 1ULIB 1WMNA 1QVF2 1W2ZA 1OCVA 5ELUA 4CCVA 4H3UA 1OACA 5IW9A 3NV0A 4J9AA 2OTL3 2HMNB 4GL6A 4L8OA 3KE7A 2YFJB 4OK0A 1OH0A 3VSYA 3CC73 3PCRA 2MF7A 5AYRB 1VQ73 3DUKA 3NBRA 1N9EA 2CFGA 5BXQA 1LVNA 3M8CA 1ROVA 1ULJB 1A67A 3Q90A 1OF5A 3ER7A 2CFLA 1STFI 1OGXA 4ORLA 4JRFA 3WA3A 3CD63 3I0YA 3MWZA 2OOVA 2PNCA 1A2KA 2JDIH 2RGQA 2HMMB 1YJN3 4WFOA 1IDPA 2RSXA 1IK3A 4FMAA 1UI7A 1AVKA 1QAFA 2E2UA 4MMXB 3OW22 3DGMA 4Q53A 5AIHA 3FZWA 3K7CA 2OTJ3 1Q40B 3NHXA 3SOAA 2XSOB 1OHPA 5AYSC 2XFTA 4N6NB 3WMDA 3B4OA 3LTAA 4LMIA 5KP1A 5FW5A 3FG1A 1US1A 4N6LA 4STDA 1GY6A 3J7Yd 5LC6A 4MMYB 1YHQ3 3HZPA 3H51A 3PXMA 1GD3A 2WOFA 2W6JH 1VQ83 3ALAA 2INXA 2WO0A 1Q40A 2O3OA 2JQ5A 3FG4A 3H3HA 2OOVC 1IVWA 3LMLA 3IJEB 4BTXA 1R4CA 2OWPA 2F99A 4K90B 3EJVA 5STDA 5AEWB 3FF0A 1IV7A 3NM2A 1O7GB 3RGRA 1JB4A 2A15A 1GS3A 4RNYA 2M7OA 1IQ8A 1OHOA 3E99A 1G96A 3X40A 5TGNA 1OGZA 2RCDA 3DGNA 4FCJA 2CHCA 2XR8B 1QJGA 1HU9A 3G4S3 2Z7AA 1RJOA 4X2HA 4K1UA 5ELJA 5IG0A 3I563 2W9PA 3T8UA 3F7SA 5AEUB 6STDA 4O2HA 4WWUC 1JV2B 3V92A 1NU3A 2IA7A 5IG4A 5D81A 3N9HA 5IERA 3Q1CA 3B7CA 3CPW2 3Q2PA 1JRQA 2LYXA 1LNHA 2CKFB 4XBYA 1YVBI 1AR0A 5KP3A 3CCM3 5BVBA 1U8CB 3LOYA 5CK6A 1SIHA 2BMQB 4HM3B 2W04A 3LTBA 8CHOA 1KQS2 3KN4A 1UUVB 1DYUA 3KZTA 2CC3A 3GAXA 3MYTA 2W03A 4FR9A 4IT7A 4HZ9B 3CCU3 1CYUA 5I97A 3WA2X 1EQKA 1QMAA 1STDA 2CIUA 2V1LA 3NBJA 3SX1A 3UB1A 4LSOA 4AKZA 1BUQA 1N5PA 3EN8A 3T0UA 3EBTA 1NWWA 1AV4A 1E97A 1S723 4ZM8A 3SXXA 1E3RA 1HKXA 3WDGB 1IVUA 2PZVA 2XGLA 1KSIA 3GZBA 4HBRA 1RRLA 4HM0B 1Q42A 2FNQA 4LEHA 3DMCA 3CCE3 1EA2A 1SQWA 3G8ZA 3OV4A 4HKVB 1WNHA 3KSED 3MSOA 4JF8A 5CLKA 4FMCA 1RN7A 1CYVA 4BTWA 3G6E3 3S5CA 2CWTA 2XFSA 3ECFA 3G16A 3CCQ3 2GU3A 1FGOA 2FGTA 4CDLA 5IG3A 4H61A 1K8A4 1PU4A 5IEPA 2Y73A 3S29A 2UX0A 3QK9A 5DRVA 3UL6A 2GEXA 3SLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQZ A;  3NQY A;  4K90 B; 
#chains in the Genus database with same CATH topology
 3EC9 A;  3CCR 3;  3RGA A;  3CCV 3;  2HMJ B;  3UJM A;  3OWU A;  1QAK A;  1O7N B;  3JUQ A;  3KII A;  1WQL B;  3OX9 A;  4O02 B;  4HM7 B;  1HYF A;  4RZM A;  2IUK A;  4EC6 A;  2CW9 A;  2CWV A;  1V57 A;  2B1X B;  2YFL B;  3GZY B;  4N6O B;  1YJ9 3;  1JBT A;  1RGC A;  1X1Y A;  1K73 4;  2XGN A;  1GMQ A;  1N8Q A;  4BL2 A;  1ASK A;  4FCM A;  2KF4 A;  1BSA A;  1EEJ A;  1BSB A;  2CG0 A;  2YX9 A;  2RFR A;  2UUG C;  2Z76 A;  4EV2 A;  3BNE A;  2H0G A;  3KCH A;  3RDE A;  1GY7 A;  2QIY A;  4PEJ A;  1FZU A;  3CME 3;  4KT3 B;  4O3V A;  2FXT A;  3QRD A;  1VQM 3;  2BT3 A;  2K0M A;  3LT9 A;  7STD A;  4N6T A;  1W02 A;  1J2B A;  1JNQ A;  3BIR A;  4N6U A;  1BNF A;  1GOY A;  5EQL A;  1T3B A;  2ZHX B;  3JUM A;  4HM2 B;  3URP A;  1B2M A;  1GMR A;  3LTC A;  1GD4 A;  5BIR A;  4KFD A;  2O9U X;  3LYG A;  4GSP A;  1BNG A;  3RNT A;  1BGS A;  2CWU A;  1JJ2 2;  2B24 B;  1YGE A;  3PYJ A;  5D83 A;  2RBI A;  2CH9 A;  4WP5 A;  3VF1 A;  1S5A A;  1TUH A;  4R9L A;  2Y74 A;  2C10 A;  1W6Y A;  3WOE B;  4K61 A;  3K5T A;  4DKI A;  3U97 A;  1RGF A;  1UGH I;  1B2S A;  3HK4 A;  3EB8 A;  3DXO A;  3EF8 A;  1BNR A;  1ZO2 A;  1RCL A;  3GZR A;  4LGQ A;  1FGT A;  3BB9 A;  4RNZ A;  1VQL 3;  1YI2 3;  3K9M C;  2XF3 A;  4HM4 B;  1G0T A;  3HIG A;  3CC2 3;  3CC4 3;  2AAD A;  1BU4 A;  4R1K A;  1FUS A;  4XBT A;  1W7C A;  1YIJ 3;  3T8N A;  2CK3 H;  1L5G B;  1RHL A;  1VQ9 3;  2XEP A;  3LT8 A;  3A5E A;  5JBS A;  3D79 A;  3U1W A;  5EVH A;  2W0Q A;  1LQM B;  1I8V A;  2BIR A;  2F86 B;  2H0H A;  2QA4 3;  1NNV A;  1K28 A;  2SBL A;  3NX0 A;  3EN1 B;  3ZFZ A;  4AEQ A;  1IQX A;  4R4K A;  3PCS A;  3A76 A;  2KCD A;  3HI7 A;  4HYZ A;  4X2O A;  1W2B 2;  5FGO A;  4KFF A;  4U13 A;  5G2G A;  5KP4 A;  5A0O B;  4GB5 A;  3EQQ B;  1GYB A;  2Z77 A;  4HM8 B;  3ROB A;  1BRK A;  3LTD A;  1VQ6 3;  1Y4K A;  2WOH A;  1VQ4 3;  5AIG A;  2CFK A;  4RNT A;  3NQZ A;  1O7P B;  1JN5 B;  2OQE A;  4R9K A;  1GMP A;  4HM5 B;  1GY5 A;  1W6C A;  2P38 A;  4G1M B;  3F8H A;  5CF1 A;  1BSC A;  1UCJ A;  3V99 A;  2Z6B A;  1TU5 A;  2XRX B;  4BTY A;  1JKG B;  1Z1S A;  1RCK A;  2I9W A;  1DMM A;  4OVM A;  3K63 A;  1B2U A;  3PZW A;  3BU4 A;  2D42 A;  2ZL8 A;  4HM1 B;  5HOH A;  3CCJ 3;  2W2C A;  1JN5 A;  2BNG A;  1LOX A;  1UW1 A;  2XH9 A;  3L0R A;  1DVD A;  4EXR A;  5DRE A;  3B4P A;  1W00 A;  2IY2 A;  3D3L A;  5M19 A;  3HII A;  3OWY A;  2HMO B;  1NB3 I;  4XDV A;  3JUN A;  3CCL 3;  1JKG A;  3GRD A;  1N5H A;  1QAL A;  1SII A;  3SOY A;  2KAA A;  3DY5 A;  3DGL A;  3HX8 A;  1AVL A;  1B2Z A;  1CH0 A;  2OQE C;  2F98 A;  3LH4 A;  3CMA 3;  1BRJ A;  3PGB A;  2WGO A;  5JPU A;  1Q7Y 4;  1ZGX A;  2ZDJ A;  3B8L A;  4QWT A;  1QVG 2;  1KWI A;  3NM7 A;  4MEI A;  5IF6 A;  1ROA A;  3F40 A;  3KFQ C;  1JZD A;  2P09 A;  5AI1 A;  2ML6 A;  2R41 A;  1M90 4;  1BIR A;  3UNL A;  5D82 A;  2ZA4 A;  1BSE A;  1W5Z A;  3KSP A;  1OHS A;  1T5Y A;  3G6E 3;  1PY3 A;  1UI8 A;  4KVH A;  1D6Y A;  3TDG A;  3OXA A;  5AIF A;  1JB2 A;  3BNB A;  1FUW A;  3X3Z A;  3FH1 A;  4CPK A;  2C11 A;  1OF5 B;  2HMK B;  1A2V A;  3FSD A;  1RN4 A;  1TIJ A;  3EE1 A;  3CNM A;  4N3V A;  2LQV A;  1N9J A;  2L4V A;  1WMO A;  3AGN A;  3F8X A;  3BND A;  1W01 A;  4LZI A;  4EBG A;  2D1W A;  1MWR A;  2GBX B;  3DGO A;  1Q81 4;  4XDW A;  1RKY A;  5BU4 A;  4KZ1 A;  1IU7 A;  5LC7 A;  5CF2 A;  1VQN 3;  1MWU A;  4IIA A;  1K41 A;  3EX9 A;  1IVX A;  3BNC A;  3K0Z A;  3MG2 A;  2BMO B;  1BVI A;  3N54 B;  4I5Q A;  4NRE A;  4O8S A;  3SED A;  3AMO B;  3UL5 A;  3X42 A;  1NJI 4;  1RNT A;  5JPP A;  3PS8 A;  3WOF B;  1UUW B;  1ISK A;  3NUV A;  2E2V A;  1NDO B;  1KD1 4;  1TFK A;  1WMP A;  1BNS A;  3EBY A;  1FGQ A;  3FKA A;  3I55 3;  4NHF A;  3WHO A;  1Q86 4;  5CXO A;  1W4N A;  1VQK 3;  2MC8 A;  2HML B;  3FG3 A;  3DM8 A;  3IPT A;  2W56 B;  4HAA A;  1TFO A;  3NQY A;  3S67 A;  1PFP A;  5HGR A;  1NB5 I;  1YIT 3;  1CQS A;  2E2T A;  1O7M B;  3AMO A;  3FLJ A;  3F7X A;  2QEX 3;  1E3V A;  3LXU X;  3X3Y A;  2CG1 A;  3X3X A;  3CPO A;  3GWR A;  5IEO A;  2IMJ A;  2WGQ A;  1OPY A;  1YJW 3;  4K1V A;  2KF3 A;  2BO9 B;  3FF2 A;  1IQY A;  2KXG A;  3ZG5 A;  1JB5 A;  1V74 A;  3STD A;  1A90 A;  1M1K 4;  1MOL A;  4FMD A;  1TRQ A;  1RRH A;  2GBW B;  1VQO 3;  2W56 A;  1IT8 A;  4ILF A;  1D6U A;  1Q82 4;  4WHA A;  1RGE A;  4RBN A;  2Q07 A;  1B3S A;  3JUP A;  4N6M A;  5IG5 A;  1LOW A;  1RDS A;  1NO3 A;  1M1X B;  1BRS A;  3IMA B;  4WYK B;  2YFI B;  4FCZ A;  4EYC A;  1BNE A;  3D5G A;  4CJN A;  1BRI A;  3GZX B;  2GSP A;  4J5G A;  1ZS7 A;  3MG3 A;  3ZG0 A;  1MWS A;  1RLS A;  1N8R 4;  2BMR B;  3AHS A;  2GU1 A;  2OCT A;  2STD A;  1GOV A;  3S27 A;  3CNX A;  3VGN A;  3X41 A;  2XSH B;  1I2E A;  2F4Y A;  3F14 A;  4I4K A;  4XM4 A;  4WYK A;  4XB5 A;  3JVC A;  1VQP 3;  1DVC A;  4L8P A;  1FYS A;  3EHC A;  3MG1 A;  1DMN A;  3D9R A;  1VZZ A;  1W6G A;  1K9M 4;  4FMB A;  3KKG A;  1R4Y A;  1I2G A;  2CFW A;  4HJL B;  4BL3 A;  3N8B A;  5G1L A;  2GXF A;  3FGY A;  3O8Y A;  1U5O A;  3CU3 A;  2W9Q A;  4L7K A;  5IEN A;  3MKI A;  1LQG C;  2L1S A;  3NXJ A;  3BLZ A;  2CX0 A;  4OUQ A;  3MPH A;  4TX4 A;  1X1X A;  1DMQ A;  4NPB A;  1TRP A;  1UCI A;  1FGR A;  2P0X A;  4R80 A;  4XBX A;  1IVV A;  5AII A;  1D6Z A;  4N6V 0;  3MHE A;  1SPU A;  3HOH A;  1KC8 4;  2K54 A;  3LZA A;  1EKM A;  3CCS 3;  1IV9 A;  1I0V A;  4HVN A;  3S28 A;  2CFD A;  2GEY A;  1FGM A;  2UGI A;  1SJW A;  2KF6 A;  3F9S A;  1CEW I;  3OWS A;  1MGR A;  5RNT A;  2R4I A;  2RNT A;  1VQ5 3;  1FA3 A;  1LXE A;  4HM6 B;  1FW7 A;  2ML5 A;  1O7H B;  4LYL B;  2P0M A;  3G71 3;  5M1A A;  1EG9 B;  3CXC 2;  1C7H A;  2BHM A;  4MJD A;  3G0K A;  4IPB A;  1M9G A;  1F8N A;  3WOD G;  3DZL A;  1ZX2 A;  2IUJ A;  3SVA A;  4AKY A;  4EV5 A;  2F5W A;  2QGU A;  3GSP A;  1OUN A;  1RTU A;  5EEO A;  2P05 A;  3AGO A;  3NV0 B;  3V98 A;  4J8T A;  1WTH A;  3AHW A;  1MNL A;  4HZB B;  1O7W B;  3FCS B;  3NBB A;  2KRT A;  4MMZ B;  1B20 A;  4KFE A;  1IT7 A;  3JUO A;  1TP6 A;  1ULI B;  1WMN A;  1B27 A;  1X1W A;  1QVF 2;  1W2Z A;  1JBS A;  1JBR A;  1OCV A;  1DET A;  5ELU A;  4BU4 A;  4H3U A;  1GOU A;  1OAC A;  4CCV A;  3NV0 A;  5IW9 A;  4J9A A;  2OTL 3;  1BRN L;  2HMN B;  1UCL A;  4GL6 A;  4L8O A;  3KE7 A;  2YFJ B;  4OK0 A;  1OH0 A;  3VSY A;  3CC7 3;  3PCR A;  2MF7 A;  5AYR B;  3Q3F A;  1VQ7 3;  1UGI A;  3DUK A;  3NBR A;  1N9E A;  2CFG A;  5BXQ A;  1LVN A;  1BNJ A;  3M8C A;  1ROV A;  1T2I A;  1ULJ B;  6RNT A;  4J5K A;  1A67 A;  3Q90 A;  1OF5 A;  3D5I A;  1BRH A;  3ER7 A;  2CFL A;  1STF I;  1OGX A;  4ORL A;  4JRF A;  3WA3 A;  3CD6 3;  3DH2 A;  1V58 A;  3I0Y A;  1MWT A;  2PNC A;  1A2K A;  2JDI H;  1YVS A;  2RGQ A;  2HMM B;  3MWZ A;  2OOV A;  4WFO A;  1IDP A;  1YJN 3;  1UCK A;  2RSX A;  1IK3 A;  4FMA A;  2J8X B;  1UI7 A;  1JZO A;  1AVK A;  1TJD A;  1QAF A;  2E2U A;  4MMX B;  3OW2 2;  2F56 A;  3DGM A;  4Q53 A;  5AIH A;  3DGY A;  3FZW A;  7RNT A;  1BUJ A;  3K7C A;  2OTJ 3;  1Q40 B;  3NHX A;  3SOA A;  2XSO B;  1OHP A;  1X1U A;  2XFT A;  4N6N B;  5AYS C;  3WMD A;  3B4O A;  3LTA A;  4LMI A;  5KP1 A;  5FW5 A;  1HZ1 A;  3FG1 A;  1AQZ A;  1US1 A;  4N6L A;  1GY6 A;  1GSP A;  1LOY A;  4STD A;  3J7Y d;  5LC6 A;  4MMY B;  1YHQ 3;  1DE3 A;  3HZP A;  1B21 A;  3H51 A;  3PXM A;  1GD3 A;  1I70 A;  2WOF A;  2W6J H;  1VQ8 3;  3ALA A;  8RNT A;  2INX A;  1VQQ A;  3SYU A;  2WO0 A;  1Q40 A;  2O3O A;  1G02 A;  2JQ5 A;  3FG4 A;  3H3H A;  2OOV C;  1IVW A;  1A2P A;  3LML A;  3IJE B;  4BTX A;  1R4C A;  2OWP A;  2F99 A;  4K90 B;  3EJV A;  1UDI I;  5STD A;  5AEW B;  1I3F A;  3FF0 A;  1RGG A;  1IV7 A;  3NM2 A;  1O7G B;  3RGR A;  1YGW A;  1JB4 A;  2A15 A;  1C54 A;  5G1K A;  1GS3 A;  4RNY A;  2M7O A;  1IQ8 A;  1OHO A;  3E99 A;  1G96 A;  3X40 A;  5TGN A;  1I3I A;  1OGZ A;  2RCD A;  3DGN A;  4FCJ A;  2IYJ A;  2CHC A;  2XR8 B;  1QJG A;  4EW5 A;  1HU9 A;  3G4S 3;  1BNI A;  1UUG B;  1FUT A;  2Z7A A;  1RGK A;  1RJO A;  4X2H A;  4K1U A;  5ELJ A;  7GSP A;  5IG0 A;  3I56 3;  2CX1 A;  2W9P A;  3T8U A;  3F7S A;  5AEU B;  1IYY A;  6STD A;  1RSN A;  4O2H A;  4WWU C;  1JV2 B;  3V92 A;  1NU3 A;  2IA7 A;  5IG4 A;  5D81 A;  3N9H A;  1Q7H A;  5IER A;  3Q1C A;  3B7C A;  4BIR A;  3CPW 2;  1MGW A;  1LNI A;  2BU4 A;  3Q2P A;  1JRQ A;  1TTO A;  2LYX A;  1LNH A;  2CKF B;  2SAR A;  1Q9E A;  4XBY A;  1YVB I;  1AR0 A;  5KP3 A;  3CCM 3;  5BVB A;  1B2X A;  1LRA A;  6GSP A;  1U8C B;  3LOY A;  5CK6 A;  1SAR A;  2KF5 A;  1SIH A;  2BMQ B;  4HM3 B;  2W04 A;  3LTB A;  8CHO A;  1KQS 2;  3KN4 A;  1UUV B;  1BRG A;  9RNT A;  1DYU A;  1RGA A;  3KZT A;  2CC3 A;  3GAX A;  3MYT A;  2W03 A;  4FR9 A;  4IT7 A;  3D4A A;  4HZ9 B;  3CCU 3;  1CYU A;  5I97 A;  3WA2 X;  1EQK A;  1QMA A;  1YNV X;  1STD A;  2CIU A;  1T2H A;  2V1L A;  1RGL A;  3NBJ A;  3SX1 A;  4LSO A;  3UB1 A;  3WR2 A;  4AKZ A;  1N5P A;  5M18 A;  1BUQ A;  3EN8 A;  2F5M A;  3T0U A;  3EBT A;  1NWW A;  1AV4 A;  2K3D A;  1E97 A;  1S72 3;  4ZM8 A;  3SXX A;  1E3R A;  1BAO A;  1HKX A;  3WDG B;  1IVU A;  2C4B A;  2PZV A;  2XGL A;  1KSI A;  3GZB A;  4HBR A;  1RRL A;  4HM0 B;  1Q42 A;  2FNQ A;  4LEH A;  1I0X A;  1RN1 A;  3DMC A;  3CCE 3;  1EA2 A;  1SQW A;  3G8Z A;  3OV4 A;  4HKV B;  1RGH A;  1BOX A;  1WNH A;  3KSE D;  3MSO A;  4JF8 A;  5CLK A;  4FMC A;  1RN7 A;  1CYV A;  1PYL A;  4GHO A;  3S5C A;  4BTW A;  1BSD A;  2CWT A;  2XFS A;  1LOV A;  3ECF A;  3G16 A;  1RNB A;  1BAN A;  1I2F A;  4HOH A;  3CCQ 3;  2H0I A;  2GU3 A;  1FGO A;  2FGT A;  1EUI C;  4CDL A;  4H61 A;  5IG3 A;  1K8A 4;  1PU4 A;  5IEP A;  5GSP A;  2Y73 A;  3S29 A;  2HOH A;  2UX0 A;  1RMS A;  3QK9 A;  5DRV A;  3UL6 A;  1AY7 A;  2AAE A;  2GEX A;  3SLU A; 
#chains in the Genus database with same CATH homology
 3EC9 A;  3CCR 3;  3RGA A;  3CCV 3;  2HMJ B;  3UJM A;  3OWU A;  1QAK A;  1O7N B;  3JUQ A;  3KII A;  1WQL B;  3OX9 A;  4O02 B;  4HM7 B;  4RZM A;  2IUK A;  4EC6 A;  2CW9 A;  2CWV A;  2B1X B;  3GZY B;  2YFL B;  4N6O B;  1YJ9 3;  1K73 4;  2XGN A;  1N8Q A;  1ASK A;  4FCM A;  2Z76 A;  4EV2 A;  2CG0 A;  2YX9 A;  2RFR A;  3BNE A;  3RDE A;  1GY7 A;  2QIY A;  4PEJ A;  3CME 3;  4O3V A;  2FXT A;  3QRD A;  1VQM 3;  2BT3 A;  2K0M A;  3LT9 A;  7STD A;  4N6T A;  1W02 A;  1J2B A;  1JNQ A;  4N6U A;  5EQL A;  3JUM A;  4HM2 B;  3LTC A;  1GD4 A;  4KFD A;  2O9U X;  3LYG A;  1JJ2 2;  2CWU A;  2B24 B;  1YGE A;  3PYJ A;  5D83 A;  2CH9 A;  4WP5 A;  3VF1 A;  1S5A A;  1TUH A;  4R9L A;  2Y74 A;  2C10 A;  1W6Y A;  3WOE B;  4K61 A;  3K5T A;  3U97 A;  3HK4 A;  3EB8 A;  3DXO A;  3EF8 A;  1ZO2 A;  3GZR A;  4LGQ A;  1FGT A;  3BB9 A;  4RNZ A;  1VQL 3;  1YI2 3;  3K9M C;  2XF3 A;  4HM4 B;  3HIG A;  3CC2 3;  3CC4 3;  4R1K A;  4XBT A;  1W7C A;  1YIJ 3;  3T8N A;  2CK3 H;  1L5G B;  1VQ9 3;  2XEP A;  3LT8 A;  5JBS A;  3U1W A;  5EVH A;  2W0Q A;  2F86 B;  2QA4 3;  1K28 A;  2SBL A;  3NX0 A;  3EN1 B;  4AEQ A;  1IQX A;  4R4K A;  3PCS A;  3A76 A;  2KCD A;  3HI7 A;  4HYZ A;  4X2O A;  1W2B 2;  5FGO A;  4KFF A;  4U13 A;  5G2G A;  5KP4 A;  5A0O B;  4GB5 A;  3EQQ B;  1GYB A;  2Z77 A;  4HM8 B;  3ROB A;  3LTD A;  1VQ6 3;  1Y4K A;  2WOH A;  1VQ4 3;  5AIG A;  2CFK A;  3NQZ A;  1O7P B;  1JN5 B;  2OQE A;  4R9K A;  4HM5 B;  1GY5 A;  1W6C A;  2P38 A;  4G1M B;  3F8H A;  5CF1 A;  3V99 A;  2Z6B A;  1TU5 A;  2XRX B;  4BTY A;  1JKG B;  1Z1S A;  2I9W A;  1DMM A;  4OVM A;  3K63 A;  3PZW A;  2D42 A;  2ZL8 A;  4HM1 B;  3CCJ 3;  2W2C A;  1JN5 A;  2BNG A;  1LOX A;  1UW1 A;  2XH9 A;  3L0R A;  1DVD A;  4EXR A;  5DRE A;  3B4P A;  1W00 A;  3D3L A;  3HII A;  3OWY A;  2HMO B;  1NB3 I;  4XDV A;  3JUN A;  3CCL 3;  1JKG A;  3GRD A;  1N5H A;  1QAL A;  1SII A;  3SOY A;  3DY5 A;  3DGL A;  3HX8 A;  1AVL A;  2OQE C;  2F98 A;  3LH4 A;  3CMA 3;  3PGB A;  2WGO A;  5JPU A;  1Q7Y 4;  2ZDJ A;  3B8L A;  4QWT A;  1QVG 2;  1KWI A;  3NM7 A;  4MEI A;  5IF6 A;  1ROA A;  3F40 A;  3KFQ C;  2P09 A;  5AI1 A;  1M90 4;  2ML6 A;  3UNL A;  5D82 A;  1W5Z A;  3KSP A;  1OHS A;  1T5Y A;  1UI8 A;  4KVH A;  1D6Y A;  3TDG A;  3OXA A;  5AIF A;  1JB2 A;  3BNB A;  1FUW A;  3X3Z A;  3FH1 A;  2C11 A;  1OF5 B;  2HMK B;  1A2V A;  3FSD A;  4N3V A;  1TIJ A;  3EE1 A;  3CNM A;  2LQV A;  1N9J A;  2L4V A;  1WMO A;  3F8X A;  3BND A;  1W01 A;  4LZI A;  4EBG A;  2D1W A;  2GBX B;  1Q81 4;  3DGO A;  4XDW A;  1RKY A;  4KZ1 A;  1IU7 A;  5LC7 A;  5CF2 A;  1VQN 3;  4IIA A;  1K41 A;  3EX9 A;  1IVX A;  3BNC A;  3K0Z A;  3MG2 A;  2BMO B;  3N54 B;  4NRE A;  4O8S A;  3UL5 A;  3SED A;  3AMO B;  3X42 A;  1NJI 4;  5JPP A;  3PS8 A;  3WOF B;  1UUW B;  1ISK A;  3NUV A;  2E2V A;  1NDO B;  1KD1 4;  1TFK A;  1WMP A;  3EBY A;  1FGQ A;  3FKA A;  3I55 3;  4NHF A;  1Q86 4;  5CXO A;  1W4N A;  1VQK 3;  2MC8 A;  2HML B;  3FG3 A;  3DM8 A;  3IPT A;  2W56 B;  1NB5 I;  1TFO A;  3NQY A;  3S67 A;  1PFP A;  5HGR A;  1YIT 3;  1CQS A;  2E2T A;  1O7M B;  3AMO A;  3FLJ A;  3F7X A;  2QEX 3;  1E3V A;  3LXU X;  3X3Y A;  2CG1 A;  3X3X A;  3CPO A;  3GWR A;  5IEO A;  2IMJ A;  2WGQ A;  1OPY A;  1YJW 3;  4K1V A;  2BO9 B;  3FF2 A;  1IQY A;  2KXG A;  1JB5 A;  1V74 A;  3STD A;  1A90 A;  1M1K 4;  1MOL A;  4FMD A;  1VQO 3;  1RRH A;  2GBW B;  1Q82 4;  2W56 A;  1IT8 A;  1D6U A;  4WHA A;  4RBN A;  2Q07 A;  3JUP A;  4N6M A;  5IG5 A;  1NO3 A;  1M1X B;  3IMA B;  4WYK B;  2YFI B;  4FCZ A;  4EYC A;  3GZX B;  3MG3 A;  1N8R 4;  2BMR B;  2GU1 A;  2OCT A;  2STD A;  3S27 A;  3VGN A;  3CNX A;  3X41 A;  2XSH B;  3F14 A;  4I4K A;  4XM4 A;  4WYK A;  4XB5 A;  3JVC A;  1VQP 3;  1DVC A;  4L8P A;  3EHC A;  3MG1 A;  1DMN A;  3D9R A;  1VZZ A;  1W6G A;  1K9M 4;  4FMB A;  3KKG A;  2CFW A;  4HJL B;  3N8B A;  2GXF A;  3FGY A;  3O8Y A;  1U5O A;  3CU3 A;  2W9Q A;  4L7K A;  5IEN A;  3MKI A;  3NXJ A;  3BLZ A;  4OUQ A;  3MPH A;  4TX4 A;  1DMQ A;  1FGR A;  2P0X A;  4R80 A;  4XBX A;  1IVV A;  5AII A;  1D6Z A;  4N6V 0;  3MHE A;  1SPU A;  1KC8 4;  2K54 A;  3LZA A;  1EKM A;  3CCS 3;  1IV9 A;  4HVN A;  3S28 A;  2CFD A;  2GEY A;  1FGM A;  1SJW A;  3F9S A;  1CEW I;  3OWS A;  2R4I A;  1VQ5 3;  1FA3 A;  1LXE A;  4HM6 B;  2ML5 A;  1O7H B;  2P0M A;  3G71 3;  1EG9 B;  3CXC 2;  1C7H A;  2BHM A;  4MJD A;  3G0K A;  4IPB A;  1M9G A;  1F8N A;  3WOD G;  3DZL A;  1ZX2 A;  2IUJ A;  3SVA A;  4AKY A;  4EV5 A;  2QGU A;  1OUN A;  5EEO A;  2P05 A;  3NV0 B;  3V98 A;  4J8T A;  1WTH A;  4HZB B;  1MNL A;  4MMZ B;  1O7W B;  3FCS B;  3NBB A;  2KRT A;  4KFE A;  1IT7 A;  3JUO A;  1TP6 A;  1ULI B;  1WMN A;  1QVF 2;  1W2Z A;  1OCV A;  5ELU A;  4CCV A;  4H3U A;  1OAC A;  5IW9 A;  3NV0 A;  4J9A A;  2OTL 3;  2HMN B;  4GL6 A;  4L8O A;  3KE7 A;  2YFJ B;  4OK0 A;  1OH0 A;  3VSY A;  3CC7 3;  3PCR A;  2MF7 A;  5AYR B;  1VQ7 3;  3DUK A;  3NBR A;  1N9E A;  2CFG A;  5BXQ A;  1LVN A;  3M8C A;  1ROV A;  1ULJ B;  1A67 A;  3Q90 A;  1OF5 A;  3ER7 A;  2CFL A;  1STF I;  1OGX A;  4ORL A;  4JRF A;  3WA3 A;  3CD6 3;  3I0Y A;  3MWZ A;  2OOV A;  2PNC A;  1A2K A;  2JDI H;  2RGQ A;  2HMM B;  1YJN 3;  4WFO A;  1IDP A;  2RSX A;  1IK3 A;  4FMA A;  1UI7 A;  1AVK A;  1QAF A;  2E2U A;  4MMX B;  3OW2 2;  3DGM A;  4Q53 A;  5AIH A;  3FZW A;  3K7C A;  2OTJ 3;  1Q40 B;  3NHX A;  3SOA A;  2XSO B;  1OHP A;  5AYS C;  2XFT A;  4N6N B;  3WMD A;  3B4O A;  3LTA A;  4LMI A;  5KP1 A;  5FW5 A;  3FG1 A;  1US1 A;  4N6L A;  4STD A;  1GY6 A;  3J7Y d;  5LC6 A;  4MMY B;  1YHQ 3;  3HZP A;  3H51 A;  3PXM A;  1GD3 A;  2WOF A;  2W6J H;  1VQ8 3;  3ALA A;  2INX A;  2WO0 A;  1Q40 A;  2O3O A;  2JQ5 A;  3FG4 A;  3H3H A;  2OOV C;  1IVW A;  3LML A;  3IJE B;  4BTX A;  1R4C A;  2OWP A;  2F99 A;  4K90 B;  3EJV A;  5STD A;  5AEW B;  3FF0 A;  1IV7 A;  3NM2 A;  1O7G B;  3RGR A;  1JB4 A;  2A15 A;  1GS3 A;  4RNY A;  2M7O A;  1IQ8 A;  1OHO A;  3E99 A;  1G96 A;  3X40 A;  5TGN A;  1OGZ A;  2RCD A;  3DGN A;  4FCJ A;  2CHC A;  2XR8 B;  1QJG A;  1HU9 A;  3G4S 3;  2Z7A A;  1RJO A;  4X2H A;  4K1U A;  5ELJ A;  5IG0 A;  3I56 3;  2W9P A;  3T8U A;  3F7S A;  5AEU B;  6STD A;  4O2H A;  4WWU C;  1JV2 B;  3V92 A;  1NU3 A;  2IA7 A;  5IG4 A;  5D81 A;  3N9H A;  5IER A;  3Q1C A;  3B7C A;  3CPW 2;  3Q2P A;  1JRQ A;  2LYX A;  1LNH A;  2CKF B;  4XBY A;  1YVB I;  1AR0 A;  5KP3 A;  3CCM 3;  5BVB A;  1U8C B;  3LOY A;  5CK6 A;  1SIH A;  2BMQ B;  4HM3 B;  2W04 A;  3LTB A;  8CHO A;  1KQS 2;  3KN4 A;  1UUV B;  1DYU A;  3KZT A;  2CC3 A;  3GAX A;  3MYT A;  2W03 A;  4FR9 A;  4IT7 A;  4HZ9 B;  3CCU 3;  1CYU A;  5I97 A;  3WA2 X;  1EQK A;  1QMA A;  1STD A;  2CIU A;  2V1L A;  3NBJ A;  3SX1 A;  3UB1 A;  4LSO A;  4AKZ A;  1BUQ A;  1N5P A;  3EN8 A;  3T0U A;  3EBT A;  1NWW A;  1AV4 A;  1E97 A;  1S72 3;  4ZM8 A;  3SXX A;  1E3R A;  1HKX A;  3WDG B;  1IVU A;  2PZV A;  2XGL A;  1KSI A;  3GZB A;  4HBR A;  1RRL A;  4HM0 B;  1Q42 A;  2FNQ A;  4LEH A;  3DMC A;  3CCE 3;  1EA2 A;  1SQW A;  3G8Z A;  3OV4 A;  4HKV B;  1WNH A;  3KSE D;  3MSO A;  4JF8 A;  5CLK A;  4FMC A;  1RN7 A;  1CYV A;  4BTW A;  3G6E 3;  3S5C A;  2CWT A;  2XFS A;  3ECF A;  3G16 A;  3CCQ 3;  2GU3 A;  1FGO A;  2FGT A;  4CDL A;  5IG3 A;  4H61 A;  1K8A 4;  1PU4 A;  5IEP A;  2Y73 A;  3S29 A;  2UX0 A;  3QK9 A;  5DRV A;  3UL6 A;  2GEX A;  3SLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...