1UGIA

Uracil-dna glycosylase inhibitor protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
b'TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
molecule tags Hydrolase inhibitor
total genus 17
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ugiA00
1LQGC 4LYLB 1EUIC 2UGIA 1LQMB 1UGHI 1UGIA 1UDII 2ZHXB 2J8XB 1UUGB 2UUGC
chains in the Genus database with same CATH superfamily
4XDWA 1JB2A 3BIRA 3NV0A 1GOVA 4HM5B 5STDA 1L5GB 1RRHA 5IEOA 3CCR3 4R80A 3EN8A 2P05A 3PCSA 1PU4A 1TFKA 1CEWI 2RBIA 4IIAA 1BANA 3BB9A 4N6TA 1IVWA 1UUWB 3O8YA 1LNIA 5EVHA 1UGHI 2WOHA 3I563 3CCM3 1YJN3 1N8R4 2XFTA 3LTBA 2K3DA 3ZG5A 2RGQA 4BU4A 1VQQA 1A2VA 4N6MA 3KSED 3SLUA 3HI7A 3EB8A 5D82A 1NB3I 3CC73 1IK3A 2FNQA 1RGFA 1O7HB 5BXQA 1LOVA 1B2MA 1LQMB 2WGOA 3F7SA 4DKIA 1JRQA 1O7NB 1RGCA 2W6JH 1C54A 1FW7A 4K1UA 4L8OA 1OHPA 3WDGB 1W6CA 2HMMB 1RKYA 4K61A 4RNZA 4RZMA 5LC7A 3CC43 1SIIA 2ZA4A 1RDSA 2UX0A 3NQYA 3F14A 2W0QA 4XB5A 1TIJA 4JRFA 5IEPA 3DH2A 2FXTA 1NNVA 2RNTA 2XH9A 1RGGA 3LT9A 1W00A 1CYUA 2CIUA 3VF1A 1YVSA 1RN4A 1YGEA 2HMKB 4Q53A 1UCJA 1I8VA 1RHLA 1Z1SA 2Q07A 1Q864 3EF8A 4KZ1A 3NM7A 4GHOA 4MMXB 4N3VA 4NPBA 1K9M4 1VQP3 3BLZA 3CD63 1QJGA 3EN1B 1DYUA 1NU3A 1OUNA 3B7CA 4O8SA 2F99A 3AMOB 3BNCA 2L4VA 2ZL8A 2CFGA 1MGRA 3CPOA 4WHAA 3OWSA 4EV5A 5IW9A 2HMOB 3K7CA 1W2B2 1UI8A 4HJLB 3RDEA 1I0VA 3CXC2 3MWZA 1OGXA 2D42A 3X42A 1BNSA 1PY3A 3CCS3 3WA3A 2LYXA 2GEXA 1C7HA 3KSPA 2GBXB 3LMLA 1X1WA 1X1XA 1ULIB 2CH9A 3BU4A 1BSAA 1MGWA 1RN1A 3LTDA 1LOWA 5CLKA 1RTUA 1QAFA 1GOYA 3EHCA 3D4AA 1VQL3 1IV7A 3KKGA 3FG4A 1BRGA 5EEOA 1BNGA 1S5AA 1FGTA 5CF2A 3NBRA 3RGAA 1IV9A 1FGOA 2KCDA 3PS8A 3D5IA 4MMZB 3RNTA 2BMRB 2P0XA 3EC9A 3KFQC 4HZBB 1B20A 1EA2A 1LOYA 2K0MA 4HZ9B 1VQ63 1BUJA 1EQKA 2CWUA 1EUIC 3WMDA 1FUSA 2OOVC 3NV0B 4O02B 3CCV3 1HU9A 1JBSA 1G0TA 2K54A 3FH1A 2P38A 1KC84 2W2CA 1RJOA 1OHSA 2H0GA 3GAXA 1K28A 1QMAA 1T3BA 2W03A 3PCRA 2CKFB 4FMCA 4CCVA 1TU5A 1I2FA 1BSBA 2W9QA 3LOYA 4KT3B 1NJI4 3JUMA 3NX0A 3ZFZA 2KF3A 5DRVA 3GZRA 4KFDA 2KF4A 4L8PA 1O7WB 4TX4A 2CC3A 1OH0A 2O3OA 3VGNA 1Q42A 4HAAA 3RGRA 1BNRA 1I3FA 4HBRA 1BRKA 3CMA3 3N54B 2L1SA 4HM1B 3CCJ3 3LYGA 2FGTA 3IJEB 1LVNA 1B2XA 3LTCA 3WHOA 4O3VA 4BIRA 3HIGA 1ZX2A 4IPBA 4XBTA 2XRXB 2R41A 3X41A 5JBSA 2CX1A 1OACA 3S67A 3H3HA 4RNTA 3UL6A 3NBBA 3CCE3 1NO3A 3FZWA 3QK9A 1RCLA 2BMQB 3FLJA 1OF5A 1RGLA 2BO9B 3GRDA 3N8BA 4N6LA 1YHQ3 3S29A 2XEPA 2C10A 1R4YA 2B24B 2LQVA 4NHFA 3X3YA 8CHOA 1MWSA 1BIRA 2OWPA 4FMDA 1N9JA 3K0ZA 4N6UA 4HM6B 3PYJA 4R4KA 1A2KA 2CW9A 3WR2A 5BVBA 5IF6A 1N8QA 3JUPA 2JDIH 1W6YA 1KWIA 1AR0A 1BOXA 2CFLA 2W9PA 4OVMA 4AKYA 1MOLA 5AYRB 4WWUC 1R4CA 3X3XA 3IPTA 1IVUA 4AEQA 3SOYA 4H61A 3CU3A 2A15A 3N9HA 1GY7A 3AHWA 2OTL3 3DUKA 5IENA 2STDA 2SARA 2YFLB 3T8NA 1D6YA 2WOFA 3OXAA 2O9UX 1K734 4MMYB 2ZDJA 3OX9A 5EQLA 2P0MA 2OQEC 3BNBA 1PYLA 5CXOA 1D6UA 2ML5A 1BNJA 1BRHA 5AIHA 1IDPA 2V1LA 1B3SA 1GYBA 1RRLA 1W4NA 4BL3A 7STDA 1MWRA 4FMAA 4GB5A 3D79A 2GXFA 3ZG0A 4CJNA 4G1MB 5A0OB 1GMQA 5I97A 2W56A 3DGMA 3MPHA 7RNTA 9RNTA 1BUQA 1GOUA 1WQLB 3HK4A 1V57A 3GZBA 1STFI 5JPUA 3DZLA 1YJW3 1E3VA 2BMOB 3ALAA 3FG3A 1RLSA 2CWVA 4OUQA 3M8CA 1B2ZA 3BNDA 3E99A 3MG1A 3T8UA 1I3IA 1SJWA 1N5PA 4EW5A 1TUHA 1T2HA 1RNBA 1STDA 4FCMA 4BL2A 4CPKA 4EC6A 3Q3FA 1YJ93 3G8ZA 3G16A 1AVLA 2PNCA 3V99A 4J5KA 4MEIA 3L0RA 1HZ1A 4FR9A 2CFKA 4I4KA 3FGYA 1IU7A 2CWTA 5DREA 3UNLA 2Y74A 1IVXA 3DXOA 3NUVA 3CCQ3 4CDLA 1FUTA 1Q814 1IQ8A 4HM7B 4XBXA 4NREA 5G2GA 1YIT3 5AEUB 1OF5B 2GU1A 2QGUA 5GSPA 1Q40B 2XSHB 1BSCA 2HMNB 2AADA 3U1WA 3HX8A 1N5HA 2CG0A 3UJMA 3NXJA 4HOHA 2H0IA 4XM4A 4OK0A 1UGIA 2GEYA 1FGQA 1IVVA 1QAKA 4RNYA 3FG1A 3JVCA 2QA43 1EG9B 2IYJA 1LQGC 1OPYA 1VQ53 3FF2A 5HGRA 1FA3A 1U8CB 5G1LA 3SOAA 1YGWA 2Y73A 3NHXA 1FGMA 1BRJA 2XF3A 2F86B 5D81A 1GS3A 1BVIA 2BHMA 3CPW2 3MG3A 3J7Yd 3B4PA 3WOEB 5AEWB 3DMCA 4IT7A 2CG1A 3GZXB 1MWTA 3FF0A 2CFDA 2HMLB 3S27A 1AV4A 3K9MC 4LZIA 1VQN3 2RCDA 1GY6A 2QIYA 3TDGA 3F8XA 1UW1A 2BNGA 3KN4A 4QWTA 4X2OA 1JN5B 1BSDA 4HYZA 1KSIA 1T5YA 3IMAB 5M1AA 1IQYA 2ML6A 3F7XA 3GZYB 3MKIA 1TRQA 3NQZA 4JF8A 3WOFB 1RSNA 4KFEA 2F56A 3LT8A 3SXXA 5IG3A 3ER7A 2W56B 3X40A 2HMJB 1CQSA 3A5EA 3DGLA 1I0XA 2OOVA 3DM8A 1DMMA 2XR8B 2XSOB 2QEX3 1BRNL 1UI7A 2D1WA 4EV2A 2H0HA 2AAEA 3EBYA 1VQM3 1BSEA 3URPA 1B27A 3UB1A 4GSPA 1IYYA 1AQZA 3A76A 3SX1A 1V58A 1IT8A 1YVBI 4LYLB 1Q40A 1M1K4 1HKXA 1X1UA 1OCVA 2E2TA 3EBTA 3ECFA 1ASKA 2GBWB 1RN7A 1GD4A 1TJDA 3KE7A 1I2EA 1QVG2 2YFJB 1GY5A 2R4IA 2IY2A 1M904 6STDA 3GSPA 1I70A 3Q2PA 3CCL3 1JJ22 1F8NA 1JKGA 1O7GB 2HOHA 1FYSA 5IG0A 3KZTA 2C4BA 1WMOA 4XDVA 4LMIA 3CME3 2KAAA 1ZGXA 2F5MA 4GL6A 4U13A 1HYFA 1BNEA 3OWYA 1DETA 1VQ93 1DMNA 1UUVB 3LXUX 4X2HA 1TRPA 1JNQA 2KF5A 2OCTA 1DVCA 2YFIB 3D5GA 3MYTA 4XBYA 6GSPA 4N6V0 1B2UA 1W2ZA 3CCU3 4AKZA 2E2VA 2SBLA 1ZS7A 1JN5A 1FGRA 3NM2A 5AYSC 5M18A 1W6GA 1UCLA 1DE3A 3STDA 1M9GA 1Q7Y4 1UCKA 1WTHA 1Y4KA 1ULJB 2KRTA 4J9AA 2UGIA 4PEJA 2RSXA 2WGQA 5BIRA 1Q9EA 3LZAA 1US1A 3NBJA 1N9EA 2J8XB 4J5GA 1YNVX 5AIFA 2RFRA 3AGOA 1UCIA 1U5OA 4ZM8A 2MF7A 2I9WA 2Z6BA 1JZOA 7GSPA 1W5ZA 1GMPA 1DMQA 2KXGA 1ROVA 2XGNA 3G0KA 3DGYA 3CC23 4R1KA 4HM3B 1JBTA 5JPPA 2BU4A 1GMRA 1TP6A 1VQ83 1EEJA 2E2UA 5IERA 5G1KA 1QALA 1A90A 3S5CA 3F40A 2CHCA 4HKVB 3VSYA 1A67A 3OWUA 5AIGA 3MSOA 1OHOA 3F8HA 2OQEA 1S723 5M19A 4LSOA 4K1VA 1T2IA 1W02A 1ZO2A 1SPUA 4BTXA 3I553 1X1YA 1I2GA 2GU3A 3G4S3 3V92A 1VQO3 5HOHA 1VQ73 5FW5A 4O2HA 1NWWA 4K90B 3G713 4STDA 4LEHA 4FCZA 1G96A 3PGBA 1DVDA 3S28A 2CFWA 4I5QA 1JB4A 3T0UA 3HZPA 3UL5A 1MNLA 5TGNA 3X3ZA 1YI23 1BGSA 3QRDA 3FCSB 4N6OB 2XGLA 1BRSA 4WYKA 3F9SA 3BNEA 3CNXA 4HM4B 3SVAA 1JV2B 1G02A 5LC6A 2IA7A 3EJVA 4HM2B 3EX9A 1VQK3 3CNMA 1VQ43 1K8A4 1B2SA 3V98A 1VZZA 2YX9A 3B8LA 5CK6A 1JKGB 1B21A 2ZHXB 5FGOA 1SIHA 1Q7HA 1J2BA 1K41A 3KCHA 4N6NB 1W01A 3EQQB 1WMNA 2Z7AA 1BNIA 5KP4A 1FZUA 5IG4A 1IQXA 2Z77A 1WNHA 4ORLA 4L7KA 3D9RA 3D3LA 3H51A 2F4YA 4RBNA 1NB5I 1MWUA 2F98A 3AGNA 2BIRA 3JUNA 3JUOA 2WO0A 3DGOA 4EYCA 4J8TA 3K5TA 3MHEA 2IUJA 4EXRA 4LGQA 4KFFA 1O7PB 4HM0B 1BAOA 1BU4A 1D6ZA 1FUWA 4FCJA 3FSDA 3WODG 3MG2A 4MJDA 1RGEA 1LXEA 1Q824 2M7OA 3PXMA 1UUGB 1V74A 3B4OA 5RNTA 3JUQA 4H3UA 1E3RA 5AI1A 3FKAA 1RGHA 3LTAA 4HM8B 3ROBA 1IT7A 2CK3H 3I0YA 5CF1A 5ELUA 1ISKA 2UUGC 2JQ5A 4WP5A 2BT3A 1JB5A 1AVKA 5ELJA 6RNTA 4R9LA 2P09A 1KD14 3EE1A 1O7MB 2Z76A 1RMSA 1YIJ3 3KIIA 1RCKA 3AHSA 3AMOA 3DGNA 2MC8A 1QVF2 5BU4A 2KF6A 2PZVA 5KP3A 1PFPA 1WMPA 1NDOB 1RGKA 5AIIA 1ROAA 3SEDA 1AY7A 3WA2X 2GSPA 3Q1CA 4R9KA 4EBGA 1OGZA 1W7CA 3G6E3 1JBRA 1EKMA 1CH0A 4HVNA 2W04A 1BRIA 2OTJ3 2B1XB 3OW22 1SQWA 5KP1A 2C11A 1UDII 5D83A 1A2PA 2INXA 3HOHA 5IG5A 3LH4A 2IUKA 1E97A 3U97A 4BTYA 3K63A 3Q90A 1RGAA 3DY5A 1GD3A 1TFOA 1TTOA 2F5WA 3GWRA 4BTWA 4KVHA 1RNTA 1LRAA 4FMBA 3SYUA 1GSPA 1SARA 1M1XB 1CYVA 1JZDA 4WYKB 1LOXA 1LNHA 1BNFA 2IMJA 2CX0A 3HIIA 4WFOA 1KQS2 3OV4A 2XFSA 8RNTA 4ILFA 3PZWA
chains in the Genus database with same CATH topology
1LQGC 4LYLB 1EUIC 2UGIA 1LQMB 1UGHI 1UGIA 1UDII 2ZHXB 2J8XB 1UUGB 2UUGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQG C;  4LYL B;  1EUI C;  2UGI A;  1LQM B;  1UGH I;  1UGI A;  1UDI I;  2ZHX B;  2J8X B;  1UUG B;  2UUG C; 
#chains in the Genus database with same CATH topology
 4XDW A;  1JB2 A;  3BIR A;  3NV0 A;  1GOV A;  4HM5 B;  5STD A;  1L5G B;  1RRH A;  5IEO A;  3CCR 3;  4R80 A;  3EN8 A;  2P05 A;  3PCS A;  1PU4 A;  1TFK A;  1CEW I;  2RBI A;  4IIA A;  1BAN A;  3BB9 A;  4N6T A;  1IVW A;  1UUW B;  3O8Y A;  1LNI A;  5EVH A;  1UGH I;  2WOH A;  3I56 3;  3CCM 3;  1YJN 3;  1N8R 4;  2XFT A;  3LTB A;  2K3D A;  3ZG5 A;  2RGQ A;  4BU4 A;  1VQQ A;  1A2V A;  4N6M A;  3KSE D;  3SLU A;  3HI7 A;  3EB8 A;  5D82 A;  1NB3 I;  3CC7 3;  1IK3 A;  2FNQ A;  1RGF A;  1O7H B;  5BXQ A;  1LOV A;  1B2M A;  1LQM B;  2WGO A;  3F7S A;  4DKI A;  1JRQ A;  1O7N B;  1RGC A;  2W6J H;  1C54 A;  1FW7 A;  4K1U A;  4L8O A;  1OHP A;  3WDG B;  1W6C A;  2HMM B;  1RKY A;  4K61 A;  4RNZ A;  4RZM A;  5LC7 A;  3CC4 3;  1SII A;  2ZA4 A;  1RDS A;  2UX0 A;  3NQY A;  3F14 A;  2W0Q A;  4XB5 A;  1TIJ A;  4JRF A;  5IEP A;  3DH2 A;  2FXT A;  1NNV A;  2RNT A;  2XH9 A;  1RGG A;  3LT9 A;  1W00 A;  1CYU A;  2CIU A;  3VF1 A;  1YVS A;  1RN4 A;  1YGE A;  2HMK B;  4Q53 A;  1UCJ A;  1I8V A;  1RHL A;  1Z1S A;  2Q07 A;  1Q86 4;  3EF8 A;  4KZ1 A;  3NM7 A;  4GHO A;  4MMX B;  4N3V A;  4NPB A;  1K9M 4;  1VQP 3;  3BLZ A;  3CD6 3;  1QJG A;  3EN1 B;  1DYU A;  1NU3 A;  1OUN A;  3B7C A;  4O8S A;  2F99 A;  3AMO B;  3BNC A;  2L4V A;  2ZL8 A;  2CFG A;  1MGR A;  3CPO A;  4WHA A;  3OWS A;  4EV5 A;  5IW9 A;  2HMO B;  3K7C A;  1W2B 2;  1UI8 A;  4HJL B;  3RDE A;  1I0V A;  3CXC 2;  3MWZ A;  1OGX A;  2D42 A;  3X42 A;  1BNS A;  1PY3 A;  3CCS 3;  3WA3 A;  2LYX A;  2GEX A;  1C7H A;  3KSP A;  2GBX B;  3LML A;  1X1W A;  1X1X A;  1ULI B;  2CH9 A;  3BU4 A;  1BSA A;  1MGW A;  1RN1 A;  3LTD A;  1LOW A;  5CLK A;  1RTU A;  1QAF A;  1GOY A;  3EHC A;  3D4A A;  1VQL 3;  1IV7 A;  3KKG A;  3FG4 A;  1BRG A;  5EEO A;  1BNG A;  1S5A A;  1FGT A;  5CF2 A;  3NBR A;  3RGA A;  1IV9 A;  1FGO A;  2KCD A;  3PS8 A;  3D5I A;  4MMZ B;  3RNT A;  2BMR B;  2P0X A;  3EC9 A;  3KFQ C;  4HZB B;  1B20 A;  1EA2 A;  1LOY A;  2K0M A;  4HZ9 B;  1VQ6 3;  1BUJ A;  1EQK A;  2CWU A;  1EUI C;  3WMD A;  1FUS A;  2OOV C;  3NV0 B;  4O02 B;  3CCV 3;  1HU9 A;  1JBS A;  1G0T A;  2K54 A;  3FH1 A;  2P38 A;  1KC8 4;  2W2C A;  1RJO A;  1OHS A;  2H0G A;  3GAX A;  1K28 A;  1QMA A;  1T3B A;  2W03 A;  3PCR A;  2CKF B;  4FMC A;  4CCV A;  1TU5 A;  1I2F A;  1BSB A;  2W9Q A;  3LOY A;  4KT3 B;  1NJI 4;  3JUM A;  3NX0 A;  3ZFZ A;  2KF3 A;  5DRV A;  3GZR A;  4KFD A;  2KF4 A;  4L8P A;  1O7W B;  4TX4 A;  2CC3 A;  1OH0 A;  2O3O A;  3VGN A;  1Q42 A;  4HAA A;  3RGR A;  1BNR A;  1I3F A;  4HBR A;  1BRK A;  3CMA 3;  3N54 B;  2L1S A;  4HM1 B;  3CCJ 3;  3LYG A;  2FGT A;  3IJE B;  1LVN A;  1B2X A;  3LTC A;  3WHO A;  4O3V A;  4BIR A;  3HIG A;  1ZX2 A;  4IPB A;  4XBT A;  2XRX B;  2R41 A;  3X41 A;  5JBS A;  2CX1 A;  1OAC A;  3S67 A;  3H3H A;  4RNT A;  3UL6 A;  3NBB A;  3CCE 3;  1NO3 A;  3FZW A;  3QK9 A;  1RCL A;  2BMQ B;  3FLJ A;  1OF5 A;  1RGL A;  2BO9 B;  3GRD A;  3N8B A;  4N6L A;  1YHQ 3;  3S29 A;  2XEP A;  2C10 A;  1R4Y A;  2B24 B;  2LQV A;  4NHF A;  3X3Y A;  8CHO A;  1MWS A;  1BIR A;  2OWP A;  4FMD A;  1N9J A;  3K0Z A;  4N6U A;  4HM6 B;  3PYJ A;  4R4K A;  1A2K A;  2CW9 A;  3WR2 A;  5BVB A;  5IF6 A;  1N8Q A;  3JUP A;  2JDI H;  1W6Y A;  1KWI A;  1AR0 A;  1BOX A;  2CFL A;  2W9P A;  4OVM A;  4AKY A;  1MOL A;  5AYR B;  4WWU C;  1R4C A;  3X3X A;  3IPT A;  1IVU A;  4AEQ A;  3SOY A;  4H61 A;  3CU3 A;  2A15 A;  3N9H A;  1GY7 A;  3AHW A;  2OTL 3;  3DUK A;  5IEN A;  2STD A;  2SAR A;  2YFL B;  3T8N A;  1D6Y A;  2WOF A;  3OXA A;  2O9U X;  1K73 4;  4MMY B;  2ZDJ A;  3OX9 A;  5EQL A;  2P0M A;  2OQE C;  3BNB A;  1PYL A;  5CXO A;  1D6U A;  2ML5 A;  1BNJ A;  1BRH A;  5AIH A;  1IDP A;  2V1L A;  1B3S A;  1GYB A;  1RRL A;  1W4N A;  4BL3 A;  7STD A;  1MWR A;  4FMA A;  4GB5 A;  3D79 A;  2GXF A;  3ZG0 A;  4CJN A;  4G1M B;  5A0O B;  1GMQ A;  5I97 A;  2W56 A;  3DGM A;  3MPH A;  7RNT A;  9RNT A;  1BUQ A;  1GOU A;  1WQL B;  3HK4 A;  1V57 A;  3GZB A;  1STF I;  5JPU A;  3DZL A;  1YJW 3;  1E3V A;  2BMO B;  3ALA A;  3FG3 A;  1RLS A;  2CWV A;  4OUQ A;  3M8C A;  1B2Z A;  3BND A;  3E99 A;  3MG1 A;  3T8U A;  1I3I A;  1SJW A;  1N5P A;  4EW5 A;  1TUH A;  1T2H A;  1RNB A;  1STD A;  4FCM A;  4BL2 A;  4CPK A;  4EC6 A;  3Q3F A;  1YJ9 3;  3G8Z A;  3G16 A;  1AVL A;  2PNC A;  3V99 A;  4J5K A;  4MEI A;  3L0R A;  1HZ1 A;  4FR9 A;  2CFK A;  4I4K A;  3FGY A;  1IU7 A;  2CWT A;  5DRE A;  3UNL A;  2Y74 A;  1IVX A;  3DXO A;  3NUV A;  3CCQ 3;  4CDL A;  1FUT A;  1Q81 4;  1IQ8 A;  4HM7 B;  4XBX A;  4NRE A;  5G2G A;  1YIT 3;  5AEU B;  1OF5 B;  2GU1 A;  2QGU A;  5GSP A;  1Q40 B;  2XSH B;  1BSC A;  2HMN B;  2AAD A;  3U1W A;  3HX8 A;  1N5H A;  2CG0 A;  3UJM A;  3NXJ A;  4HOH A;  2H0I A;  4XM4 A;  4OK0 A;  1UGI A;  2GEY A;  1FGQ A;  1IVV A;  1QAK A;  4RNY A;  3FG1 A;  3JVC A;  2QA4 3;  1EG9 B;  2IYJ A;  1LQG C;  1OPY A;  1VQ5 3;  3FF2 A;  5HGR A;  1FA3 A;  1U8C B;  5G1L A;  3SOA A;  1YGW A;  2Y73 A;  3NHX A;  1FGM A;  1BRJ A;  2XF3 A;  2F86 B;  5D81 A;  1GS3 A;  1BVI A;  2BHM A;  3CPW 2;  3MG3 A;  3J7Y d;  3B4P A;  3WOE B;  5AEW B;  3DMC A;  4IT7 A;  2CG1 A;  3GZX B;  1MWT A;  3FF0 A;  2CFD A;  2HML B;  3S27 A;  1AV4 A;  3K9M C;  4LZI A;  1VQN 3;  2RCD A;  1GY6 A;  2QIY A;  3TDG A;  3F8X A;  1UW1 A;  2BNG A;  3KN4 A;  4QWT A;  4X2O A;  1JN5 B;  1BSD A;  4HYZ A;  1KSI A;  1T5Y A;  3IMA B;  5M1A A;  1IQY A;  2ML6 A;  3F7X A;  3GZY B;  3MKI A;  1TRQ A;  3NQZ A;  4JF8 A;  3WOF B;  1RSN A;  4KFE A;  2F56 A;  3LT8 A;  3SXX A;  5IG3 A;  3ER7 A;  2W56 B;  3X40 A;  2HMJ B;  1CQS A;  3A5E A;  3DGL A;  1I0X A;  2OOV A;  3DM8 A;  1DMM A;  2XR8 B;  2XSO B;  2QEX 3;  1BRN L;  1UI7 A;  2D1W A;  4EV2 A;  2H0H A;  2AAE A;  3EBY A;  1VQM 3;  1BSE A;  3URP A;  1B27 A;  3UB1 A;  4GSP A;  1IYY A;  1AQZ A;  3A76 A;  3SX1 A;  1V58 A;  1IT8 A;  1YVB I;  4LYL B;  1Q40 A;  1M1K 4;  1HKX A;  1X1U A;  1OCV A;  2E2T A;  3EBT A;  3ECF A;  1ASK A;  2GBW B;  1RN7 A;  1GD4 A;  1TJD A;  3KE7 A;  1I2E A;  1QVG 2;  2YFJ B;  1GY5 A;  2R4I A;  2IY2 A;  1M90 4;  6STD A;  3GSP A;  1I70 A;  3Q2P A;  3CCL 3;  1JJ2 2;  1F8N A;  1JKG A;  1O7G B;  2HOH A;  1FYS A;  5IG0 A;  3KZT A;  2C4B A;  1WMO A;  4XDV A;  4LMI A;  3CME 3;  2KAA A;  1ZGX A;  2F5M A;  4GL6 A;  4U13 A;  1HYF A;  1BNE A;  3OWY A;  1DET A;  1VQ9 3;  1DMN A;  1UUV B;  3LXU X;  4X2H A;  1TRP A;  1JNQ A;  2KF5 A;  2OCT A;  1DVC A;  2YFI B;  3D5G A;  3MYT A;  4XBY A;  6GSP A;  4N6V 0;  1B2U A;  1W2Z A;  3CCU 3;  4AKZ A;  2E2V A;  2SBL A;  1ZS7 A;  1JN5 A;  1FGR A;  3NM2 A;  5AYS C;  5M18 A;  1W6G A;  1UCL A;  1DE3 A;  3STD A;  1M9G A;  1Q7Y 4;  1UCK A;  1WTH A;  1Y4K A;  1ULJ B;  2KRT A;  4J9A A;  2UGI A;  4PEJ A;  2RSX A;  2WGQ A;  5BIR A;  1Q9E A;  3LZA A;  1US1 A;  3NBJ A;  1N9E A;  2J8X B;  4J5G A;  1YNV X;  5AIF A;  2RFR A;  3AGO A;  1UCI A;  1U5O A;  4ZM8 A;  2MF7 A;  2I9W A;  2Z6B A;  1JZO A;  7GSP A;  1W5Z A;  1GMP A;  1DMQ A;  2KXG A;  1ROV A;  2XGN A;  3G0K A;  3DGY A;  3CC2 3;  4R1K A;  4HM3 B;  1JBT A;  5JPP A;  2BU4 A;  1GMR A;  1TP6 A;  1VQ8 3;  1EEJ A;  2E2U A;  5IER A;  5G1K A;  1QAL A;  1A90 A;  3S5C A;  3F40 A;  2CHC A;  4HKV B;  3VSY A;  1A67 A;  3OWU A;  5AIG A;  3MSO A;  1OHO A;  3F8H A;  2OQE A;  1S72 3;  5M19 A;  4LSO A;  4K1V A;  1T2I A;  1W02 A;  1ZO2 A;  1SPU A;  4BTX A;  3I55 3;  1X1Y A;  1I2G A;  2GU3 A;  3G4S 3;  3V92 A;  1VQO 3;  5HOH A;  1VQ7 3;  5FW5 A;  4O2H A;  1NWW A;  4K90 B;  3G71 3;  4STD A;  4LEH A;  4FCZ A;  1G96 A;  3PGB A;  1DVD A;  3S28 A;  2CFW A;  4I5Q A;  1JB4 A;  3T0U A;  3HZP A;  3UL5 A;  1MNL A;  5TGN A;  3X3Z A;  1YI2 3;  1BGS A;  3QRD A;  3FCS B;  4N6O B;  2XGL A;  1BRS A;  4WYK A;  3F9S A;  3BNE A;  3CNX A;  4HM4 B;  3SVA A;  1JV2 B;  1G02 A;  5LC6 A;  2IA7 A;  3EJV A;  4HM2 B;  3EX9 A;  1VQK 3;  3CNM A;  1VQ4 3;  1K8A 4;  1B2S A;  3V98 A;  1VZZ A;  2YX9 A;  3B8L A;  5CK6 A;  1JKG B;  1B21 A;  2ZHX B;  5FGO A;  1SIH A;  1Q7H A;  1J2B A;  1K41 A;  3KCH A;  4N6N B;  1W01 A;  3EQQ B;  1WMN A;  2Z7A A;  1BNI A;  5KP4 A;  1FZU A;  5IG4 A;  1IQX A;  2Z77 A;  1WNH A;  4ORL A;  4L7K A;  3D9R A;  3D3L A;  3H51 A;  2F4Y A;  4RBN A;  1NB5 I;  1MWU A;  2F98 A;  3AGN A;  2BIR A;  3JUN A;  3JUO A;  2WO0 A;  3DGO A;  4EYC A;  4J8T A;  3K5T A;  3MHE A;  2IUJ A;  4EXR A;  4LGQ A;  4KFF A;  1O7P B;  4HM0 B;  1BAO A;  1BU4 A;  1D6Z A;  1FUW A;  4FCJ A;  3FSD A;  3WOD G;  3MG2 A;  4MJD A;  1RGE A;  1LXE A;  1Q82 4;  2M7O A;  3PXM A;  1UUG B;  1V74 A;  3B4O A;  5RNT A;  3JUQ A;  4H3U A;  1E3R A;  5AI1 A;  3FKA A;  1RGH A;  3LTA A;  4HM8 B;  3ROB A;  1IT7 A;  2CK3 H;  3I0Y A;  5CF1 A;  5ELU A;  1ISK A;  2UUG C;  2JQ5 A;  4WP5 A;  2BT3 A;  1JB5 A;  1AVK A;  5ELJ A;  6RNT A;  4R9L A;  2P09 A;  1KD1 4;  3EE1 A;  1O7M B;  2Z76 A;  1RMS A;  1YIJ 3;  3KII A;  1RCK A;  3AHS A;  3AMO A;  3DGN A;  2MC8 A;  1QVF 2;  5BU4 A;  2KF6 A;  2PZV A;  5KP3 A;  1PFP A;  1WMP A;  1NDO B;  1RGK A;  5AII A;  1ROA A;  3SED A;  1AY7 A;  3WA2 X;  2GSP A;  3Q1C A;  4R9K A;  4EBG A;  1OGZ A;  1W7C A;  3G6E 3;  1JBR A;  1EKM A;  1CH0 A;  4HVN A;  2W04 A;  1BRI A;  2OTJ 3;  2B1X B;  3OW2 2;  1SQW A;  5KP1 A;  2C11 A;  1UDI I;  5D83 A;  1A2P A;  2INX A;  3HOH A;  5IG5 A;  3LH4 A;  2IUK A;  1E97 A;  3U97 A;  4BTY A;  3K63 A;  3Q90 A;  1RGA A;  3DY5 A;  1GD3 A;  1TFO A;  1TTO A;  2F5W A;  3GWR A;  4BTW A;  4KVH A;  1RNT A;  1LRA A;  4FMB A;  3SYU A;  1GSP A;  1SAR A;  1M1X B;  1CYV A;  1JZD A;  4WYK B;  1LOX A;  1LNH A;  1BNF A;  2IMJ A;  2CX0 A;  3HII A;  4WFO A;  1KQS 2;  3OV4 A;  2XFS A;  8RNT A;  4ILF A;  3PZW A; 
#chains in the Genus database with same CATH homology
 1LQG C;  4LYL B;  1EUI C;  2UGI A;  1LQM B;  1UGH I;  1UGI A;  1UDI I;  2ZHX B;  2J8X B;  1UUG B;  2UUG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...