1FA3A

Solution structure of mnei, a sweet protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
b'GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MNEI SWEET PROTEIN RELATED TO MONELLIN
publication title Solution structure of a sweet protein: NMR study of MNEI, a single chain monellin.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Structural protein
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1fa3A00
4TX4A 1RN7A 3SVAA 3K9MC 3S67A 1N9JA 1R4CA 4LZIA 5ELJA 3UL6A 1DVCA 1N5PA 4N6UA 4N6LA 1GD4A 2KXGA 4N6MA 4CCVA 1STFI 1CYVA 1ROAA 2O9UX 1YVBI 1MNLA 1CYUA 1LXEA 3LH4A 5LC7A 3L0RA 1NB5I 4N6V0 3KSED 3IMAB 4EYCA 2BO9B 3PS8A 3PXMA 1EQKA 4IT7A 3NX0A 1FA3A 4ZM8A 1FUWA 1IV9A 1MOLA 3PYJA 1TIJA 1N5HA 3GAXA 4N6TA 3KFQC 3MWZA 1NB3I 5LC6A 1M9GA 1DVDA 3UL5A 3QRDA 1PFPA 2W9PA 1A67A 3Q2PA 1WNHA 1GD3A 2CH9A 5A0OB 1A90A 2W9QA 1IV7A 1G96A 4N6OB 1CEWI 5EQLA 1KWIA 5ELUA 4N6NB 2OCTA
chains in the Genus database with same CATH superfamily
2MF7A 3SEDA 3F14A 2OOVA 1SIHA 3N9HA 1MWRA 1YJN3 4WYKA 3S67A 3ZG0A 3KKGA 2OQEC 1S5AA 1BRNL 2CWVA 3D9RA 1O7HB 4HKVB 3BU4A 2CWUA 3GZRA 1JB5A 4MMXB 1J2BA 6STDA 3DGNA 4R1KA 1YNVX 4LYLB 3BNDA 1N5PA 3HZPA 2F4YA 4K1VA 2B1XB 3X3YA 1RGKA 4MJDA 3GZXB 4OVMA 1I2GA 3HIGA 3K0ZA 2KXGA 1T2IA 3CPOA 4N6MA 1BRIA 5STDA 3X41A 4CCVA 3EQQB 1GMQA 2W2CA 3FGYA 1Q7HA 3JUQA 4GL6A 4WHAA 1YVSA 2QEX3 1M1K4 1VQ53 2BT3A 3CCV3 1ROAA 3BB9A 4FMCA 1CYUA 1PYLA 3LH4A 5CLKA 2ZA4A 1C7HA 3AHSA 6RNTA 5I97A 3L0RA 1RGLA 1GY7A 1NB5I 1ISKA 2HMKB 1O7PB 3ECFA 3N54B 1I70A 3V98A 1N8R4 2XRXB 1EUIC 4JF8A 1IQYA 1NDOB 4L8OA 4J5KA 1MWUA 4IPBA 2GXFA 1LOYA 1GS3A 5BU4A 5KP1A 3EBTA 2YFLB 3B7CA 4RBNA 5TGNA 5KP4A 2BO9B 2PZVA 1BU4A 1JBTA 1KQS2 1BAOA 2BMOB 4LEHA 3S5CA 2CFGA 3X42A 1YHQ3 1ULIB 2KCDA 1VQ43 2XGLA 3OW22 3ZG5A 1A2VA 1B20A 1JB2A 1JN5A 4LGQA 3EBYA 2W03A 4EBGA 3S27A 1RKYA 3F7XA 1B27A 3K7CA 1IQ8A 3NBBA 3EF8A 4R80A 1BUJA 3D3LA 1YJW3 3HI7A 2KAAA 2LQVA 3EJVA 2I9WA 1NNVA 4N6TA 3AGOA 1IT7A 3KFQC 1BRHA 3GRDA 4O3VA 3B8LA 2GSPA 4KFEA 5FW5A 2ZDJA 2QA43 1T3BA 3M8CA 3CCJ3 1SQWA 1OGZA 1MWSA 2YFIB 3Q1CA 1M9GA 1IVWA 1QVF2 1IT8A 1DVDA 1G02A 3UL5A 4KT3B 4N3VA 1M1XB 3V92A 4O8SA 1TFOA 3DUKA 3MPHA 1VQ83 3UB1A 3STDA 1UCJA 4IIAA 2XGNA 1JBRA 1JZOA 1W01A 1HU9A 1PFPA 2UGIA 4OUQA 1HZ1A 2ML5A 4XDWA 1BVIA 3PZWA 1BSAA 1JKGB 3BNBA 3D5IA 2CFWA 3G713 1RGEA 2C10A 1WNHA 3X3ZA 1US1A 2SARA 2CG1A 2FNQA 2RBIA 3F8HA 1A2PA 4CDLA 3DM8A 1A2KA 1G0TA 4O02B 4AKZA 3AMOA 3GWRA 1UW1A 3WA2X 5BXQA 2F5WA 5CF2A 2WO0A 3DGLA 3AHWA 3F7SA 1KWIA 4R9LA 1NJI4 2FGTA 5G2GA 1V58A 2H0GA 4TX4A 1OHOA 1E3RA 2QIYA 3OWUA 1MGWA 3K9MC 1L5GB 3MG2A 1RHLA 1F8NA 3V99A 2W0QA 3N8BA 1K41A 1NWWA 3UL6A 4NPBA 1GY6A 3LXUX 4N6UA 3BNCA 1RCLA 4I4KA 1AVLA 5D82A 1RGHA 4N6LA 4HVNA 4HM1B 1AQZA 3I553 4DKIA 4GHOA 1JRQA 4HM0B 2HMOB 3JUNA 4X2OA 4NREA 1Q9EA 2C11A 5CK6A 5EEOA 1YI23 1UUGB 1N8QA 2H0IA 1VQN3 1EKMA 3IPTA 3RDEA 4HM3B 2OQEA 3VGNA 1STDA 3WODG 5AIGA 1YVBI 1MNLA 1W2B2 2CW9A 2A15A 3MSOA 4J8TA 1O7MB 3JUPA 1B2MA 2BHMA 2K54A 3G8ZA 4FMBA 3AGNA 5AEUB 4HOHA 4FCMA 3EN1B 4N6V0 1MWTA 2XH9A 3B4OA 1WMOA 3JVCA 5IEOA 1RRHA 2Y74A 3VF1A 3CCL3 4BL2A 3RNTA 1B2XA 1RGFA 3IMAB 1AY7A 3CCS3 2K3DA 3HIIA 5AIIA 1CH0A 3DMCA 2IY2A 3EX9A 1O7NB 2CFKA 1W6CA 3MYTA 5IG3A 2J8XB 2R4IA 4EC6A 5GSPA 3UJMA 3Q3FA 3F8XA 4XDVA 1LRAA 3OX9A 4BTWA 3PXMA 4HM4B 5CF1A 1FW7A 1LVNA 3LTDA 1FGQA 1FA3A 3G16A 1YJ93 1YGWA 1HYFA 2XEPA 4ZM8A 5AIFA 1FUWA 2OOVC 1MOLA 2V1LA 1DYUA 4XM4A 2FXTA 1N5HA 2Z77A 3FG3A 2IUJA 1KSIA 1OF5A 1BSEA 1TP6A 2AAEA 3GAXA 4O2HA 2OTL3 3DY5A 2AADA 2CHCA 5D81A 3FLJA 1SIIA 3I563 4KFFA 3MG1A 2XR8B 1EG9B 6GSPA 5LC6A 2Z76A 3CMA3 1W7CA 4AKYA 3EN8A 3OWSA 2BIRA 3X40A 1ASKA 4FMAA 4FR9A 1SJWA 3EB8A 1YIT3 3FG4A 1RNTA 4XBXA 1W2ZA 3LYGA 2D42A 2P09A 3X3XA 1D6UA 2JQ5A 4HM5B 1UI7A 1JKGA 4HAAA 3PCRA 4K1UA 1TRPA 3CCE3 1OCVA 1E3VA 2GU1A 3NV0A 1EA2A 2W9PA 4EV5A 1A67A 2XFSA 2CFDA 1LOVA 2GU3A 1RJOA 4BL3A 3EC9A 2STDA 1Q864 5IEPA 3CCU3 2CH9A 1Y4KA 4ORLA 1QMAA 2HMLB 1YGEA 1V57A 2D1WA 2W9QA 2F5MA 3RGAA 2OTJ3 1BOXA 2WOFA 4N6OB 1IVVA 1CEWI 2BU4A 2YX9A 3GZBA 5BIRA 5KP3A 1K28A 2KF3A 2IA7A 2UX0A 1K734 5D83A 3PCSA 3ROBA 1VQ73 1W4NA 3CC73 2WGOA 1WMPA 5HGRA 3WR2A 3WA3A 3SVAA 4MMZB 3LTCA 1LQGC 2XSOB 3NQZA 3FCSB 4XBTA 4EXRA 1RTUA 3D4AA 3DH2A 1R4CA 1RNBA 5M1AA 1BRJA 1ZGXA 1DE3A 2P0XA 1JBSA 1X1UA 2KF4A 1WMNA 2BMRB 1DVCA 1JNQA 1OH0A 1ZO2A 4FCJA 3CU3A 2Z6BA 1ROVA 1C54A 2RSXA 5AEWB 1FUSA 3URPA 1BSDA 1K8A4 1GD4A 1OHPA 1BNGA 3T8NA 1SARA 1WQLB 2GBWB 3E99A 1M904 5IW9A 1Q814 1Q42A 1QAFA 1BNEA 2CIUA 4J5GA 1FGRA 1RGGA 2SBLA 4BU4A 1LOXA 2L4VA 1BNFA 1GMPA 4HM7B 4BIRA 4BTYA 1RLSA 3H51A 4XBYA 1LXEA 4JRFA 3FF0A 2INXA 1YIJ3 2CWTA 1RSNA 4OK0A 2Q07A 1BRSA 2W6JH 3G0KA 5JPPA 3LTAA 1OUNA 2QGUA 3F40A 3RGRA 1X1YA 2F86B 3OV4A 1I0VA 4GB5A 3WOEB 1PU4A 4BTXA 4RZMA 2ML6A 2RGQA 1BSBA 2IUKA 3F9SA 1BNRA 1B2SA 1ZS7A 1HKXA 2F56A 4L7KA 3T8UA 1QVG2 1VQO3 4EYCA 4KFDA 1UUVB 1DMMA 1RCKA 3NUVA 3KSPA 5DREA 3FSDA 2Y73A 3WHOA 1N9EA 3ER7A 1DMQA 3SOAA 1W6GA 3D79A 2MC8A 5IENA 3MKIA 5FGOA 1FGMA 1CQSA 3K63A 4CPKA 1MGRA 3HK4A 1T2HA 1EQKA 2IMJA 5AI1A 4KVHA 1UUWB 2CKFB 3FH1A 1LNHA 1R4YA 4U13A 1VQK3 3S28A 1X1XA 4MMYB 1IK3A 1IV9A 2IYJA 1VQP3 2HOHA 3PYJA 1TRQA 1Q824 4G1MB 5JBSA 3NBRA 1IYYA 1FYSA 5AIHA 2BNGA 4HZ9B 3CD63 1LOWA 2B24B 1B3SA 4HM8B 1IDPA 1RRLA 4LMIA 7GSPA 1VZZA 1AV4A 1BNJA 1IVXA 4FCZA 1NB3I 2HMNB 4Q53A 1VQ63 1ZX2A 2RCDA 1GOUA 4RNYA 3CPW2 3LTBA 4EW5A 2PNCA 3QK9A 1B2UA 1TTOA 3CCM3 3NXJA 1W00A 4WWUC 5G1KA 1GYBA 1I2FA 1W6YA 4WP5A 1E97A 3BIRA 3I0YA 1LQMB 3OWYA 3LMLA 2ZL8A 2K0MA 3MG3A 3U1WA 2E2UA 2LYXA 3LZAA 5HOHA 2H0HA 1Q40B 7STDA 2W56B 2CC3A 3DGMA 1BANA 1BGSA 9RNTA 1BIRA 1IV7A 3OXAA 3TDGA 3G4S3 2P0MA 1EEJA 3FF2A 3FKAA 3S29A 1UI8A 3JUOA 3PGBA 1O7WB 3JUMA 1GY5A 2KF5A 5EQLA 4L8PA 5ELUA 3SLUA 1IVUA 1AR0A 2OCTA 4WFOA 4ILFA 3SYUA 5M18A 1RN7A 1JZDA 3K5TA 4HM2B 4J9AA 8RNTA 3NM2A 2CFLA 1FGOA 1QJGA 3CC43 1I3IA 2RNTA 4QWTA 1N9JA 7RNTA 3B4PA 4LZIA 5ELJA 4WYKB 3O8YA 5AYRB 1DMNA 1OHSA 1U5OA 4RNZA 1FZUA 1UCKA 3Q90A 1GMRA 3CME3 3ALAA 4RNTA 1S723 1TJDA 1OGXA 3MHEA 2P05A 1B21A 1IQXA 3DZLA 3EHCA 3U97A 2WGQA 1UDII 4STDA 5RNTA 5IF6A 4R9KA 1LNIA 1STFI 3WDGB 5BVBA 1I0XA 5AYSC 1UCLA 1CYVA 4H3UA 2O9UX 3UNLA 3CCQ3 2OWPA 2CX1A 2RFRA 1UGHI 1BSCA 2XSHB 4X2HA 1DETA 5LC7A 3GZYB 4CJNA 2GEXA 1Q7Y4 4HBRA 3FZWA 3NM7A 2F98A 2P38A 4MEIA 3CNXA 4HJLB 3CNMA 3BNEA 2UUGC 4KZ1A 1RMSA 1TUHA 3KSED 1B2ZA 4H61A 5DRVA 5EVHA 2O3OA 3J7Yd 3G6E3 2WOHA 1O7GB 1BNSA 3DXOA 2W04A 1JJ22 4HM6B 1OF5B 4EV2A 2F99A 1JB4A 3KN4A 3KIIA 1V74A 3PS8A 3VSYA 5IERA 2R41A 3DGYA 1AVKA 1NU3A 4HZBB 3WOFB 3LT9A 2BMQB 1GOVA 2C4BA 2HMJB 4AEQA 1BNIA 1WTHA 2GBXB 4R4KA 1VQM3 2CK3H 1RN4A 2E2TA 3H3HA 4IT7A 3NX0A 4K90B 5IG4A 2GEYA 3FG1A 1JN5B 3KCHA 3CC23 1BUQA 1QALA 1T5YA 8CHOA 1OACA 1BRKA 3HX8A 3LOYA 2M7OA 1TIJA 3NV0B 2E2VA 3CXC2 3NHXA 1FUTA 1VQ93 1JV2B 1ULJB 1KD14 2CG0A 1I3FA 3EE1A 5G1LA 3SOYA 3GSPA 3A76A 1UGIA 3A5EA 3MWZA 2JDIH 2Z7AA 1RGAA 3DGOA 3IJEB 3T0UA 2KRTA 4NHFA 3CCR3 2KF6A 3LT8A 2HMMB 3KZTA 4GSPA 2ZHXB 4I5QA 5CXOA 3ZFZA 2CX0A 3NQYA 5IG0A 2XFTA 3KE7A 3SX1A 1OPYA 1VQQA 4XB5A 3D5GA 3QRDA 2XF3A 4FMDA 1QAKA 1PY3A 1W02A 5IG5A 5M19A 1X1WA 1IU7A 1RDSA 1BRGA 4K61A 1I8VA 2YFJB 1K9M4 1GSPA 1U8CB 3SXXA 1UCIA 3Q2PA 4PEJA 1Q40A 1NO3A 1D6YA 1FGTA 2W56A 1Z1SA 1GD3A 5JPUA 1TU5A 3NBJA 1GOYA 1RN1A 5A0OB 2L1SA 3HOHA 1A90A 4HYZA 1TFKA 1G96A 4LSOA 1KC84 1RGCA 1W5ZA 3AMOB 1I2EA 1D6ZA 4N6NB 1VQL3 1SPUA 3WMDA 3BLZA
chains in the Genus database with same CATH topology
2MF7A 3SEDA 3F14A 2OOVA 1SIHA 3N9HA 1YJN3 4WYKA 3S67A 3KKGA 2OQEC 1S5AA 2CWVA 3D9RA 1O7HB 4HKVB 1J2BA 2CWUA 3GZRA 1JB5A 4MMXB 6STDA 3DGNA 4R1KA 3BNDA 1N5PA 3HZPA 4K1VA 2B1XB 3X3YA 4MJDA 3GZXB 4OVMA 3HIGA 3K0ZA 2KXGA 3CPOA 4N6MA 5STDA 3X41A 4CCVA 3EQQB 2W2CA 3FGYA 4GL6A 3JUQA 4WHAA 1M1K4 2QEX3 1VQ53 2BT3A 3CCV3 1ROAA 3BB9A 4FMCA 1CYUA 3LH4A 5CLKA 1C7HA 5I97A 3L0RA 1GY7A 1NB5I 1ISKA 2HMKB 1O7PB 3ECFA 3N54B 3V98A 1N8R4 2XRXB 4JF8A 1IQYA 1NDOB 4L8OA 4IPBA 2GXFA 1GS3A 5KP1A 3EBTA 2YFLB 3B7CA 4RBNA 5TGNA 5KP4A 2BO9B 2PZVA 1KQS2 3S5CA 2BMOB 4LEHA 1YHQ3 2CFGA 3X42A 1VQ43 1ULIB 2KCDA 2XGLA 3OW22 1A2VA 1JB2A 1JN5A 4LGQA 3EBYA 2W03A 4EBGA 3S27A 1RKYA 3F7XA 3K7CA 1IQ8A 3NBBA 3EF8A 4R80A 3D3LA 1YJW3 3HI7A 2LQVA 3EJVA 2I9WA 4N6TA 1IT7A 3KFQC 4O3VA 3GRDA 3B8LA 4KFEA 5FW5A 2ZDJA 2QA43 3M8CA 3CCJ3 1SQWA 1OGZA 2YFIB 3Q1CA 1M9GA 1IVWA 1QVF2 1IT8A 1DVDA 3UL5A 4N3VA 1M1XB 3V92A 4O8SA 1TFOA 3DUKA 3MPHA 1VQ83 3UB1A 3STDA 4IIAA 2XGNA 1W01A 1HU9A 1PFPA 4OUQA 2ML5A 4XDWA 3PZWA 3BNBA 1JKGB 2CFWA 3G713 2C10A 1WNHA 3X3ZA 1US1A 2CG1A 2FNQA 3F8HA 4CDLA 3DM8A 1A2KA 4O02B 4AKZA 3AMOA 3GWRA 1UW1A 3WA2X 5BXQA 5CF2A 2WO0A 3DGLA 3F7SA 1KWIA 4R9LA 1NJI4 2FGTA 5G2GA 4TX4A 1OHOA 1E3RA 2QIYA 3OWUA 3K9MC 1L5GB 3MG2A 1F8NA 3V99A 2W0QA 3N8BA 1K41A 1NWWA 3UL6A 1GY6A 3LXUX 4N6UA 3BNCA 4I4KA 1AVLA 5D82A 4N6LA 4HVNA 4HM1B 3I553 1JRQA 4HM0B 2HMOB 3JUNA 4X2OA 4NREA 2C11A 5CK6A 1YI23 5EEOA 1N8QA 1VQN3 1EKMA 3IPTA 3RDEA 4HM3B 2OQEA 3VGNA 1STDA 3WODG 5AIGA 1YVBI 1MNLA 1W2B2 2CW9A 2A15A 3MSOA 4J8TA 1O7MB 3JUPA 2BHMA 2K54A 3G8ZA 4FMBA 5AEUB 4FCMA 3EN1B 4N6V0 2XH9A 3B4OA 5IEOA 1WMOA 3JVCA 1RRHA 2Y74A 3VF1A 3CCL3 3IMAB 3CCS3 3HIIA 5AIIA 3DMCA 3EX9A 1O7NB 2CFKA 1W6CA 3MYTA 5IG3A 2R4IA 4EC6A 3UJMA 3F8XA 4XDVA 3OX9A 4BTWA 3PXMA 4HM4B 5CF1A 1LVNA 3LTDA 1FGQA 1FA3A 3G16A 1YJ93 2XEPA 4ZM8A 5AIFA 1FUWA 2OOVC 1MOLA 2V1LA 1DYUA 4XM4A 2FXTA 1N5HA 2Z77A 3FG3A 2IUJA 1KSIA 1OF5A 1TP6A 4O2HA 3GAXA 2OTL3 3DY5A 2CHCA 5D81A 3FLJA 1SIIA 3I563 4KFFA 3MG1A 2XR8B 1EG9B 5LC6A 2Z76A 3CMA3 1W7CA 4AKYA 3EN8A 3OWSA 3X40A 1ASKA 4FMAA 4FR9A 1SJWA 3EB8A 1YIT3 3FG4A 4XBXA 1W2ZA 3LYGA 2D42A 2P09A 3X3XA 1D6UA 2JQ5A 4HM5B 1JKGA 1UI7A 4K1UA 3PCRA 3CCE3 1OCVA 1E3VA 2GU1A 3NV0A 1EA2A 2W9PA 4EV5A 1A67A 2XFSA 2CFDA 2GU3A 1RJOA 3EC9A 2STDA 1Q864 5IEPA 3CCU3 2CH9A 1Y4KA 4ORLA 1QMAA 2HMLB 1YGEA 3RGAA 2D1WA 2W9QA 2OTJ3 2WOFA 4N6OB 1IVVA 1CEWI 2YX9A 3GZBA 5KP3A 1K28A 1K734 2IA7A 2UX0A 5D83A 3PCSA 3ROBA 1VQ73 1W4NA 3CC73 2WGOA 1WMPA 5HGRA 3WA3A 3SVAA 4MMZB 3LTCA 2XSOB 3NQZA 3FCSB 4XBTA 4EXRA 1R4CA 2P0XA 1WMNA 2BMRB 1DVCA 1JNQA 1OH0A 1ZO2A 4FCJA 3CU3A 2Z6BA 1ROVA 2RSXA 5AEWB 1K8A4 1GD4A 1OHPA 3T8NA 1WQLB 2GBWB 3E99A 1M904 5IW9A 1Q814 1Q42A 1QAFA 2CIUA 1FGRA 2SBLA 1LOXA 2L4VA 4HM7B 4BTYA 3H51A 4XBYA 1LXEA 4JRFA 3FF0A 2INXA 1YIJ3 2CWTA 4OK0A 2Q07A 3G0KA 2W6JH 5JPPA 3LTAA 1OUNA 2QGUA 3F40A 3RGRA 2F86B 3OV4A 4GB5A 3WOEB 1PU4A 4BTXA 4RZMA 2ML6A 2RGQA 2IUKA 3F9SA 1HKXA 4L7KA 3T8UA 1QVG2 1VQO3 4EYCA 4KFDA 1UUVB 1DMMA 3NUVA 3KSPA 5DREA 3FSDA 2Y73A 1N9EA 3ER7A 1DMQA 3SOAA 1W6GA 2MC8A 5IENA 3MKIA 5FGOA 1FGMA 1CQSA 3K63A 3HK4A 1EQKA 2IMJA 5AI1A 4KVHA 1UUWB 2CKFB 3FH1A 1LNHA 4U13A 1VQK3 3S28A 4MMYB 1IK3A 1IV9A 1VQP3 3PYJA 1Q824 4G1MB 5JBSA 3NBRA 5AIHA 2BNGA 4HZ9B 3CD63 2B24B 4HM8B 1IDPA 1RRLA 4LMIA 1VZZA 1AV4A 1IVXA 4FCZA 1NB3I 2HMNB 4Q53A 1VQ63 1ZX2A 2RCDA 4RNYA 3CPW2 3LTBA 2PNCA 3QK9A 3CCM3 3NXJA 1W00A 4WWUC 1GYBA 1W6YA 4WP5A 1E97A 3I0YA 3OWYA 3LMLA 2ZL8A 2K0MA 3MG3A 3U1WA 2E2UA 2LYXA 3LZAA 1Q40B 7STDA 2W56B 2CC3A 3DGMA 1IV7A 3G4S3 3OXAA 3TDGA 2P0MA 3FF2A 3FKAA 3S29A 1UI8A 3JUOA 3PGBA 1O7WB 3JUMA 1GY5A 5EQLA 4L8PA 5ELUA 3SLUA 1IVUA 1AR0A 2OCTA 4WFOA 1RN7A 3K5TA 4HM2B 4J9AA 3NM2A 2CFLA 1FGOA 1QJGA 3CC43 4QWTA 1N9JA 3B4PA 4LZIA 5ELJA 4WYKB 3O8YA 5AYRB 1DMNA 1OHSA 1U5OA 4RNZA 3Q90A 3CME3 3ALAA 1S723 1OGXA 3MHEA 2P05A 3DZLA 1IQXA 3EHCA 3U97A 2WGQA 4STDA 5IF6A 4R9KA 1STFI 3WDGB 5BVBA 5AYSC 4H3UA 1CYVA 2O9UX 3UNLA 3CCQ3 2OWPA 2RFRA 2XSHB 4X2HA 5LC7A 3GZYB 1Q7Y4 2GEXA 4HBRA 3FZWA 3NM7A 2F98A 2P38A 4MEIA 3CNXA 4HJLB 3CNMA 3BNEA 4KZ1A 5DRVA 1TUHA 3KSED 4H61A 5EVHA 3J7Yd 1JJ22 2O3OA 3G6E3 2WOHA 1O7GB 3DXOA 2W04A 4HM6B 1OF5B 4EV2A 2F99A 1JB4A 3KN4A 3KIIA 1V74A 3PS8A 3VSYA 5IERA 1AVKA 1NU3A 4HZBB 3WOFB 3LT9A 2BMQB 2HMJB 4AEQA 1WTHA 2GBXB 4R4KA 1VQM3 2CK3H 3H3HA 2E2TA 4IT7A 3NX0A 4K90B 5IG4A 2GEYA 3FG1A 1JN5B 3CC23 1BUQA 1QALA 1T5YA 8CHOA 1OACA 3HX8A 3LOYA 2M7OA 1TIJA 3NV0B 2E2VA 3CXC2 3NHXA 1VQ93 1JV2B 1ULJB 1KD14 2CG0A 3EE1A 3SOYA 3A76A 3MWZA 2JDIH 2Z7AA 3DGOA 3IJEB 3T0UA 2KRTA 4NHFA 3CCR3 3LT8A 2HMMB 3KZTA 5CXOA 3NQYA 5IG0A 2XFTA 3KE7A 3SX1A 1OPYA 4XB5A 3QRDA 2XF3A 4FMDA 1QAKA 5IG5A 1W02A 1IU7A 4K61A 2YFJB 1K9M4 1U8CB 3SXXA 3Q2PA 4PEJA 1Q40A 1NO3A 1D6YA 1FGTA 2W56A 1Z1SA 1GD3A 5JPUA 1TU5A 3NBJA 5A0OB 1A90A 4HYZA 1TFKA 1G96A 4LSOA 1KC84 1W5ZA 3AMOB 1D6ZA 4N6NB 1VQL3 1SPUA 3WMDA 3BLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX4 A;  1RN7 A;  3SVA A;  3K9M C;  3S67 A;  1N9J A;  1R4C A;  4LZI A;  5ELJ A;  3UL6 A;  1DVC A;  1N5P A;  4N6U A;  4N6L A;  1GD4 A;  2KXG A;  4N6M A;  4CCV A;  1STF I;  1CYV A;  1ROA A;  2O9U X;  1YVB I;  1MNL A;  1CYU A;  1LXE A;  3LH4 A;  5LC7 A;  3L0R A;  1NB5 I;  4N6V 0;  3KSE D;  3IMA B;  4EYC A;  2BO9 B;  3PS8 A;  3PXM A;  1EQK A;  4IT7 A;  3NX0 A;  1FA3 A;  4ZM8 A;  1FUW A;  1IV9 A;  1MOL A;  3PYJ A;  1TIJ A;  1N5H A;  3GAX A;  4N6T A;  3KFQ C;  3MWZ A;  1NB3 I;  5LC6 A;  1M9G A;  1DVD A;  3UL5 A;  3QRD A;  1PFP A;  2W9P A;  1A67 A;  3Q2P A;  1WNH A;  1GD3 A;  2CH9 A;  5A0O B;  1A90 A;  2W9Q A;  1IV7 A;  1G96 A;  4N6O B;  1CEW I;  5EQL A;  1KWI A;  5ELU A;  4N6N B;  2OCT A; 
#chains in the Genus database with same CATH topology
 2MF7 A;  3SED A;  3F14 A;  2OOV A;  1SIH A;  3N9H A;  1MWR A;  1YJN 3;  4WYK A;  3S67 A;  3ZG0 A;  3KKG A;  2OQE C;  1S5A A;  1BRN L;  2CWV A;  3D9R A;  1O7H B;  4HKV B;  3BU4 A;  2CWU A;  3GZR A;  1JB5 A;  4MMX B;  1J2B A;  6STD A;  3DGN A;  4R1K A;  1YNV X;  4LYL B;  3BND A;  1N5P A;  3HZP A;  2F4Y A;  4K1V A;  2B1X B;  3X3Y A;  1RGK A;  4MJD A;  3GZX B;  4OVM A;  1I2G A;  3HIG A;  3K0Z A;  2KXG A;  1T2I A;  3CPO A;  4N6M A;  1BRI A;  5STD A;  3X41 A;  4CCV A;  3EQQ B;  1GMQ A;  2W2C A;  3FGY A;  1Q7H A;  3JUQ A;  4GL6 A;  4WHA A;  1YVS A;  2QEX 3;  1M1K 4;  1VQ5 3;  2BT3 A;  3CCV 3;  1ROA A;  3BB9 A;  4FMC A;  1CYU A;  1PYL A;  3LH4 A;  5CLK A;  2ZA4 A;  1C7H A;  3AHS A;  6RNT A;  5I97 A;  3L0R A;  1RGL A;  1GY7 A;  1NB5 I;  1ISK A;  2HMK B;  1O7P B;  3ECF A;  3N54 B;  1I70 A;  3V98 A;  1N8R 4;  2XRX B;  1EUI C;  4JF8 A;  1IQY A;  1NDO B;  4L8O A;  4J5K A;  1MWU A;  4IPB A;  2GXF A;  1LOY A;  1GS3 A;  5BU4 A;  5KP1 A;  3EBT A;  2YFL B;  3B7C A;  4RBN A;  5TGN A;  5KP4 A;  2BO9 B;  2PZV A;  1BU4 A;  1JBT A;  1KQS 2;  1BAO A;  2BMO B;  4LEH A;  3S5C A;  2CFG A;  3X42 A;  1YHQ 3;  1ULI B;  2KCD A;  1VQ4 3;  2XGL A;  3OW2 2;  3ZG5 A;  1A2V A;  1B20 A;  1JB2 A;  1JN5 A;  4LGQ A;  3EBY A;  2W03 A;  4EBG A;  3S27 A;  1RKY A;  3F7X A;  1B27 A;  3K7C A;  1IQ8 A;  3NBB A;  3EF8 A;  4R80 A;  1BUJ A;  3D3L A;  1YJW 3;  3HI7 A;  2KAA A;  2LQV A;  3EJV A;  2I9W A;  1NNV A;  4N6T A;  3AGO A;  1IT7 A;  3KFQ C;  1BRH A;  3GRD A;  4O3V A;  3B8L A;  2GSP A;  4KFE A;  5FW5 A;  2ZDJ A;  2QA4 3;  1T3B A;  3M8C A;  3CCJ 3;  1SQW A;  1OGZ A;  1MWS A;  2YFI B;  3Q1C A;  1M9G A;  1IVW A;  1QVF 2;  1IT8 A;  1DVD A;  1G02 A;  3UL5 A;  4KT3 B;  4N3V A;  1M1X B;  3V92 A;  4O8S A;  1TFO A;  3DUK A;  3MPH A;  1VQ8 3;  3UB1 A;  3STD A;  1UCJ A;  4IIA A;  2XGN A;  1JBR A;  1JZO A;  1W01 A;  1HU9 A;  1PFP A;  2UGI A;  4OUQ A;  1HZ1 A;  2ML5 A;  4XDW A;  1BVI A;  3PZW A;  1BSA A;  1JKG B;  3BNB A;  3D5I A;  2CFW A;  3G71 3;  1RGE A;  2C10 A;  1WNH A;  3X3Z A;  1US1 A;  2SAR A;  2CG1 A;  2FNQ A;  2RBI A;  3F8H A;  1A2P A;  4CDL A;  3DM8 A;  1A2K A;  1G0T A;  4O02 B;  4AKZ A;  3AMO A;  3GWR A;  1UW1 A;  3WA2 X;  5BXQ A;  2F5W A;  5CF2 A;  2WO0 A;  3DGL A;  3AHW A;  3F7S A;  1KWI A;  4R9L A;  1NJI 4;  2FGT A;  5G2G A;  1V58 A;  2H0G A;  4TX4 A;  1OHO A;  1E3R A;  2QIY A;  3OWU A;  1MGW A;  3K9M C;  1L5G B;  3MG2 A;  1RHL A;  1F8N A;  3V99 A;  2W0Q A;  3N8B A;  1K41 A;  1NWW A;  3UL6 A;  4NPB A;  1GY6 A;  3LXU X;  4N6U A;  3BNC A;  1RCL A;  4I4K A;  1AVL A;  5D82 A;  1RGH A;  4N6L A;  4HVN A;  4HM1 B;  1AQZ A;  3I55 3;  4DKI A;  4GHO A;  1JRQ A;  4HM0 B;  2HMO B;  3JUN A;  4X2O A;  4NRE A;  1Q9E A;  2C11 A;  5CK6 A;  5EEO A;  1YI2 3;  1UUG B;  1N8Q A;  2H0I A;  1VQN 3;  1EKM A;  3IPT A;  3RDE A;  4HM3 B;  2OQE A;  3VGN A;  1STD A;  3WOD G;  5AIG A;  1YVB I;  1MNL A;  1W2B 2;  2CW9 A;  2A15 A;  3MSO A;  4J8T A;  1O7M B;  3JUP A;  1B2M A;  2BHM A;  2K54 A;  3G8Z A;  4FMB A;  3AGN A;  5AEU B;  4HOH A;  4FCM A;  3EN1 B;  4N6V 0;  1MWT A;  2XH9 A;  3B4O A;  1WMO A;  3JVC A;  5IEO A;  1RRH A;  2Y74 A;  3VF1 A;  3CCL 3;  4BL2 A;  3RNT A;  1B2X A;  1RGF A;  3IMA B;  1AY7 A;  3CCS 3;  2K3D A;  3HII A;  5AII A;  1CH0 A;  3DMC A;  2IY2 A;  3EX9 A;  1O7N B;  2CFK A;  1W6C A;  3MYT A;  5IG3 A;  2J8X B;  2R4I A;  4EC6 A;  5GSP A;  3UJM A;  3Q3F A;  3F8X A;  4XDV A;  1LRA A;  3OX9 A;  4BTW A;  3PXM A;  4HM4 B;  5CF1 A;  1FW7 A;  1LVN A;  3LTD A;  1FGQ A;  1FA3 A;  3G16 A;  1YJ9 3;  1YGW A;  1HYF A;  2XEP A;  4ZM8 A;  5AIF A;  1FUW A;  2OOV C;  1MOL A;  2V1L A;  1DYU A;  4XM4 A;  2FXT A;  1N5H A;  2Z77 A;  3FG3 A;  2IUJ A;  1KSI A;  1OF5 A;  1BSE A;  1TP6 A;  2AAE A;  3GAX A;  4O2H A;  2OTL 3;  3DY5 A;  2AAD A;  2CHC A;  5D81 A;  3FLJ A;  1SII A;  3I56 3;  4KFF A;  3MG1 A;  2XR8 B;  1EG9 B;  6GSP A;  5LC6 A;  2Z76 A;  3CMA 3;  1W7C A;  4AKY A;  3EN8 A;  3OWS A;  2BIR A;  3X40 A;  1ASK A;  4FMA A;  4FR9 A;  1SJW A;  3EB8 A;  1YIT 3;  3FG4 A;  1RNT A;  4XBX A;  1W2Z A;  3LYG A;  2D42 A;  2P09 A;  3X3X A;  1D6U A;  2JQ5 A;  4HM5 B;  1UI7 A;  1JKG A;  4HAA A;  3PCR A;  4K1U A;  1TRP A;  3CCE 3;  1OCV A;  1E3V A;  2GU1 A;  3NV0 A;  1EA2 A;  2W9P A;  4EV5 A;  1A67 A;  2XFS A;  2CFD A;  1LOV A;  2GU3 A;  1RJO A;  4BL3 A;  3EC9 A;  2STD A;  1Q86 4;  5IEP A;  3CCU 3;  2CH9 A;  1Y4K A;  4ORL A;  1QMA A;  2HML B;  1YGE A;  1V57 A;  2D1W A;  2W9Q A;  2F5M A;  3RGA A;  2OTJ 3;  1BOX A;  2WOF A;  4N6O B;  1IVV A;  1CEW I;  2BU4 A;  2YX9 A;  3GZB A;  5BIR A;  5KP3 A;  1K28 A;  2KF3 A;  2IA7 A;  2UX0 A;  1K73 4;  5D83 A;  3PCS A;  3ROB A;  1VQ7 3;  1W4N A;  3CC7 3;  2WGO A;  1WMP A;  5HGR A;  3WR2 A;  3WA3 A;  3SVA A;  4MMZ B;  3LTC A;  1LQG C;  2XSO B;  3NQZ A;  3FCS B;  4XBT A;  4EXR A;  1RTU A;  3D4A A;  3DH2 A;  1R4C A;  1RNB A;  5M1A A;  1BRJ A;  1ZGX A;  1DE3 A;  2P0X A;  1JBS A;  1X1U A;  2KF4 A;  1WMN A;  2BMR B;  1DVC A;  1JNQ A;  1OH0 A;  1ZO2 A;  4FCJ A;  3CU3 A;  2Z6B A;  1ROV A;  1C54 A;  2RSX A;  5AEW B;  1FUS A;  3URP A;  1BSD A;  1K8A 4;  1GD4 A;  1OHP A;  1BNG A;  3T8N A;  1SAR A;  1WQL B;  2GBW B;  3E99 A;  1M90 4;  5IW9 A;  1Q81 4;  1Q42 A;  1QAF A;  1BNE A;  2CIU A;  4J5G A;  1FGR A;  1RGG A;  2SBL A;  4BU4 A;  1LOX A;  2L4V A;  1BNF A;  1GMP A;  4HM7 B;  4BIR A;  4BTY A;  1RLS A;  3H51 A;  4XBY A;  1LXE A;  4JRF A;  3FF0 A;  2INX A;  1YIJ 3;  2CWT A;  1RSN A;  4OK0 A;  2Q07 A;  1BRS A;  2W6J H;  3G0K A;  5JPP A;  3LTA A;  1OUN A;  2QGU A;  3F40 A;  3RGR A;  1X1Y A;  2F86 B;  3OV4 A;  1I0V A;  4GB5 A;  3WOE B;  1PU4 A;  4BTX A;  4RZM A;  2ML6 A;  2RGQ A;  1BSB A;  2IUK A;  3F9S A;  1BNR A;  1B2S A;  1ZS7 A;  1HKX A;  2F56 A;  4L7K A;  3T8U A;  1QVG 2;  1VQO 3;  4EYC A;  4KFD A;  1UUV B;  1DMM A;  1RCK A;  3NUV A;  3KSP A;  5DRE A;  3FSD A;  2Y73 A;  3WHO A;  1N9E A;  3ER7 A;  1DMQ A;  3SOA A;  1W6G A;  3D79 A;  2MC8 A;  5IEN A;  3MKI A;  5FGO A;  1FGM A;  1CQS A;  3K63 A;  4CPK A;  1MGR A;  3HK4 A;  1T2H A;  1EQK A;  2IMJ A;  5AI1 A;  4KVH A;  1UUW B;  2CKF B;  3FH1 A;  1LNH A;  1R4Y A;  4U13 A;  1VQK 3;  3S28 A;  1X1X A;  4MMY B;  1IK3 A;  1IV9 A;  2IYJ A;  1VQP 3;  2HOH A;  3PYJ A;  1TRQ A;  1Q82 4;  4G1M B;  5JBS A;  3NBR A;  1IYY A;  1FYS A;  5AIH A;  2BNG A;  4HZ9 B;  3CD6 3;  1LOW A;  2B24 B;  1B3S A;  4HM8 B;  1IDP A;  1RRL A;  4LMI A;  7GSP A;  1VZZ A;  1AV4 A;  1BNJ A;  1IVX A;  4FCZ A;  1NB3 I;  2HMN B;  4Q53 A;  1VQ6 3;  1ZX2 A;  2RCD A;  1GOU A;  4RNY A;  3CPW 2;  3LTB A;  4EW5 A;  2PNC A;  3QK9 A;  1B2U A;  1TTO A;  3CCM 3;  3NXJ A;  1W00 A;  4WWU C;  5G1K A;  1GYB A;  1I2F A;  1W6Y A;  4WP5 A;  1E97 A;  3BIR A;  3I0Y A;  1LQM B;  3OWY A;  3LML A;  2ZL8 A;  2K0M A;  3MG3 A;  3U1W A;  2E2U A;  2LYX A;  3LZA A;  5HOH A;  2H0H A;  1Q40 B;  7STD A;  2W56 B;  2CC3 A;  3DGM A;  1BAN A;  1BGS A;  9RNT A;  1BIR A;  1IV7 A;  3OXA A;  3TDG A;  3G4S 3;  2P0M A;  1EEJ A;  3FF2 A;  3FKA A;  3S29 A;  1UI8 A;  3JUO A;  3PGB A;  1O7W B;  3JUM A;  1GY5 A;  2KF5 A;  5EQL A;  4L8P A;  5ELU A;  3SLU A;  1IVU A;  1AR0 A;  2OCT A;  4WFO A;  4ILF A;  3SYU A;  5M18 A;  1RN7 A;  1JZD A;  3K5T A;  4HM2 B;  4J9A A;  8RNT A;  3NM2 A;  2CFL A;  1FGO A;  1QJG A;  3CC4 3;  1I3I A;  2RNT A;  4QWT A;  1N9J A;  7RNT A;  3B4P A;  4LZI A;  5ELJ A;  4WYK B;  3O8Y A;  5AYR B;  1DMN A;  1OHS A;  1U5O A;  4RNZ A;  1FZU A;  1UCK A;  3Q90 A;  1GMR A;  3CME 3;  3ALA A;  4RNT A;  1S72 3;  1TJD A;  1OGX A;  3MHE A;  2P05 A;  1B21 A;  1IQX A;  3DZL A;  3EHC A;  3U97 A;  2WGQ A;  1UDI I;  4STD A;  5RNT A;  5IF6 A;  4R9K A;  1LNI A;  1STF I;  3WDG B;  5BVB A;  1I0X A;  5AYS C;  1UCL A;  1CYV A;  4H3U A;  2O9U X;  3UNL A;  3CCQ 3;  2OWP A;  2CX1 A;  2RFR A;  1UGH I;  1BSC A;  2XSH B;  4X2H A;  1DET A;  5LC7 A;  3GZY B;  4CJN A;  2GEX A;  1Q7Y 4;  4HBR A;  3FZW A;  3NM7 A;  2F98 A;  2P38 A;  4MEI A;  3CNX A;  4HJL B;  3CNM A;  3BNE A;  2UUG C;  4KZ1 A;  1RMS A;  1TUH A;  3KSE D;  1B2Z A;  4H61 A;  5DRV A;  5EVH A;  2O3O A;  3J7Y d;  3G6E 3;  2WOH A;  1O7G B;  1BNS A;  3DXO A;  2W04 A;  1JJ2 2;  4HM6 B;  1OF5 B;  4EV2 A;  2F99 A;  1JB4 A;  3KN4 A;  3KII A;  1V74 A;  3PS8 A;  3VSY A;  5IER A;  2R41 A;  3DGY A;  1AVK A;  1NU3 A;  4HZB B;  3WOF B;  3LT9 A;  2BMQ B;  1GOV A;  2C4B A;  2HMJ B;  4AEQ A;  1BNI A;  1WTH A;  2GBX B;  4R4K A;  1VQM 3;  2CK3 H;  1RN4 A;  2E2T A;  3H3H A;  4IT7 A;  3NX0 A;  4K90 B;  5IG4 A;  2GEY A;  3FG1 A;  1JN5 B;  3KCH A;  3CC2 3;  1BUQ A;  1QAL A;  1T5Y A;  8CHO A;  1OAC A;  1BRK A;  3HX8 A;  3LOY A;  2M7O A;  1TIJ A;  3NV0 B;  2E2V A;  3CXC 2;  3NHX A;  1FUT A;  1VQ9 3;  1JV2 B;  1ULJ B;  1KD1 4;  2CG0 A;  1I3F A;  3EE1 A;  5G1L A;  3SOY A;  3GSP A;  3A76 A;  1UGI A;  3A5E A;  3MWZ A;  2JDI H;  2Z7A A;  1RGA A;  3DGO A;  3IJE B;  3T0U A;  2KRT A;  4NHF A;  3CCR 3;  2KF6 A;  3LT8 A;  2HMM B;  3KZT A;  4GSP A;  2ZHX B;  4I5Q A;  5CXO A;  3ZFZ A;  2CX0 A;  3NQY A;  5IG0 A;  2XFT A;  3KE7 A;  3SX1 A;  1OPY A;  1VQQ A;  4XB5 A;  3D5G A;  3QRD A;  2XF3 A;  4FMD A;  1QAK A;  1PY3 A;  1W02 A;  5IG5 A;  5M19 A;  1X1W A;  1IU7 A;  1RDS A;  1BRG A;  4K61 A;  1I8V A;  2YFJ B;  1K9M 4;  1GSP A;  1U8C B;  3SXX A;  1UCI A;  3Q2P A;  4PEJ A;  1Q40 A;  1NO3 A;  1D6Y A;  1FGT A;  2W56 A;  1Z1S A;  1GD3 A;  5JPU A;  1TU5 A;  3NBJ A;  1GOY A;  1RN1 A;  5A0O B;  2L1S A;  3HOH A;  1A90 A;  4HYZ A;  1TFK A;  1G96 A;  4LSO A;  1KC8 4;  1RGC A;  1W5Z A;  3AMO B;  1I2E A;  1D6Z A;  4N6N B;  1VQL 3;  1SPU A;  3WMD A;  3BLZ A; 
#chains in the Genus database with same CATH homology
 2MF7 A;  3SED A;  3F14 A;  2OOV A;  1SIH A;  3N9H A;  1YJN 3;  4WYK A;  3S67 A;  3KKG A;  2OQE C;  1S5A A;  2CWV A;  3D9R A;  1O7H B;  4HKV B;  1J2B A;  2CWU A;  3GZR A;  1JB5 A;  4MMX B;  6STD A;  3DGN A;  4R1K A;  3BND A;  1N5P A;  3HZP A;  4K1V A;  2B1X B;  3X3Y A;  4MJD A;  3GZX B;  4OVM A;  3HIG A;  3K0Z A;  2KXG A;  3CPO A;  4N6M A;  5STD A;  3X41 A;  4CCV A;  3EQQ B;  2W2C A;  3FGY A;  4GL6 A;  3JUQ A;  4WHA A;  1M1K 4;  2QEX 3;  1VQ5 3;  2BT3 A;  3CCV 3;  1ROA A;  3BB9 A;  4FMC A;  1CYU A;  3LH4 A;  5CLK A;  1C7H A;  5I97 A;  3L0R A;  1GY7 A;  1NB5 I;  1ISK A;  2HMK B;  1O7P B;  3ECF A;  3N54 B;  3V98 A;  1N8R 4;  2XRX B;  4JF8 A;  1IQY A;  1NDO B;  4L8O A;  4IPB A;  2GXF A;  1GS3 A;  5KP1 A;  3EBT A;  2YFL B;  3B7C A;  4RBN A;  5TGN A;  5KP4 A;  2BO9 B;  2PZV A;  1KQS 2;  3S5C A;  2BMO B;  4LEH A;  1YHQ 3;  2CFG A;  3X42 A;  1VQ4 3;  1ULI B;  2KCD A;  2XGL A;  3OW2 2;  1A2V A;  1JB2 A;  1JN5 A;  4LGQ A;  3EBY A;  2W03 A;  4EBG A;  3S27 A;  1RKY A;  3F7X A;  3K7C A;  1IQ8 A;  3NBB A;  3EF8 A;  4R80 A;  3D3L A;  1YJW 3;  3HI7 A;  2LQV A;  3EJV A;  2I9W A;  4N6T A;  1IT7 A;  3KFQ C;  4O3V A;  3GRD A;  3B8L A;  4KFE A;  5FW5 A;  2ZDJ A;  2QA4 3;  3M8C A;  3CCJ 3;  1SQW A;  1OGZ A;  2YFI B;  3Q1C A;  1M9G A;  1IVW A;  1QVF 2;  1IT8 A;  1DVD A;  3UL5 A;  4N3V A;  1M1X B;  3V92 A;  4O8S A;  1TFO A;  3DUK A;  3MPH A;  1VQ8 3;  3UB1 A;  3STD A;  4IIA A;  2XGN A;  1W01 A;  1HU9 A;  1PFP A;  4OUQ A;  2ML5 A;  4XDW A;  3PZW A;  3BNB A;  1JKG B;  2CFW A;  3G71 3;  2C10 A;  1WNH A;  3X3Z A;  1US1 A;  2CG1 A;  2FNQ A;  3F8H A;  4CDL A;  3DM8 A;  1A2K A;  4O02 B;  4AKZ A;  3AMO A;  3GWR A;  1UW1 A;  3WA2 X;  5BXQ A;  5CF2 A;  2WO0 A;  3DGL A;  3F7S A;  1KWI A;  4R9L A;  1NJI 4;  2FGT A;  5G2G A;  4TX4 A;  1OHO A;  1E3R A;  2QIY A;  3OWU A;  3K9M C;  1L5G B;  3MG2 A;  1F8N A;  3V99 A;  2W0Q A;  3N8B A;  1K41 A;  1NWW A;  3UL6 A;  1GY6 A;  3LXU X;  4N6U A;  3BNC A;  4I4K A;  1AVL A;  5D82 A;  4N6L A;  4HVN A;  4HM1 B;  3I55 3;  1JRQ A;  4HM0 B;  2HMO B;  3JUN A;  4X2O A;  4NRE A;  2C11 A;  5CK6 A;  1YI2 3;  5EEO A;  1N8Q A;  1VQN 3;  1EKM A;  3IPT A;  3RDE A;  4HM3 B;  2OQE A;  3VGN A;  1STD A;  3WOD G;  5AIG A;  1YVB I;  1MNL A;  1W2B 2;  2CW9 A;  2A15 A;  3MSO A;  4J8T A;  1O7M B;  3JUP A;  2BHM A;  2K54 A;  3G8Z A;  4FMB A;  5AEU B;  4FCM A;  3EN1 B;  4N6V 0;  2XH9 A;  3B4O A;  5IEO A;  1WMO A;  3JVC A;  1RRH A;  2Y74 A;  3VF1 A;  3CCL 3;  3IMA B;  3CCS 3;  3HII A;  5AII A;  3DMC A;  3EX9 A;  1O7N B;  2CFK A;  1W6C A;  3MYT A;  5IG3 A;  2R4I A;  4EC6 A;  3UJM A;  3F8X A;  4XDV A;  3OX9 A;  4BTW A;  3PXM A;  4HM4 B;  5CF1 A;  1LVN A;  3LTD A;  1FGQ A;  1FA3 A;  3G16 A;  1YJ9 3;  2XEP A;  4ZM8 A;  5AIF A;  1FUW A;  2OOV C;  1MOL A;  2V1L A;  1DYU A;  4XM4 A;  2FXT A;  1N5H A;  2Z77 A;  3FG3 A;  2IUJ A;  1KSI A;  1OF5 A;  1TP6 A;  4O2H A;  3GAX A;  2OTL 3;  3DY5 A;  2CHC A;  5D81 A;  3FLJ A;  1SII A;  3I56 3;  4KFF A;  3MG1 A;  2XR8 B;  1EG9 B;  5LC6 A;  2Z76 A;  3CMA 3;  1W7C A;  4AKY A;  3EN8 A;  3OWS A;  3X40 A;  1ASK A;  4FMA A;  4FR9 A;  1SJW A;  3EB8 A;  1YIT 3;  3FG4 A;  4XBX A;  1W2Z A;  3LYG A;  2D42 A;  2P09 A;  3X3X A;  1D6U A;  2JQ5 A;  4HM5 B;  1JKG A;  1UI7 A;  4K1U A;  3PCR A;  3CCE 3;  1OCV A;  1E3V A;  2GU1 A;  3NV0 A;  1EA2 A;  2W9P A;  4EV5 A;  1A67 A;  2XFS A;  2CFD A;  2GU3 A;  1RJO A;  3EC9 A;  2STD A;  1Q86 4;  5IEP A;  3CCU 3;  2CH9 A;  1Y4K A;  4ORL A;  1QMA A;  2HML B;  1YGE A;  3RGA A;  2D1W A;  2W9Q A;  2OTJ 3;  2WOF A;  4N6O B;  1IVV A;  1CEW I;  2YX9 A;  3GZB A;  5KP3 A;  1K28 A;  1K73 4;  2IA7 A;  2UX0 A;  5D83 A;  3PCS A;  3ROB A;  1VQ7 3;  1W4N A;  3CC7 3;  2WGO A;  1WMP A;  5HGR A;  3WA3 A;  3SVA A;  4MMZ B;  3LTC A;  2XSO B;  3NQZ A;  3FCS B;  4XBT A;  4EXR A;  1R4C A;  2P0X A;  1WMN A;  2BMR B;  1DVC A;  1JNQ A;  1OH0 A;  1ZO2 A;  4FCJ A;  3CU3 A;  2Z6B A;  1ROV A;  2RSX A;  5AEW B;  1K8A 4;  1GD4 A;  1OHP A;  3T8N A;  1WQL B;  2GBW B;  3E99 A;  1M90 4;  5IW9 A;  1Q81 4;  1Q42 A;  1QAF A;  2CIU A;  1FGR A;  2SBL A;  1LOX A;  2L4V A;  4HM7 B;  4BTY A;  3H51 A;  4XBY A;  1LXE A;  4JRF A;  3FF0 A;  2INX A;  1YIJ 3;  2CWT A;  4OK0 A;  2Q07 A;  3G0K A;  2W6J H;  5JPP A;  3LTA A;  1OUN A;  2QGU A;  3F40 A;  3RGR A;  2F86 B;  3OV4 A;  4GB5 A;  3WOE B;  1PU4 A;  4BTX A;  4RZM A;  2ML6 A;  2RGQ A;  2IUK A;  3F9S A;  1HKX A;  4L7K A;  3T8U A;  1QVG 2;  1VQO 3;  4EYC A;  4KFD A;  1UUV B;  1DMM A;  3NUV A;  3KSP A;  5DRE A;  3FSD A;  2Y73 A;  1N9E A;  3ER7 A;  1DMQ A;  3SOA A;  1W6G A;  2MC8 A;  5IEN A;  3MKI A;  5FGO A;  1FGM A;  1CQS A;  3K63 A;  3HK4 A;  1EQK A;  2IMJ A;  5AI1 A;  4KVH A;  1UUW B;  2CKF B;  3FH1 A;  1LNH A;  4U13 A;  1VQK 3;  3S28 A;  4MMY B;  1IK3 A;  1IV9 A;  1VQP 3;  3PYJ A;  1Q82 4;  4G1M B;  5JBS A;  3NBR A;  5AIH A;  2BNG A;  4HZ9 B;  3CD6 3;  2B24 B;  4HM8 B;  1IDP A;  1RRL A;  4LMI A;  1VZZ A;  1AV4 A;  1IVX A;  4FCZ A;  1NB3 I;  2HMN B;  4Q53 A;  1VQ6 3;  1ZX2 A;  2RCD A;  4RNY A;  3CPW 2;  3LTB A;  2PNC A;  3QK9 A;  3CCM 3;  3NXJ A;  1W00 A;  4WWU C;  1GYB A;  1W6Y A;  4WP5 A;  1E97 A;  3I0Y A;  3OWY A;  3LML A;  2ZL8 A;  2K0M A;  3MG3 A;  3U1W A;  2E2U A;  2LYX A;  3LZA A;  1Q40 B;  7STD A;  2W56 B;  2CC3 A;  3DGM A;  1IV7 A;  3G4S 3;  3OXA A;  3TDG A;  2P0M A;  3FF2 A;  3FKA A;  3S29 A;  1UI8 A;  3JUO A;  3PGB A;  1O7W B;  3JUM A;  1GY5 A;  5EQL A;  4L8P A;  5ELU A;  3SLU A;  1IVU A;  1AR0 A;  2OCT A;  4WFO A;  1RN7 A;  3K5T A;  4HM2 B;  4J9A A;  3NM2 A;  2CFL A;  1FGO A;  1QJG A;  3CC4 3;  4QWT A;  1N9J A;  3B4P A;  4LZI A;  5ELJ A;  4WYK B;  3O8Y A;  5AYR B;  1DMN A;  1OHS A;  1U5O A;  4RNZ A;  3Q90 A;  3CME 3;  3ALA A;  1S72 3;  1OGX A;  3MHE A;  2P05 A;  3DZL A;  1IQX A;  3EHC A;  3U97 A;  2WGQ A;  4STD A;  5IF6 A;  4R9K A;  1STF I;  3WDG B;  5BVB A;  5AYS C;  4H3U A;  1CYV A;  2O9U X;  3UNL A;  3CCQ 3;  2OWP A;  2RFR A;  2XSH B;  4X2H A;  5LC7 A;  3GZY B;  1Q7Y 4;  2GEX A;  4HBR A;  3FZW A;  3NM7 A;  2F98 A;  2P38 A;  4MEI A;  3CNX A;  4HJL B;  3CNM A;  3BNE A;  4KZ1 A;  5DRV A;  1TUH A;  3KSE D;  4H61 A;  5EVH A;  3J7Y d;  1JJ2 2;  2O3O A;  3G6E 3;  2WOH A;  1O7G B;  3DXO A;  2W04 A;  4HM6 B;  1OF5 B;  4EV2 A;  2F99 A;  1JB4 A;  3KN4 A;  3KII A;  1V74 A;  3PS8 A;  3VSY A;  5IER A;  1AVK A;  1NU3 A;  4HZB B;  3WOF B;  3LT9 A;  2BMQ B;  2HMJ B;  4AEQ A;  1WTH A;  2GBX B;  4R4K A;  1VQM 3;  2CK3 H;  3H3H A;  2E2T A;  4IT7 A;  3NX0 A;  4K90 B;  5IG4 A;  2GEY A;  3FG1 A;  1JN5 B;  3CC2 3;  1BUQ A;  1QAL A;  1T5Y A;  8CHO A;  1OAC A;  3HX8 A;  3LOY A;  2M7O A;  1TIJ A;  3NV0 B;  2E2V A;  3CXC 2;  3NHX A;  1VQ9 3;  1JV2 B;  1ULJ B;  1KD1 4;  2CG0 A;  3EE1 A;  3SOY A;  3A76 A;  3MWZ A;  2JDI H;  2Z7A A;  3DGO A;  3IJE B;  3T0U A;  2KRT A;  4NHF A;  3CCR 3;  3LT8 A;  2HMM B;  3KZT A;  5CXO A;  3NQY A;  5IG0 A;  2XFT A;  3KE7 A;  3SX1 A;  1OPY A;  4XB5 A;  3QRD A;  2XF3 A;  4FMD A;  1QAK A;  5IG5 A;  1W02 A;  1IU7 A;  4K61 A;  2YFJ B;  1K9M 4;  1U8C B;  3SXX A;  3Q2P A;  4PEJ A;  1Q40 A;  1NO3 A;  1D6Y A;  1FGT A;  2W56 A;  1Z1S A;  1GD3 A;  5JPU A;  1TU5 A;  3NBJ A;  5A0O B;  1A90 A;  4HYZ A;  1TFK A;  1G96 A;  4LSO A;  1KC8 4;  1W5Z A;  3AMO B;  1D6Z A;  4N6N B;  1VQL 3;  1SPU A;  3WMD A;  3BLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...