1UGIA

Uracil-dna glycosylase inhibitor protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
molecule tags Hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
total genus 17
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ugiA00
2UGIA 1LQGC 1LQMB 4LYLB 2UUGC 1UGIA 1UDII 1UUGB 1EUIC 1UGHI 2J8XB 2ZHXB
chains in the Genus database with same CATH superfamily
3EQQB 4LZIA 5BVBA 4J5KA 3KIIA 3UB1A 3Q1CA 1ZO2A 1M904 1BOXA 1SJWA 3HX8A 3LYGA 2K3DA 1I3FA 4K90B 3S29A 2QIYA 1ROVA 3STDA 1BIRA 2P05A 3CME3 1RN4A 5EQLA 2IUKA 1YHQ3 1G96A 1M1XB 2QA43 1EQKA 2HMJB 1VQ73 2BIRA 5D82A 3OWUA 1ZX2A 1EEJA 1RGEA 1WMOA 1N8QA 1C7HA 5CLKA 3K0ZA 2HMNB 4LGQA 2GSPA 3LTDA 2BMOB 1IQXA 3KN4A 4GB5A 3HK4A 2L4VA 1L5GB 5M19A 4L8PA 4HOHA 3NQYA 4FMBA 1PYLA 5DREA 4HM6B 2F5MA 2KF3A 3AGOA 2F86B 2GXFA 4N6NB 1ZGXA 3SOAA 4GHOA 4CDLA 2OOVA 4H61A 1OUNA 2BT3A 2FNQA 5FW5A 3HIIA 2H0GA 1W01A 1RHLA 2MF7A 2UX0A 2W6JH 3V98A 2Z6BA 3KSED 1IK3A 1UCLA 4KZ1A 1YIJ3 2YFLB 3K63A 3D3LA 3G4S3 2IMJA 1JB4A 1PY3A 1BUQA 1NWWA 2KAAA 4R9KA 1US1A 4I5QA 3VSYA 6GSPA 1LVNA 1YVBI 4N3VA 1LQGC 2P38A 1W4NA 3FCSB 1GMPA 3NM2A 4HYZA 2CFKA 4H3UA 2RBIA 3MWZA 4HKVB 1RSNA 3X41A 2P09A 1J2BA 1TRQA 3NUVA 3S67A 3FKAA 3IJEB 3URPA 1JB5A 3SOYA 4WFOA 3MPHA 3NHXA 4N6MA 5STDA 1BNIA 2INXA 1WMNA 4OVMA 2OTL3 2PZVA 4HAAA 1FZUA 4NHFA 1JKGA 1Q864 5BIRA 2CG0A 4ILFA 3F8HA 1LOYA 1N9EA 1GY7A 1OGXA 3F7SA 5CXOA 2GBXB 1A2PA 1V74A 4EV5A 2IY2A 1AVKA 3HZPA 3S5CA 4CCVA 1GY6A 2CKFB 4HM0B 1RDSA 2XEPA 2KXGA 4LEHA 1UDII 1T2IA 1FGOA 3NM7A 2I9WA 1I70A 1W2B2 5AYRB 1RNBA 1VQQA 1IVXA 1BAOA 1DETA 2GU1A 4I4KA 4AEQA 1B2ZA 1UI8A 3X40A 1D6UA 1ROAA 1QALA 1T2HA 2PNCA 7STDA 1BSDA 3MKIA 4BTWA 1QAKA 1CQSA 1FGTA 1TFOA 3FG4A 1VQL3 3NV0A 4OK0A 3DGNA 1B2SA 2XH9A 1V58A 2KCDA 1IDPA 3F40A 1DMNA 1O7NB 2CH9A 1RJOA 2JDIH 2F4YA 3GZRA 2W2CA 4EC6A 2GU3A 1Q42A 2BMRB 2ML5A 4LSOA 4N6LA 1G0TA 2CW9A 3UL6A 3EE1A 1ULIB 3LTAA 5AEUB 1RGHA 2XFTA 1YI23 2KF6A 3NXJA 4WHAA 1GOUA 2CFGA 2XSOB 1FGMA 3F9SA 3G713 1VQ53 1LOWA 4KFDA 2ZA4A 3Q3FA 1STFI 2F98A 3X42A 4O8SA 3DXOA 2IA7A 4K61A 1RGLA 4X2OA 3KKGA 3Q2PA 1X1UA 5LC6A 2P0MA 2Y74A 1S723 2RCDA 2SARA 3CCL3 2W56B 3K5TA 3DMCA 3OX9A 1M1K4 2RFRA 3MG2A 3NV0B 1QAFA 3BNEA 3ZG5A 1PFPA 4GL6A 1SIHA 2IYJA 3EN1B 2HMMB 4J8TA 3AMOB 1RN1A 2MC8A 3K9MC 1E3VA 3BNBA 3UL5A 4U13A 1MNLA 1TJDA 3EF8A 5KP4A 1BSEA 1VQP3 1JB2A 1AV4A 1U8CB 2A15A 3VGNA 1W02A 3FH1A 4EBGA 1I0VA 1UGIA 1Q9EA 3KFQC 5IEPA 1W7CA 1BSCA 1UUGB 3V99A 3CCQ3 1OH0A 2F99A 3S28A 3X3YA 4RNZA 1IVWA 1TUHA 1WNHA 4WWUC 5AEWB 2KF5A 3CCR3 1ISKA 1MWRA 1UCJA 1VZZA 5G1KA 5RNTA 1OHPA 3U1WA 1E3RA 2WGOA 3WMDA 4JF8A 1N8R4 2O9UX 4HM8B 2E2VA 1BU4A 1JZDA 1SIIA 5FGOA 1BGSA 1W6CA 2W56A 2WOFA 3FZWA 3I0YA 3NQZA 1IYYA 1UI7A 4KFFA 4IIAA 5AIFA 3G0KA 2GEYA 3CU3A 3FSDA 3FG3A 1BRSA 1N9JA 4HBRA 4GSPA 1VQ63 4R1KA 4N6V0 4EYCA 1BNGA 3O8YA 2CX0A 3DUKA 1YJ93 4AKZA 2HMOB 5JBSA 1BRNL 2WGQA 1Q824 1LOXA 1I3IA 3SEDA 4N6TA 3M8CA 3QK9A 4FCZA 5AIIA 3DY5A 1I2EA 3KZTA 1IV9A 2XGNA 2Q07A 1GSPA 3QRDA 2OCTA 2W0QA 3GWRA 3I563 1OCVA 3A76A 4NREA 3FLJA 1IU7A 4O3VA 5HGRA 5KP1A 2OTJ3 1FW7A 3GAXA 1VQ83 1JNQA 2YFIB 3GRDA 4EV2A 2UGIA 2YX9A 1B21A 2B24B 2C10A 2FGTA 4LYLB 2XGLA 3X3ZA 4BU4A 3LMLA 1D6YA 1RRLA 3A5EA 1RTUA 3I553 4CJNA 4BIRA 3WDGB 3F8XA 5G2GA 4IPBA 1W2ZA 5IEOA 3WOFB 1Q814 1OHSA 2XRXB 4RBNA 1ASKA 3FF0A 4RZMA 4XDVA 4XBYA 1GS3A 3FF2A 5TGNA 8CHOA 1K8A4 2H0IA 1JN5B 3G16A 4Q53A 5D81A 4EXRA 1KQS2 3T0UA 1OGZA 4LMIA 1T3BA 1FGRA 2W9QA 2ZDJA 1BSAA 1UCIA 1SQWA 3HOHA 1IT8A 2RGQA 1QJGA 1O7GB 5IW9A 3MG3A 1WQLB 4L7KA 7GSPA 4WYKB 4XDWA 1JV2B 2QGUA 4HVNA 4STDA 4J5GA 5LC7A 3EJVA 1DMQA 2W03A 1AY7A 1GYBA 1IV7A 1O7PB 3FGYA 3AMOA 5IERA 2STDA 1YGWA 1W6YA 2KRTA 3E99A 3F14A 4KVHA 3VF1A 3D4AA 1HU9A 1Y4KA 2W04A 3LH4A 3LOYA 1MGWA 1UUWB 1RGFA 1S5AA 5AIGA 1OHOA 5EEOA 1TIJA 1JZOA 1RGKA 3PS8A 4FMCA 1IQ8A 1O7MB 1VQ93 2OOVC 2CG1A 1TTOA 1BVIA 1AR0A 1RGGA 1STDA 3EC9A 3KE7A 3GSPA 3H3HA 1VQM3 1GD4A 1GOVA 2Z7AA 1JRQA 3CCJ3 3B7CA 5ELUA 4QWTA 4CPKA 5I97A 1X1XA 1JBSA 2CWVA 4O2HA 1Z1SA 3PXMA 1R4YA 3JUOA 1BRGA 2F5WA 1BNEA 4RNTA 8RNTA 4BL2A 1UCKA 1X1WA 1U5OA 3LTBA 3UJMA 5BXQA 3V92A 3ZG0A 1C54A 6STDA 3OXAA 1TFKA 4JRFA 3CMA3 2F56A 5IENA 1TP6A 1BNFA 3WHOA 1QVF2 3RGRA 2CK3H 3HIGA 4O02B 5D83A 1K28A 2K0MA 1DVCA 2CWTA 4N6UA 3S27A 3WODG 3IMAB 1LNIA 1B27A 2O3OA 1RMSA 2XR8B 3OV4A 1UGHI 3GZYB 1NB5I 3G8ZA 4R4KA 3EX9A 1Q7HA 4XBXA 3DGMA 3F7XA 3B8LA 3EN8A 3Q90A 1EKMA 4N6OB 4ZM8A 2E2TA 5IG3A 4G1MB 1BRHA 1GOYA 3CC43 1B20A 3N9HA 2Y73A 4HM5B 5IG4A 3DH2A 1K41A 3GZBA 1B2UA 3CPOA 3SX1A 5BU4A 1TRPA 3D5GA 3B4PA 4K1UA 1BANA 2ZL8A 3ZFZA 3MHEA 2LYXA 1RGCA 3K7CA 1LXEA 4K1VA 3DGLA 1HYFA 1W6GA 2R4IA 3JUQA 3X3XA 2Z76A 1YNVX 3BNCA 3CD63 1GD3A 1WTHA 2V1LA 4FR9A 1Q40B 4AKYA 1JKGB 2LQVA 2L1SA 1K734 1K9M4 1F8NA 3MG1A 1RCLA 4HM1B 1FGQA 3EBYA 1IVVA 2ML6A 3BIRA 2IUJA 3D5IA 4FCMA 1CEWI 3MYTA 3SVAA 3L0RA 5ELJA 1EG9B 4KFEA 4MMYB 1QVG2 1IVUA 3WR2A 1CH0A 1AVLA 2CHCA 4R80A 5AYSC 1BNRA 3PZWA 3PGBA 3SLUA 5JPPA 5G1LA 2QEX3 3CCM3 2XSHB 3LZAA 2JQ5A 1YVSA 1G02A 1CYUA 4NPBA 5AI1A 5DRVA 1B2MA 4WYKA 2CFWA 1DE3A 2CFDA 3CNMA 1LQMB 1GY5A 1BNJA 2AAEA 1ULJB 1IT7A 3BNDA 4L8OA 3SYUA 4BTYA 2GEXA 4X2HA 1B3SA 1BRJA 5KP3A 2FXTA 4OUQA 1I0XA 3AHSA 3RDEA 1I2FA 1YGEA 5AIHA 1O7WB 3CNXA 2HMLB 4HM4B 1OACA 2B1XB 4HM3B 2ZHXB 3CC73 1CYVA 3ROBA 3KSPA 2UUGC 3JUMA 1NNVA 1JN5A 3G6E3 2SBLA 3LXUX 3AGNA 1DMMA 3BLZA 1RGAA 3KCHA 2OWPA 4WP5A 3TDGA 1Q7Y4 1BSBA 1I8VA 1NB3I 1KWIA 1FYSA 1IQYA 1M9GA 1KC84 3LTCA 5IG0A 1FUTA 1D6ZA 3NBBA 3BB9A 3DGOA 2C11A 4HZ9B 1MOLA 3IPTA 4HZBB 5CK6A 1HKXA 5IG5A 1DVDA 2OQEA 1VQ43 2W9PA 4XB5A 4FMAA 3SXXA 1MGRA 1W5ZA 1LNHA 2GBWB 3U97A 1PU4A 3CXC2 3OWYA 1EUIC 1E97A 3ECFA 3WA2X 3AHWA 2P0XA 3PYJA 4PEJA 2D1WA 4FCJA 4HM2B 3BU4A 3NBJA 1OF5B 3DM8A 2XF3A 3JUPA 2RSXA 3RGAA 3B4OA 3DGYA 1SPUA 1RN7A 1NJI4 2E2UA 1A2KA 1WMPA 3D79A 2YFJB 5IF6A 1HZ1A 4R9LA 2BNGA 1W00A 5GSPA 3DZLA 2C4BA 3LT9A 3OWSA 1YJN3 1KD14 3N54B 4HM7B 4MMZB 5HOHA 1RKYA 3J7Yd 1O7HB 3JUNA 1BUJA 2BHMA 4J9AA 3HI7A 4XBTA 3D9RA 3UNLA 3CCU3 1UW1A 3EBTA 3NX0A 3CCE3 2R41A 1MWUA 4HJLB 4BTXA 3N8BA 4MEIA 1KSIA 3T8NA 1N5HA 1QMAA 2KF4A 1A67A 1SARA 1JBTA 5CF2A 2M7OA 4FMDA 1NO3A 1NDOB 5EVHA 1FA3A 4BL3A 2CWUA 1B2XA 7RNTA 3ER7A 9RNTA 2Z77A 2WOHA 1BNSA 2HMKB 4TX4A 2BO9B 3ALAA 3CCV3 5JPUA 1A2VA 2AADA 2J8XB 5M18A 1AQZA 1NU3A 3PCSA 4IT7A 2H0HA 4RNYA 3RNTA 4DKIA 1GMQA 3JVCA 3CC23 2CFLA 3OW22 1VQK3 1BRIA 1X1YA 3MSOA 3H51A 1VQO3 5CF1A 3EB8A 1RNTA 1RRHA 1YIT3 3NBRA 4KT3B 1A90A 1UUVB 1N5PA 2HOHA 3T8UA 1JBRA 1T5YA 1BRKA 1V57A 1OPYA 1RCKA 1MWTA 1Q40A 4ORLA 1GMRA 1R4CA 1FUWA 2CX1A 3EHCA 4EW5A 3WA3A 1I2GA 3PCRA 1LRAA 2RNTA 1EA2A 3LT8A 2CC3A 2CIUA 1DYUA 4XM4A 3CCS3 5A0OB 3CPW2 6RNTA 1MWSA 3GZXB 3FG1A 2OQEC 1RLSA 2BMQB 4MJDA 2BU4A 4MMXB 5M1AA 1FUSA 2K54A 3WOEB 1JJ22 2WO0A 2XFSA 2D42A 1VQN3 1OF5A 1ZS7A 1YJW3 1LOVA 1TU5A
chains in the Genus database with same CATH topology
2UGIA 1LQGC 1LQMB 4LYLB 2UUGC 1UGIA 1UDII 1UUGB 1EUIC 1UGHI 2J8XB 2ZHXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UGI A;  1LQG C;  1LQM B;  4LYL B;  2UUG C;  1UGI A;  1UDI I;  1UUG B;  1EUI C;  1UGH I;  2J8X B;  2ZHX B; 
#chains in the Genus database with same CATH topology
 3EQQ B;  4LZI A;  5BVB A;  4J5K A;  3KII A;  3UB1 A;  3Q1C A;  1ZO2 A;  1M90 4;  1BOX A;  1SJW A;  3HX8 A;  3LYG A;  2K3D A;  1I3F A;  4K90 B;  3S29 A;  2QIY A;  1ROV A;  3STD A;  1BIR A;  2P05 A;  3CME 3;  1RN4 A;  5EQL A;  2IUK A;  1YHQ 3;  1G96 A;  1M1X B;  2QA4 3;  1EQK A;  2HMJ B;  1VQ7 3;  2BIR A;  5D82 A;  3OWU A;  1ZX2 A;  1EEJ A;  1RGE A;  1WMO A;  1N8Q A;  1C7H A;  5CLK A;  3K0Z A;  2HMN B;  4LGQ A;  2GSP A;  3LTD A;  2BMO B;  1IQX A;  3KN4 A;  4GB5 A;  3HK4 A;  2L4V A;  1L5G B;  5M19 A;  4L8P A;  4HOH A;  3NQY A;  4FMB A;  1PYL A;  5DRE A;  4HM6 B;  2F5M A;  2KF3 A;  3AGO A;  2F86 B;  2GXF A;  4N6N B;  1ZGX A;  3SOA A;  4GHO A;  4CDL A;  2OOV A;  4H61 A;  1OUN A;  2BT3 A;  2FNQ A;  5FW5 A;  3HII A;  2H0G A;  1W01 A;  1RHL A;  2MF7 A;  2UX0 A;  2W6J H;  3V98 A;  2Z6B A;  3KSE D;  1IK3 A;  1UCL A;  4KZ1 A;  1YIJ 3;  2YFL B;  3K63 A;  3D3L A;  3G4S 3;  2IMJ A;  1JB4 A;  1PY3 A;  1BUQ A;  1NWW A;  2KAA A;  4R9K A;  1US1 A;  4I5Q A;  3VSY A;  6GSP A;  1LVN A;  1YVB I;  4N3V A;  1LQG C;  2P38 A;  1W4N A;  3FCS B;  1GMP A;  3NM2 A;  4HYZ A;  2CFK A;  4H3U A;  2RBI A;  3MWZ A;  4HKV B;  1RSN A;  3X41 A;  2P09 A;  1J2B A;  1TRQ A;  3NUV A;  3S67 A;  3FKA A;  3IJE B;  3URP A;  1JB5 A;  3SOY A;  4WFO A;  3MPH A;  3NHX A;  4N6M A;  5STD A;  1BNI A;  2INX A;  1WMN A;  4OVM A;  2OTL 3;  2PZV A;  4HAA A;  1FZU A;  4NHF A;  1JKG A;  1Q86 4;  5BIR A;  2CG0 A;  4ILF A;  3F8H A;  1LOY A;  1N9E A;  1GY7 A;  1OGX A;  3F7S A;  5CXO A;  2GBX B;  1A2P A;  1V74 A;  4EV5 A;  2IY2 A;  1AVK A;  3HZP A;  3S5C A;  4CCV A;  1GY6 A;  2CKF B;  4HM0 B;  1RDS A;  2XEP A;  2KXG A;  4LEH A;  1UDI I;  1T2I A;  1FGO A;  3NM7 A;  2I9W A;  1I70 A;  1W2B 2;  5AYR B;  1RNB A;  1VQQ A;  1IVX A;  1BAO A;  1DET A;  2GU1 A;  4I4K A;  4AEQ A;  1B2Z A;  1UI8 A;  3X40 A;  1D6U A;  1ROA A;  1QAL A;  1T2H A;  2PNC A;  7STD A;  1BSD A;  3MKI A;  4BTW A;  1QAK A;  1CQS A;  1FGT A;  1TFO A;  3FG4 A;  1VQL 3;  3NV0 A;  4OK0 A;  3DGN A;  1B2S A;  2XH9 A;  1V58 A;  2KCD A;  1IDP A;  3F40 A;  1DMN A;  1O7N B;  2CH9 A;  1RJO A;  2JDI H;  2F4Y A;  3GZR A;  2W2C A;  4EC6 A;  2GU3 A;  1Q42 A;  2BMR B;  2ML5 A;  4LSO A;  4N6L A;  1G0T A;  2CW9 A;  3UL6 A;  3EE1 A;  1ULI B;  3LTA A;  5AEU B;  1RGH A;  2XFT A;  1YI2 3;  2KF6 A;  3NXJ A;  4WHA A;  1GOU A;  2CFG A;  2XSO B;  1FGM A;  3F9S A;  3G71 3;  1VQ5 3;  1LOW A;  4KFD A;  2ZA4 A;  3Q3F A;  1STF I;  2F98 A;  3X42 A;  4O8S A;  3DXO A;  2IA7 A;  4K61 A;  1RGL A;  4X2O A;  3KKG A;  3Q2P A;  1X1U A;  5LC6 A;  2P0M A;  2Y74 A;  1S72 3;  2RCD A;  2SAR A;  3CCL 3;  2W56 B;  3K5T A;  3DMC A;  3OX9 A;  1M1K 4;  2RFR A;  3MG2 A;  3NV0 B;  1QAF A;  3BNE A;  3ZG5 A;  1PFP A;  4GL6 A;  1SIH A;  2IYJ A;  3EN1 B;  2HMM B;  4J8T A;  3AMO B;  1RN1 A;  2MC8 A;  3K9M C;  1E3V A;  3BNB A;  3UL5 A;  4U13 A;  1MNL A;  1TJD A;  3EF8 A;  5KP4 A;  1BSE A;  1VQP 3;  1JB2 A;  1AV4 A;  1U8C B;  2A15 A;  3VGN A;  1W02 A;  3FH1 A;  4EBG A;  1I0V A;  1UGI A;  1Q9E A;  3KFQ C;  5IEP A;  1W7C A;  1BSC A;  1UUG B;  3V99 A;  3CCQ 3;  1OH0 A;  2F99 A;  3S28 A;  3X3Y A;  4RNZ A;  1IVW A;  1TUH A;  1WNH A;  4WWU C;  5AEW B;  2KF5 A;  3CCR 3;  1ISK A;  1MWR A;  1UCJ A;  1VZZ A;  5G1K A;  5RNT A;  1OHP A;  3U1W A;  1E3R A;  2WGO A;  3WMD A;  4JF8 A;  1N8R 4;  2O9U X;  4HM8 B;  2E2V A;  1BU4 A;  1JZD A;  1SII A;  5FGO A;  1BGS A;  1W6C A;  2W56 A;  2WOF A;  3FZW A;  3I0Y A;  3NQZ A;  1IYY A;  1UI7 A;  4KFF A;  4IIA A;  5AIF A;  3G0K A;  2GEY A;  3CU3 A;  3FSD A;  3FG3 A;  1BRS A;  1N9J A;  4HBR A;  4GSP A;  1VQ6 3;  4R1K A;  4N6V 0;  4EYC A;  1BNG A;  3O8Y A;  2CX0 A;  3DUK A;  1YJ9 3;  4AKZ A;  2HMO B;  5JBS A;  1BRN L;  2WGQ A;  1Q82 4;  1LOX A;  1I3I A;  3SED A;  4N6T A;  3M8C A;  3QK9 A;  4FCZ A;  5AII A;  3DY5 A;  1I2E A;  3KZT A;  1IV9 A;  2XGN A;  2Q07 A;  1GSP A;  3QRD A;  2OCT A;  2W0Q A;  3GWR A;  3I56 3;  1OCV A;  3A76 A;  4NRE A;  3FLJ A;  1IU7 A;  4O3V A;  5HGR A;  5KP1 A;  2OTJ 3;  1FW7 A;  3GAX A;  1VQ8 3;  1JNQ A;  2YFI B;  3GRD A;  4EV2 A;  2UGI A;  2YX9 A;  1B21 A;  2B24 B;  2C10 A;  2FGT A;  4LYL B;  2XGL A;  3X3Z A;  4BU4 A;  3LML A;  1D6Y A;  1RRL A;  3A5E A;  1RTU A;  3I55 3;  4CJN A;  4BIR A;  3WDG B;  3F8X A;  5G2G A;  4IPB A;  1W2Z A;  5IEO A;  3WOF B;  1Q81 4;  1OHS A;  2XRX B;  4RBN A;  1ASK A;  3FF0 A;  4RZM A;  4XDV A;  4XBY A;  1GS3 A;  3FF2 A;  5TGN A;  8CHO A;  1K8A 4;  2H0I A;  1JN5 B;  3G16 A;  4Q53 A;  5D81 A;  4EXR A;  1KQS 2;  3T0U A;  1OGZ A;  4LMI A;  1T3B A;  1FGR A;  2W9Q A;  2ZDJ A;  1BSA A;  1UCI A;  1SQW A;  3HOH A;  1IT8 A;  2RGQ A;  1QJG A;  1O7G B;  5IW9 A;  3MG3 A;  1WQL B;  4L7K A;  7GSP A;  4WYK B;  4XDW A;  1JV2 B;  2QGU A;  4HVN A;  4STD A;  4J5G A;  5LC7 A;  3EJV A;  1DMQ A;  2W03 A;  1AY7 A;  1GYB A;  1IV7 A;  1O7P B;  3FGY A;  3AMO A;  5IER A;  2STD A;  1YGW A;  1W6Y A;  2KRT A;  3E99 A;  3F14 A;  4KVH A;  3VF1 A;  3D4A A;  1HU9 A;  1Y4K A;  2W04 A;  3LH4 A;  3LOY A;  1MGW A;  1UUW B;  1RGF A;  1S5A A;  5AIG A;  1OHO A;  5EEO A;  1TIJ A;  1JZO A;  1RGK A;  3PS8 A;  4FMC A;  1IQ8 A;  1O7M B;  1VQ9 3;  2OOV C;  2CG1 A;  1TTO A;  1BVI A;  1AR0 A;  1RGG A;  1STD A;  3EC9 A;  3KE7 A;  3GSP A;  3H3H A;  1VQM 3;  1GD4 A;  1GOV A;  2Z7A A;  1JRQ A;  3CCJ 3;  3B7C A;  5ELU A;  4QWT A;  4CPK A;  5I97 A;  1X1X A;  1JBS A;  2CWV A;  4O2H A;  1Z1S A;  3PXM A;  1R4Y A;  3JUO A;  1BRG A;  2F5W A;  1BNE A;  4RNT A;  8RNT A;  4BL2 A;  1UCK A;  1X1W A;  1U5O A;  3LTB A;  3UJM A;  5BXQ A;  3V92 A;  3ZG0 A;  1C54 A;  6STD A;  3OXA A;  1TFK A;  4JRF A;  3CMA 3;  2F56 A;  5IEN A;  1TP6 A;  1BNF A;  3WHO A;  1QVF 2;  3RGR A;  2CK3 H;  3HIG A;  4O02 B;  5D83 A;  1K28 A;  2K0M A;  1DVC A;  2CWT A;  4N6U A;  3S27 A;  3WOD G;  3IMA B;  1LNI A;  1B27 A;  2O3O A;  1RMS A;  2XR8 B;  3OV4 A;  1UGH I;  3GZY B;  1NB5 I;  3G8Z A;  4R4K A;  3EX9 A;  1Q7H A;  4XBX A;  3DGM A;  3F7X A;  3B8L A;  3EN8 A;  3Q90 A;  1EKM A;  4N6O B;  4ZM8 A;  2E2T A;  5IG3 A;  4G1M B;  1BRH A;  1GOY A;  3CC4 3;  1B20 A;  3N9H A;  2Y73 A;  4HM5 B;  5IG4 A;  3DH2 A;  1K41 A;  3GZB A;  1B2U A;  3CPO A;  3SX1 A;  5BU4 A;  1TRP A;  3D5G A;  3B4P A;  4K1U A;  1BAN A;  2ZL8 A;  3ZFZ A;  3MHE A;  2LYX A;  1RGC A;  3K7C A;  1LXE A;  4K1V A;  3DGL A;  1HYF A;  1W6G A;  2R4I A;  3JUQ A;  3X3X A;  2Z76 A;  1YNV X;  3BNC A;  3CD6 3;  1GD3 A;  1WTH A;  2V1L A;  4FR9 A;  1Q40 B;  4AKY A;  1JKG B;  2LQV A;  2L1S A;  1K73 4;  1K9M 4;  1F8N A;  3MG1 A;  1RCL A;  4HM1 B;  1FGQ A;  3EBY A;  1IVV A;  2ML6 A;  3BIR A;  2IUJ A;  3D5I A;  4FCM A;  1CEW I;  3MYT A;  3SVA A;  3L0R A;  5ELJ A;  1EG9 B;  4KFE A;  4MMY B;  1QVG 2;  1IVU A;  3WR2 A;  1CH0 A;  1AVL A;  2CHC A;  4R80 A;  5AYS C;  1BNR A;  3PZW A;  3PGB A;  3SLU A;  5JPP A;  5G1L A;  2QEX 3;  3CCM 3;  2XSH B;  3LZA A;  2JQ5 A;  1YVS A;  1G02 A;  1CYU A;  4NPB A;  5AI1 A;  5DRV A;  1B2M A;  4WYK A;  2CFW A;  1DE3 A;  2CFD A;  3CNM A;  1LQM B;  1GY5 A;  1BNJ A;  2AAE A;  1ULJ B;  1IT7 A;  3BND A;  4L8O A;  3SYU A;  4BTY A;  2GEX A;  4X2H A;  1B3S A;  1BRJ A;  5KP3 A;  2FXT A;  4OUQ A;  1I0X A;  3AHS A;  3RDE A;  1I2F A;  1YGE A;  5AIH A;  1O7W B;  3CNX A;  2HML B;  4HM4 B;  1OAC A;  2B1X B;  4HM3 B;  2ZHX B;  3CC7 3;  1CYV A;  3ROB A;  3KSP A;  2UUG C;  3JUM A;  1NNV A;  1JN5 A;  3G6E 3;  2SBL A;  3LXU X;  3AGN A;  1DMM A;  3BLZ A;  1RGA A;  3KCH A;  2OWP A;  4WP5 A;  3TDG A;  1Q7Y 4;  1BSB A;  1I8V A;  1NB3 I;  1KWI A;  1FYS A;  1IQY A;  1M9G A;  1KC8 4;  3LTC A;  5IG0 A;  1FUT A;  1D6Z A;  3NBB A;  3BB9 A;  3DGO A;  2C11 A;  4HZ9 B;  1MOL A;  3IPT A;  4HZB B;  5CK6 A;  1HKX A;  5IG5 A;  1DVD A;  2OQE A;  1VQ4 3;  2W9P A;  4XB5 A;  4FMA A;  3SXX A;  1MGR A;  1W5Z A;  1LNH A;  2GBW B;  3U97 A;  1PU4 A;  3CXC 2;  3OWY A;  1EUI C;  1E97 A;  3ECF A;  3WA2 X;  3AHW A;  2P0X A;  3PYJ A;  4PEJ A;  2D1W A;  4FCJ A;  4HM2 B;  3BU4 A;  3NBJ A;  1OF5 B;  3DM8 A;  2XF3 A;  3JUP A;  2RSX A;  3RGA A;  3B4O A;  3DGY A;  1SPU A;  1RN7 A;  1NJI 4;  2E2U A;  1A2K A;  1WMP A;  3D79 A;  2YFJ B;  5IF6 A;  1HZ1 A;  4R9L A;  2BNG A;  1W00 A;  5GSP A;  3DZL A;  2C4B A;  3LT9 A;  3OWS A;  1YJN 3;  1KD1 4;  3N54 B;  4HM7 B;  4MMZ B;  5HOH A;  1RKY A;  3J7Y d;  1O7H B;  3JUN A;  1BUJ A;  2BHM A;  4J9A A;  3HI7 A;  4XBT A;  3D9R A;  3UNL A;  3CCU 3;  1UW1 A;  3EBT A;  3NX0 A;  3CCE 3;  2R41 A;  1MWU A;  4HJL B;  4BTX A;  3N8B A;  4MEI A;  1KSI A;  3T8N A;  1N5H A;  1QMA A;  2KF4 A;  1A67 A;  1SAR A;  1JBT A;  5CF2 A;  2M7O A;  4FMD A;  1NO3 A;  1NDO B;  5EVH A;  1FA3 A;  4BL3 A;  2CWU A;  1B2X A;  7RNT A;  3ER7 A;  9RNT A;  2Z77 A;  2WOH A;  1BNS A;  2HMK B;  4TX4 A;  2BO9 B;  3ALA A;  3CCV 3;  5JPU A;  1A2V A;  2AAD A;  2J8X B;  5M18 A;  1AQZ A;  1NU3 A;  3PCS A;  4IT7 A;  2H0H A;  4RNY A;  3RNT A;  4DKI A;  1GMQ A;  3JVC A;  3CC2 3;  2CFL A;  3OW2 2;  1VQK 3;  1BRI A;  1X1Y A;  3MSO A;  3H51 A;  1VQO 3;  5CF1 A;  3EB8 A;  1RNT A;  1RRH A;  1YIT 3;  3NBR A;  4KT3 B;  1A90 A;  1UUV B;  1N5P A;  2HOH A;  3T8U A;  1JBR A;  1T5Y A;  1BRK A;  1V57 A;  1OPY A;  1RCK A;  1MWT A;  1Q40 A;  4ORL A;  1GMR A;  1R4C A;  1FUW A;  2CX1 A;  3EHC A;  4EW5 A;  3WA3 A;  1I2G A;  3PCR A;  1LRA A;  2RNT A;  1EA2 A;  3LT8 A;  2CC3 A;  2CIU A;  1DYU A;  4XM4 A;  3CCS 3;  5A0O B;  3CPW 2;  6RNT A;  1MWS A;  3GZX B;  3FG1 A;  2OQE C;  1RLS A;  2BMQ B;  4MJD A;  2BU4 A;  4MMX B;  5M1A A;  1FUS A;  2K54 A;  3WOE B;  1JJ2 2;  2WO0 A;  2XFS A;  2D42 A;  1VQN 3;  1OF5 A;  1ZS7 A;  1YJW 3;  1LOV A;  1TU5 A; 
#chains in the Genus database with same CATH homology
 2UGI A;  1LQG C;  1LQM B;  4LYL B;  2UUG C;  1UGI A;  1UDI I;  1UUG B;  1EUI C;  1UGH I;  2J8X B;  2ZHX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...