4K90B

Extracellular metalloproteinase from aspergillus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
207
Chain Sequence
TVDLNAFRLKSLAKYVNATETVIEAPSPQSYVEVATQHVKMIAPDATFRVVDDHYVGDNGVAHVHFRQTANGLDIDNADFNVNVGKDGKVFSYGNSFYTGQIPSSAALTKRDFSDPVTALKGTTNTLQLPITVDSASSESTKESYVFKGVSGTVSDPKAKLVYFVKDDGTLALAWRVETDIDSNWLLTYIDAKSGEEIHGVVDYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Extracellular metalloproteinase mep
publication title A functional and structural study of the major metalloprotease secreted by the pathogenic fungus Aspergillus fumigatus.
pubmed doi rcsb
source organism Aspergillus fumigatus
total genus 46
structure length 207
sequence length 215
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k90B00
3NQYA 4K90B 3NQZA
chains in the Genus database with same CATH superfamily
5CXOA 3F7XA 1A67A 3A5EA 3MHEA 2YX9A 3S29A 2OQEA 3BIRA 5FGOA 2IUJA 1RN4A 5TGNA 1AV4A 1N9JA 2XRXB 3OX9A 1WQLB 1C54A 2SARA 5M19A 2HMNB 4N6LA 1OUNA 4N6NB 3D5IA 1JV2B 1BNGA 1I0VA 1V57A 1WTHA 2HOHA 3NM7A 3PYJA 9RNTA 1BNFA 2YFIB 1RGHA 3H3HA 1NB5I 5BU4A 4MEIA 2XF3A 3G8ZA 1BOXA 3B4PA 5IEOA 3G713 2W2CA 1JJ22 1AY7A 3ROBA 2QA43 1B2XA 2OOVC 2BMOB 3S27A 2W03A 1O7HB 3EN8A 2SBLA 4HM8B 1V74A 3T8NA 1OHSA 3V92A 2ML6A 4R9LA 1ZGXA 2D1WA 2O9UX 2M7OA 1FGRA 1TRQA 1UGHI 3EE1A 3OWUA 1BSAA 5AYRB 3GZXB 5GSPA 1RGEA 3K9MC 3MSOA 2KAAA 4HM0B 4MMZB 4CPKA 2YFJB 4L8OA 1I2GA 4BU4A 3LZAA 4MMYB 3CMA3 1R4CA 1G02A 3RGAA 1WNHA 4BL2A 3I563 1DMQA 3VF1A 3G16A 2RGQA 3SYUA 1BUQA 4TX4A 5D82A 1UI8A 4QWTA 3WOFB 2E2UA 3AHSA 1GS3A 1BU4A 1IDPA 3EQQB 3NM2A 1W4NA 4WYKA 2OCTA 1BANA 4R80A 2HMMB 2Y73A 1VQ43 2W9PA 4XDVA 2C4BA 1LQMB 4LSOA 3T8UA 1CYUA 4CCVA 1STFI 1LNIA 2W0QA 1O7MB 2KF5A 7GSPA 3KKGA 4MJDA 5IG3A 3DGNA 1IQ8A 1JBRA 3ALAA 1O7PB 4HM4B 4XBYA 3CCE3 3D3LA 3DGMA 2WOFA 2F86B 3GRDA 3QK9A 3LOYA 4RNTA 1YI23 4ILFA 2K54A 1RCLA 1UCLA 1TRPA 3BU4A 4HAAA 1BNRA 1BVIA 1W2ZA 1OF5B 2ML5A 1DMMA 3PCRA 4G1MB 5A0OB 1JBTA 4XB5A 4HZBB 1J2BA 3S5CA 4LYLB 1LQGC 1VQ83 1TP6A 3LMLA 5IG4A 3IJEB 2W9QA 3MG2A 3WHOA 1D6UA 2CW9A 1VQL3 1I70A 3Q3FA 1Q9EA 2J8XB 2E2TA 1JB5A 3KSED 3ZG5A 3ECFA 1RNTA 3F8HA 1C7HA 8CHOA 3BNEA 3CNMA 1RN7A 1RJOA 1ULIB 2AADA 3UJMA 3MWZA 4HYZA 4L8PA 3U1WA 4HM7B 1GOUA 1TIJA 3DGLA 1FUWA 4FCJA 2CK3H 1A90A 3OW22 2OTL3 2OTJ3 1FUTA 5G1KA 2K3DA 1F8NA 1ROVA 2P0XA 1OH0A 2CIUA 2QIYA 3SEDA 4GB5A 2INXA 2BIRA 3NV0A 5CK6A 2CFWA 1T5YA 1N5PA 1JN5A 1ROAA 2UUGC 3JUMA 1YNVX 1RGFA 2YFLB 3CCJ3 1GYBA 1NWWA 2BU4A 3LT9A 4NHFA 4HM5B 2E2VA 4Q53A 4EXRA 8RNTA 1I8VA 2W56B 1OGXA 1NDOB 4EC6A 1RKYA 1Q864 1VZZA 3GZBA 1IT8A 1FUSA 3GZRA 1L5GB 3KFQC 4FMCA 5ELUA 1UI7A 2GU3A 5G2GA 1STDA 2UX0A 5AYSC 5M1AA 1D6ZA 2F4YA 1QALA 1BUJA 1RGLA 2JQ5A 4KVHA 2Z6BA 1CH0A 1VQM3 4FCMA 4EBGA 3N8BA 1BRGA 1RSNA 7RNTA 5M18A 1VQ63 1RHLA 3CU3A 4R4KA 3PZWA 1IU7A 1S723 1GD4A 2XGLA 4LEHA 5IW9A 1YJN3 4N6OB 1W7CA 1IVWA 2XEPA 2IYJA 1GOYA 3PGBA 4HM1B 1X1XA 1BRSA 1ZX2A 2P09A 1PFPA 3IPTA 5AIFA 3QRDA 1RLSA 2I9WA 1BNIA 5STDA 3KN4A 4BTYA 1W2B2 1NJI4 1RN1A 2D42A 1JNQA 1JB4A 3NHXA 1UCIA 4NPBA 1QVF2 5JPPA 1QAFA 1OHOA 2HMJB 3K7CA 1SIIA 5FW5A 1GY7A 1JRQA 3RDEA 2GBXB 4O3VA 1VQ93 3N54B 4N3VA 4DKIA 3DMCA 1VQ73 4KZ1A 2F98A 4LGQA 3WR2A 1JKGA 3X3XA 2HMOB 1A2PA 1YVBI 4EYCA 3Q1CA 3Q2PA 2C10A 2W04A 3FKAA 2O3OA 5D83A 1ASKA 1N9EA 1W6YA 4X2HA 2CWUA 2KF6A 5BVBA 1KQS2 1MNLA 1YIT3 2GEYA 3V99A 1Q42A 1DETA 2BT3A 2RFRA 1IVUA 4FCZA 4J9AA 3FH1A 3DH2A 4JRFA 2B1XB 3CME3 2CX1A 3CC23 1PU4A 1BRHA 1DMNA 4KFDA 3NV0B 4XBXA 3SXXA 5EQLA 1GY6A 1MGWA 1JN5B 4HM6B 1CYVA 4RNZA 3WODG 5DRVA 3NBBA 1MWTA 3HZPA 3LTBA 7STDA 2V1LA 2XFSA 1SQWA 1W01A 1AVKA 1OGZA 2H0IA 3D5GA 1U5OA 2HMLB 1ZO2A 2BMQB 2WOHA 1O7NB 4O2HA 5KP1A 3D79A 1TTOA 4ORLA 1OCVA 2GBWB 1Q40A 2CWVA 2H0GA 3KCHA 1RGKA 3GAXA 1WMNA 3LXUX 3G6E3 1E3VA 3V98A 1IT7A 4LMIA 2KXGA 5AIIA 1IV7A 2B24B 4N6UA 4RBNA 3FGYA 4LZIA 1W6CA 2F5WA 2MC8A 2FXTA 3K63A 4L7KA 1FGOA 6STDA 2KF3A 3EHCA 4HKVB 4FMAA 1NO3A 1N5HA 1UUWB 3UL6A 1EKMA 4XBTA 1S5AA 3FG3A 3ZFZA 5AIGA 3CC43 1ISKA 4XDWA 1RTUA 1IQXA 2R4IA 3DM8A 1RDSA 4IPBA 4O8SA 3EBYA 1M1XB 1MWSA 1UCJA 3DY5A 1N8R4 1Q7Y4 3HIGA 1K28A 4O02B 4RZMA 2GEXA 4OK0A 3H51A 3K5TA 3GSPA 1VQK3 1QAKA 5HOHA 2A15A 1YGWA 3BNCA 1JKGB 4HM2B 2P0MA 4OVMA 2ZDJA 1GMPA 3DZLA 3FF0A 5IENA 1IVVA 2L1SA 3G4S3 5IG5A 2F56A 5KP3A 3FZWA 3CD63 1BRKA 3Q90A 4R9KA 1JZDA 4JF8A 3A76A 1K734 1IVXA 1GMQA 1O7GB 2GXFA 2OWPA 2Z76A 5IG0A 2LQVA 3E99A 3FCSB 3SVAA 1RRLA 3MPHA 2XGNA 1FZUA 1I0XA 2OQEC 1I2FA 3FLJA 4WWUC 2CC3A 3CCQ3 1DYUA 2CG0A 6GSPA 4I4KA 3WMDA 4GSPA 2CG1A 1US1A 1YIJ3 1MGRA 4BIRA 4U13A 1UUGB 3MG3A 3AMOA 3HK4A 4WYKB 3F14A 1BSEA 3RGRA 1KWIA 4HM3B 5I97A 3AHWA 1HU9A 4AEQA 1MWUA 2RSXA 5RNTA 3KSPA 1UDII 1KC84 2RBIA 5AEUB 4BL3A 2ZA4A 1HZ1A 3LT8A 2L4VA 3LTDA 3T0UA 2ZL8A 5EEOA 2CFDA 5BIRA 5JBSA 3N9HA 5D81A 1RGCA 4STDA 1WMOA 2H0HA 3D4AA 3UL5A 2K0MA 2QEX3 1Z1SA 3F40A 2CH9A 4CDLA 2CX0A 4KT3B 3NBJA 2BNGA 2MF7A 3NBRA 1BIRA 1M904 1K8A4 1HKXA 1QMAA 2BHMA 3X3ZA 3EC9A 1UGIA 3EN1B 1KD14 1LVNA 2GSPA 1TFOA 3MYTA 3JUQA 1FGMA 5IEPA 3EX9A 3D9RA 4J8TA 5BXQA 1GSPA 1ULJB 1LRAA 2XSHB 2CHCA 1X1YA 1A2KA 3GZYB 3NQZA 5CLKA 4AKYA 2C11A 3MKIA 3PCSA 3HOHA 3BNDA 3X41A 1QJGA 3NUVA 1B27A 3F7SA 3FG4A 1X1UA 3AGOA 1W00A 3S28A 2CKFB 3TDGA 1AQZA 1RCKA 2CWTA 4AKZA 1AR0A 3LH4A 1I3FA 1I2EA 3EB8A 1YGEA 3NX0A 3LTAA 1FA3A 4NREA 2KF4A 1G0TA 1JBSA 3WA3A 3F8XA 3UNLA 4OUQA 2Y74A 1BRJA 3URPA 3NXJA 1YVSA 4FR9A 3PS8A 3CCU3 1BGSA 2PZVA 1RNBA 1JB2A 1KSIA 2F5MA 2FGTA 1BSBA 1I3IA 1O7WB 5LC6A 1LOVA 1BAOA 3EJVA 3DGYA 1SJWA 5G1LA 2LYXA 1BNEA 4BTWA 1WMPA 1LOWA 1IK3A 2UGIA 4X2OA 4XM4A 4EV2A 1AVLA 1VQO3 1IV9A 2GU1A 3EF8A 4K1UA 1LOYA 5KP4A 1T3BA 3AMOB 3B8LA 4WFOA 1GD3A 4HOHA 3G0KA 3F9SA 4I5QA 1MOLA 3U97A 4HJLB 1R4YA 1FYSA 1T2HA 4H61A 2W56A 3LTCA 3NQYA 1EG9B 1NB3I 4ZM8A 1UCKA 4FMDA 1LXEA 4R1KA 2BO9B 3S67A 3SX1A 4N6TA 3JVCA 5CF2A 1M9GA 3SOAA 3CPW2 1BSCA 4K1VA 3WOEB 1B2UA 2OOVA 1B2MA 1VQ53 3O8YA 1TU5A 3CCL3 2STDA 3KZTA 1NU3A 4CJNA 3CCR3 1VQQA 3CPOA 3OV4A 3CCM3 1Q814 1W5ZA 4PEJA 1GMRA 1RRHA 1EUIC 1YHQ3 1GY5A 1GOVA 2ZHXB 3HX8A 1A2VA 1RGGA 1UUVB 5AEWB 1K41A 3CCS3 1HYFA 3FG1A 2R41A 3SLUA 3I553 1QVG2 3FF2A 1CQSA 3X3YA 3DGOA 4MMXB 3CNXA 3JUPA 1YJW3 1OHPA 2W6JH 1BRNL 5ELJA 1B3SA 2QGUA 1CEWI 1B20A 1W02A 3LYGA 5AI1A 1RGAA 3ZG0A 1SPUA 3J7Yd 2CFGA 1Q824 4J5KA 1B2ZA 2BMRB 4K61A 3ER7A 3STDA 1EA2A 2WGQA 1RMSA 3HI7A 5AIHA 4GHOA 3PXMA 4H3UA 3BNBA 2CFLA 1PY3A 3CC73 3BB9A 3M8CA 2Z7AA 1SARA 3KIIA 2RNTA 2AAEA 4K90B 1E97A 1Y4KA 3UB1A 1B21A 1G96A 4J5GA 1BSDA 2Q07A 1JZOA 4N6MA 3GWRA 1EQKA 1FGTA 1W6GA 4EV5A 3FSDA 3CCV3 1UW1A 2P38A 3L0RA 1OACA 3I0YA 3K0ZA 1EEJA 3DUKA 2P05A 2IY2A 3MG1A 2Z77A 3JUOA 4RNYA 4N6V0 2KRTA 1BNJA 2HMKB 2IA7A 1Q7HA 3JUNA 4EW5A 5IERA 3KE7A 1OPYA 1NNVA 3OXAA 3VSYA 1FGQA 3OWSA 1Q40B 4IIAA 1YJ93 4BTXA 1LNHA 5DREA 2WO0A 5LC7A 3RNTA 6RNTA 5IF6A 2FNQA 4HBRA 1BNSA 4WP5A 2XR8B 3WA2X 2PNCA 3B4OA 3B7CA 1D6YA 2RCDA 3EBTA 2IMJA 4KFEA 4WHAA 1DVDA 1IQYA 1DVCA 2CFKA 5HGRA 1E3RA 1SIHA 1FW7A 3AGNA 4FMBA 1ZS7A 1U8CB 4HZ9B 5EVHA 3CXC2 2F99A 1V58A 1LOXA 3WDGB 4HVNA 2IUKA 5JPUA 1T2IA 2XH9A 4KFFA 3OWYA 1DE3A 1VQN3 1MWRA 3VGNA 3X42A 1TJDA 5CF1A 1K9M4 1TUHA 2JDIH 1VQP3 2XFTA 2WGOA 3DXOA 1TFKA 2KCDA 3BLZA 1B2SA 1BRIA 1PYLA 1X1WA 3SOYA 1M1K4 3HIIA 3IMAB 2XSOB 4GL6A 1N8QA 1OF5A 1IYYA 4IT7A 3X40A
chains in the Genus database with same CATH topology
5CXOA 3F7XA 1A67A 3MHEA 2YX9A 3S29A 2OQEA 5FGOA 2IUJA 5TGNA 1AV4A 1N9JA 2XRXB 3OX9A 1WQLB 2HMNB 4N6LA 1OUNA 4N6NB 1JV2B 1WTHA 3PYJA 3NM7A 2YFIB 3H3HA 1NB5I 4MEIA 2XF3A 3G8ZA 3B4PA 5IEOA 3G713 1JJ22 2W2CA 3ROBA 2QA43 2OOVC 2BMOB 3S27A 2W03A 1O7HB 3EN8A 2SBLA 4HM8B 1V74A 3T8NA 1OHSA 3V92A 2ML6A 4R9LA 2D1WA 2O9UX 2M7OA 1FGRA 3EE1A 3OWUA 5AYRB 3GZXB 3MSOA 3K9MC 4HM0B 4MMZB 1S723 2YFJB 4L8OA 3LZAA 4MMYB 3CMA3 1R4CA 3RGAA 3I563 1WNHA 1DMQA 3VF1A 3G16A 2RGQA 1BUQA 4TX4A 5D82A 1UI8A 4QWTA 3WOFB 2E2UA 1GS3A 1IDPA 3EQQB 3NM2A 1W4NA 4WYKA 2OCTA 4R80A 2HMMB 2Y73A 1VQ43 2W9PA 4XDVA 4LSOA 3T8UA 1CYUA 4CCVA 1STFI 2W0QA 1O7MB 5IG3A 3KKGA 4MJDA 3DGNA 1IQ8A 3ALAA 1O7PB 4HM4B 4XBYA 3CCE3 3D3LA 3DGMA 2WOFA 2F86B 3GRDA 3QK9A 3LOYA 1YI23 2K54A 1W2ZA 1OF5B 2ML5A 1DMMA 3PCRA 4G1MB 5A0OB 4XB5A 4HZBB 1J2BA 3S5CA 1VQ83 1TP6A 3LMLA 5IG4A 3IJEB 2W9QA 3MG2A 1D6UA 2CW9A 1VQL3 2E2TA 1JB5A 3KSED 3ECFA 3F8HA 1C7HA 8CHOA 3BNEA 3CNMA 1RN7A 1RJOA 1ULIB 3UJMA 3MWZA 4HYZA 4L8PA 3U1WA 4HM7B 1TIJA 3DGLA 1FUWA 4FCJA 2CK3H 1A90A 3OW22 2OTL3 2OTJ3 2P0XA 1F8NA 1ROVA 1OH0A 2CIUA 2QIYA 3SEDA 4GB5A 2INXA 3NV0A 5CK6A 2CFWA 1T5YA 1N5PA 1JN5A 1ROAA 3JUMA 2YFLB 3CCJ3 1GYBA 1NWWA 3LT9A 4NHFA 4HM5B 2E2VA 4Q53A 4EXRA 2W56B 1OGXA 1NDOB 4EC6A 1RKYA 1Q864 1VZZA 3GZBA 1IT8A 1L5GB 3GZRA 3KFQC 4FMCA 5ELUA 1UI7A 2GU3A 5G2GA 1STDA 2UX0A 5AYSC 1D6ZA 1QALA 2JQ5A 4KVHA 2Z6BA 1VQM3 4FCMA 4EBGA 3N8BA 1VQ63 3CU3A 4R4KA 3PZWA 1IU7A 1GD4A 2XGLA 4LEHA 5IW9A 1YJN3 4N6OB 1W7CA 1IVWA 2XEPA 3PGBA 4HM1B 2P09A 1ZX2A 3IPTA 5AIFA 1PFPA 3QRDA 2I9WA 4BTYA 5STDA 3KN4A 1W2B2 1NJI4 2D42A 1JNQA 1JB4A 3NHXA 1QVF2 5JPPA 1QAFA 1OHOA 2HMJB 3K7CA 1SIIA 5FW5A 1GY7A 1JRQA 3RDEA 2GBXB 4O3VA 1VQ93 3N54B 4N3VA 3DMCA 1VQ73 4KZ1A 2F98A 4LGQA 3X3XA 1JKGA 2HMOB 1YVBI 4EYCA 3Q1CA 3Q2PA 2C10A 2W04A 3FKAA 2O3OA 5D83A 1ASKA 1N9EA 1W6YA 4X2HA 2CWUA 5BVBA 1MNLA 1YIT3 2GEYA 3V99A 1Q42A 2BT3A 2RFRA 4FCZA 1IVUA 4J9AA 3FH1A 4JRFA 2B1XB 3CME3 3CC23 1PU4A 1DMNA 4KFDA 3NV0B 4XBXA 3SXXA 5EQLA 1GY6A 1JN5B 4HM6B 1CYVA 4RNZA 3WODG 5DRVA 3NBBA 3HZPA 3LTBA 7STDA 2V1LA 2XFSA 1SQWA 1W01A 1AVKA 1OGZA 1U5OA 2HMLB 1ZO2A 2BMQB 2WOHA 1O7NB 4O2HA 5KP1A 4ORLA 1OCVA 2GBWB 1Q40A 2CWVA 3G6E3 3GAXA 1WMNA 3LXUX 1E3VA 3V98A 1IT7A 4LMIA 2KXGA 5AIIA 1IV7A 2B24B 4N6UA 4RBNA 3FGYA 4LZIA 1W6CA 2MC8A 2FXTA 3K63A 4L7KA 1FGOA 6STDA 3EHCA 4HKVB 4FMAA 1NO3A 1N5HA 1UUWB 3UL6A 1EKMA 4XBTA 1S5AA 3FG3A 5AIGA 3CC43 1ISKA 4XDWA 2R4IA 1IQXA 3DM8A 4IPBA 4O8SA 3EBYA 1M1XB 3DY5A 1N8R4 1Q7Y4 3HIGA 1K28A 4O02B 4RZMA 2GEXA 4OK0A 3H51A 3K5TA 1VQK3 1QAKA 2A15A 3BNCA 1JKGB 4HM2B 2P0MA 4OVMA 2ZDJA 3DZLA 3FF0A 5IENA 1IVVA 3G4S3 5IG5A 5KP3A 3FZWA 3CD63 3Q90A 4R9KA 4JF8A 3A76A 1K734 1IVXA 1O7GB 2GXFA 2OWPA 2Z76A 5IG0A 2LQVA 3E99A 3FCSB 3SVAA 1RRLA 3MPHA 2XGNA 2OQEC 4WWUC 3FLJA 2CC3A 3CCQ3 1DYUA 2CG0A 4I4KA 3WMDA 2CG1A 1US1A 1YIJ3 4U13A 3MG3A 3AMOA 3HK4A 4WYKB 3F14A 3RGRA 1KWIA 4HM3B 5I97A 1HU9A 4AEQA 2RSXA 3KSPA 1KC84 5AEUB 3LT8A 3LTDA 2L4VA 3T0UA 2ZL8A 5EEOA 2CFDA 5JBSA 3N9HA 5D81A 4STDA 1WMOA 3UL5A 2K0MA 2QEX3 1Z1SA 3F40A 2CH9A 4CDLA 3NBJA 2BNGA 2MF7A 3NBRA 1M904 1K8A4 1HKXA 1QMAA 2BHMA 3X3ZA 3EC9A 3EN1B 1KD14 1LVNA 3MYTA 1TFOA 5IEPA 3JUQA 1FGMA 3EX9A 3D9RA 4J8TA 5BXQA 1ULJB 2XSHB 2CHCA 3GZYB 1A2KA 3NQZA 5CLKA 4AKYA 2C11A 3MKIA 3PCSA 3BNDA 3X41A 1QJGA 3NUVA 3F7SA 3FG4A 3S28A 1W00A 2CKFB 3TDGA 2CWTA 4AKZA 1AR0A 3LH4A 3EB8A 1YGEA 3NX0A 3LTAA 1FA3A 4NREA 3WA3A 3F8XA 3UNLA 4OUQA 2Y74A 3CCU3 1KQS2 3NXJA 4FR9A 3PS8A 2PZVA 1JB2A 1KSIA 2FGTA 1O7WB 5LC6A 3EJVA 1SJWA 2LYXA 4BTWA 1IK3A 1WMPA 4X2OA 4XM4A 4EV2A 1VQO3 1AVLA 1IV9A 2GU1A 3EF8A 4K1UA 5KP4A 3AMOB 3B8LA 4WFOA 1GD3A 3G0KA 3F9SA 3U97A 1MOLA 4HJLB 4H61A 2W56A 3LTCA 3NQYA 1EG9B 1NB3I 4ZM8A 4FMDA 1LXEA 4R1KA 2BO9B 3S67A 3SX1A 4N6TA 3JVCA 5CF2A 1M9GA 3SOAA 3CPW2 4K1VA 3WOEB 1VQ53 2OOVA 3O8YA 1TU5A 3CCL3 2STDA 3KZTA 1NU3A 3CCR3 3CPOA 3OV4A 1Q814 3CCM3 1W5ZA 4PEJA 1RRHA 1YHQ3 1GY5A 3HX8A 1A2VA 1UUVB 5AEWB 1K41A 3CCS3 3FG1A 3SLUA 3I553 1QVG2 3FF2A 1CQSA 3X3YA 3DGOA 4MMXB 3CNXA 3JUPA 1YJW3 1OHPA 2W6JH 5ELJA 2QGUA 5AI1A 1CEWI 1W02A 3LYGA 1SPUA 3J7Yd 2CFGA 1Q824 2BMRB 4K61A 3ER7A 3STDA 1EA2A 2WGQA 3HI7A 5AIHA 3PXMA 4H3UA 3BNBA 2CFLA 3CC73 3BB9A 3M8CA 2Z7AA 3KIIA 4K90B 1E97A 1Y4KA 3UB1A 1G96A 2Q07A 1EQKA 4N6MA 3GWRA 1FGTA 1W6GA 4EV5A 3FSDA 3CCV3 1UW1A 2P38A 3L0RA 1OACA 3I0YA 3K0ZA 3DUKA 2P05A 3MG1A 2Z77A 3JUOA 4RNYA 4N6V0 2KRTA 2HMKB 2IA7A 3JUNA 5IERA 3KE7A 1OPYA 3OXAA 3VSYA 1FGQA 3OWSA 1Q40B 4IIAA 1YJ93 4BTXA 1LNHA 5DREA 2WO0A 5LC7A 5IF6A 2FNQA 4HBRA 4WP5A 2XR8B 3WA2X 2PNCA 3B4OA 3B7CA 1D6YA 2RCDA 3EBTA 2IMJA 4KFEA 4WHAA 1DVDA 1IQYA 1DVCA 2CFKA 5HGRA 1E3RA 1SIHA 4FMBA 4HZ9B 1U8CB 5EVHA 3CXC2 2F99A 1LOXA 3WDGB 4HVNA 2IUKA 5JPUA 2XH9A 4KFFA 3OWYA 1VQN3 3VGNA 3X42A 1K9M4 5CF1A 1TUHA 2JDIH 1VQP3 2XFTA 2WGOA 3DXOA 1TFKA 2KCDA 3BLZA 3SOYA 1M1K4 3HIIA 3IMAB 2XSOB 4GL6A 1N8QA 1OF5A 4IT7A 3X40A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQY A;  4K90 B;  3NQZ A; 
#chains in the Genus database with same CATH topology
 5CXO A;  3F7X A;  1A67 A;  3A5E A;  3MHE A;  2YX9 A;  3S29 A;  2OQE A;  3BIR A;  5FGO A;  2IUJ A;  1RN4 A;  5TGN A;  1AV4 A;  1N9J A;  2XRX B;  3OX9 A;  1WQL B;  1C54 A;  2SAR A;  5M19 A;  2HMN B;  4N6L A;  1OUN A;  4N6N B;  3D5I A;  1JV2 B;  1BNG A;  1I0V A;  1V57 A;  1WTH A;  2HOH A;  3NM7 A;  3PYJ A;  9RNT A;  1BNF A;  2YFI B;  1RGH A;  3H3H A;  1NB5 I;  5BU4 A;  4MEI A;  2XF3 A;  3G8Z A;  1BOX A;  3B4P A;  5IEO A;  3G71 3;  2W2C A;  1JJ2 2;  1AY7 A;  3ROB A;  2QA4 3;  1B2X A;  2OOV C;  2BMO B;  3S27 A;  2W03 A;  1O7H B;  3EN8 A;  2SBL A;  4HM8 B;  1V74 A;  3T8N A;  1OHS A;  3V92 A;  2ML6 A;  4R9L A;  1ZGX A;  2D1W A;  2O9U X;  2M7O A;  1FGR A;  1TRQ A;  1UGH I;  3EE1 A;  3OWU A;  1BSA A;  5AYR B;  3GZX B;  5GSP A;  1RGE A;  3K9M C;  3MSO A;  2KAA A;  4HM0 B;  4MMZ B;  4CPK A;  2YFJ B;  4L8O A;  1I2G A;  4BU4 A;  3LZA A;  4MMY B;  3CMA 3;  1R4C A;  1G02 A;  3RGA A;  1WNH A;  4BL2 A;  3I56 3;  1DMQ A;  3VF1 A;  3G16 A;  2RGQ A;  3SYU A;  1BUQ A;  4TX4 A;  5D82 A;  1UI8 A;  4QWT A;  3WOF B;  2E2U A;  3AHS A;  1GS3 A;  1BU4 A;  1IDP A;  3EQQ B;  3NM2 A;  1W4N A;  4WYK A;  2OCT A;  1BAN A;  4R80 A;  2HMM B;  2Y73 A;  1VQ4 3;  2W9P A;  4XDV A;  2C4B A;  1LQM B;  4LSO A;  3T8U A;  1CYU A;  4CCV A;  1STF I;  1LNI A;  2W0Q A;  1O7M B;  2KF5 A;  7GSP A;  3KKG A;  4MJD A;  5IG3 A;  3DGN A;  1IQ8 A;  1JBR A;  3ALA A;  1O7P B;  4HM4 B;  4XBY A;  3CCE 3;  3D3L A;  3DGM A;  2WOF A;  2F86 B;  3GRD A;  3QK9 A;  3LOY A;  4RNT A;  1YI2 3;  4ILF A;  2K54 A;  1RCL A;  1UCL A;  1TRP A;  3BU4 A;  4HAA A;  1BNR A;  1BVI A;  1W2Z A;  1OF5 B;  2ML5 A;  1DMM A;  3PCR A;  4G1M B;  5A0O B;  1JBT A;  4XB5 A;  4HZB B;  1J2B A;  3S5C A;  4LYL B;  1LQG C;  1VQ8 3;  1TP6 A;  3LML A;  5IG4 A;  3IJE B;  2W9Q A;  3MG2 A;  3WHO A;  1D6U A;  2CW9 A;  1VQL 3;  1I70 A;  3Q3F A;  1Q9E A;  2J8X B;  2E2T A;  1JB5 A;  3KSE D;  3ZG5 A;  3ECF A;  1RNT A;  3F8H A;  1C7H A;  8CHO A;  3BNE A;  3CNM A;  1RN7 A;  1RJO A;  1ULI B;  2AAD A;  3UJM A;  3MWZ A;  4HYZ A;  4L8P A;  3U1W A;  4HM7 B;  1GOU A;  1TIJ A;  3DGL A;  1FUW A;  4FCJ A;  2CK3 H;  1A90 A;  3OW2 2;  2OTL 3;  2OTJ 3;  1FUT A;  5G1K A;  2K3D A;  1F8N A;  1ROV A;  2P0X A;  1OH0 A;  2CIU A;  2QIY A;  3SED A;  4GB5 A;  2INX A;  2BIR A;  3NV0 A;  5CK6 A;  2CFW A;  1T5Y A;  1N5P A;  1JN5 A;  1ROA A;  2UUG C;  3JUM A;  1YNV X;  1RGF A;  2YFL B;  3CCJ 3;  1GYB A;  1NWW A;  2BU4 A;  3LT9 A;  4NHF A;  4HM5 B;  2E2V A;  4Q53 A;  4EXR A;  8RNT A;  1I8V A;  2W56 B;  1OGX A;  1NDO B;  4EC6 A;  1RKY A;  1Q86 4;  1VZZ A;  3GZB A;  1IT8 A;  1FUS A;  3GZR A;  1L5G B;  3KFQ C;  4FMC A;  5ELU A;  1UI7 A;  2GU3 A;  5G2G A;  1STD A;  2UX0 A;  5AYS C;  5M1A A;  1D6Z A;  2F4Y A;  1QAL A;  1BUJ A;  1RGL A;  2JQ5 A;  4KVH A;  2Z6B A;  1CH0 A;  1VQM 3;  4FCM A;  4EBG A;  3N8B A;  1BRG A;  1RSN A;  7RNT A;  5M18 A;  1VQ6 3;  1RHL A;  3CU3 A;  4R4K A;  3PZW A;  1IU7 A;  1S72 3;  1GD4 A;  2XGL A;  4LEH A;  5IW9 A;  1YJN 3;  4N6O B;  1W7C A;  1IVW A;  2XEP A;  2IYJ A;  1GOY A;  3PGB A;  4HM1 B;  1X1X A;  1BRS A;  1ZX2 A;  2P09 A;  1PFP A;  3IPT A;  5AIF A;  3QRD A;  1RLS A;  2I9W A;  1BNI A;  5STD A;  3KN4 A;  4BTY A;  1W2B 2;  1NJI 4;  1RN1 A;  2D42 A;  1JNQ A;  1JB4 A;  3NHX A;  1UCI A;  4NPB A;  1QVF 2;  5JPP A;  1QAF A;  1OHO A;  2HMJ B;  3K7C A;  1SII A;  5FW5 A;  1GY7 A;  1JRQ A;  3RDE A;  2GBX B;  4O3V A;  1VQ9 3;  3N54 B;  4N3V A;  4DKI A;  3DMC A;  1VQ7 3;  4KZ1 A;  2F98 A;  4LGQ A;  3WR2 A;  1JKG A;  3X3X A;  2HMO B;  1A2P A;  1YVB I;  4EYC A;  3Q1C A;  3Q2P A;  2C10 A;  2W04 A;  3FKA A;  2O3O A;  5D83 A;  1ASK A;  1N9E A;  1W6Y A;  4X2H A;  2CWU A;  2KF6 A;  5BVB A;  1KQS 2;  1MNL A;  1YIT 3;  2GEY A;  3V99 A;  1Q42 A;  1DET A;  2BT3 A;  2RFR A;  1IVU A;  4FCZ A;  4J9A A;  3FH1 A;  3DH2 A;  4JRF A;  2B1X B;  3CME 3;  2CX1 A;  3CC2 3;  1PU4 A;  1BRH A;  1DMN A;  4KFD A;  3NV0 B;  4XBX A;  3SXX A;  5EQL A;  1GY6 A;  1MGW A;  1JN5 B;  4HM6 B;  1CYV A;  4RNZ A;  3WOD G;  5DRV A;  3NBB A;  1MWT A;  3HZP A;  3LTB A;  7STD A;  2V1L A;  2XFS A;  1SQW A;  1W01 A;  1AVK A;  1OGZ A;  2H0I A;  3D5G A;  1U5O A;  2HML B;  1ZO2 A;  2BMQ B;  2WOH A;  1O7N B;  4O2H A;  5KP1 A;  3D79 A;  1TTO A;  4ORL A;  1OCV A;  2GBW B;  1Q40 A;  2CWV A;  2H0G A;  3KCH A;  1RGK A;  3GAX A;  1WMN A;  3LXU X;  3G6E 3;  1E3V A;  3V98 A;  1IT7 A;  4LMI A;  2KXG A;  5AII A;  1IV7 A;  2B24 B;  4N6U A;  4RBN A;  3FGY A;  4LZI A;  1W6C A;  2F5W A;  2MC8 A;  2FXT A;  3K63 A;  4L7K A;  1FGO A;  6STD A;  2KF3 A;  3EHC A;  4HKV B;  4FMA A;  1NO3 A;  1N5H A;  1UUW B;  3UL6 A;  1EKM A;  4XBT A;  1S5A A;  3FG3 A;  3ZFZ A;  5AIG A;  3CC4 3;  1ISK A;  4XDW A;  1RTU A;  1IQX A;  2R4I A;  3DM8 A;  1RDS A;  4IPB A;  4O8S A;  3EBY A;  1M1X B;  1MWS A;  1UCJ A;  3DY5 A;  1N8R 4;  1Q7Y 4;  3HIG A;  1K28 A;  4O02 B;  4RZM A;  2GEX A;  4OK0 A;  3H51 A;  3K5T A;  3GSP A;  1VQK 3;  1QAK A;  5HOH A;  2A15 A;  1YGW A;  3BNC A;  1JKG B;  4HM2 B;  2P0M A;  4OVM A;  2ZDJ A;  1GMP A;  3DZL A;  3FF0 A;  5IEN A;  1IVV A;  2L1S A;  3G4S 3;  5IG5 A;  2F56 A;  5KP3 A;  3FZW A;  3CD6 3;  1BRK A;  3Q90 A;  4R9K A;  1JZD A;  4JF8 A;  3A76 A;  1K73 4;  1IVX A;  1GMQ A;  1O7G B;  2GXF A;  2OWP A;  2Z76 A;  5IG0 A;  2LQV A;  3E99 A;  3FCS B;  3SVA A;  1RRL A;  3MPH A;  2XGN A;  1FZU A;  1I0X A;  2OQE C;  1I2F A;  3FLJ A;  4WWU C;  2CC3 A;  3CCQ 3;  1DYU A;  2CG0 A;  6GSP A;  4I4K A;  3WMD A;  4GSP A;  2CG1 A;  1US1 A;  1YIJ 3;  1MGR A;  4BIR A;  4U13 A;  1UUG B;  3MG3 A;  3AMO A;  3HK4 A;  4WYK B;  3F14 A;  1BSE A;  3RGR A;  1KWI A;  4HM3 B;  5I97 A;  3AHW A;  1HU9 A;  4AEQ A;  1MWU A;  2RSX A;  5RNT A;  3KSP A;  1UDI I;  1KC8 4;  2RBI A;  5AEU B;  4BL3 A;  2ZA4 A;  1HZ1 A;  3LT8 A;  2L4V A;  3LTD A;  3T0U A;  2ZL8 A;  5EEO A;  2CFD A;  5BIR A;  5JBS A;  3N9H A;  5D81 A;  1RGC A;  4STD A;  1WMO A;  2H0H A;  3D4A A;  3UL5 A;  2K0M A;  2QEX 3;  1Z1S A;  3F40 A;  2CH9 A;  4CDL A;  2CX0 A;  4KT3 B;  3NBJ A;  2BNG A;  2MF7 A;  3NBR A;  1BIR A;  1M90 4;  1K8A 4;  1HKX A;  1QMA A;  2BHM A;  3X3Z A;  3EC9 A;  1UGI A;  3EN1 B;  1KD1 4;  1LVN A;  2GSP A;  1TFO A;  3MYT A;  3JUQ A;  1FGM A;  5IEP A;  3EX9 A;  3D9R A;  4J8T A;  5BXQ A;  1GSP A;  1ULJ B;  1LRA A;  2XSH B;  2CHC A;  1X1Y A;  1A2K A;  3GZY B;  3NQZ A;  5CLK A;  4AKY A;  2C11 A;  3MKI A;  3PCS A;  3HOH A;  3BND A;  3X41 A;  1QJG A;  3NUV A;  1B27 A;  3F7S A;  3FG4 A;  1X1U A;  3AGO A;  1W00 A;  3S28 A;  2CKF B;  3TDG A;  1AQZ A;  1RCK A;  2CWT A;  4AKZ A;  1AR0 A;  3LH4 A;  1I3F A;  1I2E A;  3EB8 A;  1YGE A;  3NX0 A;  3LTA A;  1FA3 A;  4NRE A;  2KF4 A;  1G0T A;  1JBS A;  3WA3 A;  3F8X A;  3UNL A;  4OUQ A;  2Y74 A;  1BRJ A;  3URP A;  3NXJ A;  1YVS A;  4FR9 A;  3PS8 A;  3CCU 3;  1BGS A;  2PZV A;  1RNB A;  1JB2 A;  1KSI A;  2F5M A;  2FGT A;  1BSB A;  1I3I A;  1O7W B;  5LC6 A;  1LOV A;  1BAO A;  3EJV A;  3DGY A;  1SJW A;  5G1L A;  2LYX A;  1BNE A;  4BTW A;  1WMP A;  1LOW A;  1IK3 A;  2UGI A;  4X2O A;  4XM4 A;  4EV2 A;  1AVL A;  1VQO 3;  1IV9 A;  2GU1 A;  3EF8 A;  4K1U A;  1LOY A;  5KP4 A;  1T3B A;  3AMO B;  3B8L A;  4WFO A;  1GD3 A;  4HOH A;  3G0K A;  3F9S A;  4I5Q A;  1MOL A;  3U97 A;  4HJL B;  1R4Y A;  1FYS A;  1T2H A;  4H61 A;  2W56 A;  3LTC A;  3NQY A;  1EG9 B;  1NB3 I;  4ZM8 A;  1UCK A;  4FMD A;  1LXE A;  4R1K A;  2BO9 B;  3S67 A;  3SX1 A;  4N6T A;  3JVC A;  5CF2 A;  1M9G A;  3SOA A;  3CPW 2;  1BSC A;  4K1V A;  3WOE B;  1B2U A;  2OOV A;  1B2M A;  1VQ5 3;  3O8Y A;  1TU5 A;  3CCL 3;  2STD A;  3KZT A;  1NU3 A;  4CJN A;  3CCR 3;  1VQQ A;  3CPO A;  3OV4 A;  3CCM 3;  1Q81 4;  1W5Z A;  4PEJ A;  1GMR A;  1RRH A;  1EUI C;  1YHQ 3;  1GY5 A;  1GOV A;  2ZHX B;  3HX8 A;  1A2V A;  1RGG A;  1UUV B;  5AEW B;  1K41 A;  3CCS 3;  1HYF A;  3FG1 A;  2R41 A;  3SLU A;  3I55 3;  1QVG 2;  3FF2 A;  1CQS A;  3X3Y A;  3DGO A;  4MMX B;  3CNX A;  3JUP A;  1YJW 3;  1OHP A;  2W6J H;  1BRN L;  5ELJ A;  1B3S A;  2QGU A;  1CEW I;  1B20 A;  1W02 A;  3LYG A;  5AI1 A;  1RGA A;  3ZG0 A;  1SPU A;  3J7Y d;  2CFG A;  1Q82 4;  4J5K A;  1B2Z A;  2BMR B;  4K61 A;  3ER7 A;  3STD A;  1EA2 A;  2WGQ A;  1RMS A;  3HI7 A;  5AIH A;  4GHO A;  3PXM A;  4H3U A;  3BNB A;  2CFL A;  1PY3 A;  3CC7 3;  3BB9 A;  3M8C A;  2Z7A A;  1SAR A;  3KII A;  2RNT A;  2AAE A;  4K90 B;  1E97 A;  1Y4K A;  3UB1 A;  1B21 A;  1G96 A;  4J5G A;  1BSD A;  2Q07 A;  1JZO A;  4N6M A;  3GWR A;  1EQK A;  1FGT A;  1W6G A;  4EV5 A;  3FSD A;  3CCV 3;  1UW1 A;  2P38 A;  3L0R A;  1OAC A;  3I0Y A;  3K0Z A;  1EEJ A;  3DUK A;  2P05 A;  2IY2 A;  3MG1 A;  2Z77 A;  3JUO A;  4RNY A;  4N6V 0;  2KRT A;  1BNJ A;  2HMK B;  2IA7 A;  1Q7H A;  3JUN A;  4EW5 A;  5IER A;  3KE7 A;  1OPY A;  1NNV A;  3OXA A;  3VSY A;  1FGQ A;  3OWS A;  1Q40 B;  4IIA A;  1YJ9 3;  4BTX A;  1LNH A;  5DRE A;  2WO0 A;  5LC7 A;  3RNT A;  6RNT A;  5IF6 A;  2FNQ A;  4HBR A;  1BNS A;  4WP5 A;  2XR8 B;  3WA2 X;  2PNC A;  3B4O A;  3B7C A;  1D6Y A;  2RCD A;  3EBT A;  2IMJ A;  4KFE A;  4WHA A;  1DVD A;  1IQY A;  1DVC A;  2CFK A;  5HGR A;  1E3R A;  1SIH A;  1FW7 A;  3AGN A;  4FMB A;  1ZS7 A;  1U8C B;  4HZ9 B;  5EVH A;  3CXC 2;  2F99 A;  1V58 A;  1LOX A;  3WDG B;  4HVN A;  2IUK A;  5JPU A;  1T2I A;  2XH9 A;  4KFF A;  3OWY A;  1DE3 A;  1VQN 3;  1MWR A;  3VGN A;  3X42 A;  1TJD A;  5CF1 A;  1K9M 4;  1TUH A;  2JDI H;  1VQP 3;  2XFT A;  2WGO A;  3DXO A;  1TFK A;  2KCD A;  3BLZ A;  1B2S A;  1BRI A;  1PYL A;  1X1W A;  3SOY A;  1M1K 4;  3HII A;  3IMA B;  2XSO B;  4GL6 A;  1N8Q A;  1OF5 A;  1IYY A;  4IT7 A;  3X40 A; 
#chains in the Genus database with same CATH homology
 5CXO A;  3F7X A;  1A67 A;  3MHE A;  2YX9 A;  3S29 A;  2OQE A;  5FGO A;  2IUJ A;  5TGN A;  1AV4 A;  1N9J A;  2XRX B;  3OX9 A;  1WQL B;  2HMN B;  4N6L A;  1OUN A;  4N6N B;  1JV2 B;  1WTH A;  3PYJ A;  3NM7 A;  2YFI B;  3H3H A;  1NB5 I;  4MEI A;  2XF3 A;  3G8Z A;  3B4P A;  5IEO A;  3G71 3;  1JJ2 2;  2W2C A;  3ROB A;  2QA4 3;  2OOV C;  2BMO B;  3S27 A;  2W03 A;  1O7H B;  3EN8 A;  2SBL A;  4HM8 B;  1V74 A;  3T8N A;  1OHS A;  3V92 A;  2ML6 A;  4R9L A;  2D1W A;  2O9U X;  2M7O A;  1FGR A;  3EE1 A;  3OWU A;  5AYR B;  3GZX B;  3MSO A;  3K9M C;  4HM0 B;  4MMZ B;  1S72 3;  2YFJ B;  4L8O A;  3LZA A;  4MMY B;  3CMA 3;  1R4C A;  3RGA A;  3I56 3;  1WNH A;  1DMQ A;  3VF1 A;  3G16 A;  2RGQ A;  1BUQ A;  4TX4 A;  5D82 A;  1UI8 A;  4QWT A;  3WOF B;  2E2U A;  1GS3 A;  1IDP A;  3EQQ B;  3NM2 A;  1W4N A;  4WYK A;  2OCT A;  4R80 A;  2HMM B;  2Y73 A;  1VQ4 3;  2W9P A;  4XDV A;  4LSO A;  3T8U A;  1CYU A;  4CCV A;  1STF I;  2W0Q A;  1O7M B;  5IG3 A;  3KKG A;  4MJD A;  3DGN A;  1IQ8 A;  3ALA A;  1O7P B;  4HM4 B;  4XBY A;  3CCE 3;  3D3L A;  3DGM A;  2WOF A;  2F86 B;  3GRD A;  3QK9 A;  3LOY A;  1YI2 3;  2K54 A;  1W2Z A;  1OF5 B;  2ML5 A;  1DMM A;  3PCR A;  4G1M B;  5A0O B;  4XB5 A;  4HZB B;  1J2B A;  3S5C A;  1VQ8 3;  1TP6 A;  3LML A;  5IG4 A;  3IJE B;  2W9Q A;  3MG2 A;  1D6U A;  2CW9 A;  1VQL 3;  2E2T A;  1JB5 A;  3KSE D;  3ECF A;  3F8H A;  1C7H A;  8CHO A;  3BNE A;  3CNM A;  1RN7 A;  1RJO A;  1ULI B;  3UJM A;  3MWZ A;  4HYZ A;  4L8P A;  3U1W A;  4HM7 B;  1TIJ A;  3DGL A;  1FUW A;  4FCJ A;  2CK3 H;  1A90 A;  3OW2 2;  2OTL 3;  2OTJ 3;  2P0X A;  1F8N A;  1ROV A;  1OH0 A;  2CIU A;  2QIY A;  3SED A;  4GB5 A;  2INX A;  3NV0 A;  5CK6 A;  2CFW A;  1T5Y A;  1N5P A;  1JN5 A;  1ROA A;  3JUM A;  2YFL B;  3CCJ 3;  1GYB A;  1NWW A;  3LT9 A;  4NHF A;  4HM5 B;  2E2V A;  4Q53 A;  4EXR A;  2W56 B;  1OGX A;  1NDO B;  4EC6 A;  1RKY A;  1Q86 4;  1VZZ A;  3GZB A;  1IT8 A;  1L5G B;  3GZR A;  3KFQ C;  4FMC A;  5ELU A;  1UI7 A;  2GU3 A;  5G2G A;  1STD A;  2UX0 A;  5AYS C;  1D6Z A;  1QAL A;  2JQ5 A;  4KVH A;  2Z6B A;  1VQM 3;  4FCM A;  4EBG A;  3N8B A;  1VQ6 3;  3CU3 A;  4R4K A;  3PZW A;  1IU7 A;  1GD4 A;  2XGL A;  4LEH A;  5IW9 A;  1YJN 3;  4N6O B;  1W7C A;  1IVW A;  2XEP A;  3PGB A;  4HM1 B;  2P09 A;  1ZX2 A;  3IPT A;  5AIF A;  1PFP A;  3QRD A;  2I9W A;  4BTY A;  5STD A;  3KN4 A;  1W2B 2;  1NJI 4;  2D42 A;  1JNQ A;  1JB4 A;  3NHX A;  1QVF 2;  5JPP A;  1QAF A;  1OHO A;  2HMJ B;  3K7C A;  1SII A;  5FW5 A;  1GY7 A;  1JRQ A;  3RDE A;  2GBX B;  4O3V A;  1VQ9 3;  3N54 B;  4N3V A;  3DMC A;  1VQ7 3;  4KZ1 A;  2F98 A;  4LGQ A;  3X3X A;  1JKG A;  2HMO B;  1YVB I;  4EYC A;  3Q1C A;  3Q2P A;  2C10 A;  2W04 A;  3FKA A;  2O3O A;  5D83 A;  1ASK A;  1N9E A;  1W6Y A;  4X2H A;  2CWU A;  5BVB A;  1MNL A;  1YIT 3;  2GEY A;  3V99 A;  1Q42 A;  2BT3 A;  2RFR A;  4FCZ A;  1IVU A;  4J9A A;  3FH1 A;  4JRF A;  2B1X B;  3CME 3;  3CC2 3;  1PU4 A;  1DMN A;  4KFD A;  3NV0 B;  4XBX A;  3SXX A;  5EQL A;  1GY6 A;  1JN5 B;  4HM6 B;  1CYV A;  4RNZ A;  3WOD G;  5DRV A;  3NBB A;  3HZP A;  3LTB A;  7STD A;  2V1L A;  2XFS A;  1SQW A;  1W01 A;  1AVK A;  1OGZ A;  1U5O A;  2HML B;  1ZO2 A;  2BMQ B;  2WOH A;  1O7N B;  4O2H A;  5KP1 A;  4ORL A;  1OCV A;  2GBW B;  1Q40 A;  2CWV A;  3G6E 3;  3GAX A;  1WMN A;  3LXU X;  1E3V A;  3V98 A;  1IT7 A;  4LMI A;  2KXG A;  5AII A;  1IV7 A;  2B24 B;  4N6U A;  4RBN A;  3FGY A;  4LZI A;  1W6C A;  2MC8 A;  2FXT A;  3K63 A;  4L7K A;  1FGO A;  6STD A;  3EHC A;  4HKV B;  4FMA A;  1NO3 A;  1N5H A;  1UUW B;  3UL6 A;  1EKM A;  4XBT A;  1S5A A;  3FG3 A;  5AIG A;  3CC4 3;  1ISK A;  4XDW A;  2R4I A;  1IQX A;  3DM8 A;  4IPB A;  4O8S A;  3EBY A;  1M1X B;  3DY5 A;  1N8R 4;  1Q7Y 4;  3HIG A;  1K28 A;  4O02 B;  4RZM A;  2GEX A;  4OK0 A;  3H51 A;  3K5T A;  1VQK 3;  1QAK A;  2A15 A;  3BNC A;  1JKG B;  4HM2 B;  2P0M A;  4OVM A;  2ZDJ A;  3DZL A;  3FF0 A;  5IEN A;  1IVV A;  3G4S 3;  5IG5 A;  5KP3 A;  3FZW A;  3CD6 3;  3Q90 A;  4R9K A;  4JF8 A;  3A76 A;  1K73 4;  1IVX A;  1O7G B;  2GXF A;  2OWP A;  2Z76 A;  5IG0 A;  2LQV A;  3E99 A;  3FCS B;  3SVA A;  1RRL A;  3MPH A;  2XGN A;  2OQE C;  4WWU C;  3FLJ A;  2CC3 A;  3CCQ 3;  1DYU A;  2CG0 A;  4I4K A;  3WMD A;  2CG1 A;  1US1 A;  1YIJ 3;  4U13 A;  3MG3 A;  3AMO A;  3HK4 A;  4WYK B;  3F14 A;  3RGR A;  1KWI A;  4HM3 B;  5I97 A;  1HU9 A;  4AEQ A;  2RSX A;  3KSP A;  1KC8 4;  5AEU B;  3LT8 A;  3LTD A;  2L4V A;  3T0U A;  2ZL8 A;  5EEO A;  2CFD A;  5JBS A;  3N9H A;  5D81 A;  4STD A;  1WMO A;  3UL5 A;  2K0M A;  2QEX 3;  1Z1S A;  3F40 A;  2CH9 A;  4CDL A;  3NBJ A;  2BNG A;  2MF7 A;  3NBR A;  1M90 4;  1K8A 4;  1HKX A;  1QMA A;  2BHM A;  3X3Z A;  3EC9 A;  3EN1 B;  1KD1 4;  1LVN A;  3MYT A;  1TFO A;  5IEP A;  3JUQ A;  1FGM A;  3EX9 A;  3D9R A;  4J8T A;  5BXQ A;  1ULJ B;  2XSH B;  2CHC A;  3GZY B;  1A2K A;  3NQZ A;  5CLK A;  4AKY A;  2C11 A;  3MKI A;  3PCS A;  3BND A;  3X41 A;  1QJG A;  3NUV A;  3F7S A;  3FG4 A;  3S28 A;  1W00 A;  2CKF B;  3TDG A;  2CWT A;  4AKZ A;  1AR0 A;  3LH4 A;  3EB8 A;  1YGE A;  3NX0 A;  3LTA A;  1FA3 A;  4NRE A;  3WA3 A;  3F8X A;  3UNL A;  4OUQ A;  2Y74 A;  3CCU 3;  1KQS 2;  3NXJ A;  4FR9 A;  3PS8 A;  2PZV A;  1JB2 A;  1KSI A;  2FGT A;  1O7W B;  5LC6 A;  3EJV A;  1SJW A;  2LYX A;  4BTW A;  1IK3 A;  1WMP A;  4X2O A;  4XM4 A;  4EV2 A;  1VQO 3;  1AVL A;  1IV9 A;  2GU1 A;  3EF8 A;  4K1U A;  5KP4 A;  3AMO B;  3B8L A;  4WFO A;  1GD3 A;  3G0K A;  3F9S A;  3U97 A;  1MOL A;  4HJL B;  4H61 A;  2W56 A;  3LTC A;  3NQY A;  1EG9 B;  1NB3 I;  4ZM8 A;  4FMD A;  1LXE A;  4R1K A;  2BO9 B;  3S67 A;  3SX1 A;  4N6T A;  3JVC A;  5CF2 A;  1M9G A;  3SOA A;  3CPW 2;  4K1V A;  3WOE B;  1VQ5 3;  2OOV A;  3O8Y A;  1TU5 A;  3CCL 3;  2STD A;  3KZT A;  1NU3 A;  3CCR 3;  3CPO A;  3OV4 A;  1Q81 4;  3CCM 3;  1W5Z A;  4PEJ A;  1RRH A;  1YHQ 3;  1GY5 A;  3HX8 A;  1A2V A;  1UUV B;  5AEW B;  1K41 A;  3CCS 3;  3FG1 A;  3SLU A;  3I55 3;  1QVG 2;  3FF2 A;  1CQS A;  3X3Y A;  3DGO A;  4MMX B;  3CNX A;  3JUP A;  1YJW 3;  1OHP A;  2W6J H;  5ELJ A;  2QGU A;  5AI1 A;  1CEW I;  1W02 A;  3LYG A;  1SPU A;  3J7Y d;  2CFG A;  1Q82 4;  2BMR B;  4K61 A;  3ER7 A;  3STD A;  1EA2 A;  2WGQ A;  3HI7 A;  5AIH A;  3PXM A;  4H3U A;  3BNB A;  2CFL A;  3CC7 3;  3BB9 A;  3M8C A;  2Z7A A;  3KII A;  4K90 B;  1E97 A;  1Y4K A;  3UB1 A;  1G96 A;  2Q07 A;  1EQK A;  4N6M A;  3GWR A;  1FGT A;  1W6G A;  4EV5 A;  3FSD A;  3CCV 3;  1UW1 A;  2P38 A;  3L0R A;  1OAC A;  3I0Y A;  3K0Z A;  3DUK A;  2P05 A;  3MG1 A;  2Z77 A;  3JUO A;  4RNY A;  4N6V 0;  2KRT A;  2HMK B;  2IA7 A;  3JUN A;  5IER A;  3KE7 A;  1OPY A;  3OXA A;  3VSY A;  1FGQ A;  3OWS A;  1Q40 B;  4IIA A;  1YJ9 3;  4BTX A;  1LNH A;  5DRE A;  2WO0 A;  5LC7 A;  5IF6 A;  2FNQ A;  4HBR A;  4WP5 A;  2XR8 B;  3WA2 X;  2PNC A;  3B4O A;  3B7C A;  1D6Y A;  2RCD A;  3EBT A;  2IMJ A;  4KFE A;  4WHA A;  1DVD A;  1IQY A;  1DVC A;  2CFK A;  5HGR A;  1E3R A;  1SIH A;  4FMB A;  4HZ9 B;  1U8C B;  5EVH A;  3CXC 2;  2F99 A;  1LOX A;  3WDG B;  4HVN A;  2IUK A;  5JPU A;  2XH9 A;  4KFF A;  3OWY A;  1VQN 3;  3VGN A;  3X42 A;  1K9M 4;  5CF1 A;  1TUH A;  2JDI H;  1VQP 3;  2XFT A;  2WGO A;  3DXO A;  1TFK A;  2KCD A;  3BLZ A;  3SOY A;  1M1K 4;  3HII A;  3IMA B;  2XSO B;  4GL6 A;  1N8Q A;  1OF5 A;  4IT7 A;  3X40 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...