4K90B

Extracellular metalloproteinase from aspergillus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
207
Chain Sequence
TVDLNAFRLKSLAKYVNATETVIEAPSPQSYVEVATQHVKMIAPDATFRVVDDHYVGDNGVAHVHFRQTANGLDIDNADFNVNVGKDGKVFSYGNSFYTGQIPSSAALTKRDFSDPVTALKGTTNTLQLPITVDSASSESTKESYVFKGVSGTVSDPKAKLVYFVKDDGTLALAWRVETDIDSNWLLTYIDAKSGEEIHGVVDYVAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A functional and structural study of the major metalloprotease secreted by the pathogenic fungus Aspergillus fumigatus.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Hydrolase
molecule keywords Extracellular metalloproteinase mep
total genus 46
structure length 207
sequence length 215
ec nomenclature ec 3.4.24.-:
pdb deposition date 2013-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07504 FTP Fungalysin/Thermolysin Propeptide Motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.490 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4k90B00
3NQZA 3NQYA 4K90B
chains in the Genus database with same CATH superfamily
1BRHA 2A15A 1YIT3 3K7CA 4XDWA 1OHSA 2Q07A 2LYXA 1RTUA 1I2EA 1IYYA 3RDEA 2W9PA 1W2ZA 1AVKA 1N9JA 3F9SA 1PY3A 1GOUA 3GWRA 3STDA 1IQYA 1VQ63 5D81A 1C54A 1GD4A 1V74A 1HU9A 3WDGB 1FUSA 1OF5A 1BUQA 1T2HA 3GZXB 1OH0A 3KE7A 1UCJA 4HM5B 2XEPA 1IQ8A 3X3XA 4HM6B 2E2TA 2BU4A 1AY7A 1RDSA 1FYSA 1M1K4 4MMXB 1STFI 2XSOB 3PCRA 5CK6A 1IV7A 4LZIA 2YFJB 4MJDA 1QJGA 3DXOA 1JRQA 2CX1A 4FMDA 1BNIA 1NDOB 1IVWA 1CYUA 3DGMA 2B24B 3B4PA 3F14A 4HZBB 3B4OA 2CKFB 1NB3I 1CQSA 3WOEB 1B3SA 1RCKA 2I9WA 1LXEA 5D82A 1V58A 1D6UA 2KCDA 3CC23 3G8ZA 3WHOA 1N8R4 2JQ5A 3KKGA 1X1XA 3CCJ3 1KWIA 3I0YA 5CXOA 5BU4A 3D3LA 2ML6A 1IVXA 1M9GA 4BU4A 1A2PA 3B8LA 3PGBA 4KFEA 4AKYA 3EN8A 1K41A 2CFDA 1JNQA 2ML5A 1U8CB 2OQEA 1JZOA 1YI23 3SYUA 3WR2A 2GBWB 2WOHA 4AKZA 2MC8A 4TX4A 1M1XB 1PYLA 1VQ73 1BUJA 1CYVA 7RNTA 3CC73 3BIRA 2IA7A 5AI1A 1RGAA 1BRIA 1I0VA 1STDA 2E2VA 3KIIA 1TFOA 3MHEA 2F5MA 3AHSA 3KCHA 4U13A 6RNTA 1YHQ3 4CCVA 3CD63 1I3FA 5KP4A 1MWRA 1LRAA 2RCDA 1R4YA 5AYRB 2CWUA 3D5IA 5FGOA 3CCE3 3FF0A 3HX8A 1JN5B 1SARA 2XFTA 3S28A 4X2OA 2V1LA 1SPUA 1JKGA 2AADA 2XSHB 4BL2A 4CJNA 3I563 3T8UA 1VQK3 3X3ZA 1MWUA 2P0MA 1ZS7A 1RRLA 1IT7A 3NQZA 4WWUC 3HZPA 1S5AA 3MG1A 5EQLA 1A2KA 2HMMB 4HVNA 3OWSA 3BLZA 1YVSA 1LOYA 1T2IA 3RGRA 1QAFA 4N3VA 2IY2A 4HM7B 1G0TA 4WHAA 1GS3A 1VZZA 1BSEA 1O7MB 5I97A 1TU5A 5FW5A 1AV4A 1NB5I 1KQS2 2BHMA 3CNXA 1YGEA 2KRTA 3GZRA 2F5WA 4EV5A 3CME3 3X42A 1OPYA 1FW7A 1AVLA 3OWYA 1ROAA 2UX0A 4N6V0 1RMSA 1E3VA 4XBXA 1B2UA 4BL3A 3I553 3EHCA 2W0QA 1OGXA 2ZL8A 3BNBA 3EBYA 1UGIA 1PFPA 2F86B 3F7SA 1BNGA 2QGUA 1B2XA 2Z77A 3B7CA 1JJ22 2XGNA 2GEYA 1BU4A 2BIRA 1JBSA 3DGNA 2MF7A 2D42A 3CCL3 5AIFA 4WYKA 3PZWA 3ZFZA 2YFIB 3EF8A 1MNLA 1RHLA 4ZM8A 4RNZA 2CWTA 3S67A 2GBXB 1B2SA 1Q7HA 2P09A 1SQWA 2QIYA 2R4IA 3PS8A 4MMYB 3WA3A 4IT7A 1K9M4 3FGYA 4KT3B 1RN1A 5GSPA 3NBJA 1JB2A 3NV0B 5KP3A 3RNTA 2BMQB 1WMNA 3PCSA 1US1A 5G1KA 4DKIA 1O7WB 2CH9A 5CF2A 4O8SA 2WGQA 4WYKB 3VF1A 4XDVA 3T0UA 3DMCA 1EA2A 4K1UA 4HM8B 1BRSA 2CC3A 4J9AA 5D83A 3G713 1EUIC 2BNGA 1VQ53 4IIAA 5ELJA 1I70A 3FF2A 1JBTA 4MMZB 1T3BA 2FNQA 2W56A 4FCMA 1BOXA 1MWSA 1TIJA 3BNCA 1LQGC 1VQM3 1Q7Y4 1RN7A 1ROVA 4NPBA 4WP5A 1W6CA 1BAOA 1Q40A 1DMQA 3Q90A 2W6JH 3DH2A 3TDGA 1YIJ3 1T5YA 1ULIB 3MPHA 2XF3A 3NM7A 3F7XA 2H0GA 3K5TA 3WA2X 4HM2B 1E97A 1Z1SA 2C4BA 1VQ83 3UNLA 2HMKB 3KFQC 1TUHA 5G2GA 1LNHA 4HM0B 1GMRA 4LSOA 4Q53A 1B27A 1UGHI 1TTOA 1N9EA 4L8PA 4N6NB 4CPKA 5AIHA 1BSAA 4RBNA 1S723 2RBIA 4FMAA 3F8HA 1LOVA 3FSDA 1LQMB 1O7GB 3NHXA 2AAEA 1RGLA 3HK4A 2BO9B 4XM4A 3FG3A 1W6GA 4J8TA 1W6YA 1QAKA 2KF6A 2C11A 3DM8A 3KN4A 5HOHA 3FCSB 3QK9A 4RZMA 2UUGC 1NU3A 1EEJA 3CCS3 7GSPA 2LQVA 3FG1A 4JF8A 1TFKA 3JUNA 1YJ93 1ULJB 2KF3A 1OF5B 1UCIA 2J8XB 2XR8B 4R9KA 3J7Yd 1SJWA 4LGQA 1MGRA 1I0XA 3GZYB 5IEOA 4R9LA 1ZGXA 1X1UA 1OHOA 1NO3A 4FMCA 1UUWB 1UI7A 5A0OB 2QEX3 1Q824 1DVCA 1JBRA 2RFRA 1EKMA 2GEXA 4J5GA 3ROBA 1YJN3 1UDII 8CHOA 4K61A 1IVVA 2GSPA 4ORLA 1U5OA 1JZDA 1FGTA 1TRQA 4WFOA 3UL5A 2FXTA 5BVBA 1N5PA 1DE3A 1W01A 1OUNA 3MG2A 5LC6A 3V92A 1NNVA 5DREA 1SIIA 2OWPA 4FCZA 2STDA 4GSPA 3SEDA 1CEWI 1TJDA 3CU3A 1GYBA 2F56A 4X2HA 3X3YA 1K28A 1I8VA 1NWWA 4EYCA 3VGNA 1VQN3 3EJVA 1KC84 1RKYA 3MSOA 2SARA 4FCJA 3KSPA 4BTWA 4R1KA 1JB5A 1Q864 1PU4A 4O3VA 1Q42A 3DY5A 3WMDA 3FH1A 2QA43 3Q3FA 1BANA 3JUOA 3ZG0A 3D4AA 3A5EA 2WO0A 3JUQA 1YNVX 3EB8A 1BNRA 1K8A4 4GL6A 3AGOA 2H0IA 4BTXA 2BMOB 1TRPA 1WQLB 2W04A 1CH0A 3IPTA 3N9HA 1JN5A 3NBBA 4GHOA 3QRDA 1BSDA 1I3IA 1R4CA 1Y4KA 2IUKA 2Z7AA 1JB4A 3GZBA 3H3HA 1L5GB 1NJI4 3LTCA 1DMNA 2KAAA 4O02B 3BU4A 4XBYA 5M18A 1IT8A 1WMPA 3IJEB 1IQXA 3MYTA 1BNEA 5M19A 2OTL3 1RNBA 3FZWA 3LTAA 1VQP3 3SLUA 1WTHA 5CLKA 2W03A 1O7HB 2CFGA 5TGNA 1RLSA 1A67A 4EXRA 1RGGA 2XFSA 3FLJA 1KD14 3NX0A 5EEOA 2L4VA 1BGSA 1A90A 5HGRA 4CDLA 1M904 1K734 2KF4A 1YJW3 3K9MC 1FUTA 1MOLA 2GXFA 1N5HA 2HMOB 2R41A 3BNEA 5IG3A 4IPBA 3EQQB 3HOHA 2CW9A 2OQEC 3PYJA 2SBLA 4RNTA 3FG4A 4HZ9B 3EN1B 3OV4A 1RGFA 3SOYA 2Z76A 5KP1A 1YGWA 1DYUA 2H0HA 2K3DA 3A76A 3S29A 3PXMA 1I2FA 1BNFA 4N6UA 1FGRA 1GY5A 6GSPA 2IYJA 1E3RA 2F98A 1OACA 3OX9A 4R4KA 3MG3A 1IV9A 2FGTA 3OXAA 1AQZA 2E2UA 2KXGA 5AEUB 4LMIA 2GU1A 3NXJA 1GY6A 2PZVA 3CPOA 1UCKA 3GAXA 5CF1A 1D6ZA 3G4S3 1ASKA 3AMOB 2CIUA 2CFWA 4OUQA 1HYFA 2Z6BA 3VSYA 1YVBI 4HKVB 1W00A 1JV2B 1BNSA 4LYLB 5BIRA 1VQ43 1DETA 2O3OA 4OK0A 4G1MB 2RSXA 1EG9B 1UUVB 2IUJA 4KFDA 4L7KA 3LT9A 3Q2PA 3NUVA 4KFFA 1OGZA 3NV0A 3N8BA 1BRGA 2YFLB 1QVG2 2P05A 5IENA 2CG0A 2IMJA 1Q40B 2C10A 4AEQA 5DRVA 2WOFA 1I2GA 3L0RA 4I4KA 1BRJA 1UW1A 1KSIA 1ZO2A 2CHCA 3BB9A 3DUKA 2CX0A 2Y74A 2W56B 1DVDA 3SXXA 3WODG 3KZTA 1B2MA 4KZ1A 5JBSA 4HAAA 3JUMA 1BNJA 3SX1A 1RJOA 5AYSC 2W2CA 4NREA 3CCR3 1N8QA 1X1YA 3D9RA 4HM4B 1X1WA 3IMAB 3EE1A 4FR9A 5IG0A 4HM3B 5JPPA 3CCM3 1B20A 1AR0A 1D6YA 1LOXA 3DGOA 2P0XA 3CCQ3 1O7PB 1G96A 3LTDA 2CFLA 4N6OB 2K54A 3F8XA 1BRKA 4MEIA 2RGQA 1BSCA 2K0MA 1VQQA 3LH4A 1W5ZA 1GSPA 4HJLB 1B21A 4NHFA 3HIIA 3KSED 2OOVC 5EVHA 1UCLA 1J2BA 3BNDA 1FGQA 3O8YA 3LYGA 1LOWA 4N6LA 1FUWA 3AMOA 3U1WA 2B1XB 3N54B 3CNMA 1JKGB 5AIGA 1GOVA 1G02A 5STDA 3LT8A 5G1LA 4GB5A 3G0KA 3G6E3 2WGOA 1V57A 3Q1CA 2BMRB 6STDA 1B2ZA 1LVNA 5IF6A 9RNTA 4I5QA 3GRDA 4XB5A 1BVIA 1SIHA 7STDA 3G16A 4O2HA 3RGAA 3S5CA 3CPW2 3JUPA 1VQO3 3CXC2 1FZUA 1TP6A 2JDIH 4HBRA 3K0ZA 1UI8A 2XH9A 2OCTA 1IK3A 1HZ1A 3HI7A 1BSBA 3CCV3 5IG5A 2CK3H 1FGOA 1W7CA 2HOHA 1W4NA 3SOAA 2KF5A 2ZA4A 3LOYA 3CCU3 1GD3A 4PEJA 4H61A 4QWTA 1RSNA 1QMAA 3M8CA 1W2B2 3CC43 1RGCA 5M1AA 1C7HA 1UUGB 2INXA 5IG4A 1VQL3 3AHWA 3V99A 1ZX2A 2O9UX 1FA3A 2ZDJA 2RNTA 1QALA 3WOFB 2XRXB 1GMQA 3OW22 2OTJ3 2F99A 3OWUA 3X41A 2XGLA 3URPA 5AEWB 3AGNA 5RNTA 2GU3A 3NQYA 3D79A 5BXQA 2UGIA 2D1WA 2HMNB 3E99A 4EC6A 4FMBA 2F4YA 1EQKA 3DGYA 3DGLA 3LMLA 3LZAA 4R80A 2P38A 5IEPA 1MWTA 2L1SA 1RGEA 1RN4A 4K1VA 3T8NA 5IW9A 3ER7A 4N6MA 4L8OA 4OVMA 1RNTA 1BRNL 3LXUX 4HYZA 3UJMA 3EC9A 3K63A 4HOHA 1Q814 1GOYA 2HMJB 1BIRA 3F40A 1WNHA 8RNTA 4STDA 4J5KA 3HIGA 3H51A 1OHPA 5IERA 1O7NB 3UL6A 2CFKA 2ZHXB 1A2VA 3MKIA 3ZG5A 2Y73A 1ISKA 1LNIA 3MWZA 4LEHA 1RRHA 4RNYA 1W02A 5ELUA 5LC7A 1IVUA 3CMA3 1RGHA 1Q9EA 4BIRA 2W9QA 3SVAA 2YX9A 5JPUA 1GY7A 1MGWA 4EV2A 1QVF2 1F8NA 1DMMA 4XBTA 3LTBA 3NM2A 3UB1A 3D5GA 4EBGA 2OOVA 3DZLA 1IU7A 1FGMA 3GSPA 3FKAA 4JRFA 5AIIA 4K90B 4EW5A 1OCVA 1VQ93 2PNCA 3EX9A 1WMOA 3EBTA 1RGKA 4BTYA 1IDPA 4HM1B 3U97A 2BT3A 1RCLA 2HMLB 3JVCA 4N6TA 1GMPA 3ALAA 4KVHA 4H3UA 2CWVA 3V98A 3NBRA 3X40A 3ECFA 1HKXA 2CG1A 2M7OA 4ILFA 3S27A
chains in the Genus database with same CATH topology
2A15A 1YIT3 3K7CA 4XDWA 1OHSA 2Q07A 2LYXA 3RDEA 2W9PA 1W2ZA 1AVKA 1N9JA 3F9SA 3GWRA 3STDA 1IQYA 1VQ63 5D81A 1GD4A 1V74A 1HU9A 3WDGB 1OF5A 1BUQA 3GZXB 1OH0A 3KE7A 4HM5B 2XEPA 1IQ8A 3X3XA 4HM6B 2E2TA 1M1K4 4MMXB 1STFI 2XSOB 3PCRA 5CK6A 1IV7A 4LZIA 2YFJB 4MJDA 1QJGA 3DXOA 1JRQA 4FMDA 1NDOB 1IVWA 1CYUA 3DGMA 2B24B 3B4PA 3F14A 4HZBB 3B4OA 2CKFB 1NB3I 1CQSA 3WOEB 2I9WA 1LXEA 5D82A 1D6UA 2KCDA 3CC23 3G8ZA 1N8R4 2JQ5A 3KKGA 3CCJ3 1KWIA 3I0YA 5CXOA 3D3LA 2ML6A 1IVXA 1M9GA 3B8LA 3PGBA 4KFEA 4AKYA 3EN8A 1K41A 2CFDA 1JNQA 2ML5A 1U8CB 2OQEA 1YI23 4AKZA 2GBWB 2WOHA 2MC8A 4TX4A 1M1XB 1VQ73 1CYVA 3CC73 2IA7A 5AI1A 1STDA 2E2VA 3KIIA 3MHEA 1TFOA 4U13A 3CD63 1YHQ3 4CCVA 5KP4A 2RCDA 5AYRB 2CWUA 5FGOA 3CCE3 3FF0A 3HX8A 1JN5B 2XFTA 3S28A 4X2OA 2V1LA 1SPUA 1JKGA 2XSHB 3I563 3T8UA 1VQK3 3X3ZA 2P0MA 3NQZA 1RRLA 1IT7A 4WWUC 3HZPA 1S5AA 3MG1A 5EQLA 1A2KA 2HMMB 4HVNA 3OWSA 3BLZA 3RGRA 1QAFA 4N3VA 4HM7B 4WHAA 1GS3A 1VZZA 1O7MB 5I97A 1TU5A 5FW5A 1AV4A 1NB5I 1KQS2 2BHMA 3CNXA 1YGEA 2KRTA 3GZRA 4EV5A 3CME3 3X42A 1OPYA 1AVLA 3OWYA 1ROAA 2UX0A 4N6V0 3I553 1E3VA 4XBXA 3EHCA 2W0QA 1OGXA 2ZL8A 3BNBA 3EBYA 1PFPA 2F86B 3F7SA 2QGUA 2Z77A 3B7CA 1JJ22 2XGNA 2GEYA 3DGNA 2MF7A 2D42A 3CCL3 5AIFA 4WYKA 3PZWA 2YFIB 3EF8A 1MNLA 4ZM8A 4RNZA 2CWTA 3S67A 2GBXB 2P09A 1SQWA 2QIYA 2R4IA 3PS8A 4MMYB 3WA3A 4IT7A 1K9M4 3FGYA 3NBJA 1JB2A 3NV0B 5KP3A 2BMQB 1WMNA 3PCSA 1US1A 1O7WB 2CH9A 5CF2A 4O8SA 2WGQA 4WYKB 3VF1A 4XDVA 3T0UA 3DMCA 1EA2A 4K1UA 4HM8B 2CC3A 4J9AA 5D83A 3G713 1VQ53 2BNGA 4IIAA 5ELJA 3FF2A 4MMZB 2W56A 2FNQA 4FCMA 1TIJA 3BNCA 1VQM3 1Q7Y4 1RN7A 1ROVA 4WP5A 1W6CA 1Q40A 1DMQA 3Q90A 2W6JH 1YIJ3 3TDGA 1T5YA 1ULIB 3MPHA 2XF3A 3NM7A 3F7XA 3K5TA 3WA2X 4HM2B 1E97A 1Z1SA 1VQ83 3UNLA 2HMKB 3KFQC 1TUHA 5G2GA 1LNHA 4HM0B 4LSOA 4Q53A 4L8PA 1N9EA 4N6NB 5AIHA 4RBNA 1S723 4FMAA 3F8HA 3FSDA 1O7GB 3NHXA 3HK4A 4XM4A 2BO9B 3FG3A 1W6GA 4J8TA 1W6YA 1QAKA 2C11A 3DM8A 3KN4A 3FCSB 3QK9A 4RZMA 1NU3A 3CCS3 2LQVA 3FG1A 4JF8A 1TFKA 3JUNA 1YJ93 1ULJB 3J7Yd 1OF5B 2XR8B 4R9KA 1SJWA 4LGQA 3GZYB 5IEOA 4R9LA 1OHOA 1NO3A 4FMCA 1UUWB 1UI7A 5A0OB 2QEX3 1Q824 1DVCA 2RFRA 1EKMA 2GEXA 3ROBA 1YJN3 8CHOA 4K61A 1IVVA 4ORLA 1U5OA 1FGTA 4WFOA 3UL5A 2FXTA 5BVBA 1N5PA 1W01A 1OUNA 3MG2A 5LC6A 3V92A 5DREA 1SIIA 2OWPA 4FCZA 2STDA 3SEDA 1CEWI 3CU3A 1GYBA 4X2HA 3X3YA 1K28A 1NWWA 4EYCA 3VGNA 1VQN3 3EJVA 1KC84 1RKYA 3MSOA 4FCJA 3KSPA 4BTWA 4R1KA 1JB5A 1Q864 1PU4A 4O3VA 1Q42A 3DY5A 3WMDA 3FH1A 2QA43 3JUOA 3JUQA 2WO0A 3EB8A 1K8A4 4GL6A 4BTXA 2BMOB 1WQLB 2W04A 3N9HA 3IPTA 1JN5A 3NBBA 3QRDA 1R4CA 2IUKA 1Y4KA 2Z7AA 3GZBA 1JB4A 3H3HA 1L5GB 1NJI4 3LTCA 1DMNA 4O02B 4XBYA 1IT8A 1WMPA 3IJEB 1IQXA 3MYTA 2OTL3 3FZWA 3LTAA 1VQP3 3SLUA 1WTHA 5CLKA 2W03A 1O7HB 2CFGA 5TGNA 1A67A 4EXRA 2XFSA 3FLJA 1KD14 3NX0A 5EEOA 2L4VA 1A90A 5HGRA 4CDLA 1M904 1K734 1YJW3 3K9MC 2HMOB 1MOLA 2GXFA 1N5HA 5IG3A 3BNEA 4IPBA 3EQQB 2CW9A 2OQEC 3PYJA 2SBLA 3FG4A 4HZ9B 3EN1B 3OV4A 3SOYA 2Z76A 5KP1A 1DYUA 3A76A 3S29A 3PXMA 4N6UA 1FGRA 1GY5A 1E3RA 2F98A 1OACA 3OX9A 4R4KA 3MG3A 1IV9A 2FGTA 3OXAA 2E2UA 2KXGA 5AEUB 4LMIA 2GU1A 3NXJA 1GY6A 2PZVA 3CPOA 5CF1A 3GAXA 1D6ZA 3G4S3 1ASKA 3AMOB 2CIUA 2CFWA 4OUQA 2Z6BA 3VSYA 1YVBI 4HKVB 1W00A 1JV2B 1VQ43 2O3OA 4OK0A 4G1MB 2RSXA 1EG9B 1UUVB 2IUJA 4KFDA 4L7KA 3LT9A 3Q2PA 3NUVA 4KFFA 1OGZA 3NV0A 3N8BA 2YFLB 1QVG2 2P05A 5IENA 2CG0A 2IMJA 1Q40B 2C10A 4AEQA 5DRVA 2WOFA 3L0RA 4I4KA 1ZO2A 1UW1A 1KSIA 2CHCA 3BB9A 3DUKA 2Y74A 2W56B 1DVDA 3SXXA 3WODG 3KZTA 4KZ1A 5JBSA 3JUMA 3SX1A 1RJOA 5AYSC 2W2CA 4NREA 3CCR3 1N8QA 3D9RA 4HM4B 3IMAB 3EE1A 4FR9A 5IG0A 4HM3B 5JPPA 3CCM3 1AR0A 1D6YA 1LOXA 3DGOA 2P0XA 3CCQ3 1O7PB 1G96A 3LTDA 2CFLA 4N6OB 2K54A 3F8XA 4MEIA 2RGQA 2K0MA 3LH4A 1W5ZA 4HJLB 4NHFA 3HIIA 3KSED 2OOVC 5EVHA 1J2BA 3BNDA 1FGQA 3O8YA 3LYGA 4N6LA 1FUWA 3AMOA 3U1WA 2B1XB 3N54B 3CNMA 1JKGB 5AIGA 5STDA 3LT8A 4GB5A 3G0KA 3G6E3 2WGOA 3Q1CA 2BMRB 6STDA 5IF6A 1LVNA 3GRDA 4XB5A 1SIHA 7STDA 3G16A 4O2HA 3RGAA 3S5CA 3CPW2 3JUPA 1VQO3 3CXC2 1TP6A 2JDIH 4HBRA 3K0ZA 1UI8A 2XH9A 2OCTA 1IK3A 3HI7A 3CCV3 5IG5A 2CK3H 1FGOA 1W7CA 1W4NA 3SOAA 3LOYA 3CCU3 1GD3A 4PEJA 4H61A 4QWTA 3M8CA 1QMAA 1W2B2 3CC43 1C7HA 2INXA 5IG4A 1VQL3 3V99A 1ZX2A 2O9UX 1FA3A 2ZDJA 1QALA 3WOFB 2XRXB 3OW22 2OTJ3 2F99A 3OWUA 3X41A 2XGLA 5AEWB 2GU3A 3NQYA 5BXQA 2D1WA 2HMNB 3E99A 4EC6A 4FMBA 1EQKA 3DGLA 3LMLA 3LZAA 4R80A 2P38A 5IEPA 4K1VA 3T8NA 5IW9A 3ER7A 4N6MA 4L8OA 4OVMA 3LXUX 4HYZA 3UJMA 3EC9A 3K63A 1Q814 2HMJB 3F40A 1WNHA 4STDA 3HIGA 3H51A 1OHPA 5IERA 1O7NB 3UL6A 2CFKA 1A2VA 3MKIA 2Y73A 1ISKA 3MWZA 4LEHA 1RRHA 4RNYA 1W02A 5ELUA 5LC7A 1IVUA 3CMA3 2W9QA 3SVAA 2YX9A 5JPUA 1GY7A 4EV2A 1QVF2 1F8NA 1DMMA 4XBTA 3LTBA 3NM2A 3UB1A 4EBGA 2OOVA 3DZLA 1IU7A 1FGMA 3FKAA 4JRFA 5AIIA 4K90B 1OCVA 1VQ93 2PNCA 3EX9A 1WMOA 3EBTA 4BTYA 1IDPA 4HM1B 3U97A 2BT3A 2HMLB 3JVCA 4N6TA 3ALAA 4KVHA 4H3UA 2CWVA 3V98A 3NBRA 3X40A 3ECFA 1HKXA 2CG1A 2M7OA 3S27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NQZ A;  3NQY A;  4K90 B; 
#chains in the Genus database with same CATH topology
 1BRH A;  2A15 A;  1YIT 3;  3K7C A;  4XDW A;  1OHS A;  2Q07 A;  2LYX A;  1RTU A;  1I2E A;  1IYY A;  3RDE A;  2W9P A;  1W2Z A;  1AVK A;  1N9J A;  3F9S A;  1PY3 A;  1GOU A;  3GWR A;  3STD A;  1IQY A;  1VQ6 3;  5D81 A;  1C54 A;  1GD4 A;  1V74 A;  1HU9 A;  3WDG B;  1FUS A;  1OF5 A;  1BUQ A;  1T2H A;  3GZX B;  1OH0 A;  3KE7 A;  1UCJ A;  4HM5 B;  2XEP A;  1IQ8 A;  3X3X A;  4HM6 B;  2E2T A;  2BU4 A;  1AY7 A;  1RDS A;  1FYS A;  1M1K 4;  4MMX B;  1STF I;  2XSO B;  3PCR A;  5CK6 A;  1IV7 A;  4LZI A;  2YFJ B;  4MJD A;  1QJG A;  3DXO A;  1JRQ A;  2CX1 A;  4FMD A;  1BNI A;  1NDO B;  1IVW A;  1CYU A;  3DGM A;  2B24 B;  3B4P A;  3F14 A;  4HZB B;  3B4O A;  2CKF B;  1NB3 I;  1CQS A;  3WOE B;  1B3S A;  1RCK A;  2I9W A;  1LXE A;  5D82 A;  1V58 A;  1D6U A;  2KCD A;  3CC2 3;  3G8Z A;  3WHO A;  1N8R 4;  2JQ5 A;  3KKG A;  1X1X A;  3CCJ 3;  1KWI A;  3I0Y A;  5CXO A;  5BU4 A;  3D3L A;  2ML6 A;  1IVX A;  1M9G A;  4BU4 A;  1A2P A;  3B8L A;  3PGB A;  4KFE A;  4AKY A;  3EN8 A;  1K41 A;  2CFD A;  1JNQ A;  2ML5 A;  1U8C B;  2OQE A;  1JZO A;  1YI2 3;  3SYU A;  3WR2 A;  2GBW B;  2WOH A;  4AKZ A;  2MC8 A;  4TX4 A;  1M1X B;  1PYL A;  1VQ7 3;  1BUJ A;  1CYV A;  7RNT A;  3CC7 3;  3BIR A;  2IA7 A;  5AI1 A;  1RGA A;  1BRI A;  1I0V A;  1STD A;  2E2V A;  3KII A;  1TFO A;  3MHE A;  2F5M A;  3AHS A;  3KCH A;  4U13 A;  6RNT A;  1YHQ 3;  4CCV A;  3CD6 3;  1I3F A;  5KP4 A;  1MWR A;  1LRA A;  2RCD A;  1R4Y A;  5AYR B;  2CWU A;  3D5I A;  5FGO A;  3CCE 3;  3FF0 A;  3HX8 A;  1JN5 B;  1SAR A;  2XFT A;  3S28 A;  4X2O A;  2V1L A;  1SPU A;  1JKG A;  2AAD A;  2XSH B;  4BL2 A;  4CJN A;  3I56 3;  3T8U A;  1VQK 3;  3X3Z A;  1MWU A;  2P0M A;  1ZS7 A;  1RRL A;  1IT7 A;  3NQZ A;  4WWU C;  3HZP A;  1S5A A;  3MG1 A;  5EQL A;  1A2K A;  2HMM B;  4HVN A;  3OWS A;  3BLZ A;  1YVS A;  1LOY A;  1T2I A;  3RGR A;  1QAF A;  4N3V A;  2IY2 A;  4HM7 B;  1G0T A;  4WHA A;  1GS3 A;  1VZZ A;  1BSE A;  1O7M B;  5I97 A;  1TU5 A;  5FW5 A;  1AV4 A;  1NB5 I;  1KQS 2;  2BHM A;  3CNX A;  1YGE A;  2KRT A;  3GZR A;  2F5W A;  4EV5 A;  3CME 3;  3X42 A;  1OPY A;  1FW7 A;  1AVL A;  3OWY A;  1ROA A;  2UX0 A;  4N6V 0;  1RMS A;  1E3V A;  4XBX A;  1B2U A;  4BL3 A;  3I55 3;  3EHC A;  2W0Q A;  1OGX A;  2ZL8 A;  3BNB A;  3EBY A;  1UGI A;  1PFP A;  2F86 B;  3F7S A;  1BNG A;  2QGU A;  1B2X A;  2Z77 A;  3B7C A;  1JJ2 2;  2XGN A;  2GEY A;  1BU4 A;  2BIR A;  1JBS A;  3DGN A;  2MF7 A;  2D42 A;  3CCL 3;  5AIF A;  4WYK A;  3PZW A;  3ZFZ A;  2YFI B;  3EF8 A;  1MNL A;  1RHL A;  4ZM8 A;  4RNZ A;  2CWT A;  3S67 A;  2GBX B;  1B2S A;  1Q7H A;  2P09 A;  1SQW A;  2QIY A;  2R4I A;  3PS8 A;  4MMY B;  3WA3 A;  4IT7 A;  1K9M 4;  3FGY A;  4KT3 B;  1RN1 A;  5GSP A;  3NBJ A;  1JB2 A;  3NV0 B;  5KP3 A;  3RNT A;  2BMQ B;  1WMN A;  3PCS A;  1US1 A;  5G1K A;  4DKI A;  1O7W B;  2CH9 A;  5CF2 A;  4O8S A;  2WGQ A;  4WYK B;  3VF1 A;  4XDV A;  3T0U A;  3DMC A;  1EA2 A;  4K1U A;  4HM8 B;  1BRS A;  2CC3 A;  4J9A A;  5D83 A;  3G71 3;  1EUI C;  2BNG A;  1VQ5 3;  4IIA A;  5ELJ A;  1I70 A;  3FF2 A;  1JBT A;  4MMZ B;  1T3B A;  2FNQ A;  2W56 A;  4FCM A;  1BOX A;  1MWS A;  1TIJ A;  3BNC A;  1LQG C;  1VQM 3;  1Q7Y 4;  1RN7 A;  1ROV A;  4NPB A;  4WP5 A;  1W6C A;  1BAO A;  1Q40 A;  1DMQ A;  3Q90 A;  2W6J H;  3DH2 A;  3TDG A;  1YIJ 3;  1T5Y A;  1ULI B;  3MPH A;  2XF3 A;  3NM7 A;  3F7X A;  2H0G A;  3K5T A;  3WA2 X;  4HM2 B;  1E97 A;  1Z1S A;  2C4B A;  1VQ8 3;  3UNL A;  2HMK B;  3KFQ C;  1TUH A;  5G2G A;  1LNH A;  4HM0 B;  1GMR A;  4LSO A;  4Q53 A;  1B27 A;  1UGH I;  1TTO A;  1N9E A;  4L8P A;  4N6N B;  4CPK A;  5AIH A;  1BSA A;  4RBN A;  1S72 3;  2RBI A;  4FMA A;  3F8H A;  1LOV A;  3FSD A;  1LQM B;  1O7G B;  3NHX A;  2AAE A;  1RGL A;  3HK4 A;  2BO9 B;  4XM4 A;  3FG3 A;  1W6G A;  4J8T A;  1W6Y A;  1QAK A;  2KF6 A;  2C11 A;  3DM8 A;  3KN4 A;  5HOH A;  3FCS B;  3QK9 A;  4RZM A;  2UUG C;  1NU3 A;  1EEJ A;  3CCS 3;  7GSP A;  2LQV A;  3FG1 A;  4JF8 A;  1TFK A;  3JUN A;  1YJ9 3;  1ULJ B;  2KF3 A;  1OF5 B;  1UCI A;  2J8X B;  2XR8 B;  4R9K A;  3J7Y d;  1SJW A;  4LGQ A;  1MGR A;  1I0X A;  3GZY B;  5IEO A;  4R9L A;  1ZGX A;  1X1U A;  1OHO A;  1NO3 A;  4FMC A;  1UUW B;  1UI7 A;  5A0O B;  2QEX 3;  1Q82 4;  1DVC A;  1JBR A;  2RFR A;  1EKM A;  2GEX A;  4J5G A;  3ROB A;  1YJN 3;  1UDI I;  8CHO A;  4K61 A;  1IVV A;  2GSP A;  4ORL A;  1U5O A;  1JZD A;  1FGT A;  1TRQ A;  4WFO A;  3UL5 A;  2FXT A;  5BVB A;  1N5P A;  1DE3 A;  1W01 A;  1OUN A;  3MG2 A;  5LC6 A;  3V92 A;  1NNV A;  5DRE A;  1SII A;  2OWP A;  4FCZ A;  2STD A;  4GSP A;  3SED A;  1CEW I;  1TJD A;  3CU3 A;  1GYB A;  2F56 A;  4X2H A;  3X3Y A;  1K28 A;  1I8V A;  1NWW A;  4EYC A;  3VGN A;  1VQN 3;  3EJV A;  1KC8 4;  1RKY A;  3MSO A;  2SAR A;  4FCJ A;  3KSP A;  4BTW A;  4R1K A;  1JB5 A;  1Q86 4;  1PU4 A;  4O3V A;  1Q42 A;  3DY5 A;  3WMD A;  3FH1 A;  2QA4 3;  3Q3F A;  1BAN A;  3JUO A;  3ZG0 A;  3D4A A;  3A5E A;  2WO0 A;  3JUQ A;  1YNV X;  3EB8 A;  1BNR A;  1K8A 4;  4GL6 A;  3AGO A;  2H0I A;  4BTX A;  2BMO B;  1TRP A;  1WQL B;  2W04 A;  1CH0 A;  3IPT A;  3N9H A;  1JN5 A;  3NBB A;  4GHO A;  3QRD A;  1BSD A;  1I3I A;  1R4C A;  1Y4K A;  2IUK A;  2Z7A A;  1JB4 A;  3GZB A;  3H3H A;  1L5G B;  1NJI 4;  3LTC A;  1DMN A;  2KAA A;  4O02 B;  3BU4 A;  4XBY A;  5M18 A;  1IT8 A;  1WMP A;  3IJE B;  1IQX A;  3MYT A;  1BNE A;  5M19 A;  2OTL 3;  1RNB A;  3FZW A;  3LTA A;  1VQP 3;  3SLU A;  1WTH A;  5CLK A;  2W03 A;  1O7H B;  2CFG A;  5TGN A;  1RLS A;  1A67 A;  4EXR A;  1RGG A;  2XFS A;  3FLJ A;  1KD1 4;  3NX0 A;  5EEO A;  2L4V A;  1BGS A;  1A90 A;  5HGR A;  4CDL A;  1M90 4;  1K73 4;  2KF4 A;  1YJW 3;  3K9M C;  1FUT A;  1MOL A;  2GXF A;  1N5H A;  2HMO B;  2R41 A;  3BNE A;  5IG3 A;  4IPB A;  3EQQ B;  3HOH A;  2CW9 A;  2OQE C;  3PYJ A;  2SBL A;  4RNT A;  3FG4 A;  4HZ9 B;  3EN1 B;  3OV4 A;  1RGF A;  3SOY A;  2Z76 A;  5KP1 A;  1YGW A;  1DYU A;  2H0H A;  2K3D A;  3A76 A;  3S29 A;  3PXM A;  1I2F A;  1BNF A;  4N6U A;  1FGR A;  1GY5 A;  6GSP A;  2IYJ A;  1E3R A;  2F98 A;  1OAC A;  3OX9 A;  4R4K A;  3MG3 A;  1IV9 A;  2FGT A;  3OXA A;  1AQZ A;  2E2U A;  2KXG A;  5AEU B;  4LMI A;  2GU1 A;  3NXJ A;  1GY6 A;  2PZV A;  3CPO A;  1UCK A;  3GAX A;  5CF1 A;  1D6Z A;  3G4S 3;  1ASK A;  3AMO B;  2CIU A;  2CFW A;  4OUQ A;  1HYF A;  2Z6B A;  3VSY A;  1YVB I;  4HKV B;  1W00 A;  1JV2 B;  1BNS A;  4LYL B;  5BIR A;  1VQ4 3;  1DET A;  2O3O A;  4OK0 A;  4G1M B;  2RSX A;  1EG9 B;  1UUV B;  2IUJ A;  4KFD A;  4L7K A;  3LT9 A;  3Q2P A;  3NUV A;  4KFF A;  1OGZ A;  3NV0 A;  3N8B A;  1BRG A;  2YFL B;  1QVG 2;  2P05 A;  5IEN A;  2CG0 A;  2IMJ A;  1Q40 B;  2C10 A;  4AEQ A;  5DRV A;  2WOF A;  1I2G A;  3L0R A;  4I4K A;  1BRJ A;  1UW1 A;  1KSI A;  1ZO2 A;  2CHC A;  3BB9 A;  3DUK A;  2CX0 A;  2Y74 A;  2W56 B;  1DVD A;  3SXX A;  3WOD G;  3KZT A;  1B2M A;  4KZ1 A;  5JBS A;  4HAA A;  3JUM A;  1BNJ A;  3SX1 A;  1RJO A;  5AYS C;  2W2C A;  4NRE A;  3CCR 3;  1N8Q A;  1X1Y A;  3D9R A;  4HM4 B;  1X1W A;  3IMA B;  3EE1 A;  4FR9 A;  5IG0 A;  4HM3 B;  5JPP A;  3CCM 3;  1B20 A;  1AR0 A;  1D6Y A;  1LOX A;  3DGO A;  2P0X A;  3CCQ 3;  1O7P B;  1G96 A;  3LTD A;  2CFL A;  4N6O B;  2K54 A;  3F8X A;  1BRK A;  4MEI A;  2RGQ A;  1BSC A;  2K0M A;  1VQQ A;  3LH4 A;  1W5Z A;  1GSP A;  4HJL B;  1B21 A;  4NHF A;  3HII A;  3KSE D;  2OOV C;  5EVH A;  1UCL A;  1J2B A;  3BND A;  1FGQ A;  3O8Y A;  3LYG A;  1LOW A;  4N6L A;  1FUW A;  3AMO A;  3U1W A;  2B1X B;  3N54 B;  3CNM A;  1JKG B;  5AIG A;  1GOV A;  1G02 A;  5STD A;  3LT8 A;  5G1L A;  4GB5 A;  3G0K A;  3G6E 3;  2WGO A;  1V57 A;  3Q1C A;  2BMR B;  6STD A;  1B2Z A;  1LVN A;  5IF6 A;  9RNT A;  4I5Q A;  3GRD A;  4XB5 A;  1BVI A;  1SIH A;  7STD A;  3G16 A;  4O2H A;  3RGA A;  3S5C A;  3CPW 2;  3JUP A;  1VQO 3;  3CXC 2;  1FZU A;  1TP6 A;  2JDI H;  4HBR A;  3K0Z A;  1UI8 A;  2XH9 A;  2OCT A;  1IK3 A;  1HZ1 A;  3HI7 A;  1BSB A;  3CCV 3;  5IG5 A;  2CK3 H;  1FGO A;  1W7C A;  2HOH A;  1W4N A;  3SOA A;  2KF5 A;  2ZA4 A;  3LOY A;  3CCU 3;  1GD3 A;  4PEJ A;  4H61 A;  4QWT A;  1RSN A;  1QMA A;  3M8C A;  1W2B 2;  3CC4 3;  1RGC A;  5M1A A;  1C7H A;  1UUG B;  2INX A;  5IG4 A;  1VQL 3;  3AHW A;  3V99 A;  1ZX2 A;  2O9U X;  1FA3 A;  2ZDJ A;  2RNT A;  1QAL A;  3WOF B;  2XRX B;  1GMQ A;  3OW2 2;  2OTJ 3;  2F99 A;  3OWU A;  3X41 A;  2XGL A;  3URP A;  5AEW B;  3AGN A;  5RNT A;  2GU3 A;  3NQY A;  3D79 A;  5BXQ A;  2UGI A;  2D1W A;  2HMN B;  3E99 A;  4EC6 A;  4FMB A;  2F4Y A;  1EQK A;  3DGY A;  3DGL A;  3LML A;  3LZA A;  4R80 A;  2P38 A;  5IEP A;  1MWT A;  2L1S A;  1RGE A;  1RN4 A;  4K1V A;  3T8N A;  5IW9 A;  3ER7 A;  4N6M A;  4L8O A;  4OVM A;  1RNT A;  1BRN L;  3LXU X;  4HYZ A;  3UJM A;  3EC9 A;  3K63 A;  4HOH A;  1Q81 4;  1GOY A;  2HMJ B;  1BIR A;  3F40 A;  1WNH A;  8RNT A;  4STD A;  4J5K A;  3HIG A;  3H51 A;  1OHP A;  5IER A;  1O7N B;  3UL6 A;  2CFK A;  2ZHX B;  1A2V A;  3MKI A;  3ZG5 A;  2Y73 A;  1ISK A;  1LNI A;  3MWZ A;  4LEH A;  1RRH A;  4RNY A;  1W02 A;  5ELU A;  5LC7 A;  1IVU A;  3CMA 3;  1RGH A;  1Q9E A;  4BIR A;  2W9Q A;  3SVA A;  2YX9 A;  5JPU A;  1GY7 A;  1MGW A;  4EV2 A;  1QVF 2;  1F8N A;  1DMM A;  4XBT A;  3LTB A;  3NM2 A;  3UB1 A;  3D5G A;  4EBG A;  2OOV A;  3DZL A;  1IU7 A;  1FGM A;  3GSP A;  3FKA A;  4JRF A;  5AII A;  4K90 B;  4EW5 A;  1OCV A;  1VQ9 3;  2PNC A;  3EX9 A;  1WMO A;  3EBT A;  1RGK A;  4BTY A;  1IDP A;  4HM1 B;  3U97 A;  2BT3 A;  1RCL A;  2HML B;  3JVC A;  4N6T A;  1GMP A;  3ALA A;  4KVH A;  4H3U A;  2CWV A;  3V98 A;  3NBR A;  3X40 A;  3ECF A;  1HKX A;  2CG1 A;  2M7O A;  4ILF A;  3S27 A; 
#chains in the Genus database with same CATH homology
 2A15 A;  1YIT 3;  3K7C A;  4XDW A;  1OHS A;  2Q07 A;  2LYX A;  3RDE A;  2W9P A;  1W2Z A;  1AVK A;  1N9J A;  3F9S A;  3GWR A;  3STD A;  1IQY A;  1VQ6 3;  5D81 A;  1GD4 A;  1V74 A;  1HU9 A;  3WDG B;  1OF5 A;  1BUQ A;  3GZX B;  1OH0 A;  3KE7 A;  4HM5 B;  2XEP A;  1IQ8 A;  3X3X A;  4HM6 B;  2E2T A;  1M1K 4;  4MMX B;  1STF I;  2XSO B;  3PCR A;  5CK6 A;  1IV7 A;  4LZI A;  2YFJ B;  4MJD A;  1QJG A;  3DXO A;  1JRQ A;  4FMD A;  1NDO B;  1IVW A;  1CYU A;  3DGM A;  2B24 B;  3B4P A;  3F14 A;  4HZB B;  3B4O A;  2CKF B;  1NB3 I;  1CQS A;  3WOE B;  2I9W A;  1LXE A;  5D82 A;  1D6U A;  2KCD A;  3CC2 3;  3G8Z A;  1N8R 4;  2JQ5 A;  3KKG A;  3CCJ 3;  1KWI A;  3I0Y A;  5CXO A;  3D3L A;  2ML6 A;  1IVX A;  1M9G A;  3B8L A;  3PGB A;  4KFE A;  4AKY A;  3EN8 A;  1K41 A;  2CFD A;  1JNQ A;  2ML5 A;  1U8C B;  2OQE A;  1YI2 3;  4AKZ A;  2GBW B;  2WOH A;  2MC8 A;  4TX4 A;  1M1X B;  1VQ7 3;  1CYV A;  3CC7 3;  2IA7 A;  5AI1 A;  1STD A;  2E2V A;  3KII A;  3MHE A;  1TFO A;  4U13 A;  3CD6 3;  1YHQ 3;  4CCV A;  5KP4 A;  2RCD A;  5AYR B;  2CWU A;  5FGO A;  3CCE 3;  3FF0 A;  3HX8 A;  1JN5 B;  2XFT A;  3S28 A;  4X2O A;  2V1L A;  1SPU A;  1JKG A;  2XSH B;  3I56 3;  3T8U A;  1VQK 3;  3X3Z A;  2P0M A;  3NQZ A;  1RRL A;  1IT7 A;  4WWU C;  3HZP A;  1S5A A;  3MG1 A;  5EQL A;  1A2K A;  2HMM B;  4HVN A;  3OWS A;  3BLZ A;  3RGR A;  1QAF A;  4N3V A;  4HM7 B;  4WHA A;  1GS3 A;  1VZZ A;  1O7M B;  5I97 A;  1TU5 A;  5FW5 A;  1AV4 A;  1NB5 I;  1KQS 2;  2BHM A;  3CNX A;  1YGE A;  2KRT A;  3GZR A;  4EV5 A;  3CME 3;  3X42 A;  1OPY A;  1AVL A;  3OWY A;  1ROA A;  2UX0 A;  4N6V 0;  3I55 3;  1E3V A;  4XBX A;  3EHC A;  2W0Q A;  1OGX A;  2ZL8 A;  3BNB A;  3EBY A;  1PFP A;  2F86 B;  3F7S A;  2QGU A;  2Z77 A;  3B7C A;  1JJ2 2;  2XGN A;  2GEY A;  3DGN A;  2MF7 A;  2D42 A;  3CCL 3;  5AIF A;  4WYK A;  3PZW A;  2YFI B;  3EF8 A;  1MNL A;  4ZM8 A;  4RNZ A;  2CWT A;  3S67 A;  2GBX B;  2P09 A;  1SQW A;  2QIY A;  2R4I A;  3PS8 A;  4MMY B;  3WA3 A;  4IT7 A;  1K9M 4;  3FGY A;  3NBJ A;  1JB2 A;  3NV0 B;  5KP3 A;  2BMQ B;  1WMN A;  3PCS A;  1US1 A;  1O7W B;  2CH9 A;  5CF2 A;  4O8S A;  2WGQ A;  4WYK B;  3VF1 A;  4XDV A;  3T0U A;  3DMC A;  1EA2 A;  4K1U A;  4HM8 B;  2CC3 A;  4J9A A;  5D83 A;  3G71 3;  1VQ5 3;  2BNG A;  4IIA A;  5ELJ A;  3FF2 A;  4MMZ B;  2W56 A;  2FNQ A;  4FCM A;  1TIJ A;  3BNC A;  1VQM 3;  1Q7Y 4;  1RN7 A;  1ROV A;  4WP5 A;  1W6C A;  1Q40 A;  1DMQ A;  3Q90 A;  2W6J H;  1YIJ 3;  3TDG A;  1T5Y A;  1ULI B;  3MPH A;  2XF3 A;  3NM7 A;  3F7X A;  3K5T A;  3WA2 X;  4HM2 B;  1E97 A;  1Z1S A;  1VQ8 3;  3UNL A;  2HMK B;  3KFQ C;  1TUH A;  5G2G A;  1LNH A;  4HM0 B;  4LSO A;  4Q53 A;  4L8P A;  1N9E A;  4N6N B;  5AIH A;  4RBN A;  1S72 3;  4FMA A;  3F8H A;  3FSD A;  1O7G B;  3NHX A;  3HK4 A;  4XM4 A;  2BO9 B;  3FG3 A;  1W6G A;  4J8T A;  1W6Y A;  1QAK A;  2C11 A;  3DM8 A;  3KN4 A;  3FCS B;  3QK9 A;  4RZM A;  1NU3 A;  3CCS 3;  2LQV A;  3FG1 A;  4JF8 A;  1TFK A;  3JUN A;  1YJ9 3;  1ULJ B;  3J7Y d;  1OF5 B;  2XR8 B;  4R9K A;  1SJW A;  4LGQ A;  3GZY B;  5IEO A;  4R9L A;  1OHO A;  1NO3 A;  4FMC A;  1UUW B;  1UI7 A;  5A0O B;  2QEX 3;  1Q82 4;  1DVC A;  2RFR A;  1EKM A;  2GEX A;  3ROB A;  1YJN 3;  8CHO A;  4K61 A;  1IVV A;  4ORL A;  1U5O A;  1FGT A;  4WFO A;  3UL5 A;  2FXT A;  5BVB A;  1N5P A;  1W01 A;  1OUN A;  3MG2 A;  5LC6 A;  3V92 A;  5DRE A;  1SII A;  2OWP A;  4FCZ A;  2STD A;  3SED A;  1CEW I;  3CU3 A;  1GYB A;  4X2H A;  3X3Y A;  1K28 A;  1NWW A;  4EYC A;  3VGN A;  1VQN 3;  3EJV A;  1KC8 4;  1RKY A;  3MSO A;  4FCJ A;  3KSP A;  4BTW A;  4R1K A;  1JB5 A;  1Q86 4;  1PU4 A;  4O3V A;  1Q42 A;  3DY5 A;  3WMD A;  3FH1 A;  2QA4 3;  3JUO A;  3JUQ A;  2WO0 A;  3EB8 A;  1K8A 4;  4GL6 A;  4BTX A;  2BMO B;  1WQL B;  2W04 A;  3N9H A;  3IPT A;  1JN5 A;  3NBB A;  3QRD A;  1R4C A;  2IUK A;  1Y4K A;  2Z7A A;  3GZB A;  1JB4 A;  3H3H A;  1L5G B;  1NJI 4;  3LTC A;  1DMN A;  4O02 B;  4XBY A;  1IT8 A;  1WMP A;  3IJE B;  1IQX A;  3MYT A;  2OTL 3;  3FZW A;  3LTA A;  1VQP 3;  3SLU A;  1WTH A;  5CLK A;  2W03 A;  1O7H B;  2CFG A;  5TGN A;  1A67 A;  4EXR A;  2XFS A;  3FLJ A;  1KD1 4;  3NX0 A;  5EEO A;  2L4V A;  1A90 A;  5HGR A;  4CDL A;  1M90 4;  1K73 4;  1YJW 3;  3K9M C;  2HMO B;  1MOL A;  2GXF A;  1N5H A;  5IG3 A;  3BNE A;  4IPB A;  3EQQ B;  2CW9 A;  2OQE C;  3PYJ A;  2SBL A;  3FG4 A;  4HZ9 B;  3EN1 B;  3OV4 A;  3SOY A;  2Z76 A;  5KP1 A;  1DYU A;  3A76 A;  3S29 A;  3PXM A;  4N6U A;  1FGR A;  1GY5 A;  1E3R A;  2F98 A;  1OAC A;  3OX9 A;  4R4K A;  3MG3 A;  1IV9 A;  2FGT A;  3OXA A;  2E2U A;  2KXG A;  5AEU B;  4LMI A;  2GU1 A;  3NXJ A;  1GY6 A;  2PZV A;  3CPO A;  5CF1 A;  3GAX A;  1D6Z A;  3G4S 3;  1ASK A;  3AMO B;  2CIU A;  2CFW A;  4OUQ A;  2Z6B A;  3VSY A;  1YVB I;  4HKV B;  1W00 A;  1JV2 B;  1VQ4 3;  2O3O A;  4OK0 A;  4G1M B;  2RSX A;  1EG9 B;  1UUV B;  2IUJ A;  4KFD A;  4L7K A;  3LT9 A;  3Q2P A;  3NUV A;  4KFF A;  1OGZ A;  3NV0 A;  3N8B A;  2YFL B;  1QVG 2;  2P05 A;  5IEN A;  2CG0 A;  2IMJ A;  1Q40 B;  2C10 A;  4AEQ A;  5DRV A;  2WOF A;  3L0R A;  4I4K A;  1ZO2 A;  1UW1 A;  1KSI A;  2CHC A;  3BB9 A;  3DUK A;  2Y74 A;  2W56 B;  1DVD A;  3SXX A;  3WOD G;  3KZT A;  4KZ1 A;  5JBS A;  3JUM A;  3SX1 A;  1RJO A;  5AYS C;  2W2C A;  4NRE A;  3CCR 3;  1N8Q A;  3D9R A;  4HM4 B;  3IMA B;  3EE1 A;  4FR9 A;  5IG0 A;  4HM3 B;  5JPP A;  3CCM 3;  1AR0 A;  1D6Y A;  1LOX A;  3DGO A;  2P0X A;  3CCQ 3;  1O7P B;  1G96 A;  3LTD A;  2CFL A;  4N6O B;  2K54 A;  3F8X A;  4MEI A;  2RGQ A;  2K0M A;  3LH4 A;  1W5Z A;  4HJL B;  4NHF A;  3HII A;  3KSE D;  2OOV C;  5EVH A;  1J2B A;  3BND A;  1FGQ A;  3O8Y A;  3LYG A;  4N6L A;  1FUW A;  3AMO A;  3U1W A;  2B1X B;  3N54 B;  3CNM A;  1JKG B;  5AIG A;  5STD A;  3LT8 A;  4GB5 A;  3G0K A;  3G6E 3;  2WGO A;  3Q1C A;  2BMR B;  6STD A;  5IF6 A;  1LVN A;  3GRD A;  4XB5 A;  1SIH A;  7STD A;  3G16 A;  4O2H A;  3RGA A;  3S5C A;  3CPW 2;  3JUP A;  1VQO 3;  3CXC 2;  1TP6 A;  2JDI H;  4HBR A;  3K0Z A;  1UI8 A;  2XH9 A;  2OCT A;  1IK3 A;  3HI7 A;  3CCV 3;  5IG5 A;  2CK3 H;  1FGO A;  1W7C A;  1W4N A;  3SOA A;  3LOY A;  3CCU 3;  1GD3 A;  4PEJ A;  4H61 A;  4QWT A;  3M8C A;  1QMA A;  1W2B 2;  3CC4 3;  1C7H A;  2INX A;  5IG4 A;  1VQL 3;  3V99 A;  1ZX2 A;  2O9U X;  1FA3 A;  2ZDJ A;  1QAL A;  3WOF B;  2XRX B;  3OW2 2;  2OTJ 3;  2F99 A;  3OWU A;  3X41 A;  2XGL A;  5AEW B;  2GU3 A;  3NQY A;  5BXQ A;  2D1W A;  2HMN B;  3E99 A;  4EC6 A;  4FMB A;  1EQK A;  3DGL A;  3LML A;  3LZA A;  4R80 A;  2P38 A;  5IEP A;  4K1V A;  3T8N A;  5IW9 A;  3ER7 A;  4N6M A;  4L8O A;  4OVM A;  3LXU X;  4HYZ A;  3UJM A;  3EC9 A;  3K63 A;  1Q81 4;  2HMJ B;  3F40 A;  1WNH A;  4STD A;  3HIG A;  3H51 A;  1OHP A;  5IER A;  1O7N B;  3UL6 A;  2CFK A;  1A2V A;  3MKI A;  2Y73 A;  1ISK A;  3MWZ A;  4LEH A;  1RRH A;  4RNY A;  1W02 A;  5ELU A;  5LC7 A;  1IVU A;  3CMA 3;  2W9Q A;  3SVA A;  2YX9 A;  5JPU A;  1GY7 A;  4EV2 A;  1QVF 2;  1F8N A;  1DMM A;  4XBT A;  3LTB A;  3NM2 A;  3UB1 A;  4EBG A;  2OOV A;  3DZL A;  1IU7 A;  1FGM A;  3FKA A;  4JRF A;  5AII A;  4K90 B;  1OCV A;  1VQ9 3;  2PNC A;  3EX9 A;  1WMO A;  3EBT A;  4BTY A;  1IDP A;  4HM1 B;  3U97 A;  2BT3 A;  2HML B;  3JVC A;  4N6T A;  3ALA A;  4KVH A;  4H3U A;  2CWV A;  3V98 A;  3NBR A;  3X40 A;  3ECF A;  1HKX A;  2CG1 A;  2M7O A;  3S27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...