1UGIA

Uracil-dna glycosylase inhibitor protein
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
83
structure length
83
Chain Sequence
TNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords URACIL-DNA GLYCOSYLASE INHIBITOR
publication title Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase
pubmed doi rcsb
source organism Bacillus phage pbs2
total genus 17
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.20 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Bacteriophage PBS2, uracil-glycosylase inhibitor 1ugiA00
1EUIC 1LQGC 4LYLB 2J8XB 2UUGC 1LQMB 1UGHI 1UUGB 2ZHXB 1UDII 1UGIA 2UGIA
chains in the Genus database with same CATH superfamily
2WGOA 3DUKA 1DVDA 4HBRA 1DMNA 4N6OB 1OH0A 3GZBA 1GOVA 1I2FA 3URPA 2OTJ3 2WO0A 5CK6A 2XGNA 1TRQA 2M7OA 5CF2A 2CFWA 2CHCA 3EBYA 1LOXA 4MJDA 1UW1A 5IG0A 1VQM3 1S723 2E2UA 4R1KA 4BTWA 1M904 2CG1A 4GHOA 3NQZA 1PFPA 2XF3A 3WA2X 5EEOA 3BU4A 7STDA 2F86B 3CC43 5AI1A 3VF1A 3NV0B 1W01A 2CWVA 1B2XA 3K0ZA 1EKMA 3ECFA 1BNEA 1DVCA 3FG4A 1AQZA 2KF4A 3K63A 1BRJA 1QMAA 3DGYA 5BU4A 4PEJA 3EE1A 1RN1A 2GU1A 1RGCA 2Z76A 1RHLA 3GZRA 4XDWA 3CMA3 1GMQA 1A2PA 3DGNA 3HOHA 5DREA 4EXRA 3MG3A 2HMOB 4RNTA 3TDGA 3FCSB 1I0VA 5A0OB 3WA3A 1OHPA 4STDA 2OTL3 1FW7A 3KKGA 2AAEA 1I2GA 1Q9EA 2ZA4A 4CPKA 1W2ZA 3H3HA 5IW9A 3HZPA 5LC7A 1BANA 5AYRB 1W6GA 3EC9A 1W02A 3NXJA 1N5HA 3KIIA 4MEIA 1Q864 2GSPA 1QVF2 1O7PB 1IV9A 2FNQA 1RGLA 1ZS7A 3WR2A 3OV4A 1JB4A 3E99A 3IMAB 4RNZA 1IVVA 1JRQA 3JVCA 1MWTA 1W6YA 1Y4KA 4N6UA 2STDA 3IJEB 1ZO2A 3HIIA 1KSIA 1DE3A 2W2CA 1EUIC 2ZDJA 5AIIA 3AMOB 1CEWI 1YIT3 3CCE3 3CC73 3EX9A 3S27A 7RNTA 1UI8A 2BMQB 2MC8A 3GZXB 1O7WB 1RSNA 1JBSA 2KF6A 1HU9A 3AHWA 3EB8A 3NBBA 1I3IA 3G16A 1WTHA 1T2IA 5LC6A 3S5CA 1AV4A 2F98A 4HM3B 3SOYA 1UDII 1GSPA 2XRXB 4FCMA 2JDIH 1KWIA 1ROAA 2Z6BA 4JF8A 1AR0A 2CFGA 3QRDA 1QVG2 2QGUA 3F7XA 1B2UA 3NBJA 5M18A 1JBTA 1W5ZA 2XSOB 3D79A 2XFTA 3CC23 3GWRA 3D5GA 2OQEA 1OGZA 5HGRA 3CCM3 3JUNA 1QAFA 2UX0A 3LMLA 2B24B 1BRKA 1T3BA 1O7HB 1YNVX 5AIGA 5IF6A 1D6ZA 5STDA 3PYJA 1LQGC 1EA2A 1JKGA 2C11A 3NHXA 3T8UA 2MF7A 3DGOA 1EQKA 3EHCA 2RFRA 2XGLA 3ZG5A 1GMRA 2CFKA 2YFLB 5EQLA 2BU4A 1AVKA 2BIRA 4H3UA 5AIFA 2Y73A 5IG5A 2HMNB 1RDSA 3SXXA 4CCVA 3EJVA 1UUVB 2WGQA 4N3VA 3OWYA 4FCZA 1Q40A 4AKZA 1OHSA 2FXTA 3NX0A 1BRHA 4K90B 1G96A 1FUTA 3L0RA 3SVAA 1VQ63 1VQ53 2BT3A 3D5IA 5AIHA 3RGRA 2XH9A 4AEQA 1N5PA 1VQN3 5CXOA 1WMNA 1JN5A 1SIIA 2JQ5A 2CX1A 1MGRA 1Q7HA 2F99A 3CPW2 3LTBA 4I4KA 1UUGB 3D3LA 4O02B 3SEDA 1M9GA 2PNCA 3AHSA 4BIRA 1GOYA 4NHFA 3BNEA 1TU5A 3V98A 2C10A 3K7CA 1JB5A 1AVLA 1NNVA 2P38A 3FKAA 3CU3A 1G0TA 1MNLA 1RN4A 5D81A 1SARA 5IG3A 4L8PA 4HM7B 2QA43 1YIJ3 2QIYA 3A5EA 4WYKA 3N8BA 3V99A 2GBXB 3X41A 4BTXA 6GSPA 2W0QA 2KF5A 4WP5A 4XBXA 1DYUA 1RGKA 3X40A 4BTYA 1OACA 1PY3A 1M1XB 2CH9A 4KVHA 1C54A 1N9JA 3X42A 5ELJA 1BNFA 1B21A 2OWPA 4RBNA 1DMMA 4L7KA 3X3YA 5JBSA 1WQLB 4O3VA 4ILFA 1LXEA 2SBLA 1YJW3 1JJ22 2RNTA 3NM7A 1HYFA 1LNHA 1BUJA 5IENA 4HM6B 1V57A 2CFLA 1RGGA 2K3DA 2W04A 2C4BA 1D6UA 4FR9A 1IT7A 8RNTA 3K9MC 1GY7A 3F8HA 3UJMA 4BL2A 3G4S3 1KC84 4ORLA 4HKVB 2KF3A 1YJN3 3HI7A 6RNTA 2HMJB 3S29A 5BXQA 3RGAA 3CCR3 3DGLA 4J8TA 4HOHA 2FGTA 3Q90A 4XBTA 3DZLA 1FGOA 2E2TA 3T0UA 1NU3A 1K8A4 1V58A 2E2VA 1UCJA 3N9HA 3DY5A 1MGWA 3OWSA 4N6V0 4X2OA 3GAXA 3MG2A 2UGIA 1KQS2 3OW22 1BSCA 2HMLB 3EF8A 4CJNA 4ZM8A 1IVXA 2WOHA 1X1XA 3F7SA 1JKGB 3KZTA 3LTDA 1JZDA 4KFFA 4HM4B 4HM8B 3WDGB 5BIRA 1FGQA 1VQQA 1JZOA 1OF5A 2A15A 1X1YA 5D83A 1IQ8A 1Q824 5IEOA 2W9PA 2CC3A 2CX0A 4K61A 1TFKA 2GEXA 1I8VA 1IQYA 3WOFB 1QALA 3JUQA 1NB5I 2O3OA 4EYCA 4XM4A 2RSXA 1UI7A 5GSPA 1W7CA 2B1XB 3KE7A 1N8R4 1B2MA 5DRVA 3LH4A 3CD63 2W6JH 1Q40B 1W00A 4FCJA 4JRFA 3UL6A 4BU4A 4CDLA 3FF2A 1RGEA 4AKYA 3F8XA 1TRPA 4XBYA 4NREA 1GD3A 4OUQA 3HX8A 3ROBA 1BNSA 2HMMB 2ML6A 1JN5B 1RRLA 1RNTA 1F8NA 1BAOA 1RGFA 3CCJ3 1EG9B 3MPHA 4MMZB 3EQQB 1HZ1A 1PU4A 2BMOB 3FF0A 3OXAA 4U13A 4XB5A 1VQ43 1OUNA 1LNIA 1GD4A 5KP4A 2BNGA 3SX1A 1N8QA 3MYTA 2OQEC 3NBRA 2Y74A 3G0KA 3DMCA 4FMDA 3WOEB 2R4IA 1IV7A 1CH0A 3GZYB 4WYKB 3MG1A 3LTAA 3MKIA 4KT3B 1TTOA 3CXC2 2L1SA 4KFEA 1K41A 1BSAA 3BIRA 1QJGA 1DMQA 1OGXA 3B4PA 3CCV3 6STDA 1ROVA 2Q07A 1I0XA 1X1WA 1MWSA 1DETA 4FMBA 2K54A 4X2HA 1STDA 5IEPA 4LZIA 2OCTA 1X1UA 4K1UA 3NQYA 4MMYB 3CPOA 2F4YA 4WWUC 3NUVA 3S28A 3MWZA 1W4NA 1NDOB 2Z77A 1N9EA 3AGNA 4LEHA 4EV2A 2IYJA 2CFDA 1I70A 3X3XA 5KP1A 3X3ZA 2SARA 1BRIA 2KXGA 1IVWA 2W56A 2BO9B 1GS3A 1JNQA 3WODG 3ZG0A 1BIRA 2BHMA 3QK9A 1BSDA 3FH1A 2K0MA 3SLUA 1K9M4 1B3SA 1BOXA 1RTUA 1OCVA 1RGHA 3LZAA 2YX9A 1EEJA 2R41A 1C7HA 1GOUA 1BNJA 1D6YA 1LOYA 1A67A 1A90A 4HM0B 1FUSA 1VQ73 2Z7AA 1VQ83 1PYLA 1B27A 1NWWA 1R4YA 3ALAA 3LTCA 1UCLA 1FZUA 4O8SA 3O8YA 1L5GB 5FGOA 2F5MA 3LT9A 1IYYA 3FSDA 3UL5A 4EW5A 1UUWB 3LYGA 3M8CA 3KN4A 1T2HA 5EVHA 1M1K4 2P09A 1I3FA 2KRTA 1VQL3 3KSPA 5HOHA 2KAAA 2RBIA 3A76A 5CLKA 3VGNA 1NO3A 1R4CA 3BNBA 2IUKA 3S67A 1CYUA 1UGHI 1IDPA 1BSBA 2P05A 1LRAA 3F40A 1FGRA 1OF5B 2XEPA 5I97A 1O7GB 1Q42A 4HM5B 4OK0A 4NPBA 1GY5A 1SIHA 3CNXA 2LYXA 3DGMA 1BRGA 2RGQA 2O9UX 4IT7A 3JUMA 4MMXB 3FZWA 2IY2A 3RDEA 3EBTA 1Z1SA 3K5TA 2HOHA 1QAKA 4R9LA 5TGNA 1ULJB 2LQVA 3WHOA 4R80A 1BU4A 3RNTA 3SYUA 3PXMA 1KD14 3JUOA 1W2B2 2KCDA 1E97A 2H0HA 1YGEA 2XFSA 1I2EA 1RN7A 1TP6A 5AEUB 5JPPA 5G1KA 1BRNL 1YVBI 2BMRB 2H0IA 3LOYA 1IQXA 2IA7A 3NM2A 1UCIA 4GB5A 2IUJA 3UNLA 1WNHA 4KFDA 4BL3A 1Q7Y4 1RJOA 1ZX2A 1BNIA 1K734 1B20A 1TJDA 4J5KA 5RNTA 5CF1A 7GSPA 1OHOA 1RCKA 2UUGC 1K28A 1BSEA 1TUHA 3G8ZA 1J2BA 1UCKA 1STFI 3D4AA 3F14A 2D42A 1RKYA 1U5OA 4H61A 5FW5A 2I9WA 4LMIA 4LGQA 1YVSA 4RNYA 2GXFA 3BNDA 3OX9A 1GMPA 5AEWB 1NB3I 2J8XB 3V92A 4EV5A 3ER7A 3FLJA 1BVIA 1US1A 3Q1CA 1JV2B 1RLSA 2F56A 2WOFA 4FMCA 5AYSC 3FG1A 3UB1A 2XR8B 1SPUA 2YFJB 1IVUA 1AY7A 1LOWA 3NV0A 1E3RA 2L4VA 4J9AA 5IG4A 2W56B 1VQ93 1LVNA 3HK4A 1VQP3 1G02A 1RGAA 2PZVA 4R9KA 1RNBA 1ASKA 4Q53A 2GEYA 3H51A 2GBWB 1Q814 3T8NA 3OWUA 1MOLA 3VSYA 1CYVA 2YFIB 1FYSA 4EBGA 3SOAA 2XSHB 4HVNA 2CWTA 8CHOA 4O2HA 3B4OA 2CK3H 3GSPA 5M1AA 2P0MA 1FA3A 1U8CB 4J5GA 1GYBA 3CCL3 4K1VA 1LOVA 3B7CA 4XDVA 3KFQC 5M19A 1V74A 3KSED 1JB2A 4HJLB 4TX4A 4WFOA 3U97A 5G2GA 3PCRA 1RCLA 2F5WA 4HAAA 1OPYA 3U1WA 1FUWA 1IU7A 4GSPA 1B2ZA 3WMDA 1T5YA 2V1LA 1WMOA 5KP3A 1VQK3 3MHEA 3I553 5G1LA 1VQO3 1O7NB 4HM1B 4OVMA 4HZ9B 1YHQ3 2W03A 9RNTA 1ZGXA 3PCSA 1YGWA 4LYLB 3PGBA 1A2KA 1B2SA 1SJWA 3G713 3AMOA 3KCHA 3G6E3 1IT8A 2INXA 3CNMA 4N6TA 1FGMA 4HM2B 1S5AA 1MWRA 3Q3FA 1BUQA 4IPBA 1RMSA 1JBRA 1VZZA 3CCU3 3FG3A 1BRSA 3MSOA 2QEX3 2IMJA 3DH2A 3DM8A 4DKIA 5ELUA 3GRDA 5BVBA 1HKXA 3EN1B 1ULIB 1NJI4 1O7MB 2P0XA 2AADA 3D9RA 1LQMB 4N6NB 4L8OA 3AGOA 1WMPA 3BB9A 1A2VA 4RZMA 1ISKA 1GY6A 3DXOA 1TFOA 3IPTA 3PS8A 3I563 1MWUA 4EC6A 3F9SA 2CKFB 2W9QA 2CW9A 2ZL8A 3FGYA 4I5QA 3N54B 4FMAA 2OOVA 3CME3 3PZWA 3LXUX 1YJ93 3BLZA 4IIAA 4N6LA 1BGSA 1CQSA 2H0GA 3Q2PA 1W6CA 2CG0A 1YI23 4N6MA 4G1MB 3STDA 2OOVC 1RRHA 3BNCA 4GL6A 4LSOA 4KZ1A 3CCQ3 3HIGA 1E3VA 3EN8A 3I0YA 1SQWA 5JPUA 1BNRA 4WHAA 3J7Yd 3B8LA 2GU3A 5IERA 2D1WA 3CCS3 4HZBB 1FGTA 2CWUA 2ZHXB 4R4KA 1TIJA 2CIUA 5D82A 2RCDA 4HYZA 2HMKB 3LT8A 1IK3A 3ZFZA 4QWTA 1UGIA 3JUPA 2ML5A 1BNGA
chains in the Genus database with same CATH topology
1EUIC 1LQGC 4LYLB 2J8XB 2UUGC 1LQMB 1UGHI 1UUGB 2ZHXB 1UDII 1UGIA 2UGIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUI C;  1LQG C;  4LYL B;  2J8X B;  2UUG C;  1LQM B;  1UGH I;  1UUG B;  2ZHX B;  1UDI I;  1UGI A;  2UGI A; 
#chains in the Genus database with same CATH topology
 2WGO A;  3DUK A;  1DVD A;  4HBR A;  1DMN A;  4N6O B;  1OH0 A;  3GZB A;  1GOV A;  1I2F A;  3URP A;  2OTJ 3;  2WO0 A;  5CK6 A;  2XGN A;  1TRQ A;  2M7O A;  5CF2 A;  2CFW A;  2CHC A;  3EBY A;  1LOX A;  4MJD A;  1UW1 A;  5IG0 A;  1VQM 3;  1S72 3;  2E2U A;  4R1K A;  4BTW A;  1M90 4;  2CG1 A;  4GHO A;  3NQZ A;  1PFP A;  2XF3 A;  3WA2 X;  5EEO A;  3BU4 A;  7STD A;  2F86 B;  3CC4 3;  5AI1 A;  3VF1 A;  3NV0 B;  1W01 A;  2CWV A;  1B2X A;  3K0Z A;  1EKM A;  3ECF A;  1BNE A;  1DVC A;  3FG4 A;  1AQZ A;  2KF4 A;  3K63 A;  1BRJ A;  1QMA A;  3DGY A;  5BU4 A;  4PEJ A;  3EE1 A;  1RN1 A;  2GU1 A;  1RGC A;  2Z76 A;  1RHL A;  3GZR A;  4XDW A;  3CMA 3;  1GMQ A;  1A2P A;  3DGN A;  3HOH A;  5DRE A;  4EXR A;  3MG3 A;  2HMO B;  4RNT A;  3TDG A;  3FCS B;  1I0V A;  5A0O B;  3WA3 A;  1OHP A;  4STD A;  2OTL 3;  1FW7 A;  3KKG A;  2AAE A;  1I2G A;  1Q9E A;  2ZA4 A;  4CPK A;  1W2Z A;  3H3H A;  5IW9 A;  3HZP A;  5LC7 A;  1BAN A;  5AYR B;  1W6G A;  3EC9 A;  1W02 A;  3NXJ A;  1N5H A;  3KII A;  4MEI A;  1Q86 4;  2GSP A;  1QVF 2;  1O7P B;  1IV9 A;  2FNQ A;  1RGL A;  1ZS7 A;  3WR2 A;  3OV4 A;  1JB4 A;  3E99 A;  3IMA B;  4RNZ A;  1IVV A;  1JRQ A;  3JVC A;  1MWT A;  1W6Y A;  1Y4K A;  4N6U A;  2STD A;  3IJE B;  1ZO2 A;  3HII A;  1KSI A;  1DE3 A;  2W2C A;  1EUI C;  2ZDJ A;  5AII A;  3AMO B;  1CEW I;  1YIT 3;  3CCE 3;  3CC7 3;  3EX9 A;  3S27 A;  7RNT A;  1UI8 A;  2BMQ B;  2MC8 A;  3GZX B;  1O7W B;  1RSN A;  1JBS A;  2KF6 A;  1HU9 A;  3AHW A;  3EB8 A;  3NBB A;  1I3I A;  3G16 A;  1WTH A;  1T2I A;  5LC6 A;  3S5C A;  1AV4 A;  2F98 A;  4HM3 B;  3SOY A;  1UDI I;  1GSP A;  2XRX B;  4FCM A;  2JDI H;  1KWI A;  1ROA A;  2Z6B A;  4JF8 A;  1AR0 A;  2CFG A;  3QRD A;  1QVG 2;  2QGU A;  3F7X A;  1B2U A;  3NBJ A;  5M18 A;  1JBT A;  1W5Z A;  2XSO B;  3D79 A;  2XFT A;  3CC2 3;  3GWR A;  3D5G A;  2OQE A;  1OGZ A;  5HGR A;  3CCM 3;  3JUN A;  1QAF A;  2UX0 A;  3LML A;  2B24 B;  1BRK A;  1T3B A;  1O7H B;  1YNV X;  5AIG A;  5IF6 A;  1D6Z A;  5STD A;  3PYJ A;  1LQG C;  1EA2 A;  1JKG A;  2C11 A;  3NHX A;  3T8U A;  2MF7 A;  3DGO A;  1EQK A;  3EHC A;  2RFR A;  2XGL A;  3ZG5 A;  1GMR A;  2CFK A;  2YFL B;  5EQL A;  2BU4 A;  1AVK A;  2BIR A;  4H3U A;  5AIF A;  2Y73 A;  5IG5 A;  2HMN B;  1RDS A;  3SXX A;  4CCV A;  3EJV A;  1UUV B;  2WGQ A;  4N3V A;  3OWY A;  4FCZ A;  1Q40 A;  4AKZ A;  1OHS A;  2FXT A;  3NX0 A;  1BRH A;  4K90 B;  1G96 A;  1FUT A;  3L0R A;  3SVA A;  1VQ6 3;  1VQ5 3;  2BT3 A;  3D5I A;  5AIH A;  3RGR A;  2XH9 A;  4AEQ A;  1N5P A;  1VQN 3;  5CXO A;  1WMN A;  1JN5 A;  1SII A;  2JQ5 A;  2CX1 A;  1MGR A;  1Q7H A;  2F99 A;  3CPW 2;  3LTB A;  4I4K A;  1UUG B;  3D3L A;  4O02 B;  3SED A;  1M9G A;  2PNC A;  3AHS A;  4BIR A;  1GOY A;  4NHF A;  3BNE A;  1TU5 A;  3V98 A;  2C10 A;  3K7C A;  1JB5 A;  1AVL A;  1NNV A;  2P38 A;  3FKA A;  3CU3 A;  1G0T A;  1MNL A;  1RN4 A;  5D81 A;  1SAR A;  5IG3 A;  4L8P A;  4HM7 B;  2QA4 3;  1YIJ 3;  2QIY A;  3A5E A;  4WYK A;  3N8B A;  3V99 A;  2GBX B;  3X41 A;  4BTX A;  6GSP A;  2W0Q A;  2KF5 A;  4WP5 A;  4XBX A;  1DYU A;  1RGK A;  3X40 A;  4BTY A;  1OAC A;  1PY3 A;  1M1X B;  2CH9 A;  4KVH A;  1C54 A;  1N9J A;  3X42 A;  5ELJ A;  1BNF A;  1B21 A;  2OWP A;  4RBN A;  1DMM A;  4L7K A;  3X3Y A;  5JBS A;  1WQL B;  4O3V A;  4ILF A;  1LXE A;  2SBL A;  1YJW 3;  1JJ2 2;  2RNT A;  3NM7 A;  1HYF A;  1LNH A;  1BUJ A;  5IEN A;  4HM6 B;  1V57 A;  2CFL A;  1RGG A;  2K3D A;  2W04 A;  2C4B A;  1D6U A;  4FR9 A;  1IT7 A;  8RNT A;  3K9M C;  1GY7 A;  3F8H A;  3UJM A;  4BL2 A;  3G4S 3;  1KC8 4;  4ORL A;  4HKV B;  2KF3 A;  1YJN 3;  3HI7 A;  6RNT A;  2HMJ B;  3S29 A;  5BXQ A;  3RGA A;  3CCR 3;  3DGL A;  4J8T A;  4HOH A;  2FGT A;  3Q90 A;  4XBT A;  3DZL A;  1FGO A;  2E2T A;  3T0U A;  1NU3 A;  1K8A 4;  1V58 A;  2E2V A;  1UCJ A;  3N9H A;  3DY5 A;  1MGW A;  3OWS A;  4N6V 0;  4X2O A;  3GAX A;  3MG2 A;  2UGI A;  1KQS 2;  3OW2 2;  1BSC A;  2HML B;  3EF8 A;  4CJN A;  4ZM8 A;  1IVX A;  2WOH A;  1X1X A;  3F7S A;  1JKG B;  3KZT A;  3LTD A;  1JZD A;  4KFF A;  4HM4 B;  4HM8 B;  3WDG B;  5BIR A;  1FGQ A;  1VQQ A;  1JZO A;  1OF5 A;  2A15 A;  1X1Y A;  5D83 A;  1IQ8 A;  1Q82 4;  5IEO A;  2W9P A;  2CC3 A;  2CX0 A;  4K61 A;  1TFK A;  2GEX A;  1I8V A;  1IQY A;  3WOF B;  1QAL A;  3JUQ A;  1NB5 I;  2O3O A;  4EYC A;  4XM4 A;  2RSX A;  1UI7 A;  5GSP A;  1W7C A;  2B1X B;  3KE7 A;  1N8R 4;  1B2M A;  5DRV A;  3LH4 A;  3CD6 3;  2W6J H;  1Q40 B;  1W00 A;  4FCJ A;  4JRF A;  3UL6 A;  4BU4 A;  4CDL A;  3FF2 A;  1RGE A;  4AKY A;  3F8X A;  1TRP A;  4XBY A;  4NRE A;  1GD3 A;  4OUQ A;  3HX8 A;  3ROB A;  1BNS A;  2HMM B;  2ML6 A;  1JN5 B;  1RRL A;  1RNT A;  1F8N A;  1BAO A;  1RGF A;  3CCJ 3;  1EG9 B;  3MPH A;  4MMZ B;  3EQQ B;  1HZ1 A;  1PU4 A;  2BMO B;  3FF0 A;  3OXA A;  4U13 A;  4XB5 A;  1VQ4 3;  1OUN A;  1LNI A;  1GD4 A;  5KP4 A;  2BNG A;  3SX1 A;  1N8Q A;  3MYT A;  2OQE C;  3NBR A;  2Y74 A;  3G0K A;  3DMC A;  4FMD A;  3WOE B;  2R4I A;  1IV7 A;  1CH0 A;  3GZY B;  4WYK B;  3MG1 A;  3LTA A;  3MKI A;  4KT3 B;  1TTO A;  3CXC 2;  2L1S A;  4KFE A;  1K41 A;  1BSA A;  3BIR A;  1QJG A;  1DMQ A;  1OGX A;  3B4P A;  3CCV 3;  6STD A;  1ROV A;  2Q07 A;  1I0X A;  1X1W A;  1MWS A;  1DET A;  4FMB A;  2K54 A;  4X2H A;  1STD A;  5IEP A;  4LZI A;  2OCT A;  1X1U A;  4K1U A;  3NQY A;  4MMY B;  3CPO A;  2F4Y A;  4WWU C;  3NUV A;  3S28 A;  3MWZ A;  1W4N A;  1NDO B;  2Z77 A;  1N9E A;  3AGN A;  4LEH A;  4EV2 A;  2IYJ A;  2CFD A;  1I70 A;  3X3X A;  5KP1 A;  3X3Z A;  2SAR A;  1BRI A;  2KXG A;  1IVW A;  2W56 A;  2BO9 B;  1GS3 A;  1JNQ A;  3WOD G;  3ZG0 A;  1BIR A;  2BHM A;  3QK9 A;  1BSD A;  3FH1 A;  2K0M A;  3SLU A;  1K9M 4;  1B3S A;  1BOX A;  1RTU A;  1OCV A;  1RGH A;  3LZA A;  2YX9 A;  1EEJ A;  2R41 A;  1C7H A;  1GOU A;  1BNJ A;  1D6Y A;  1LOY A;  1A67 A;  1A90 A;  4HM0 B;  1FUS A;  1VQ7 3;  2Z7A A;  1VQ8 3;  1PYL A;  1B27 A;  1NWW A;  1R4Y A;  3ALA A;  3LTC A;  1UCL A;  1FZU A;  4O8S A;  3O8Y A;  1L5G B;  5FGO A;  2F5M A;  3LT9 A;  1IYY A;  3FSD A;  3UL5 A;  4EW5 A;  1UUW B;  3LYG A;  3M8C A;  3KN4 A;  1T2H A;  5EVH A;  1M1K 4;  2P09 A;  1I3F A;  2KRT A;  1VQL 3;  3KSP A;  5HOH A;  2KAA A;  2RBI A;  3A76 A;  5CLK A;  3VGN A;  1NO3 A;  1R4C A;  3BNB A;  2IUK A;  3S67 A;  1CYU A;  1UGH I;  1IDP A;  1BSB A;  2P05 A;  1LRA A;  3F40 A;  1FGR A;  1OF5 B;  2XEP A;  5I97 A;  1O7G B;  1Q42 A;  4HM5 B;  4OK0 A;  4NPB A;  1GY5 A;  1SIH A;  3CNX A;  2LYX A;  3DGM A;  1BRG A;  2RGQ A;  2O9U X;  4IT7 A;  3JUM A;  4MMX B;  3FZW A;  2IY2 A;  3RDE A;  3EBT A;  1Z1S A;  3K5T A;  2HOH A;  1QAK A;  4R9L A;  5TGN A;  1ULJ B;  2LQV A;  3WHO A;  4R80 A;  1BU4 A;  3RNT A;  3SYU A;  3PXM A;  1KD1 4;  3JUO A;  1W2B 2;  2KCD A;  1E97 A;  2H0H A;  1YGE A;  2XFS A;  1I2E A;  1RN7 A;  1TP6 A;  5AEU B;  5JPP A;  5G1K A;  1BRN L;  1YVB I;  2BMR B;  2H0I A;  3LOY A;  1IQX A;  2IA7 A;  3NM2 A;  1UCI A;  4GB5 A;  2IUJ A;  3UNL A;  1WNH A;  4KFD A;  4BL3 A;  1Q7Y 4;  1RJO A;  1ZX2 A;  1BNI A;  1K73 4;  1B20 A;  1TJD A;  4J5K A;  5RNT A;  5CF1 A;  7GSP A;  1OHO A;  1RCK A;  2UUG C;  1K28 A;  1BSE A;  1TUH A;  3G8Z A;  1J2B A;  1UCK A;  1STF I;  3D4A A;  3F14 A;  2D42 A;  1RKY A;  1U5O A;  4H61 A;  5FW5 A;  2I9W A;  4LMI A;  4LGQ A;  1YVS A;  4RNY A;  2GXF A;  3BND A;  3OX9 A;  1GMP A;  5AEW B;  1NB3 I;  2J8X B;  3V92 A;  4EV5 A;  3ER7 A;  3FLJ A;  1BVI A;  1US1 A;  3Q1C A;  1JV2 B;  1RLS A;  2F56 A;  2WOF A;  4FMC A;  5AYS C;  3FG1 A;  3UB1 A;  2XR8 B;  1SPU A;  2YFJ B;  1IVU A;  1AY7 A;  1LOW A;  3NV0 A;  1E3R A;  2L4V A;  4J9A A;  5IG4 A;  2W56 B;  1VQ9 3;  1LVN A;  3HK4 A;  1VQP 3;  1G02 A;  1RGA A;  2PZV A;  4R9K A;  1RNB A;  1ASK A;  4Q53 A;  2GEY A;  3H51 A;  2GBW B;  1Q81 4;  3T8N A;  3OWU A;  1MOL A;  3VSY A;  1CYV A;  2YFI B;  1FYS A;  4EBG A;  3SOA A;  2XSH B;  4HVN A;  2CWT A;  8CHO A;  4O2H A;  3B4O A;  2CK3 H;  3GSP A;  5M1A A;  2P0M A;  1FA3 A;  1U8C B;  4J5G A;  1GYB A;  3CCL 3;  4K1V A;  1LOV A;  3B7C A;  4XDV A;  3KFQ C;  5M19 A;  1V74 A;  3KSE D;  1JB2 A;  4HJL B;  4TX4 A;  4WFO A;  3U97 A;  5G2G A;  3PCR A;  1RCL A;  2F5W A;  4HAA A;  1OPY A;  3U1W A;  1FUW A;  1IU7 A;  4GSP A;  1B2Z A;  3WMD A;  1T5Y A;  2V1L A;  1WMO A;  5KP3 A;  1VQK 3;  3MHE A;  3I55 3;  5G1L A;  1VQO 3;  1O7N B;  4HM1 B;  4OVM A;  4HZ9 B;  1YHQ 3;  2W03 A;  9RNT A;  1ZGX A;  3PCS A;  1YGW A;  4LYL B;  3PGB A;  1A2K A;  1B2S A;  1SJW A;  3G71 3;  3AMO A;  3KCH A;  3G6E 3;  1IT8 A;  2INX A;  3CNM A;  4N6T A;  1FGM A;  4HM2 B;  1S5A A;  1MWR A;  3Q3F A;  1BUQ A;  4IPB A;  1RMS A;  1JBR A;  1VZZ A;  3CCU 3;  3FG3 A;  1BRS A;  3MSO A;  2QEX 3;  2IMJ A;  3DH2 A;  3DM8 A;  4DKI A;  5ELU A;  3GRD A;  5BVB A;  1HKX A;  3EN1 B;  1ULI B;  1NJI 4;  1O7M B;  2P0X A;  2AAD A;  3D9R A;  1LQM B;  4N6N B;  4L8O A;  3AGO A;  1WMP A;  3BB9 A;  1A2V A;  4RZM A;  1ISK A;  1GY6 A;  3DXO A;  1TFO A;  3IPT A;  3PS8 A;  3I56 3;  1MWU A;  4EC6 A;  3F9S A;  2CKF B;  2W9Q A;  2CW9 A;  2ZL8 A;  3FGY A;  4I5Q A;  3N54 B;  4FMA A;  2OOV A;  3CME 3;  3PZW A;  3LXU X;  1YJ9 3;  3BLZ A;  4IIA A;  4N6L A;  1BGS A;  1CQS A;  2H0G A;  3Q2P A;  1W6C A;  2CG0 A;  1YI2 3;  4N6M A;  4G1M B;  3STD A;  2OOV C;  1RRH A;  3BNC A;  4GL6 A;  4LSO A;  4KZ1 A;  3CCQ 3;  3HIG A;  1E3V A;  3EN8 A;  3I0Y A;  1SQW A;  5JPU A;  1BNR A;  4WHA A;  3J7Y d;  3B8L A;  2GU3 A;  5IER A;  2D1W A;  3CCS 3;  4HZB B;  1FGT A;  2CWU A;  2ZHX B;  4R4K A;  1TIJ A;  2CIU A;  5D82 A;  2RCD A;  4HYZ A;  2HMK B;  3LT8 A;  1IK3 A;  3ZFZ A;  4QWT A;  1UGI A;  3JUP A;  2ML5 A;  1BNG A; 
#chains in the Genus database with same CATH homology
 1EUI C;  1LQG C;  4LYL B;  2J8X B;  2UUG C;  1LQM B;  1UGH I;  1UUG B;  2ZHX B;  1UDI I;  1UGI A;  2UGI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...