4PEJA

Crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
120
Chain Sequence
LPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVESPFGQPPIHGREQIAAHYRQWLKFRVSLTGPVRASHNGSGAMPLRKEWGQPSALDVILVMRFDEHGRIQTEQRYWSEVNLSVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Retro-aldolase
publication title De novo-designed enzymes as small-molecule-regulated fluorescence imaging tags and fluorescent reporters.
pubmed doi rcsb
source organism Artificial gene
total genus 33
structure length 120
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4pejA00
1DMQA 4HM0B 1O7HB 3GRDA 3MHEA 3JUNA 3NHXA 3T8NA 1O7WB 3HK4A 4PEJA 4LGQA 3E99A 4L8OA 2HMKB 3SEDA 3EF8A 4HM3B 4LMIA 3BB9A 3STDA 5EVHA 3RGAA 3FZWA 2XR8B 1W02A 4STDA 4WP5A 4HM7B 4XBXA 1EA2A 4HJLB 3JUQA 3UNLA 5DREA 5KP4A 5CF2A 1W01A 6STDA 4Q53A 2B24B 5AIGA 2IMJA 2Z76A 3NV0B 3IPTA 2YFIB 4ORLA 4HM2B 2HMJB 1OHPA 3EBTA 1JB2A 3OWUA 5DRVA 5KP3A 3B4OA 2K54A 2W2CA 5D83A 2BMRB 3FKAA 3B4PA 5CLKA 4RZMA 1GS3A 3EQQB 3CNMA 3D9RA 1HKXA 4J9AA 3F8HA 4GB5A 3MG3A 1Q40A 4OVMA 3G0KA 1ASKA 1O7GB 4KVHA 3F7SA 1ISKA 3OV4A 2BMQB 4X2HA 2RGQA 5CF1A 1OF5B 4L8PA 3H51A 2I9WA 1A2KA 1OPYA 2GXFA 4CDLA 3CU3A 4R9LA 1UUVB 4XB5A 3I0YA 5JPPA 4HKVB 5IEOA 3F9SA 1OF5A 1JN5A 3ROBA 5FW5A 5IEPA 3EN1B 1Z1SA 3F7XA 4MJDA 1SJWA 3DM8A 1Q42A 1JKGA 1ZX2A 4X2OA 3B7CA 4L7KA 5BXQA 3MYTA 3DUKA 4OUQA 1TUHA 2HMLB 4FCMA 2PZVA 2RCDA 3DMCA 5AEWB 3LZAA 3G16A 4WYKB 5CK6A 1OGZA 3JUMA 3FGYA 3G8ZA 4HM8B 2F98A 2GEXA 3DZLA 3FSDA 1JB5A 4HM1B 4XBTA 3SOAA 4J8TA 1U5OA 4WYKA 2CHCA 2INXA 3ER7A 3OX9A 3GZXB 1EG9B 1STDA 5IERA 4XDWA 2Z77A 3NBRA 1NWWA 3S5CA 3KKGA 1E97A 4R1KA 1WQLB 4N3VA 3KE7A 5IG5A 1W00A 1QMAA 1E3RA 3BLZA 3MKIA 3GZRA 3DXOA 2UX0A 3SOYA 2GBXB 3MSOA 1Q40B 1QJGA 3OWSA 3KZTA 3NXJA 3EBYA 3F40A 1GY7A 2XSOB 3NUVA 2F86B 3F8XA 3OWYA 4HM5B 3EJVA 3GZBA 3VSYA 4K1VA 5STDA 1JN5B 5D81A 3MG2A 1BUQA 1TP6A 5G2GA 2XSHB 2JQ5A 1E3VA 1OH0A 1OGXA 4FCJA 2QGUA 5IF6A 3FF0A 1JKGB 2STDA 3FLJA 4IIAA 4HZBB 4R9KA 2HMOB 4XBYA 1GY5A 4HM4B 1JB4A 5AI1A 3GWRA 3B8LA 1O7NB 3EX9A 5AIFA 5D82A 3JUPA 2BMOB 5HGRA 3LYGA 2B1XB 5AIIA 1IDPA 5KP1A 1OUNA 4I4KA 1ULJB 3GZYB 3EN8A 3EC9A 4HZ9B 3NM2A 1GYBA 7STDA 5IENA 1GY6A 3A76A 3FH1A 5IG0A 2YFJB 1ZO2A 3CPOA 1S5AA 3ECFA 1OHOA 2XRXB 5IG3A 3H3HA 2F99A 1ULIB 2BNGA 3EHCA 3JUOA 5CXOA 2GBWB 1VZZA 2YFLB 1AR0A 3WMDA 4U13A 1DMMA 3CNXA 1UUWB 1C7HA 4XM4A 2RFRA 4LEHA 5BVBA 4XDVA 3T8UA 5AIHA 3HX8A 5TGNA 1O7PB 3KSPA 3NV0A 4WWUC 3RGRA 3K7CA 2CKFB 5JPUA 1OCVA 2HMMB 2HMNB 3FF2A 3OXAA 3MG1A 5IG4A 1W6YA 3UJMA 2A15A 1NDOB 1OHSA 3M8CA 2QIYA 4K1UA 1DMNA 2R4IA 1NU3A 5AEUB 1CQSA 1O7MB 4HVNA 3K0ZA 1K41A 3VGNA 3HZPA 4HM6B 3Q90A 3F14A 2GEYA 2Z7AA 2OWPA 8CHOA 4H3UA
chains in the Genus database with same CATH superfamily
1DMQA 1QVG2 3LT8A 2W56B 2QA43 3D5IA 4HM0B 2IYJA 1O7HB 1UW1A 5M1AA 3X3YA 3GRDA 2K3DA 1QAKA 1AVKA 3MHEA 2ML6A 3JUNA 1IV9A 2LYXA 1T2HA 3NHXA 3T8NA 1LQMB 1O7WB 4MMXB 4CCVA 1JRQA 1UCLA 1B27A 1A2PA 3HK4A 1FW7A 1D6UA 4PEJA 1RHLA 1VQQA 2IA7A 1FGTA 4BIRA 1BVIA 2JDIH 5BIRA 4LGQA 3E99A 4L8OA 1IQXA 3FG4A 2HMKB 1ROVA 5RNTA 1FUWA 2E2VA 1BRNL 1B2SA 4AKYA 2O3OA 1IK3A 3S28A 1BGSA 2W03A 3I563 4KZ1A 3SEDA 1A67A 3EF8A 2H0IA 4HM3B 4LMIA 3BB9A 3STDA 3DGNA 5EVHA 1MWRA 1B21A 1DETA 3BNBA 3RGAA 3FZWA 2XR8B 1W02A 4STDA 3J7Yd 1LOVA 1BOXA 2ML5A 3D3LA 4KFDA 3CCU3 3PGBA 2UUGC 3LTAA 1SIIA 4WP5A 4HM7B 1WNHA 4EXRA 4XBXA 1EA2A 1GOUA 4HJLB 4LSOA 3EE1A 3JUQA 4ZM8A 3UNLA 2Z6BA 1VQP3 5DREA 1RJOA 5KP4A 2D42A 5CF2A 1IU7A 2C4BA 1MGWA 1W01A 6STDA 1V58A 1BUJA 2C10A 4Q53A 2B24B 1DVCA 1ZS7A 2KAAA 5AIGA 3RDEA 1W2B2 4CPKA 2KRTA 3URPA 2IMJA 4J5KA 1IQYA 1NB5I 1JBRA 4NPBA 2Z76A 3NV0B 4RNZA 1TJDA 3IPTA 2J8XB 1X1YA 3WDGB 2YFIB 2ZDJA 2CX1A 4BTXA 1B2UA 1Y4KA 2KF5A 3AGOA 4ORLA 4HM2B 2HMJB 2HOHA 3LTCA 3N54B 4KFEA 1OHPA 2WOFA 4FMBA 3EBTA 1FGRA 1JB2A 3CCS3 3OWUA 2CIUA 2F5WA 5DRVA 1PYLA 5KP3A 1G96A 2K54A 2W0QA 3B4OA 2W2CA 1K8A4 5D83A 2GU3A 5I97A 4BU4A 4HBRA 3D79A 2BMRB 3FKAA 3B4PA 5CLKA 1N8R4 1BNIA 3AMOA 2L1SA 3D4AA 3ZFZA 3G4S3 4JF8A 1W6CA 5AYSC 1WMPA 7GSPA 3A5EA 2C11A 4RZMA 1FGQA 1GS3A 1PFPA 3QK9A 3EQQB 3CNMA 1PY3A 3D9RA 1UCJA 1HKXA 4NREA 4J9AA 1IT8A 1FZUA 2KCDA 1A2VA 3F8HA 4GB5A 3CCQ3 5CF1A 1Q814 3MG3A 1TIJA 1F8NA 3CCR3 1IV7A 1Q40A 4OVMA 1BNRA 3G0KA 1ASKA 1O7GB 2CK3H 4KVHA 1N9EA 5M19A 3F7SA 4N6UA 1ISKA 3OV4A 2BMQB 4X2HA 1QAFA 2BT3A 1OF5B 1IVXA 2RGQA 4L8PA 3RNTA 1W6GA 4O3VA 1FA3A 3VF1A 3H51A 1QALA 4RNTA 1L5GB 2I9WA 3N8BA 3SVAA 4ILFA 1A2KA 4BL2A 2CG0A 3AHSA 1OPYA 2GXFA 4CDLA 5IW9A 4TX4A 3CU3A 1SARA 5ELJA 1IT7A 1LOYA 1RGHA 2CC3A 2CFWA 1UUVB 1BANA 4R9LA 1BNGA 1VQM3 4XB5A 2XH9A 3I0YA 4NHFA 5JPPA 1GSPA 1CH0A 2F56A 3F9SA 1U8CB 4HKVB 5IEOA 1OF5A 2W04A 5A0OB 4FMDA 1MGRA 1RMSA 1JN5A 4OK0A 3K5TA 3ROBA 5FW5A 5IEPA 3EN1B 1Z1SA 3DGOA 3F7XA 1I0XA 2YX9A 4MJDA 3CCL3 2Y73A 3NBBA 3KFQC 1DYUA 1SJWA 2CWUA 3DM8A 3UL6A 2RNTA 2BIRA 2KXGA 3CCV3 1Q42A 4FR9A 1IVVA 3DGLA 4GHOA 1JKGA 1ZX2A 4X2OA 3B7CA 3SYUA 2IY2A 1VQ93 4HYZA 1RSNA 4H61A 4WFOA 2BO9B 2WGOA 4L7KA 3MYTA 5BXQA 3DUKA 4OUQA 2CG1A 1TUHA 1X1WA 2HMLB 2OQEA 4FCMA 1RN7A 2PZVA 1LOWA 2Y74A 2F4YA 2RCDA 3DMCA 1YVSA 2W6JH 4IT7A 5AEWB 3LZAA 3CCM3 1JV2B 1W4NA 3G16A 3S67A 4WYKB 5CK6A 1UGHI 3TDGA 1OGZA 3JUMA 2FXTA 2IUKA 3FGYA 3NX0A 3G8ZA 4HM8B 1EEJA 2F98A 2GEXA 2AADA 2CFLA 4GSPA 3DZLA 3IJEB 3FSDA 1BU4A 1JB5A 2CX0A 1I70A 2OQEC 1NNVA 4HM1B 2BHMA 3U1WA 3PYJA 2F5MA 3BU4A 3UL5A 3D5GA 4XBTA 3SOAA 3CC43 4J8TA 1U5OA 1LQGC 4WYKA 2CHCA 3LXUX 4IPBA 2INXA 1KWIA 3ER7A 1RCKA 1MWTA 1YHQ3 3OX9A 2WO0A 4BTWA 3GZXB 4CJNA 3T0UA 1EG9B 2P0MA 5EQLA 2KF3A 1STDA 1MWUA 5IERA 1R4YA 1ROAA 3GAXA 1KC84 1BNJA 4XDWA 1LVNA 1BSCA 1RNTA 1I3IA 2FGTA 2Z77A 3NBRA 1NWWA 4N6OB 3S5CA 3KKGA 2ZL8A 2K0MA 2RSXA 1E97A 4R1KA 1YNVX 1WQLB 2OCTA 3AMOB 3PCSA 1BNFA 2W9PA 4N3VA 1YJW3 1W7CA 2CFGA 3KE7A 1VQO3 3LMLA 1GMRA 1SPUA 5IG5A 1RLSA 1W00A 1QMAA 3QRDA 1JJ22 1UCKA 1N5HA 2RBIA 3CCE3 1E3RA 3BLZA 1NO3A 4R4KA 2CW9A 3CXC2 4GL6A 3GSPA 1BNEA 3MKIA 1RGCA 5EEOA 1RN1A 3GZRA 1K28A 3CPW2 1MOLA 3V99A 1D6YA 3DXOA 2UX0A 3SOYA 4G1MB 2GBXB 3MSOA 5G1KA 2ZHXB 1Q40B 3CMA3 1GOYA 1I2FA 3Q2PA 1TTOA 1B2ZA 3LTBA 1QJGA 1K734 3OWSA 3KZTA 3NM7A 3NXJA 3EBYA 3F40A 2L4VA 1GY7A 2XSOB 3LT9A 3NUVA 1Q9EA 1IVUA 1GMQA 2F86B 2E2TA 1JZDA 3F8XA 3OWYA 2SARA 3IMAB 5FGOA 2OOVA 4FMCA 4HM5B 1VQN3 5LC7A 3LOYA 3EJVA 1B2XA 3BNCA 3HIIA 1RKYA 3CC73 3GZBA 5G1LA 2PNCA 1B20A 1CYVA 1HZ1A 1M9GA 3NQZA 1JZOA 3NQYA 3N9HA 2MF7A 1I0VA 2KF6A 3FG3A 3VSYA 3BIRA 2QEX3 1BSBA 3SX1A 6GSPA 4K1VA 1B2MA 5STDA 1JN5B 4EV5A 5D81A 3MG2A 2Q07A 1BUQA 1S723 1TRPA 2OOVC 1DE3A 1TP6A 2WOHA 5G2GA 2XSHB 2JQ5A 1E3VA 1OH0A 1OGXA 1BSAA 1A90A 1I3FA 4FCJA 1TFKA 4AKZA 2QGUA 3KCHA 5IF6A 3FF0A 5BU4A 1JKGB 2H0GA 1FYSA 1GD4A 2STDA 5ELUA 3X3XA 3WA3A 3FLJA 2H0HA 4AEQA 1M1XB 3ZG5A 1JNQA 4IIAA 4HZBB 4R9KA 3X42A 1JBSA 1UGIA 2HMOB 3ALAA 3WOFB 4XBYA 1BRKA 1GY5A 2P38A 2D1WA 1BRHA 1R4CA 3S29A 1RGAA 3Q1CA 4HM4B 2CFDA 4I5QA 1AQZA 1JB4A 1D6ZA 1IVWA 2WGQA 1EQKA 5AI1A 1QVF2 9RNTA 1G0TA 1HU9A 3EB8A 3GWRA 2MC8A 3PZWA 1IQ8A 1UI8A 4BL3A 3B8LA 1IYYA 1RCLA 4N6NB 1O7NB 2ZA4A 3EX9A 1V57A 1TFOA 2FNQA 2LQVA 3V92A 5AIFA 1T3BA 2UGIA 5D82A 3HI7A 1CYUA 1WMNA 3JUPA 3PS8A 1VQ83 2BMOB 5HGRA 1LOXA 4EV2A 2OTJ3 3LYGA 2B1XB 5AIIA 1M904 1IDPA 1YJN3 1SIHA 4O02B 1BRSA 5KP1A 4EBGA 3CME3 1OUNA 4I4KA 5AYRB 1ULJB 1M1K4 3GZYB 3EN8A 1YGEA 1MWSA 1UUGB 3EC9A 1OACA 3HOHA 4HZ9B 4HOHA 3NBJA 3NM2A 2CWVA 1GYBA 2W56A 2CFKA 7STDA 1I2EA 5IENA 1GY6A 1I8VA 3PCRA 3OW22 1FUSA 2W9QA 4BTYA 2P0XA 3A76A 3FH1A 4HAAA 5IG0A 2YFJB 1ZO2A 1BRIA 2XFTA 2R41A 3CPOA 3Q3FA 1C54A 1W2ZA 1S5AA 1AVLA 3ECFA 1OHOA 1AV4A 3KIIA 4N6MA 3WOEB 5HOHA 2XRXB 3KN4A 3H3HA 2F99A 1RTUA 5IG3A 5JBSA 1ULIB 4FMAA 4K61A 1YIT3 2BNGA 3EHCA 3JUOA 1N5PA 3K63A 5CXOA 1WMOA 1UI7A 3PXMA 2XFSA 1KSIA 2XGLA 1J2BA 1BNSA 3HIGA 2GBWB 1PU4A 1GMPA 1VZZA 3MPHA 1Q7Y4 1BAOA 1YGWA 2YFLB 1Q864 1AR0A 2XEPA 3WMDA 1SQWA 2SBLA 1EUIC 1STFI 3FG1A 1DMMA 1BSDA 1T2IA 3O8YA 3CNXA 4QWTA 1UUWB 4U13A 2CH9A 1V74A 1C7HA 4KFFA 4XM4A 1RRHA 2RFRA 4EW5A 1Q824 1KQS2 3DY5A 4LEHA 3SXXA 1TRQA 1FUTA 4O8SA 3X3ZA 5BVBA 3G713 3LH4A 4EYCA 4XDVA 3V98A 3X41A 3T8UA 1KD14 1N8QA 4J5GA 4MMZB 1JBTA 3S27A 1RN4A 5AIHA 3HX8A 5TGNA 2AAEA 1VQK3 3G6E3 4RNYA 5GSPA 1CEWI 3K9MC 1O7PB 2P05A 4O2HA 3CCJ3 3WHOA 3DGYA 3WA2X 1YI23 1BRJA 2XGNA 4MMYB 4N6V0 1RNBA 3KSPA 2P09A 2OTL3 3NV0A 1RGGA 4FCZA 1BSEA 1RGFA 4WWUC 1VQL3 1RGKA 1T5YA 3LTDA 1NB3I 1LNIA 3X40A 4EC6A 1VQ43 1B3SA 1US1A 1HYFA 3RGRA 3I553 3K7CA 2CKFB 4R80A 1YIJ3 3DGMA 5JPUA 3BNEA 1YVBI 4DKIA 1OCVA 1X1UA 2HMMB 1RRLA 1DVDA 2M7OA 3FCSB 1BIRA 1LRAA 2HMNB 3FF2A 8RNTA 1RGEA 2BU4A 3JVCA 3OXAA 1RDSA 2XF3A 1RGLA 3WR2A 3MG1A 3WODG 1YJ93 4N6TA 3L0RA 4LZIA 4WHAA 3ZG0A 1EKMA 4RBNA 1W5ZA 1GD3A 1LNHA 4JRFA 1NJI4 3DH2A 5IG4A 2CWTA 1TU5A 1W6YA 4K90B 1MNLA 2IUJA 1BRGA 3CC23 3SLUA 2KF4A 3UJMA 2A15A 1WTHA 1NDOB 1G02A 1OHSA 3M8CA 2QIYA 4MEIA 4LYLB 4K1UA 1VQ63 1DMNA 3AHWA 1GOVA 2GU1A 3AGNA 2E2UA 2R4IA 1NU3A 2O9UX 3BNDA 3U97A 5AEUB 1CQSA 6RNTA 1UCIA 1Q7HA 1O7MB 1UDII 4HVNA 1I2GA 1VQ53 3K0ZA 1K41A 3VGNA 3KSED 1K9M4 3HZPA 4HM6B 3UB1A 3CD63 2V1LA 2GSPA 4KT3B 1FGMA 1ZGXA 3F14A 3Q90A 1AY7A 1FGOA 5M18A 2GEYA 2Z7AA 5LC6A 1N9JA 2OWPA 8CHOA 4N6LA 3MWZA 4H3UA 7RNTA 1VQ73 1LXEA 1X1XA
chains in the Genus database with same CATH topology
1DMQA 1QVG2 3LT8A 2W56B 2QA43 4HM0B 3X3YA 1O7HB 1UW1A 3GRDA 1QAKA 1AVKA 3MHEA 2ML6A 3JUNA 1IV9A 2LYXA 3NHXA 3T8NA 1O7WB 4MMXB 4CCVA 1JRQA 3HK4A 1D6UA 4PEJA 2IA7A 1FGTA 2JDIH 4LGQA 3E99A 4L8OA 1IQXA 3FG4A 2HMKB 1ROVA 1FUWA 2E2VA 4AKYA 2O3OA 1IK3A 3S28A 2W03A 3I563 4KZ1A 3SEDA 1A67A 3EF8A 4HM3B 4LMIA 3BB9A 3STDA 3DGNA 5EVHA 3BNBA 3RGAA 3FZWA 2XR8B 1W02A 4STDA 3J7Yd 3CCU3 2ML5A 4KFDA 3D3LA 3PGBA 3LTAA 1SIIA 4WP5A 4HM7B 1WNHA 4EXRA 4XBXA 1EA2A 4HJLB 4LSOA 3EE1A 3JUQA 4ZM8A 3UNLA 2Z6BA 1VQP3 5DREA 1RJOA 5KP4A 2D42A 5CF2A 1IU7A 1W01A 6STDA 2C10A 4Q53A 2B24B 1DVCA 1W2B2 5AIGA 3RDEA 2KRTA 2IMJA 1IQYA 1NB5I 2Z76A 3NV0B 4RNZA 3IPTA 3WDGB 2YFIB 2ZDJA 4BTXA 1Y4KA 4ORLA 4HM2B 2HMJB 3LTCA 3N54B 4KFEA 1OHPA 2WOFA 4FMBA 3EBTA 1FGRA 1JB2A 3CCS3 3OWUA 2CIUA 5DRVA 5KP3A 3B4OA 1G96A 2K54A 2W0QA 2W2CA 1K8A4 5D83A 2GU3A 5I97A 4HBRA 2BMRB 3FKAA 3B4PA 5CLKA 1N8R4 3AMOA 3G4S3 4JF8A 1W6CA 5AYSC 1WMPA 2C11A 4RZMA 1FGQA 1GS3A 1PFPA 3QK9A 3EQQB 3CNMA 3D9RA 1HKXA 4NREA 4J9AA 1IT8A 2KCDA 1A2VA 3F8HA 4GB5A 3CCQ3 1Q814 3MG3A 1TIJA 1F8NA 3CCR3 1IV7A 1Q40A 4OVMA 3G0KA 1ASKA 1O7GB 2CK3H 4KVHA 1N9EA 3F7SA 4N6UA 1ISKA 3OV4A 2BMQB 4X2HA 1QAFA 2BT3A 1OF5B 1IVXA 2RGQA 4L8PA 5CF1A 1W6GA 4O3VA 1FA3A 3VF1A 3H51A 1QALA 1L5GB 2I9WA 3N8BA 3SVAA 1A2KA 2CG0A 1OPYA 2GXFA 4CDLA 5IW9A 4TX4A 3CU3A 5ELJA 1IT7A 2CC3A 2CFWA 4R9LA 1UUVB 1VQM3 4XB5A 2XH9A 3I0YA 4NHFA 5JPPA 4HKVB 5IEOA 3F9SA 1U8CB 1OF5A 2W04A 5A0OB 4FMDA 1JN5A 4OK0A 3K5TA 3ROBA 5FW5A 5IEPA 3EN1B 1Z1SA 3DGOA 3F7XA 4MJDA 2YX9A 3CCL3 2Y73A 3NBBA 3KFQC 1DYUA 1SJWA 2CWUA 3DM8A 3UL6A 2KXGA 3CCV3 1Q42A 4FR9A 1IVVA 3DGLA 1JKGA 1ZX2A 4X2OA 3B7CA 1VQ93 4HYZA 4H61A 4WFOA 2BO9B 2WGOA 4L7KA 3MYTA 5BXQA 3DUKA 4OUQA 2CG1A 1TUHA 2HMLB 2OQEA 4FCMA 1RN7A 2PZVA 2Y74A 2RCDA 3DMCA 2W6JH 4IT7A 5AEWB 3LZAA 3CCM3 1JV2B 1W4NA 3G16A 3S67A 4WYKB 5CK6A 3TDGA 1OGZA 3JUMA 2FXTA 2IUKA 3FGYA 3NX0A 3G8ZA 4HM8B 2F98A 2GEXA 2CFLA 3DZLA 3IJEB 3FSDA 1JB5A 2OQEC 4HM1B 2BHMA 3U1WA 3PYJA 3UL5A 4XBTA 3SOAA 3CC43 4J8TA 1U5OA 4WYKA 2CHCA 3LXUX 4IPBA 2INXA 1KWIA 3ER7A 1YHQ3 3OX9A 2WO0A 4BTWA 3GZXB 3T0UA 1EG9B 2P0MA 5EQLA 1STDA 5IERA 1ROAA 3GAXA 1KC84 4XDWA 1LVNA 2Z77A 4N6OB 2FGTA 3NBRA 1NWWA 3S5CA 3KKGA 2ZL8A 2K0MA 2RSXA 1E97A 4R1KA 1WQLB 2OCTA 3AMOB 3PCSA 2W9PA 4N3VA 1YJW3 1W7CA 2CFGA 3KE7A 1VQO3 3LMLA 1SPUA 5IG5A 1W00A 1QMAA 3QRDA 1JJ22 1N5HA 3CCE3 1E3RA 3BLZA 1NO3A 4R4KA 2CW9A 3CXC2 4GL6A 3MKIA 5EEOA 3GZRA 1K28A 3CPW2 1MOLA 3V99A 1D6YA 3DXOA 2UX0A 3SOYA 4G1MB 2GBXB 3MSOA 3CMA3 1Q40B 3Q2PA 3LTBA 1QJGA 1K734 3OWSA 3KZTA 3NM7A 3NXJA 3EBYA 3F40A 2L4VA 1GY7A 2XSOB 3LT9A 3NUVA 1IVUA 2F86B 2E2TA 3F8XA 3OWYA 5FGOA 3IMAB 2OOVA 4FMCA 4HM5B 1VQN3 5LC7A 3LOYA 3EJVA 3BNCA 3HIIA 1RKYA 3CC73 3GZBA 2PNCA 1CYVA 1M9GA 3NQZA 3NQYA 3N9HA 2MF7A 3FG3A 3VSYA 2QEX3 3SX1A 4K1VA 5STDA 1JN5B 4EV5A 5D81A 3MG2A 2Q07A 1BUQA 1S723 2OOVC 1TP6A 2WOHA 5G2GA 2XSHB 2JQ5A 1E3VA 1OH0A 1OGXA 1A90A 4FCJA 1TFKA 4AKZA 2QGUA 5IF6A 3FF0A 1JKGB 2STDA 1GD4A 5ELUA 3X3XA 3WA3A 3FLJA 4AEQA 1M1XB 1JNQA 4IIAA 4HZBB 4R9KA 3X42A 2HMOB 3WOFB 3ALAA 4XBYA 1GY5A 2P38A 2D1WA 1R4CA 3S29A 3Q1CA 4HM4B 2CFDA 1JB4A 1D6ZA 1IVWA 2WGQA 1EQKA 5AI1A 1QVF2 1HU9A 3EB8A 2MC8A 3GWRA 3PZWA 1IQ8A 1UI8A 3B8LA 4N6NB 1O7NB 3EX9A 2LQVA 1TFOA 2FNQA 3V92A 5AIFA 5D82A 3HI7A 1CYUA 1WMNA 3JUPA 3PS8A 1VQ83 2BMOB 5HGRA 1LOXA 4EV2A 2OTJ3 3LYGA 2B1XB 5AIIA 1M904 1IDPA 1YJN3 1SIHA 4O02B 5KP1A 4EBGA 3CME3 1OUNA 4I4KA 5AYRB 1ULJB 1M1K4 3GZYB 3EN8A 1YGEA 3EC9A 1OACA 4HZ9B 3NBJA 3NM2A 2CWVA 1GYBA 2W56A 2CFKA 7STDA 5IENA 1GY6A 3PCRA 3OW22 4BTYA 2W9QA 2P0XA 3A76A 3FH1A 5IG0A 2YFJB 2XFTA 1ZO2A 3CPOA 1W2ZA 1S5AA 1AVLA 3ECFA 1OHOA 1AV4A 3KIIA 4N6MA 3WOEB 5JBSA 2XRXB 3KN4A 3H3HA 2F99A 5IG3A 1ULIB 4FMAA 4K61A 1YIT3 2BNGA 3EHCA 3JUOA 1N5PA 3K63A 5CXOA 1WMOA 1UI7A 3PXMA 2XFSA 1KSIA 2XGLA 1J2BA 3HIGA 2GBWB 1PU4A 1VZZA 3MPHA 1Q7Y4 2YFLB 1Q864 1AR0A 2XEPA 3WMDA 1SQWA 2SBLA 1STFI 3FG1A 4U13A 1DMMA 3O8YA 3CNXA 4QWTA 1UUWB 2CH9A 1V74A 1C7HA 4KFFA 4XM4A 1RRHA 2RFRA 1KQS2 3DY5A 4LEHA 3SXXA 4O8SA 3X3ZA 5BVBA 3G713 3LH4A 4EYCA 4XDVA 3V98A 3X41A 3T8UA 1KD14 1N8QA 4MMZB 3S27A 5AIHA 3HX8A 5TGNA 1VQK3 3G6E3 4RNYA 1CEWI 3K9MC 1O7PB 2P05A 4O2HA 3CCJ3 3WA2X 1YI23 2XGNA 4MMYB 4N6V0 2OTL3 3KSPA 2P09A 3NV0A 4FCZA 4WWUC 1VQL3 1T5YA 3LTDA 1NB3I 4EC6A 3X40A 1VQ43 1US1A 3I553 3RGRA 3K7CA 2CKFB 4R80A 1YIJ3 3DGMA 5JPUA 3BNEA 1YVBI 1OCVA 2HMMB 1RRLA 1DVDA 2M7OA 3FCSB 2HMNB 3FF2A 3JVCA 3OXAA 2XF3A 3MG1A 3WODG 1YJ93 4N6TA 3L0RA 4LZIA 4WHAA 1EKMA 4RBNA 1W5ZA 1GD3A 1LNHA 4JRFA 1NJI4 5IG4A 2CWTA 1TU5A 1W6YA 4K90B 1MNLA 2IUJA 3CC23 3SLUA 3UJMA 2A15A 1WTHA 1NDOB 1OHSA 3M8CA 2QIYA 4MEIA 1VQ63 4K1UA 1DMNA 2GU1A 2E2UA 2R4IA 1NU3A 2O9UX 3BNDA 3U97A 5AEUB 1CQSA 1O7MB 4HVNA 1VQ53 3K0ZA 1K41A 3VGNA 3KSED 1K9M4 3HZPA 4HM6B 3UB1A 3CD63 2V1LA 1FGMA 3Q90A 3F14A 1FGOA 2GEYA 2Z7AA 5LC6A 1N9JA 2OWPA 8CHOA 4N6LA 3MWZA 4H3UA 1VQ73 1LXEA 1Q824
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DMQ A;  4HM0 B;  1O7H B;  3GRD A;  3MHE A;  3JUN A;  3NHX A;  3T8N A;  1O7W B;  3HK4 A;  4PEJ A;  4LGQ A;  3E99 A;  4L8O A;  2HMK B;  3SED A;  3EF8 A;  4HM3 B;  4LMI A;  3BB9 A;  3STD A;  5EVH A;  3RGA A;  3FZW A;  2XR8 B;  1W02 A;  4STD A;  4WP5 A;  4HM7 B;  4XBX A;  1EA2 A;  4HJL B;  3JUQ A;  3UNL A;  5DRE A;  5KP4 A;  5CF2 A;  1W01 A;  6STD A;  4Q53 A;  2B24 B;  5AIG A;  2IMJ A;  2Z76 A;  3NV0 B;  3IPT A;  2YFI B;  4ORL A;  4HM2 B;  2HMJ B;  1OHP A;  3EBT A;  1JB2 A;  3OWU A;  5DRV A;  5KP3 A;  3B4O A;  2K54 A;  2W2C A;  5D83 A;  2BMR B;  3FKA A;  3B4P A;  5CLK A;  4RZM A;  1GS3 A;  3EQQ B;  3CNM A;  3D9R A;  1HKX A;  4J9A A;  3F8H A;  4GB5 A;  3MG3 A;  1Q40 A;  4OVM A;  3G0K A;  1ASK A;  1O7G B;  4KVH A;  3F7S A;  1ISK A;  3OV4 A;  2BMQ B;  4X2H A;  2RGQ A;  5CF1 A;  1OF5 B;  4L8P A;  3H51 A;  2I9W A;  1A2K A;  1OPY A;  2GXF A;  4CDL A;  3CU3 A;  4R9L A;  1UUV B;  4XB5 A;  3I0Y A;  5JPP A;  4HKV B;  5IEO A;  3F9S A;  1OF5 A;  1JN5 A;  3ROB A;  5FW5 A;  5IEP A;  3EN1 B;  1Z1S A;  3F7X A;  4MJD A;  1SJW A;  3DM8 A;  1Q42 A;  1JKG A;  1ZX2 A;  4X2O A;  3B7C A;  4L7K A;  5BXQ A;  3MYT A;  3DUK A;  4OUQ A;  1TUH A;  2HML B;  4FCM A;  2PZV A;  2RCD A;  3DMC A;  5AEW B;  3LZA A;  3G16 A;  4WYK B;  5CK6 A;  1OGZ A;  3JUM A;  3FGY A;  3G8Z A;  4HM8 B;  2F98 A;  2GEX A;  3DZL A;  3FSD A;  1JB5 A;  4HM1 B;  4XBT A;  3SOA A;  4J8T A;  1U5O A;  4WYK A;  2CHC A;  2INX A;  3ER7 A;  3OX9 A;  3GZX B;  1EG9 B;  1STD A;  5IER A;  4XDW A;  2Z77 A;  3NBR A;  1NWW A;  3S5C A;  3KKG A;  1E97 A;  4R1K A;  1WQL B;  4N3V A;  3KE7 A;  5IG5 A;  1W00 A;  1QMA A;  1E3R A;  3BLZ A;  3MKI A;  3GZR A;  3DXO A;  2UX0 A;  3SOY A;  2GBX B;  3MSO A;  1Q40 B;  1QJG A;  3OWS A;  3KZT A;  3NXJ A;  3EBY A;  3F40 A;  1GY7 A;  2XSO B;  3NUV A;  2F86 B;  3F8X A;  3OWY A;  4HM5 B;  3EJV A;  3GZB A;  3VSY A;  4K1V A;  5STD A;  1JN5 B;  5D81 A;  3MG2 A;  1BUQ A;  1TP6 A;  5G2G A;  2XSH B;  2JQ5 A;  1E3V A;  1OH0 A;  1OGX A;  4FCJ A;  2QGU A;  5IF6 A;  3FF0 A;  1JKG B;  2STD A;  3FLJ A;  4IIA A;  4HZB B;  4R9K A;  2HMO B;  4XBY A;  1GY5 A;  4HM4 B;  1JB4 A;  5AI1 A;  3GWR A;  3B8L A;  1O7N B;  3EX9 A;  5AIF A;  5D82 A;  3JUP A;  2BMO B;  5HGR A;  3LYG A;  2B1X B;  5AII A;  1IDP A;  5KP1 A;  1OUN A;  4I4K A;  1ULJ B;  3GZY B;  3EN8 A;  3EC9 A;  4HZ9 B;  3NM2 A;  1GYB A;  7STD A;  5IEN A;  1GY6 A;  3A76 A;  3FH1 A;  5IG0 A;  2YFJ B;  1ZO2 A;  3CPO A;  1S5A A;  3ECF A;  1OHO A;  2XRX B;  5IG3 A;  3H3H A;  2F99 A;  1ULI B;  2BNG A;  3EHC A;  3JUO A;  5CXO A;  2GBW B;  1VZZ A;  2YFL B;  1AR0 A;  3WMD A;  4U13 A;  1DMM A;  3CNX A;  1UUW B;  1C7H A;  4XM4 A;  2RFR A;  4LEH A;  5BVB A;  4XDV A;  3T8U A;  5AIH A;  3HX8 A;  5TGN A;  1O7P B;  3KSP A;  3NV0 A;  4WWU C;  3RGR A;  3K7C A;  2CKF B;  5JPU A;  1OCV A;  2HMM B;  2HMN B;  3FF2 A;  3OXA A;  3MG1 A;  5IG4 A;  1W6Y A;  3UJM A;  2A15 A;  1NDO B;  1OHS A;  3M8C A;  2QIY A;  4K1U A;  1DMN A;  2R4I A;  1NU3 A;  5AEU B;  1CQS A;  1O7M B;  4HVN A;  3K0Z A;  1K41 A;  3VGN A;  3HZP A;  4HM6 B;  3Q90 A;  3F14 A;  2GEY A;  2Z7A A;  2OWP A;  8CHO A;  4H3U A; 
#chains in the Genus database with same CATH topology
 1DMQ A;  1QVG 2;  3LT8 A;  2W56 B;  2QA4 3;  3D5I A;  4HM0 B;  2IYJ A;  1O7H B;  1UW1 A;  5M1A A;  3X3Y A;  3GRD A;  2K3D A;  1QAK A;  1AVK A;  3MHE A;  2ML6 A;  3JUN A;  1IV9 A;  2LYX A;  1T2H A;  3NHX A;  3T8N A;  1LQM B;  1O7W B;  4MMX B;  4CCV A;  1JRQ A;  1UCL A;  1B27 A;  1A2P A;  3HK4 A;  1FW7 A;  1D6U A;  4PEJ A;  1RHL A;  1VQQ A;  2IA7 A;  1FGT A;  4BIR A;  1BVI A;  2JDI H;  5BIR A;  4LGQ A;  3E99 A;  4L8O A;  1IQX A;  3FG4 A;  2HMK B;  1ROV A;  5RNT A;  1FUW A;  2E2V A;  1BRN L;  1B2S A;  4AKY A;  2O3O A;  1IK3 A;  3S28 A;  1BGS A;  2W03 A;  3I56 3;  4KZ1 A;  3SED A;  1A67 A;  3EF8 A;  2H0I A;  4HM3 B;  4LMI A;  3BB9 A;  3STD A;  3DGN A;  5EVH A;  1MWR A;  1B21 A;  1DET A;  3BNB A;  3RGA A;  3FZW A;  2XR8 B;  1W02 A;  4STD A;  3J7Y d;  1LOV A;  1BOX A;  2ML5 A;  3D3L A;  4KFD A;  3CCU 3;  3PGB A;  2UUG C;  3LTA A;  1SII A;  4WP5 A;  4HM7 B;  1WNH A;  4EXR A;  4XBX A;  1EA2 A;  1GOU A;  4HJL B;  4LSO A;  3EE1 A;  3JUQ A;  4ZM8 A;  3UNL A;  2Z6B A;  1VQP 3;  5DRE A;  1RJO A;  5KP4 A;  2D42 A;  5CF2 A;  1IU7 A;  2C4B A;  1MGW A;  1W01 A;  6STD A;  1V58 A;  1BUJ A;  2C10 A;  4Q53 A;  2B24 B;  1DVC A;  1ZS7 A;  2KAA A;  5AIG A;  3RDE A;  1W2B 2;  4CPK A;  2KRT A;  3URP A;  2IMJ A;  4J5K A;  1IQY A;  1NB5 I;  1JBR A;  4NPB A;  2Z76 A;  3NV0 B;  4RNZ A;  1TJD A;  3IPT A;  2J8X B;  1X1Y A;  3WDG B;  2YFI B;  2ZDJ A;  2CX1 A;  4BTX A;  1B2U A;  1Y4K A;  2KF5 A;  3AGO A;  4ORL A;  4HM2 B;  2HMJ B;  2HOH A;  3LTC A;  3N54 B;  4KFE A;  1OHP A;  2WOF A;  4FMB A;  3EBT A;  1FGR A;  1JB2 A;  3CCS 3;  3OWU A;  2CIU A;  2F5W A;  5DRV A;  1PYL A;  5KP3 A;  1G96 A;  2K54 A;  2W0Q A;  3B4O A;  2W2C A;  1K8A 4;  5D83 A;  2GU3 A;  5I97 A;  4BU4 A;  4HBR A;  3D79 A;  2BMR B;  3FKA A;  3B4P A;  5CLK A;  1N8R 4;  1BNI A;  3AMO A;  2L1S A;  3D4A A;  3ZFZ A;  3G4S 3;  4JF8 A;  1W6C A;  5AYS C;  1WMP A;  7GSP A;  3A5E A;  2C11 A;  4RZM A;  1FGQ A;  1GS3 A;  1PFP A;  3QK9 A;  3EQQ B;  3CNM A;  1PY3 A;  3D9R A;  1UCJ A;  1HKX A;  4NRE A;  4J9A A;  1IT8 A;  1FZU A;  2KCD A;  1A2V A;  3F8H A;  4GB5 A;  3CCQ 3;  5CF1 A;  1Q81 4;  3MG3 A;  1TIJ A;  1F8N A;  3CCR 3;  1IV7 A;  1Q40 A;  4OVM A;  1BNR A;  3G0K A;  1ASK A;  1O7G B;  2CK3 H;  4KVH A;  1N9E A;  5M19 A;  3F7S A;  4N6U A;  1ISK A;  3OV4 A;  2BMQ B;  4X2H A;  1QAF A;  2BT3 A;  1OF5 B;  1IVX A;  2RGQ A;  4L8P A;  3RNT A;  1W6G A;  4O3V A;  1FA3 A;  3VF1 A;  3H51 A;  1QAL A;  4RNT A;  1L5G B;  2I9W A;  3N8B A;  3SVA A;  4ILF A;  1A2K A;  4BL2 A;  2CG0 A;  3AHS A;  1OPY A;  2GXF A;  4CDL A;  5IW9 A;  4TX4 A;  3CU3 A;  1SAR A;  5ELJ A;  1IT7 A;  1LOY A;  1RGH A;  2CC3 A;  2CFW A;  1UUV B;  1BAN A;  4R9L A;  1BNG A;  1VQM 3;  4XB5 A;  2XH9 A;  3I0Y A;  4NHF A;  5JPP A;  1GSP A;  1CH0 A;  2F56 A;  3F9S A;  1U8C B;  4HKV B;  5IEO A;  1OF5 A;  2W04 A;  5A0O B;  4FMD A;  1MGR A;  1RMS A;  1JN5 A;  4OK0 A;  3K5T A;  3ROB A;  5FW5 A;  5IEP A;  3EN1 B;  1Z1S A;  3DGO A;  3F7X A;  1I0X A;  2YX9 A;  4MJD A;  3CCL 3;  2Y73 A;  3NBB A;  3KFQ C;  1DYU A;  1SJW A;  2CWU A;  3DM8 A;  3UL6 A;  2RNT A;  2BIR A;  2KXG A;  3CCV 3;  1Q42 A;  4FR9 A;  1IVV A;  3DGL A;  4GHO A;  1JKG A;  1ZX2 A;  4X2O A;  3B7C A;  3SYU A;  2IY2 A;  1VQ9 3;  4HYZ A;  1RSN A;  4H61 A;  4WFO A;  2BO9 B;  2WGO A;  4L7K A;  3MYT A;  5BXQ A;  3DUK A;  4OUQ A;  2CG1 A;  1TUH A;  1X1W A;  2HML B;  2OQE A;  4FCM A;  1RN7 A;  2PZV A;  1LOW A;  2Y74 A;  2F4Y A;  2RCD A;  3DMC A;  1YVS A;  2W6J H;  4IT7 A;  5AEW B;  3LZA A;  3CCM 3;  1JV2 B;  1W4N A;  3G16 A;  3S67 A;  4WYK B;  5CK6 A;  1UGH I;  3TDG A;  1OGZ A;  3JUM A;  2FXT A;  2IUK A;  3FGY A;  3NX0 A;  3G8Z A;  4HM8 B;  1EEJ A;  2F98 A;  2GEX A;  2AAD A;  2CFL A;  4GSP A;  3DZL A;  3IJE B;  3FSD A;  1BU4 A;  1JB5 A;  2CX0 A;  1I70 A;  2OQE C;  1NNV A;  4HM1 B;  2BHM A;  3U1W A;  3PYJ A;  2F5M A;  3BU4 A;  3UL5 A;  3D5G A;  4XBT A;  3SOA A;  3CC4 3;  4J8T A;  1U5O A;  1LQG C;  4WYK A;  2CHC A;  3LXU X;  4IPB A;  2INX A;  1KWI A;  3ER7 A;  1RCK A;  1MWT A;  1YHQ 3;  3OX9 A;  2WO0 A;  4BTW A;  3GZX B;  4CJN A;  3T0U A;  1EG9 B;  2P0M A;  5EQL A;  2KF3 A;  1STD A;  1MWU A;  5IER A;  1R4Y A;  1ROA A;  3GAX A;  1KC8 4;  1BNJ A;  4XDW A;  1LVN A;  1BSC A;  1RNT A;  1I3I A;  2FGT A;  2Z77 A;  3NBR A;  1NWW A;  4N6O B;  3S5C A;  3KKG A;  2ZL8 A;  2K0M A;  2RSX A;  1E97 A;  4R1K A;  1YNV X;  1WQL B;  2OCT A;  3AMO B;  3PCS A;  1BNF A;  2W9P A;  4N3V A;  1YJW 3;  1W7C A;  2CFG A;  3KE7 A;  1VQO 3;  3LML A;  1GMR A;  1SPU A;  5IG5 A;  1RLS A;  1W00 A;  1QMA A;  3QRD A;  1JJ2 2;  1UCK A;  1N5H A;  2RBI A;  3CCE 3;  1E3R A;  3BLZ A;  1NO3 A;  4R4K A;  2CW9 A;  3CXC 2;  4GL6 A;  3GSP A;  1BNE A;  3MKI A;  1RGC A;  5EEO A;  1RN1 A;  3GZR A;  1K28 A;  3CPW 2;  1MOL A;  3V99 A;  1D6Y A;  3DXO A;  2UX0 A;  3SOY A;  4G1M B;  2GBX B;  3MSO A;  5G1K A;  2ZHX B;  1Q40 B;  3CMA 3;  1GOY A;  1I2F A;  3Q2P A;  1TTO A;  1B2Z A;  3LTB A;  1QJG A;  1K73 4;  3OWS A;  3KZT A;  3NM7 A;  3NXJ A;  3EBY A;  3F40 A;  2L4V A;  1GY7 A;  2XSO B;  3LT9 A;  3NUV A;  1Q9E A;  1IVU A;  1GMQ A;  2F86 B;  2E2T A;  1JZD A;  3F8X A;  3OWY A;  2SAR A;  3IMA B;  5FGO A;  2OOV A;  4FMC A;  4HM5 B;  1VQN 3;  5LC7 A;  3LOY A;  3EJV A;  1B2X A;  3BNC A;  3HII A;  1RKY A;  3CC7 3;  3GZB A;  5G1L A;  2PNC A;  1B20 A;  1CYV A;  1HZ1 A;  1M9G A;  3NQZ A;  1JZO A;  3NQY A;  3N9H A;  2MF7 A;  1I0V A;  2KF6 A;  3FG3 A;  3VSY A;  3BIR A;  2QEX 3;  1BSB A;  3SX1 A;  6GSP A;  4K1V A;  1B2M A;  5STD A;  1JN5 B;  4EV5 A;  5D81 A;  3MG2 A;  2Q07 A;  1BUQ A;  1S72 3;  1TRP A;  2OOV C;  1DE3 A;  1TP6 A;  2WOH A;  5G2G A;  2XSH B;  2JQ5 A;  1E3V A;  1OH0 A;  1OGX A;  1BSA A;  1A90 A;  1I3F A;  4FCJ A;  1TFK A;  4AKZ A;  2QGU A;  3KCH A;  5IF6 A;  3FF0 A;  5BU4 A;  1JKG B;  2H0G A;  1FYS A;  1GD4 A;  2STD A;  5ELU A;  3X3X A;  3WA3 A;  3FLJ A;  2H0H A;  4AEQ A;  1M1X B;  3ZG5 A;  1JNQ A;  4IIA A;  4HZB B;  4R9K A;  3X42 A;  1JBS A;  1UGI A;  2HMO B;  3ALA A;  3WOF B;  4XBY A;  1BRK A;  1GY5 A;  2P38 A;  2D1W A;  1BRH A;  1R4C A;  3S29 A;  1RGA A;  3Q1C A;  4HM4 B;  2CFD A;  4I5Q A;  1AQZ A;  1JB4 A;  1D6Z A;  1IVW A;  2WGQ A;  1EQK A;  5AI1 A;  1QVF 2;  9RNT A;  1G0T A;  1HU9 A;  3EB8 A;  3GWR A;  2MC8 A;  3PZW A;  1IQ8 A;  1UI8 A;  4BL3 A;  3B8L A;  1IYY A;  1RCL A;  4N6N B;  1O7N B;  2ZA4 A;  3EX9 A;  1V57 A;  1TFO A;  2FNQ A;  2LQV A;  3V92 A;  5AIF A;  1T3B A;  2UGI A;  5D82 A;  3HI7 A;  1CYU A;  1WMN A;  3JUP A;  3PS8 A;  1VQ8 3;  2BMO B;  5HGR A;  1LOX A;  4EV2 A;  2OTJ 3;  3LYG A;  2B1X B;  5AII A;  1M90 4;  1IDP A;  1YJN 3;  1SIH A;  4O02 B;  1BRS A;  5KP1 A;  4EBG A;  3CME 3;  1OUN A;  4I4K A;  5AYR B;  1ULJ B;  1M1K 4;  3GZY B;  3EN8 A;  1YGE A;  1MWS A;  1UUG B;  3EC9 A;  1OAC A;  3HOH A;  4HZ9 B;  4HOH A;  3NBJ A;  3NM2 A;  2CWV A;  1GYB A;  2W56 A;  2CFK A;  7STD A;  1I2E A;  5IEN A;  1GY6 A;  1I8V A;  3PCR A;  3OW2 2;  1FUS A;  2W9Q A;  4BTY A;  2P0X A;  3A76 A;  3FH1 A;  4HAA A;  5IG0 A;  2YFJ B;  1ZO2 A;  1BRI A;  2XFT A;  2R41 A;  3CPO A;  3Q3F A;  1C54 A;  1W2Z A;  1S5A A;  1AVL A;  3ECF A;  1OHO A;  1AV4 A;  3KII A;  4N6M A;  3WOE B;  5HOH A;  2XRX B;  3KN4 A;  3H3H A;  2F99 A;  1RTU A;  5IG3 A;  5JBS A;  1ULI B;  4FMA A;  4K61 A;  1YIT 3;  2BNG A;  3EHC A;  3JUO A;  1N5P A;  3K63 A;  5CXO A;  1WMO A;  1UI7 A;  3PXM A;  2XFS A;  1KSI A;  2XGL A;  1J2B A;  1BNS A;  3HIG A;  2GBW B;  1PU4 A;  1GMP A;  1VZZ A;  3MPH A;  1Q7Y 4;  1BAO A;  1YGW A;  2YFL B;  1Q86 4;  1AR0 A;  2XEP A;  3WMD A;  1SQW A;  2SBL A;  1EUI C;  1STF I;  3FG1 A;  1DMM A;  1BSD A;  1T2I A;  3O8Y A;  3CNX A;  4QWT A;  1UUW B;  4U13 A;  2CH9 A;  1V74 A;  1C7H A;  4KFF A;  4XM4 A;  1RRH A;  2RFR A;  4EW5 A;  1Q82 4;  1KQS 2;  3DY5 A;  4LEH A;  3SXX A;  1TRQ A;  1FUT A;  4O8S A;  3X3Z A;  5BVB A;  3G71 3;  3LH4 A;  4EYC A;  4XDV A;  3V98 A;  3X41 A;  3T8U A;  1KD1 4;  1N8Q A;  4J5G A;  4MMZ B;  1JBT A;  3S27 A;  1RN4 A;  5AIH A;  3HX8 A;  5TGN A;  2AAE A;  1VQK 3;  3G6E 3;  4RNY A;  5GSP A;  1CEW I;  3K9M C;  1O7P B;  2P05 A;  4O2H A;  3CCJ 3;  3WHO A;  3DGY A;  3WA2 X;  1YI2 3;  1BRJ A;  2XGN A;  4MMY B;  4N6V 0;  1RNB A;  3KSP A;  2P09 A;  2OTL 3;  3NV0 A;  1RGG A;  4FCZ A;  1BSE A;  1RGF A;  4WWU C;  1VQL 3;  1RGK A;  1T5Y A;  3LTD A;  1NB3 I;  1LNI A;  3X40 A;  4EC6 A;  1VQ4 3;  1B3S A;  1US1 A;  1HYF A;  3RGR A;  3I55 3;  3K7C A;  2CKF B;  4R80 A;  1YIJ 3;  3DGM A;  5JPU A;  3BNE A;  1YVB I;  4DKI A;  1OCV A;  1X1U A;  2HMM B;  1RRL A;  1DVD A;  2M7O A;  3FCS B;  1BIR A;  1LRA A;  2HMN B;  3FF2 A;  8RNT A;  1RGE A;  2BU4 A;  3JVC A;  3OXA A;  1RDS A;  2XF3 A;  1RGL A;  3WR2 A;  3MG1 A;  3WOD G;  1YJ9 3;  4N6T A;  3L0R A;  4LZI A;  4WHA A;  3ZG0 A;  1EKM A;  4RBN A;  1W5Z A;  1GD3 A;  1LNH A;  4JRF A;  1NJI 4;  3DH2 A;  5IG4 A;  2CWT A;  1TU5 A;  1W6Y A;  4K90 B;  1MNL A;  2IUJ A;  1BRG A;  3CC2 3;  3SLU A;  2KF4 A;  3UJM A;  2A15 A;  1WTH A;  1NDO B;  1G02 A;  1OHS A;  3M8C A;  2QIY A;  4MEI A;  4LYL B;  4K1U A;  1VQ6 3;  1DMN A;  3AHW A;  1GOV A;  2GU1 A;  3AGN A;  2E2U A;  2R4I A;  1NU3 A;  2O9U X;  3BND A;  3U97 A;  5AEU B;  1CQS A;  6RNT A;  1UCI A;  1Q7H A;  1O7M B;  1UDI I;  4HVN A;  1I2G A;  1VQ5 3;  3K0Z A;  1K41 A;  3VGN A;  3KSE D;  1K9M 4;  3HZP A;  4HM6 B;  3UB1 A;  3CD6 3;  2V1L A;  2GSP A;  4KT3 B;  1FGM A;  1ZGX A;  3F14 A;  3Q90 A;  1AY7 A;  1FGO A;  5M18 A;  2GEY A;  2Z7A A;  5LC6 A;  1N9J A;  2OWP A;  8CHO A;  4N6L A;  3MWZ A;  4H3U A;  7RNT A;  1VQ7 3;  1LXE A;  1X1X A; 
#chains in the Genus database with same CATH homology
 1DMQ A;  1QVG 2;  3LT8 A;  2W56 B;  2QA4 3;  4HM0 B;  3X3Y A;  1O7H B;  1UW1 A;  3GRD A;  1QAK A;  1AVK A;  3MHE A;  2ML6 A;  3JUN A;  1IV9 A;  2LYX A;  3NHX A;  3T8N A;  1O7W B;  4MMX B;  4CCV A;  1JRQ A;  3HK4 A;  1D6U A;  4PEJ A;  2IA7 A;  1FGT A;  2JDI H;  4LGQ A;  3E99 A;  4L8O A;  1IQX A;  3FG4 A;  2HMK B;  1ROV A;  1FUW A;  2E2V A;  4AKY A;  2O3O A;  1IK3 A;  3S28 A;  2W03 A;  3I56 3;  4KZ1 A;  3SED A;  1A67 A;  3EF8 A;  4HM3 B;  4LMI A;  3BB9 A;  3STD A;  3DGN A;  5EVH A;  3BNB A;  3RGA A;  3FZW A;  2XR8 B;  1W02 A;  4STD A;  3J7Y d;  3CCU 3;  2ML5 A;  4KFD A;  3D3L A;  3PGB A;  3LTA A;  1SII A;  4WP5 A;  4HM7 B;  1WNH A;  4EXR A;  4XBX A;  1EA2 A;  4HJL B;  4LSO A;  3EE1 A;  3JUQ A;  4ZM8 A;  3UNL A;  2Z6B A;  1VQP 3;  5DRE A;  1RJO A;  5KP4 A;  2D42 A;  5CF2 A;  1IU7 A;  1W01 A;  6STD A;  2C10 A;  4Q53 A;  2B24 B;  1DVC A;  1W2B 2;  5AIG A;  3RDE A;  2KRT A;  2IMJ A;  1IQY A;  1NB5 I;  2Z76 A;  3NV0 B;  4RNZ A;  3IPT A;  3WDG B;  2YFI B;  2ZDJ A;  4BTX A;  1Y4K A;  4ORL A;  4HM2 B;  2HMJ B;  3LTC A;  3N54 B;  4KFE A;  1OHP A;  2WOF A;  4FMB A;  3EBT A;  1FGR A;  1JB2 A;  3CCS 3;  3OWU A;  2CIU A;  5DRV A;  5KP3 A;  3B4O A;  1G96 A;  2K54 A;  2W0Q A;  2W2C A;  1K8A 4;  5D83 A;  2GU3 A;  5I97 A;  4HBR A;  2BMR B;  3FKA A;  3B4P A;  5CLK A;  1N8R 4;  3AMO A;  3G4S 3;  4JF8 A;  1W6C A;  5AYS C;  1WMP A;  2C11 A;  4RZM A;  1FGQ A;  1GS3 A;  1PFP A;  3QK9 A;  3EQQ B;  3CNM A;  3D9R A;  1HKX A;  4NRE A;  4J9A A;  1IT8 A;  2KCD A;  1A2V A;  3F8H A;  4GB5 A;  3CCQ 3;  1Q81 4;  3MG3 A;  1TIJ A;  1F8N A;  3CCR 3;  1IV7 A;  1Q40 A;  4OVM A;  3G0K A;  1ASK A;  1O7G B;  2CK3 H;  4KVH A;  1N9E A;  3F7S A;  4N6U A;  1ISK A;  3OV4 A;  2BMQ B;  4X2H A;  1QAF A;  2BT3 A;  1OF5 B;  1IVX A;  2RGQ A;  4L8P A;  5CF1 A;  1W6G A;  4O3V A;  1FA3 A;  3VF1 A;  3H51 A;  1QAL A;  1L5G B;  2I9W A;  3N8B A;  3SVA A;  1A2K A;  2CG0 A;  1OPY A;  2GXF A;  4CDL A;  5IW9 A;  4TX4 A;  3CU3 A;  5ELJ A;  1IT7 A;  2CC3 A;  2CFW A;  4R9L A;  1UUV B;  1VQM 3;  4XB5 A;  2XH9 A;  3I0Y A;  4NHF A;  5JPP A;  4HKV B;  5IEO A;  3F9S A;  1U8C B;  1OF5 A;  2W04 A;  5A0O B;  4FMD A;  1JN5 A;  4OK0 A;  3K5T A;  3ROB A;  5FW5 A;  5IEP A;  3EN1 B;  1Z1S A;  3DGO A;  3F7X A;  4MJD A;  2YX9 A;  3CCL 3;  2Y73 A;  3NBB A;  3KFQ C;  1DYU A;  1SJW A;  2CWU A;  3DM8 A;  3UL6 A;  2KXG A;  3CCV 3;  1Q42 A;  4FR9 A;  1IVV A;  3DGL A;  1JKG A;  1ZX2 A;  4X2O A;  3B7C A;  1VQ9 3;  4HYZ A;  4H61 A;  4WFO A;  2BO9 B;  2WGO A;  4L7K A;  3MYT A;  5BXQ A;  3DUK A;  4OUQ A;  2CG1 A;  1TUH A;  2HML B;  2OQE A;  4FCM A;  1RN7 A;  2PZV A;  2Y74 A;  2RCD A;  3DMC A;  2W6J H;  4IT7 A;  5AEW B;  3LZA A;  3CCM 3;  1JV2 B;  1W4N A;  3G16 A;  3S67 A;  4WYK B;  5CK6 A;  3TDG A;  1OGZ A;  3JUM A;  2FXT A;  2IUK A;  3FGY A;  3NX0 A;  3G8Z A;  4HM8 B;  2F98 A;  2GEX A;  2CFL A;  3DZL A;  3IJE B;  3FSD A;  1JB5 A;  2OQE C;  4HM1 B;  2BHM A;  3U1W A;  3PYJ A;  3UL5 A;  4XBT A;  3SOA A;  3CC4 3;  4J8T A;  1U5O A;  4WYK A;  2CHC A;  3LXU X;  4IPB A;  2INX A;  1KWI A;  3ER7 A;  1YHQ 3;  3OX9 A;  2WO0 A;  4BTW A;  3GZX B;  3T0U A;  1EG9 B;  2P0M A;  5EQL A;  1STD A;  5IER A;  1ROA A;  3GAX A;  1KC8 4;  4XDW A;  1LVN A;  2Z77 A;  4N6O B;  2FGT A;  3NBR A;  1NWW A;  3S5C A;  3KKG A;  2ZL8 A;  2K0M A;  2RSX A;  1E97 A;  4R1K A;  1WQL B;  2OCT A;  3AMO B;  3PCS A;  2W9P A;  4N3V A;  1YJW 3;  1W7C A;  2CFG A;  3KE7 A;  1VQO 3;  3LML A;  1SPU A;  5IG5 A;  1W00 A;  1QMA A;  3QRD A;  1JJ2 2;  1N5H A;  3CCE 3;  1E3R A;  3BLZ A;  1NO3 A;  4R4K A;  2CW9 A;  3CXC 2;  4GL6 A;  3MKI A;  5EEO A;  3GZR A;  1K28 A;  3CPW 2;  1MOL A;  3V99 A;  1D6Y A;  3DXO A;  2UX0 A;  3SOY A;  4G1M B;  2GBX B;  3MSO A;  3CMA 3;  1Q40 B;  3Q2P A;  3LTB A;  1QJG A;  1K73 4;  3OWS A;  3KZT A;  3NM7 A;  3NXJ A;  3EBY A;  3F40 A;  2L4V A;  1GY7 A;  2XSO B;  3LT9 A;  3NUV A;  1IVU A;  2F86 B;  2E2T A;  3F8X A;  3OWY A;  5FGO A;  3IMA B;  2OOV A;  4FMC A;  4HM5 B;  1VQN 3;  5LC7 A;  3LOY A;  3EJV A;  3BNC A;  3HII A;  1RKY A;  3CC7 3;  3GZB A;  2PNC A;  1CYV A;  1M9G A;  3NQZ A;  3NQY A;  3N9H A;  2MF7 A;  3FG3 A;  3VSY A;  2QEX 3;  3SX1 A;  4K1V A;  5STD A;  1JN5 B;  4EV5 A;  5D81 A;  3MG2 A;  2Q07 A;  1BUQ A;  1S72 3;  2OOV C;  1TP6 A;  2WOH A;  5G2G A;  2XSH B;  2JQ5 A;  1E3V A;  1OH0 A;  1OGX A;  1A90 A;  4FCJ A;  1TFK A;  4AKZ A;  2QGU A;  5IF6 A;  3FF0 A;  1JKG B;  2STD A;  1GD4 A;  5ELU A;  3X3X A;  3WA3 A;  3FLJ A;  4AEQ A;  1M1X B;  1JNQ A;  4IIA A;  4HZB B;  4R9K A;  3X42 A;  2HMO B;  3WOF B;  3ALA A;  4XBY A;  1GY5 A;  2P38 A;  2D1W A;  1R4C A;  3S29 A;  3Q1C A;  4HM4 B;  2CFD A;  1JB4 A;  1D6Z A;  1IVW A;  2WGQ A;  1EQK A;  5AI1 A;  1QVF 2;  1HU9 A;  3EB8 A;  2MC8 A;  3GWR A;  3PZW A;  1IQ8 A;  1UI8 A;  3B8L A;  4N6N B;  1O7N B;  3EX9 A;  2LQV A;  1TFO A;  2FNQ A;  3V92 A;  5AIF A;  5D82 A;  3HI7 A;  1CYU A;  1WMN A;  3JUP A;  3PS8 A;  1VQ8 3;  2BMO B;  5HGR A;  1LOX A;  4EV2 A;  2OTJ 3;  3LYG A;  2B1X B;  5AII A;  1M90 4;  1IDP A;  1YJN 3;  1SIH A;  4O02 B;  5KP1 A;  4EBG A;  3CME 3;  1OUN A;  4I4K A;  5AYR B;  1ULJ B;  1M1K 4;  3GZY B;  3EN8 A;  1YGE A;  3EC9 A;  1OAC A;  4HZ9 B;  3NBJ A;  3NM2 A;  2CWV A;  1GYB A;  2W56 A;  2CFK A;  7STD A;  5IEN A;  1GY6 A;  3PCR A;  3OW2 2;  4BTY A;  2W9Q A;  2P0X A;  3A76 A;  3FH1 A;  5IG0 A;  2YFJ B;  2XFT A;  1ZO2 A;  3CPO A;  1W2Z A;  1S5A A;  1AVL A;  3ECF A;  1OHO A;  1AV4 A;  3KII A;  4N6M A;  3WOE B;  5JBS A;  2XRX B;  3KN4 A;  3H3H A;  2F99 A;  5IG3 A;  1ULI B;  4FMA A;  4K61 A;  1YIT 3;  2BNG A;  3EHC A;  3JUO A;  1N5P A;  3K63 A;  5CXO A;  1WMO A;  1UI7 A;  3PXM A;  2XFS A;  1KSI A;  2XGL A;  1J2B A;  3HIG A;  2GBW B;  1PU4 A;  1VZZ A;  3MPH A;  1Q7Y 4;  2YFL B;  1Q86 4;  1AR0 A;  2XEP A;  3WMD A;  1SQW A;  2SBL A;  1STF I;  3FG1 A;  4U13 A;  1DMM A;  3O8Y A;  3CNX A;  4QWT A;  1UUW B;  2CH9 A;  1V74 A;  1C7H A;  4KFF A;  4XM4 A;  1RRH A;  2RFR A;  1KQS 2;  3DY5 A;  4LEH A;  3SXX A;  4O8S A;  3X3Z A;  5BVB A;  3G71 3;  3LH4 A;  4EYC A;  4XDV A;  3V98 A;  3X41 A;  3T8U A;  1KD1 4;  1N8Q A;  4MMZ B;  3S27 A;  5AIH A;  3HX8 A;  5TGN A;  1VQK 3;  3G6E 3;  4RNY A;  1CEW I;  3K9M C;  1O7P B;  2P05 A;  4O2H A;  3CCJ 3;  3WA2 X;  1YI2 3;  2XGN A;  4MMY B;  4N6V 0;  2OTL 3;  3KSP A;  2P09 A;  3NV0 A;  4FCZ A;  4WWU C;  1VQL 3;  1T5Y A;  3LTD A;  1NB3 I;  4EC6 A;  3X40 A;  1VQ4 3;  1US1 A;  3I55 3;  3RGR A;  3K7C A;  2CKF B;  4R80 A;  1YIJ 3;  3DGM A;  5JPU A;  3BNE A;  1YVB I;  1OCV A;  2HMM B;  1RRL A;  1DVD A;  2M7O A;  3FCS B;  2HMN B;  3FF2 A;  3JVC A;  3OXA A;  2XF3 A;  3MG1 A;  3WOD G;  1YJ9 3;  4N6T A;  3L0R A;  4LZI A;  4WHA A;  1EKM A;  4RBN A;  1W5Z A;  1GD3 A;  1LNH A;  4JRF A;  1NJI 4;  5IG4 A;  2CWT A;  1TU5 A;  1W6Y A;  4K90 B;  1MNL A;  2IUJ A;  3CC2 3;  3SLU A;  3UJM A;  2A15 A;  1WTH A;  1NDO B;  1OHS A;  3M8C A;  2QIY A;  4MEI A;  1VQ6 3;  4K1U A;  1DMN A;  2GU1 A;  2E2U A;  2R4I A;  1NU3 A;  2O9U X;  3BND A;  3U97 A;  5AEU B;  1CQS A;  1O7M B;  4HVN A;  1VQ5 3;  3K0Z A;  1K41 A;  3VGN A;  3KSE D;  1K9M 4;  3HZP A;  4HM6 B;  3UB1 A;  3CD6 3;  2V1L A;  1FGM A;  3Q90 A;  3F14 A;  1FGO A;  2GEY A;  2Z7A A;  5LC6 A;  1N9J A;  2OWP A;  8CHO A;  4N6L A;  3MWZ A;  4H3U A;  1VQ7 3;  1LXE A;  1Q82 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...