1UGIA

Uracil-dna glycosylase inhibitor protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
molecule tags Hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
total genus 17
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ugiA00
1LQGC 1UUGB 2UGIA 1UGHI 1LQMB 2J8XB 1UDII 2UUGC 2ZHXB 4LYLB 1EUIC 1UGIA
chains in the Genus database with same CATH superfamily
3DM8A 4NREA 1WQLB 3GRDA 1RRHA 4NHFA 1B2MA 2L4VA 3F8HA 1RHLA 2SARA 4L8OA 1TU5A 1KQS2 3LTBA 3NM7A 1LXEA 3S5CA 1MWTA 3CCE3 2JDIH 4LEHA 1RSNA 1RCLA 2W6JH 1Q864 3H51A 1TP6A 3UJMA 3SYUA 4EYCA 4BL3A 3S29A 1K734 1UI7A 3VSYA 1ZS7A 2LYXA 1VQ93 4RBNA 2D42A 5AYSC 1K41A 5JPUA 4K1VA 3IJEB 4CPKA 2F56A 1JN5A 3F9SA 5EQLA 3IMAB 5AIHA 2GBWB 4LYLB 1B3SA 3BNBA 3DGMA 2B1XB 1IYYA 2XGLA 2H0HA 4LGQA 1N9JA 2K0MA 1BOXA 1TIJA 4H61A 3U1WA 1AY7A 1S723 4AKZA 2KF6A 1E3VA 3NV0B 1PFPA 1CYUA 5AYRB 4AEQA 1BANA 3O8YA 5KP3A 3SOYA 3Q3FA 2CFWA 4K61A 5I97A 1G0TA 2D1WA 4IPBA 1AR0A 1QALA 3FF2A 3FSDA 1IU7A 4FMCA 5GSPA 4X2OA 3FCSB 5JBSA 1MWRA 2Z6BA 1JB5A 3FGYA 3OX9A 3OWSA 2BO9B 3WODG 2BMRB 2P0MA 1HYFA 3MG3A 1Q824 1UGIA 1LOXA 2XGNA 1OF5B 1DVDA 1IV7A 1NNVA 3D9RA 1SIIA 1Q7HA 4IT7A 3KIIA 2SBLA 3BNEA 1GYBA 1STFI 4RNZA 2Z7AA 3IPTA 1YVSA 1BSEA 1BNEA 2GBXB 2CG1A 1RGLA 5ELUA 1IK3A 1BNRA 5BU4A 1OCVA 3GAXA 2CFKA 4XBXA 1KD14 2OQEC 1YJ93 1BUJA 4MJDA 5AEUB 2UX0A 1V74A 1W02A 2BU4A 1RRLA 1Y4KA 4ZM8A 3PCSA 2RSXA 3STDA 2FGTA 1TTOA 4XB5A 3BNDA 1Q9EA 1BSAA 3RGRA 3ROBA 2OTL3 1ZO2A 3BLZA 5G2GA 4MEIA 2GXFA 3F7XA 1UGHI 3DGNA 4L7KA 1Q42A 5DREA 5LC6A 7GSPA 2P0XA 3EX9A 1HU9A 1N5HA 4LZIA 4N6OB 5CF2A 4XDWA 2C11A 3DY5A 1K28A 1FW7A 2CC3A 1AVKA 1I0VA 3RNTA 1W2ZA 2AADA 2W9PA 4KZ1A 1B2UA 1QAKA 1W6YA 4GB5A 4EXRA 2IUJA 4ORLA 1LNIA 3UB1A 2F4YA 1RGHA 2XF3A 3SEDA 1UCIA 5CF1A 3HIIA 3CME3 3LT8A 3ALAA 3Q2PA 4PEJA 1TFKA 1SJWA 5CK6A 1FGQA 1HKXA 3B8LA 4WHAA 2QIYA 3DXOA 3NV0A 1CH0A 3S27A 1VQ73 1SIHA 4O3VA 2OOVA 3JUPA 1NO3A 4KVHA 3I553 3EJVA 3EC9A 1RGKA 3D79A 3FKAA 4N6TA 3T8NA 3D4AA 2QGUA 3LZAA 1O7HB 1SQWA 2XR8B 3CCL3 1IVVA 1VQK3 1DE3A 1FGMA 3LYGA 3EBTA 4RZMA 8RNTA 2CKFB 1YJW3 4MMYB 1CEWI 2P05A 3LOYA 3X42A 4X2HA 4XDVA 3WA3A 4N6NB 3E99A 1B21A 3X3YA 2CIUA 4WYKB 4R80A 4BTXA 1I2FA 1AQZA 1BU4A 1NDOB 1G96A 2INXA 5KP1A 3K7CA 3SX1A 3EBYA 1T3BA 5IEPA 1FZUA 4MMXB 2CWTA 1RN1A 1N5PA 2HMOB 1GS3A 2Z76A 3KCHA 4FMDA 1A67A 2F5WA 2WGOA 2QEX3 3NX0A 1FUSA 4HM4B 2F99A 3CPOA 1VQN3 1ROAA 3HIGA 1RMSA 3T8UA 5FGOA 5M1AA 2STDA 3AHSA 3B4OA 1RLSA 1VQ43 3HI7A 1CQSA 3KE7A 1GOUA 2W9QA 3NUVA 4O8SA 3D5IA 5A0OB 1TRPA 3X3ZA 3PS8A 3K9MC 2R41A 1GY5A 1TUHA 2KF4A 2HMLB 2UGIA 3G8ZA 1M9GA 4FMAA 4R4KA 4CDLA 1RN4A 1N8QA 2KF5A 1YNVX 3FG4A 1FA3A 1NB3I 2H0GA 2CFGA 3PXMA 4WWUC 5IENA 2OCTA 4J9AA 4HM2B 3AHWA 1A2VA 3I0YA 1QVG2 2BT3A 3DGLA 1BRSA 2M7OA 3ER7A 4OK0A 1B2XA 1W4NA 1RNTA 1BGSA 4HKVB 2ML6A 3PYJA 3CCJ3 2O3OA 3MPHA 1UDII 1L5GB 3ZFZA 1OGZA 1JKGA 3EQQB 2XFTA 3UNLA 2R4IA 2LQVA 5IERA 4J5GA 3GZBA 4WP5A 3MG2A 3FG1A 2CW9A 3FZWA 1VQ83 4DKIA 2YFJB 3I563 1X1YA 1RGGA 1RGCA 1QJGA 1W00A 1WTHA 2KCDA 4OUQA 4TX4A 2XSHB 1T2HA 1UCKA 1X1UA 3MSOA 3OWYA 6GSPA 4FCZA 1I2EA 1RGAA 1IT8A 1JRQA 3SLUA 1MOLA 3LMLA 4GL6A 2Z77A 4GHOA 3G713 1BRGA 5IG0A 1US1A 1PU4A 4KFDA 9RNTA 2C10A 1LRAA 3OWUA 5HGRA 3LTAA 1DETA 3LH4A 1JZDA 3V98A 1LVNA 3K63A 3LXUX 5CLKA 3RDEA 2ZL8A 3DMCA 3CD63 2ML5A 2RGQA 4ILFA 4XBTA 1PYLA 1JNQA 1ZX2A 2KRTA 5AI1A 1I8VA 1ULIB 3VF1A 2HOHA 2W03A 3EHCA 3LTCA 4OVMA 2XH9A 3D3LA 1JJ22 4MMZB 4EV5A 1UUVB 3OXAA 3GZXB 3URPA 1YHQ3 1GD3A 1BIRA 1D6UA 5IG5A 1RCKA 1OACA 2CH9A 1FYSA 1D6ZA 1LQGC 1T2IA 3FG3A 3Q90A 3QK9A 4HYZA 1R4CA 2RCDA 3X41A 1A90A 1B20A 1E3RA 1B2SA 2P38A 3OV4A 1AV4A 3FLJA 4HBRA 2JQ5A 1VQP3 1ISKA 1BRNL 3S28A 3AMOB 3NBRA 4RNYA 3KZTA 2W0QA 2XEPA 3L0RA 1B2ZA 5G1LA 1RNBA 2UUGC 2BMOB 3NQYA 1OF5A 5AEWB 5HOHA 5IF6A 1GY6A 4U13A 4HM0B 1O7NB 4STDA 1UUWB 4HZBB 4R9LA 4BU4A 1IDPA 2WO0A 3EN8A 4HVNA 3K5TA 1UW1A 1JB2A 2FXTA 2IUKA 1IV9A 4R1KA 4N6UA 4EBGA 5M18A 1TFOA 1NB5I 3AMOA 1GD4A 1DYUA 1BVIA 2FNQA 2ZA4A 1BUQA 1QMAA 2AAEA 1Q7Y4 1VQL3 1KC84 3JUOA 2XRXB 2GSPA 1OHSA 1GSPA 4HM3B 2J8XB 4J5KA 2E2VA 4CCVA 1QVF2 4K90B 4KFEA 2CWUA 4HOHA 2IY2A 3NM2A 2CX0A 4O2HA 1RJOA 4LSOA 1IVWA 1RN7A 1E97A 1LQMB 1BRKA 2CHCA 3SVAA 1VZZA 4HJLB 2CWVA 4HZ9B 1UI8A 2YFLB 3AGNA 3DGYA 4EC6A 2MC8A 1BNJA 1IVUA 1YGWA 2V1LA 3PZWA 1GMRA 3ECFA 2HMMB 4HM1B 3EF8A 2ZHXB 1O7WB 3X40A 4CJNA 1I3IA 1JB4A 2HMJB 5BIRA 1K8A4 1O7GB 2CFLA 1OHPA 1Q40A 4H3UA 1U5OA 3F14A 1ASKA 2L1SA 1G02A 1W01A 4I4KA 4EV2A 1RGFA 3KFQC 1KWIA 1VQO3 1NWWA 1LOWA 3MKIA 3FF0A 3VGNA 3F40A 3A5EA 1EUIC 1JV2B 3CC43 2OTJ3 2CG0A 1OH0A 1TRQA 3MYTA 1OUNA 2IYJA 3BU4A 3CCM3 1FUWA 1V57A 3NHXA 1RTUA 3NBJA 3CNMA 3H3HA 2RNTA 4RNTA 3WR2A 2CK3H 5IEOA 2RFRA 3CU3A 1DVCA 1Q40B 4GSPA 3CCR3 1M904 3DZLA 1F8NA 2QA43 1FGOA 4FMBA 3LT9A 1YIT3 2WGQA 3EE1A 1I2GA 1RGEA 2YFIB 3CMA3 1UUGB 5IW9A 3CPW2 1SPUA 2ZDJA 2OOVC 1SARA 2K54A 3CNXA 5EEOA 5STDA 1BNGA 5JPPA 3CC23 4FCJA 1J2BA 1V58A 1GOVA 2W2CA 3NXJA 1GMQA 1DMMA 1UCLA 2Y74A 4LMIA 3S67A 2Y73A 2E2TA 3BIRA 2WOFA 4N3VA 4N6MA 4XM4A 4WFOA 1LOVA 3KKGA 2F86B 1OGXA 1I0XA 3JUMA 5FW5A 2KAAA 1BSBA 2B24B 7RNTA 1AVLA 2WOHA 4IIAA 3WOEB 2PNCA 1BRIA 4AKYA 3B7CA 4G1MB 5DRVA 3JVCA 3WOFB 6RNTA 1N8R4 2I9WA 3B4PA 3T0UA 1O7PB 3RGAA 1YIJ3 3CC73 4KFFA 4HAAA 4I5QA 1W5ZA 3DUKA 4BTWA 4NPBA 3UL5A 2Q07A 3D5GA 5LC7A 1MWUA 1W6GA 2BNGA 2IA7A 3GZRA 1VQM3 2W04A 3WA2X 3OW22 3GWRA 1WMOA 3UL6A 1DMQA 2BIRA 3CCV3 1HZ1A 3DH2A 5AIIA 3KN4A 4WYKA 1D6YA 2CFDA 1O7MB 3LTDA 1RKYA 3K0ZA 4KT3B 4HM5B 3U97A 4FR9A 4J8TA 4HM6B 3SOAA 4BTYA 1ROVA 1K9M4 5D83A 1Q814 3JUNA 4EW5A 1GMPA 2W56B 3QRDA 3J7Yd 1BSDA 1PY3A 3Q1CA 2GU1A 3NQZA 4HM7B 5IG3A 3JUQA 1GY7A 4K1UA 3TDGA 2P09A 1X1XA 2C4BA 1Z1SA 2O9UX 1QAFA 1YGEA 3FH1A 3MG1A 5D81A 2OQEA 1BNFA 3CCS3 4XBYA 1YI23 4N6V0 3MHEA 2KF3A 3MWZA 1A2PA 1JBSA 4HM8B 5D82A 1NJI4 3AGOA 2IMJA 8CHOA 3KSED 1R4YA 2F98A 2XFSA 3G6E3 1MGWA 1VQQA 1A2KA 3KSPA 2XSOB 2PZVA 2OWPA 3SXXA 2HMKB 3N9HA 2BMQB 3ZG0A 5BVBA 1JN5B 3GZYB 1ZGXA 1IQXA 2RBIA 5RNTA 5AIGA 7STDA 2W56A 1B27A 6STDA 1W7CA 3G0KA 3PGBA 2GU3A 1WNHA 3WMDA 1TJDA 2H0IA 1OPYA 1EEJA 1EKMA 1IQ8A 1MWSA 1BSCA 1I70A 1LOYA 1MGRA 1WMNA 1W2B2 1I3FA 1EA2A 3HOHA 3HZPA 5BXQA 1WMPA 3EN1B 1BRHA 4Q53A 1FGTA 1VQ53 2HMNB 1DMNA 1JZOA 1N9EA 1RDSA 1CYVA 1C7HA 3N54B 2F5MA 5EVHA 3EB8A 3F8XA 4JF8A 1BNIA 3CCU3 1X1WA 3BNCA 1YVBI 3DGOA 3HK4A 1JKGB 2E2UA 1EG9B 3BB9A 5AIFA 2KXGA 1JBRA 1YJN3 3M8CA 4R9KA 3G16A 3CCQ3 1FUTA 1IVXA 1MNLA 5CXOA 3N8BA 3WDGB 3X3XA 1W6CA 2CX1A 1VQ63 1KSIA 1IQYA 3WHOA 5M19A 3CXC2 3ZG5A 4JRFA 3A76A 1LNHA 5G1KA 5TGNA 1S5AA 4BL2A 2GEXA 1T5YA 2GEYA 5ELJA 1EQKA 3V99A 2MF7A 5KP4A 1BAOA 4O02B 1C54A 1BRJA 1M1XB 3V92A 4N6LA 3F7SA 1OHOA 1STDA 1U8CB 3NBBA 3GSPA 4QWTA 5IG4A 1FGRA 3PCRA 2YX9A 4L8PA 1BNSA 1UCJA 4BIRA 1M1K4 2BHMA 4FCMA 1IT7A 1JBTA 2A15A 1GOYA 1NU3A 1ULJB 2K3DA 3HX8A 3G4S3
chains in the Genus database with same CATH topology
1LQGC 1UUGB 2UGIA 1UGHI 1LQMB 2J8XB 1UDII 2UUGC 2ZHXB 4LYLB 1EUIC 1UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  1UUG B;  2UGI A;  1UGH I;  1LQM B;  2J8X B;  1UDI I;  2UUG C;  2ZHX B;  4LYL B;  1EUI C;  1UGI A; 
#chains in the Genus database with same CATH topology
 3DM8 A;  4NRE A;  1WQL B;  3GRD A;  1RRH A;  4NHF A;  1B2M A;  2L4V A;  3F8H A;  1RHL A;  2SAR A;  4L8O A;  1TU5 A;  1KQS 2;  3LTB A;  3NM7 A;  1LXE A;  3S5C A;  1MWT A;  3CCE 3;  2JDI H;  4LEH A;  1RSN A;  1RCL A;  2W6J H;  1Q86 4;  3H51 A;  1TP6 A;  3UJM A;  3SYU A;  4EYC A;  4BL3 A;  3S29 A;  1K73 4;  1UI7 A;  3VSY A;  1ZS7 A;  2LYX A;  1VQ9 3;  4RBN A;  2D42 A;  5AYS C;  1K41 A;  5JPU A;  4K1V A;  3IJE B;  4CPK A;  2F56 A;  1JN5 A;  3F9S A;  5EQL A;  3IMA B;  5AIH A;  2GBW B;  4LYL B;  1B3S A;  3BNB A;  3DGM A;  2B1X B;  1IYY A;  2XGL A;  2H0H A;  4LGQ A;  1N9J A;  2K0M A;  1BOX A;  1TIJ A;  4H61 A;  3U1W A;  1AY7 A;  1S72 3;  4AKZ A;  2KF6 A;  1E3V A;  3NV0 B;  1PFP A;  1CYU A;  5AYR B;  4AEQ A;  1BAN A;  3O8Y A;  5KP3 A;  3SOY A;  3Q3F A;  2CFW A;  4K61 A;  5I97 A;  1G0T A;  2D1W A;  4IPB A;  1AR0 A;  1QAL A;  3FF2 A;  3FSD A;  1IU7 A;  4FMC A;  5GSP A;  4X2O A;  3FCS B;  5JBS A;  1MWR A;  2Z6B A;  1JB5 A;  3FGY A;  3OX9 A;  3OWS A;  2BO9 B;  3WOD G;  2BMR B;  2P0M A;  1HYF A;  3MG3 A;  1Q82 4;  1UGI A;  1LOX A;  2XGN A;  1OF5 B;  1DVD A;  1IV7 A;  1NNV A;  3D9R A;  1SII A;  1Q7H A;  4IT7 A;  3KII A;  2SBL A;  3BNE A;  1GYB A;  1STF I;  4RNZ A;  2Z7A A;  3IPT A;  1YVS A;  1BSE A;  1BNE A;  2GBX B;  2CG1 A;  1RGL A;  5ELU A;  1IK3 A;  1BNR A;  5BU4 A;  1OCV A;  3GAX A;  2CFK A;  4XBX A;  1KD1 4;  2OQE C;  1YJ9 3;  1BUJ A;  4MJD A;  5AEU B;  2UX0 A;  1V74 A;  1W02 A;  2BU4 A;  1RRL A;  1Y4K A;  4ZM8 A;  3PCS A;  2RSX A;  3STD A;  2FGT A;  1TTO A;  4XB5 A;  3BND A;  1Q9E A;  1BSA A;  3RGR A;  3ROB A;  2OTL 3;  1ZO2 A;  3BLZ A;  5G2G A;  4MEI A;  2GXF A;  3F7X A;  1UGH I;  3DGN A;  4L7K A;  1Q42 A;  5DRE A;  5LC6 A;  7GSP A;  2P0X A;  3EX9 A;  1HU9 A;  1N5H A;  4LZI A;  4N6O B;  5CF2 A;  4XDW A;  2C11 A;  3DY5 A;  1K28 A;  1FW7 A;  2CC3 A;  1AVK A;  1I0V A;  3RNT A;  1W2Z A;  2AAD A;  2W9P A;  4KZ1 A;  1B2U A;  1QAK A;  1W6Y A;  4GB5 A;  4EXR A;  2IUJ A;  4ORL A;  1LNI A;  3UB1 A;  2F4Y A;  1RGH A;  2XF3 A;  3SED A;  1UCI A;  5CF1 A;  3HII A;  3CME 3;  3LT8 A;  3ALA A;  3Q2P A;  4PEJ A;  1TFK A;  1SJW A;  5CK6 A;  1FGQ A;  1HKX A;  3B8L A;  4WHA A;  2QIY A;  3DXO A;  3NV0 A;  1CH0 A;  3S27 A;  1VQ7 3;  1SIH A;  4O3V A;  2OOV A;  3JUP A;  1NO3 A;  4KVH A;  3I55 3;  3EJV A;  3EC9 A;  1RGK A;  3D79 A;  3FKA A;  4N6T A;  3T8N A;  3D4A A;  2QGU A;  3LZA A;  1O7H B;  1SQW A;  2XR8 B;  3CCL 3;  1IVV A;  1VQK 3;  1DE3 A;  1FGM A;  3LYG A;  3EBT A;  4RZM A;  8RNT A;  2CKF B;  1YJW 3;  4MMY B;  1CEW I;  2P05 A;  3LOY A;  3X42 A;  4X2H A;  4XDV A;  3WA3 A;  4N6N B;  3E99 A;  1B21 A;  3X3Y A;  2CIU A;  4WYK B;  4R80 A;  4BTX A;  1I2F A;  1AQZ A;  1BU4 A;  1NDO B;  1G96 A;  2INX A;  5KP1 A;  3K7C A;  3SX1 A;  3EBY A;  1T3B A;  5IEP A;  1FZU A;  4MMX B;  2CWT A;  1RN1 A;  1N5P A;  2HMO B;  1GS3 A;  2Z76 A;  3KCH A;  4FMD A;  1A67 A;  2F5W A;  2WGO A;  2QEX 3;  3NX0 A;  1FUS A;  4HM4 B;  2F99 A;  3CPO A;  1VQN 3;  1ROA A;  3HIG A;  1RMS A;  3T8U A;  5FGO A;  5M1A A;  2STD A;  3AHS A;  3B4O A;  1RLS A;  1VQ4 3;  3HI7 A;  1CQS A;  3KE7 A;  1GOU A;  2W9Q A;  3NUV A;  4O8S A;  3D5I A;  5A0O B;  1TRP A;  3X3Z A;  3PS8 A;  3K9M C;  2R41 A;  1GY5 A;  1TUH A;  2KF4 A;  2HML B;  2UGI A;  3G8Z A;  1M9G A;  4FMA A;  4R4K A;  4CDL A;  1RN4 A;  1N8Q A;  2KF5 A;  1YNV X;  3FG4 A;  1FA3 A;  1NB3 I;  2H0G A;  2CFG A;  3PXM A;  4WWU C;  5IEN A;  2OCT A;  4J9A A;  4HM2 B;  3AHW A;  1A2V A;  3I0Y A;  1QVG 2;  2BT3 A;  3DGL A;  1BRS A;  2M7O A;  3ER7 A;  4OK0 A;  1B2X A;  1W4N A;  1RNT A;  1BGS A;  4HKV B;  2ML6 A;  3PYJ A;  3CCJ 3;  2O3O A;  3MPH A;  1UDI I;  1L5G B;  3ZFZ A;  1OGZ A;  1JKG A;  3EQQ B;  2XFT A;  3UNL A;  2R4I A;  2LQV A;  5IER A;  4J5G A;  3GZB A;  4WP5 A;  3MG2 A;  3FG1 A;  2CW9 A;  3FZW A;  1VQ8 3;  4DKI A;  2YFJ B;  3I56 3;  1X1Y A;  1RGG A;  1RGC A;  1QJG A;  1W00 A;  1WTH A;  2KCD A;  4OUQ A;  4TX4 A;  2XSH B;  1T2H A;  1UCK A;  1X1U A;  3MSO A;  3OWY A;  6GSP A;  4FCZ A;  1I2E A;  1RGA A;  1IT8 A;  1JRQ A;  3SLU A;  1MOL A;  3LML A;  4GL6 A;  2Z77 A;  4GHO A;  3G71 3;  1BRG A;  5IG0 A;  1US1 A;  1PU4 A;  4KFD A;  9RNT A;  2C10 A;  1LRA A;  3OWU A;  5HGR A;  3LTA A;  1DET A;  3LH4 A;  1JZD A;  3V98 A;  1LVN A;  3K63 A;  3LXU X;  5CLK A;  3RDE A;  2ZL8 A;  3DMC A;  3CD6 3;  2ML5 A;  2RGQ A;  4ILF A;  4XBT A;  1PYL A;  1JNQ A;  1ZX2 A;  2KRT A;  5AI1 A;  1I8V A;  1ULI B;  3VF1 A;  2HOH A;  2W03 A;  3EHC A;  3LTC A;  4OVM A;  2XH9 A;  3D3L A;  1JJ2 2;  4MMZ B;  4EV5 A;  1UUV B;  3OXA A;  3GZX B;  3URP A;  1YHQ 3;  1GD3 A;  1BIR A;  1D6U A;  5IG5 A;  1RCK A;  1OAC A;  2CH9 A;  1FYS A;  1D6Z A;  1LQG C;  1T2I A;  3FG3 A;  3Q90 A;  3QK9 A;  4HYZ A;  1R4C A;  2RCD A;  3X41 A;  1A90 A;  1B20 A;  1E3R A;  1B2S A;  2P38 A;  3OV4 A;  1AV4 A;  3FLJ A;  4HBR A;  2JQ5 A;  1VQP 3;  1ISK A;  1BRN L;  3S28 A;  3AMO B;  3NBR A;  4RNY A;  3KZT A;  2W0Q A;  2XEP A;  3L0R A;  1B2Z A;  5G1L A;  1RNB A;  2UUG C;  2BMO B;  3NQY A;  1OF5 A;  5AEW B;  5HOH A;  5IF6 A;  1GY6 A;  4U13 A;  4HM0 B;  1O7N B;  4STD A;  1UUW B;  4HZB B;  4R9L A;  4BU4 A;  1IDP A;  2WO0 A;  3EN8 A;  4HVN A;  3K5T A;  1UW1 A;  1JB2 A;  2FXT A;  2IUK A;  1IV9 A;  4R1K A;  4N6U A;  4EBG A;  5M18 A;  1TFO A;  1NB5 I;  3AMO A;  1GD4 A;  1DYU A;  1BVI A;  2FNQ A;  2ZA4 A;  1BUQ A;  1QMA A;  2AAE A;  1Q7Y 4;  1VQL 3;  1KC8 4;  3JUO A;  2XRX B;  2GSP A;  1OHS A;  1GSP A;  4HM3 B;  2J8X B;  4J5K A;  2E2V A;  4CCV A;  1QVF 2;  4K90 B;  4KFE A;  2CWU A;  4HOH A;  2IY2 A;  3NM2 A;  2CX0 A;  4O2H A;  1RJO A;  4LSO A;  1IVW A;  1RN7 A;  1E97 A;  1LQM B;  1BRK A;  2CHC A;  3SVA A;  1VZZ A;  4HJL B;  2CWV A;  4HZ9 B;  1UI8 A;  2YFL B;  3AGN A;  3DGY A;  4EC6 A;  2MC8 A;  1BNJ A;  1IVU A;  1YGW A;  2V1L A;  3PZW A;  1GMR A;  3ECF A;  2HMM B;  4HM1 B;  3EF8 A;  2ZHX B;  1O7W B;  3X40 A;  4CJN A;  1I3I A;  1JB4 A;  2HMJ B;  5BIR A;  1K8A 4;  1O7G B;  2CFL A;  1OHP A;  1Q40 A;  4H3U A;  1U5O A;  3F14 A;  1ASK A;  2L1S A;  1G02 A;  1W01 A;  4I4K A;  4EV2 A;  1RGF A;  3KFQ C;  1KWI A;  1VQO 3;  1NWW A;  1LOW A;  3MKI A;  3FF0 A;  3VGN A;  3F40 A;  3A5E A;  1EUI C;  1JV2 B;  3CC4 3;  2OTJ 3;  2CG0 A;  1OH0 A;  1TRQ A;  3MYT A;  1OUN A;  2IYJ A;  3BU4 A;  3CCM 3;  1FUW A;  1V57 A;  3NHX A;  1RTU A;  3NBJ A;  3CNM A;  3H3H A;  2RNT A;  4RNT A;  3WR2 A;  2CK3 H;  5IEO A;  2RFR A;  3CU3 A;  1DVC A;  1Q40 B;  4GSP A;  3CCR 3;  1M90 4;  3DZL A;  1F8N A;  2QA4 3;  1FGO A;  4FMB A;  3LT9 A;  1YIT 3;  2WGQ A;  3EE1 A;  1I2G A;  1RGE A;  2YFI B;  3CMA 3;  1UUG B;  5IW9 A;  3CPW 2;  1SPU A;  2ZDJ A;  2OOV C;  1SAR A;  2K54 A;  3CNX A;  5EEO A;  5STD A;  1BNG A;  5JPP A;  3CC2 3;  4FCJ A;  1J2B A;  1V58 A;  1GOV A;  2W2C A;  3NXJ A;  1GMQ A;  1DMM A;  1UCL A;  2Y74 A;  4LMI A;  3S67 A;  2Y73 A;  2E2T A;  3BIR A;  2WOF A;  4N3V A;  4N6M A;  4XM4 A;  4WFO A;  1LOV A;  3KKG A;  2F86 B;  1OGX A;  1I0X A;  3JUM A;  5FW5 A;  2KAA A;  1BSB A;  2B24 B;  7RNT A;  1AVL A;  2WOH A;  4IIA A;  3WOE B;  2PNC A;  1BRI A;  4AKY A;  3B7C A;  4G1M B;  5DRV A;  3JVC A;  3WOF B;  6RNT A;  1N8R 4;  2I9W A;  3B4P A;  3T0U A;  1O7P B;  3RGA A;  1YIJ 3;  3CC7 3;  4KFF A;  4HAA A;  4I5Q A;  1W5Z A;  3DUK A;  4BTW A;  4NPB A;  3UL5 A;  2Q07 A;  3D5G A;  5LC7 A;  1MWU A;  1W6G A;  2BNG A;  2IA7 A;  3GZR A;  1VQM 3;  2W04 A;  3WA2 X;  3OW2 2;  3GWR A;  1WMO A;  3UL6 A;  1DMQ A;  2BIR A;  3CCV 3;  1HZ1 A;  3DH2 A;  5AII A;  3KN4 A;  4WYK A;  1D6Y A;  2CFD A;  1O7M B;  3LTD A;  1RKY A;  3K0Z A;  4KT3 B;  4HM5 B;  3U97 A;  4FR9 A;  4J8T A;  4HM6 B;  3SOA A;  4BTY A;  1ROV A;  1K9M 4;  5D83 A;  1Q81 4;  3JUN A;  4EW5 A;  1GMP A;  2W56 B;  3QRD A;  3J7Y d;  1BSD A;  1PY3 A;  3Q1C A;  2GU1 A;  3NQZ A;  4HM7 B;  5IG3 A;  3JUQ A;  1GY7 A;  4K1U A;  3TDG A;  2P09 A;  1X1X A;  2C4B A;  1Z1S A;  2O9U X;  1QAF A;  1YGE A;  3FH1 A;  3MG1 A;  5D81 A;  2OQE A;  1BNF A;  3CCS 3;  4XBY A;  1YI2 3;  4N6V 0;  3MHE A;  2KF3 A;  3MWZ A;  1A2P A;  1JBS A;  4HM8 B;  5D82 A;  1NJI 4;  3AGO A;  2IMJ A;  8CHO A;  3KSE D;  1R4Y A;  2F98 A;  2XFS A;  3G6E 3;  1MGW A;  1VQQ A;  1A2K A;  3KSP A;  2XSO B;  2PZV A;  2OWP A;  3SXX A;  2HMK B;  3N9H A;  2BMQ B;  3ZG0 A;  5BVB A;  1JN5 B;  3GZY B;  1ZGX A;  1IQX A;  2RBI A;  5RNT A;  5AIG A;  7STD A;  2W56 A;  1B27 A;  6STD A;  1W7C A;  3G0K A;  3PGB A;  2GU3 A;  1WNH A;  3WMD A;  1TJD A;  2H0I A;  1OPY A;  1EEJ A;  1EKM A;  1IQ8 A;  1MWS A;  1BSC A;  1I70 A;  1LOY A;  1MGR A;  1WMN A;  1W2B 2;  1I3F A;  1EA2 A;  3HOH A;  3HZP A;  5BXQ A;  1WMP A;  3EN1 B;  1BRH A;  4Q53 A;  1FGT A;  1VQ5 3;  2HMN B;  1DMN A;  1JZO A;  1N9E A;  1RDS A;  1CYV A;  1C7H A;  3N54 B;  2F5M A;  5EVH A;  3EB8 A;  3F8X A;  4JF8 A;  1BNI A;  3CCU 3;  1X1W A;  3BNC A;  1YVB I;  3DGO A;  3HK4 A;  1JKG B;  2E2U A;  1EG9 B;  3BB9 A;  5AIF A;  2KXG A;  1JBR A;  1YJN 3;  3M8C A;  4R9K A;  3G16 A;  3CCQ 3;  1FUT A;  1IVX A;  1MNL A;  5CXO A;  3N8B A;  3WDG B;  3X3X A;  1W6C A;  2CX1 A;  1VQ6 3;  1KSI A;  1IQY A;  3WHO A;  5M19 A;  3CXC 2;  3ZG5 A;  4JRF A;  3A76 A;  1LNH A;  5G1K A;  5TGN A;  1S5A A;  4BL2 A;  2GEX A;  1T5Y A;  2GEY A;  5ELJ A;  1EQK A;  3V99 A;  2MF7 A;  5KP4 A;  1BAO A;  4O02 B;  1C54 A;  1BRJ A;  1M1X B;  3V92 A;  4N6L A;  3F7S A;  1OHO A;  1STD A;  1U8C B;  3NBB A;  3GSP A;  4QWT A;  5IG4 A;  1FGR A;  3PCR A;  2YX9 A;  4L8P A;  1BNS A;  1UCJ A;  4BIR A;  1M1K 4;  2BHM A;  4FCM A;  1IT7 A;  1JBT A;  2A15 A;  1GOY A;  1NU3 A;  1ULJ B;  2K3D A;  3HX8 A;  3G4S 3; 
#chains in the Genus database with same CATH homology
 1LQG C;  1UUG B;  2UGI A;  1UGH I;  1LQM B;  2J8X B;  1UDI I;  2UUG C;  2ZHX B;  4LYL B;  1EUI C;  1UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...