1FA3A

Solution structure of mnei, a sweet protein
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords MNEI SWEET PROTEIN RELATED TO MONELLIN
publication title Solution structure of a sweet protein: NMR study of MNEI, a single chain monellin.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 20
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2000-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1fa3A00
1ROAA 1A90A 1CYVA 1N5HA 1CYUA 2W9QA 4N6V0 1DVDA 4ZM8A 1TIJA 3MWZA 1GD4A 1R4CA 2CH9A 4IT7A 1GD3A 4EYCA 1PFPA 5LC6A 3NX0A 1YVBI 2O9UX 5A0OB 3LH4A 3PXMA 4N6LA 1G96A 3KFQC 5EQLA 4N6NB 4N6UA 3S67A 3GAXA 3Q2PA 4N6TA 3KSED 1STFI 2W9PA 1M9GA 1MNLA 1DVCA 4N6OB 1NB3I 4N6MA 2BO9B 1FUWA 3PS8A 4TX4A 3L0RA 1MOLA 5ELUA 1LXEA 4LZIA 5LC7A 1IV7A 1IV9A 1N9JA 1FA3A 1CEWI 1WNHA 1KWIA 3UL6A 1EQKA 2KXGA 3PYJA 1RN7A 4CCVA 1A67A 3UL5A 2OCTA 5ELJA 3SVAA 3K9MC 1NB5I 3QRDA 3IMAB 1N5PA
chains in the Genus database with same CATH superfamily
1US1A 1N8R4 1F8NA 1K41A 4K1VA 1TP6A 4WP5A 3EC9A 2HMKB 2CK3H 2ZL8A 3G0KA 1I0VA 1W6YA 2XEPA 5FW5A 1VQP3 2F99A 5G2GA 4MMZB 1B21A 3OW22 3GRDA 3SOAA 3ER7A 3DMCA 4RNTA 4XBXA 1JBRA 4ZM8A 4CDLA 1IK3A 1B2MA 1BANA 3GWRA 1V74A 3AGOA 1KQS2 1N8QA 1CH0A 2H0IA 2XF3A 2CFWA 2OOVC 3T0UA 4KT3B 5HOHA 3CNMA 1GD4A 1IYYA 1BSEA 3Q90A 1R4CA 3JUPA 5IW9A 3FLJA 1B2SA 1ZX2A 2K0MA 2CFKA 3EE1A 3D4AA 2BIRA 3PCSA 5M18A 2CWVA 1EEJA 3F8HA 1EA2A 4KFFA 1ROVA 1IDPA 4HVNA 1X1XA 3DGYA 4BIRA 4BL2A 2O9UX 4FMDA 3B4PA 3OXAA 1M1K4 4R1KA 1A2PA 1OHOA 2IYJA 5IF6A 1OACA 1MWSA 1UCIA 3A5EA 1RSNA 2P0MA 1Q9EA 4MJDA 5D82A 4WWUC 3EB8A 3DXOA 3FSDA 1G96A 1MWTA 1W01A 3KN4A 3NM7A 5KP4A 1YIT3 3VGNA 1YHQ3 1VQM3 4HYZA 2Z76A 2Z77A 4RZMA 1BIRA 3OWYA 1BNGA 1ZO2A 3CME3 3U97A 1S5AA 3X3XA 1IQ8A 2E2UA 2E2TA 2RGQA 2BHMA 1UCJA 1NNVA 4HJLB 2IY2A 3G8ZA 1B27A 3F9SA 2W9PA 2QGUA 4WYKA 5D81A 2AADA 2GBWB 1K8A4 3DGLA 3IPTA 1AQZA 3MG3A 3GSPA 1KC84 2FXTA 1BNJA 1RGGA 3EX9A 4GHOA 2HMJB 1SQWA 1YIJ3 1JRQA 3DUKA 3RNTA 1BNFA 4WHAA 1KSIA 2Z6BA 2CG1A 2CFGA 4GB5A 2M7OA 1JZOA 3PS8A 4CJNA 3D5GA 4TX4A 1J2BA 1VQO3 2IMJA 3WOEB 5BIRA 1C7HA 5DREA 2IUJA 1M904 3WA3A 2Z7AA 1I0XA 1LXEA 4LZIA 3UB1A 2OTJ3 1Z1SA 3Q3FA 1QVG2 3MYTA 1Q814 2JQ5A 2W03A 3GZYB 1JZDA 2ZDJA 3KSPA 3OWSA 5KP1A 3G6E3 1WNHA 4HZ9B 3RGAA 3SX1A 3SYUA 1TRQA 3AHWA 2C11A 3AMOA 1KWIA 1LOYA 3UL6A 3F40A 3BLZA 4FCZA 1QALA 3M8CA 3ROBA 5RNTA 1JN5A 2CHCA 2PNCA 2W56B 3DGOA 3ZFZA 4I5QA 3CCV3 1GMQA 1YJ93 1IU7A 4H61A 4HAAA 3WDGB 4EV5A 2R41A 3T8UA 1BSAA 3HX8A 4STDA 2OCTA 4FCMA 3GZXB 1I2EA 5ELJA 3BU4A 1BRNL 1LOVA 2P0XA 3DY5A 2Y73A 4JF8A 3LZAA 3CCS3 1E3RA 2E2VA 3FF2A 3ECFA 3QRDA 4HM7B 3IMAB 1E3VA 2CFDA 3AHSA 3N8BA 2JDIH 1UUVB 1DE3A 3LTDA 1Q40A 5IEOA 2AAEA 3CCM3 3TDGA 1Q824 4EC6A 3OV4A 1X1WA 1A2VA 1T3BA 1O7GB 2CW9A 4LSOA 6STDA 4G1MB 1C54A 5IERA 1IQXA 2WOHA 1OCVA 1EUIC 1GOUA 1CYVA 1N5HA 2RFRA 3PZWA 4HM0B 4R9LA 1W7CA 1BVIA 6RNTA 1JNQA 4J8TA 2V1LA 5JPPA 3J7Yd 3EF8A 3HI7A 4XM4A 3X42A 1RN1A 4HM2B 1GMRA 3SOYA 5CLKA 3NUVA 1BSCA 1TJDA 4OK0A 2IA7A 1JKGB 2H0HA 3K7CA 2BU4A 1X1UA 2PZVA 4EBGA 3LXUX 4IT7A 1JBSA 1GD3A 4L8PA 2XSOB 1PFPA 4GSPA 4JRFA 3CPOA 4HM4B 3NX0A 2YFJB 4Q53A 1JBTA 2QA43 4BTWA 2W0QA 2BT3A 2P09A 3LYGA 1LNIA 4FMBA 4FMCA 3KE7A 5G1LA 2C4BA 5EVHA 4J5GA 4WFOA 1CQSA 3H51A 1YNVX 3A76A 5EQLA 3CC73 4HM5B 2GEYA 4FCJA 1IVVA 4O2HA 4X2OA 4N6UA 2HMNB 1HU9A 4EW5A 6GSPA 4CPKA 1BUQA 4N6TA 1BSBA 2J8XB 1LOXA 5CXOA 3DGNA 1PYLA 3HIGA 3WR2A 3KIIA 1TUHA 2HMMB 2XGNA 3KKGA 1GS3A 3EBTA 3V98A 2W6JH 8CHOA 1W2ZA 4N6MA 1EG9B 2A15A 3DGMA 3DM8A 3MKIA 3O8YA 1RN4A 4KFDA 3X3YA 1RGFA 5BXQA 2GXFA 5DRVA 2L1SA 4IIAA 4H3UA 1RJOA 1MOLA 1WTHA 2FNQA 1U5OA 4I4KA 4XDWA 1BNEA 5ELUA 1JB4A 1ASKA 4XBYA 1SIHA 1B20A 3Q1CA 2OQEA 2ZHXB 2INXA 1IV7A 1GOYA 1ZGXA 1N9JA 1RGKA 2F5WA 2WGOA 1S723 4R4KA 2F98A 4BTXA 1BRGA 1UCKA 1UGIA 4NREA 5JBSA 2BNGA 2F56A 1VQ43 1GYBA 3G4S3 4XB5A 1RN7A 1BRSA 3URPA 2RSXA 3EN8A 4CCVA 1RHLA 3UL5A 3V92A 3B4OA 1RGLA 1MWUA 3UNLA 2SBLA 5CF1A 3FG1A 2UUGC 3JUQA 2RCDA 4KVHA 1FUTA 2KAAA 2KF4A 4J9AA 3K9MC 5IEPA 5IG0A 4FR9A 3LTBA 3FCSB 5M1AA 3WMDA 2SARA 3K5TA 2QEX3 1RCLA 2OOVA 1WMOA 1N9EA 1B2ZA 1ROAA 3F8XA 2ZA4A 1VQL3 3PCRA 1YGEA 1LQGC 1RGCA 3NV0A 1NO3A 4BTYA 3CCR3 8RNTA 3G16A 3MSOA 3VSYA 4BL3A 1Y4KA 3LTAA 2BMQB 1W02A 4GL6A 1X1YA 3LMLA 1SIIA 4LGQA 1UGHI 3BNBA 1PY3A 1EKMA 3JUMA 1I3FA 2STDA 1BNRA 2W9QA 1DMNA 4RBNA 1DVDA 1VQ63 1GY6A 3OWUA 1B3SA 1W6CA 4EXRA 2WGQA 1OF5A 3S5CA 4WYKB 1LVNA 9RNTA 1TIJA 3X41A 3MWZA 5AI1A 1VQ53 2CWUA 3LT9A 1MGRA 5AEWB 4MEIA 1AY7A 2FGTA 4EV2A 5AYSC 2P05A 3T8NA 1QJGA 3N9HA 5AIIA 1IVWA 1UUGB 3IJEB 4NPBA 5AYRB 3ZG5A 1ULJB 4EYCA 3BNEA 1FUSA 3UJMA 3F7SA 1WMNA 1JKGA 5EEOA 1DMQA 1YVBI 2F86B 5GSPA 3BIRA 4KFEA 5AIGA 1YVSA 3RGRA 1QMAA 1V58A 3K63A 1VZZA 2F5MA 3FH1A 2YX9A 3HOHA 4K1UA 1BRHA 3D3LA 4HM3B 2W2CA 5A0OB 3BB9A 2XFTA 3PXMA 1AVKA 3AGNA 4L8OA 4LMIA 4N6LA 4MMXB 2CX0A 3KFQC 4NHFA 2WOFA 2ML5A 1HKXA 1W2B2 5CF2A 2XRXB 3EN1B 4HOHA 3AMOB 1LQMB 4N6NB 2R4IA 2MC8A 1KD14 1SJWA 5AIFA 1JN5B 4LEHA 1WMPA 3CNXA 1T2HA 1AV4A 5TGNA 1BNIA 1VQQA 3K0ZA 4AKYA 1W5ZA 2KCDA 1Q42A 1STFI 2H0GA 2KF3A 1TRPA 5M19A 3LT8A 1DYUA 1M9GA 4XDVA 2UX0A 1OHPA 4K61A 3F14A 1IT8A 3S28A 1AVLA 2I9WA 2QIYA 1DVCA 2YFIB 1O7PB 1WQLB 1W4NA 3EJVA 1NB3I 1QAKA 3BNDA 1OH0A 1K28A 1RMSA 1W6GA 1I2FA 3MG1A 1FUWA 1BGSA 4HM1B 3KCHA 1U8CB 1NU3A 2W04A 3H3HA 1Q40B 1TFOA 5AIHA 4RNYA 1Q7HA 3WOFB 2BMOB 1LOWA 3E99A 1RNTA 5FGOA 3LTCA 1TU5A 1NJI4 2CKFB 4N3VA 1JV2B 1IV9A 5I97A 1BNSA 1CEWI 1RGAA 3FG4A 1VQ83 1T2IA 4U13A 3CU3A 2B1XB 2MF7A 1EQKA 3STDA 3SXXA 3EBYA 4AKZA 2ML6A 1RGEA 1E97A 3NBBA 5KP3A 3CXC2 3FF0A 4R9KA 4LYLB 1FGRA 3HK4A 4XBTA 1BOXA 1QAFA 1W00A 2P38A 3FKAA 1NDOB 3SVAA 1VQ93 1Q7Y4 2Q07A 4OUQA 3CC23 1ZS7A 2CIUA 2CFLA 1NB5I 1TFKA 5BU4A 1RRLA 4AEQA 3PGBA 3MG2A 3SLUA 3MHEA 1D6YA 3RDEA 1OGXA 3D79A 3JUOA 3I0YA 1A90A 4X2HA 2HMLB 3ALAA 1K734 4HZBB 1GOVA 2GBXB 3LOYA 1RNBA 2RNTA 1RRHA 1BRJA 1NWWA 3WA2X 1I2GA 1O7WB 1D6UA 1MGWA 2XSHB 1V57A 4ORLA 1I8VA 3X3ZA 1CYUA 1VQN3 2OWPA 2LYXA 4N6V0 1FZUA 3KZTA 5IG3A 2F4YA 3D5IA 3GZRA 4OVMA 3GZBA 4HM8B 1YJN3 3WODG 1VQK3 2W56A 1TTOA 3B8LA 1DETA 3NM2A 1FGQA 1O7NB 1BUJA 1RTUA 1T5YA 2Y74A 2IUKA 5JPUA 2CWTA 2K3DA 2CC3A 2CH9A 4HKVB 3G713 1B2UA 2RBIA 1PU4A 1IQYA 4FMAA 4R80A 1BU4A 3F7XA 3CCJ3 4HBRA 5LC6A 3I563 2WO0A 2YFLB 1YI23 3S27A 2CG0A 3FGYA 1UCLA 1FYSA 4PEJA 3VF1A 3FG3A 2LQVA 1D6ZA 1JB5A 1I70A 1UI8A 4K90B 5CK6A 1G0TA 3CC43 2KRTA 1UW1A 1JB2A 4ILFA 3LH4A 4O8SA 2KF5A 5BVBA 2C10A 7GSPA 1Q864 1BRIA 2CX1A 1GY7A 3CCQ3 3JUNA 2GEXA 3S67A 1ISKA 2KF6A 3GAXA 3OX9A 1FW7A 3ZG0A 1GSPA 1RCKA 1FGMA 2XFSA 1LNHA 3DZLA 3NBJA 3Q2PA 4O3VA 7STDA 2GU1A 1MWRA 3KSED 3N54B 3CD63 4KZ1A 2XH9A 1SARA 3HZPA 1BRKA 4HM6B 1O7HB 1L5GB 3SEDA 1MNLA 1G02A 4L7KA 3NQZA 1UDII 2XGLA 3CPW2 3DH2A 1YGWA 4IPBA 4BU4A 2D42A 4N6OB 3V99A 3WHOA 3JVCA 3X40A 3EHCA 5G1KA 1K9M4 2BO9B 1A2KA 3D9RA 1M1XB 3BNCA 3FZWA 1BSDA 3HIIA 5IENA 2OTL3 4RNZA 1O7MB 5D83A 5IG4A 1OGZA 2K54A 3L0RA 3NQYA 3NV0B 1A67A 3CCU3 2HOHA 4J5KA 1AR0A 1FGOA 3I553 1YJW3 1RDSA 5LC7A 4DKIA 3CCE3 1SPUA 1FA3A 1OPYA 2BMRB 1UUWB 1B2XA 3NBRA 1VQ73 1IT7A 3QK9A 4O02B 3CMA3 2HMOB 2UGIA 1I3IA 1GMPA 2KXGA 2O3OA 3PYJA 1RKYA 3B7CA 5IG5A 3U1WA 1OF5B 2XR8B 1GY5A 2GU3A 5AEUB 1RGHA 2GSPA 3CCL3 2D1WA 3NXJA 3NHXA 5HGRA 1BAOA 1OHSA 1JJ22 4MMYB 1QVF2 2L4VA 3S29A 1DMMA 1LRAA 1STDA 5STDA 2B24B 3EQQB 1R4YA 2OQEC 1IVUA 1ULIB 1FGTA 1IVXA 1UI7A 3MPHA 1RLSA 1HZ1A 4QWTA 7RNTA 1OUNA 1HYFA 1N5PA
chains in the Genus database with same CATH topology
1US1A 1N8R4 1F8NA 1K41A 4K1VA 1TP6A 4WP5A 3EC9A 2HMKB 2CK3H 2ZL8A 3G0KA 1W6YA 2XEPA 5FW5A 1VQP3 2F99A 5G2GA 4MMZB 3OW22 3GRDA 3SOAA 3ER7A 3DMCA 4XBXA 4ZM8A 4CDLA 1IK3A 3GWRA 1V74A 1KQS2 1N8QA 2XF3A 2CFWA 2OOVC 3T0UA 3CNMA 1GD4A 3Q90A 1R4CA 3JUPA 5IW9A 3FLJA 1ZX2A 2K0MA 2CFKA 3EE1A 3PCSA 2CWVA 3F8HA 1EA2A 4KFFA 1ROVA 1IDPA 4HVNA 2O9UX 4FMDA 3B4PA 3OXAA 1M1K4 4R1KA 1OHOA 5IF6A 1OACA 2P0MA 4MJDA 5D82A 4WWUC 3EB8A 3DXOA 3FSDA 1G96A 1W01A 3KN4A 1YIT3 3NM7A 5KP4A 3VGNA 1YHQ3 1VQM3 4HYZA 2Z76A 2Z77A 4RZMA 3OWYA 1ZO2A 3CME3 3U97A 1S5AA 3X3XA 1IQ8A 2E2UA 2E2TA 2RGQA 2BHMA 4HJLB 3G8ZA 3F9SA 2W9PA 2QGUA 4WYKA 5D81A 2GBWB 1K8A4 3DGLA 3IPTA 3MG3A 1KC84 2FXTA 3EX9A 2HMJB 1SQWA 1YIJ3 1JRQA 3DUKA 4WHAA 1KSIA 2Z6BA 2CG1A 2CFGA 4GB5A 2M7OA 3PS8A 4TX4A 1J2BA 1VQO3 2IMJA 3WOEB 1C7HA 5DREA 2IUJA 1M904 3WA3A 2Z7AA 1LXEA 4LZIA 3UB1A 2OTJ3 1Z1SA 1QVG2 3MYTA 1Q814 2JQ5A 2W03A 3GZYB 3KSPA 2ZDJA 3OWSA 5KP1A 3G6E3 1WNHA 4HZ9B 3RGAA 3SX1A 2C11A 3AMOA 1KWIA 3UL6A 3F40A 3BLZA 4FCZA 1QALA 3M8CA 3ROBA 1JN5A 2CHCA 2PNCA 2W56B 3DGOA 1YJ93 3CCV3 1A67A 1IU7A 4H61A 3WDGB 4EV5A 3T8UA 4STDA 3HX8A 2OCTA 4FCMA 3GZXB 5ELJA 2P0XA 3DY5A 2Y73A 4JF8A 3LZAA 3CCS3 1E3RA 2E2VA 3FF2A 3ECFA 3QRDA 4HM7B 3IMAB 2CFDA 1E3VA 3N8BA 2JDIH 1UUVB 3LTDA 1Q40A 5IEOA 3CCM3 1Q824 3TDGA 4EC6A 3OV4A 1A2VA 4LSOA 1O7GB 2CW9A 6STDA 4G1MB 5IERA 1IQXA 2WOHA 1OCVA 1CYVA 1N5HA 2RFRA 3PZWA 4HM0B 4R9LA 1W7CA 1JNQA 4J8TA 2V1LA 5JPPA 3J7Yd 3EF8A 3HI7A 4XM4A 3X42A 4HM2B 3SOYA 5CLKA 3NUVA 4OK0A 2IA7A 1JKGB 3K7CA 2PZVA 4EBGA 3LXUX 4IT7A 1GD3A 4L8PA 2XSOB 1PFPA 4JRFA 3CPOA 4HM4B 3NX0A 2YFJB 4Q53A 2QA43 4BTWA 2W0QA 2BT3A 2P09A 3LYGA 4FMBA 4FMCA 3KE7A 5EVHA 4WFOA 1CQSA 3H51A 3A76A 5EQLA 3CC73 4HM5B 2GEYA 4FCJA 1IVVA 4O2HA 4X2OA 4N6UA 2HMNB 1HU9A 1BUQA 4N6TA 1LOXA 5CXOA 3DGNA 3HIGA 3KIIA 1TUHA 2HMMB 2XGNA 3KKGA 1GS3A 3EBTA 3V98A 2W6JH 8CHOA 1W2ZA 4N6MA 1EG9B 2A15A 3DGMA 3DM8A 3MKIA 3O8YA 4KFDA 3X3YA 5BXQA 2GXFA 5DRVA 4IIAA 4H3UA 1RJOA 1MOLA 1WTHA 2FNQA 1U5OA 4I4KA 4XDWA 5ELUA 1JB4A 1ASKA 4XBYA 1SIHA 3Q1CA 2OQEA 2INXA 1IV7A 2WGOA 1N9JA 1S723 4R4KA 2F98A 4BTXA 4NREA 5JBSA 2BNGA 1VQ43 1GYBA 3G4S3 4XB5A 1RN7A 4CCVA 2RSXA 3EN8A 3UL5A 3V92A 3B4OA 3UNLA 2SBLA 5CF1A 3FG1A 3JUQA 2RCDA 4KVHA 5IEPA 4J9AA 3K9MC 5IG0A 4FR9A 3LTBA 3FCSB 3WMDA 3K5TA 2QEX3 2OOVA 1WMOA 1N9EA 1ROAA 3F8XA 1VQL3 3PCRA 1YGEA 3NV0A 4BTYA 3CCR3 1NO3A 3G16A 3MSOA 3VSYA 1Y4KA 3LTAA 2BMQB 1W02A 4GL6A 3LMLA 4LGQA 1SIIA 3BNBA 3JUMA 1EKMA 2STDA 2W9QA 1DMNA 4RBNA 1DVDA 1VQ63 1GY6A 3OWUA 1W6CA 4EXRA 2WGQA 1OF5A 3S5CA 4WYKB 1LVNA 1TIJA 3X41A 3MWZA 5AI1A 1VQ53 2CWUA 3LT9A 5AEWB 4MEIA 2FGTA 4EV2A 5AYSC 2P05A 3T8NA 1QJGA 3N9HA 5AIIA 1IVWA 4EYCA 3IJEB 5AYRB 1ULJB 3BNEA 3UJMA 3F7SA 1WMNA 1JKGA 5EEOA 1DMQA 1YVBI 2F86B 4KFEA 5AIGA 3RGRA 1QMAA 3K63A 1VZZA 3FH1A 2YX9A 4K1UA 4HM3B 3D3LA 5A0OB 2W2CA 3BB9A 2XFTA 3PXMA 1AVKA 4L8OA 4LMIA 4N6LA 4NHFA 4MMXB 3KFQC 2WOFA 2ML5A 1HKXA 1W2B2 5CF2A 2XRXB 3EN1B 3AMOB 4N6NB 2R4IA 2MC8A 1KD14 1SJWA 5AIFA 1JN5B 4LEHA 1WMPA 3CNXA 1AV4A 5TGNA 3K0ZA 4AKYA 1W5ZA 2KCDA 1Q42A 1STFI 3LT8A 1DYUA 1M9GA 4XDVA 2UX0A 1OHPA 4K61A 3F14A 1IT8A 3S28A 1AVLA 2I9WA 2QIYA 1DVCA 2YFIB 1O7PB 1WQLB 1W4NA 3EJVA 1NB3I 1QAKA 3BNDA 1OH0A 1K28A 1W6GA 3MG1A 1FUWA 4HM1B 1U8CB 1NU3A 2W04A 3H3HA 1Q40B 1TFOA 5AIHA 4RNYA 3WOFB 2BMOB 3E99A 1TU5A 5FGOA 3LTCA 1NJI4 2CKFB 4N3VA 1JV2B 1IV9A 5I97A 1CEWI 3FG4A 1VQ83 4U13A 3CU3A 2B1XB 2MF7A 1EQKA 3STDA 3SXXA 3EBYA 4AKZA 2ML6A 1E97A 3NBBA 5KP3A 3CXC2 3FF0A 4R9KA 1FGRA 3HK4A 4XBTA 1QAFA 1W00A 2P38A 3FKAA 1NDOB 3SVAA 1VQ93 1Q7Y4 2Q07A 4OUQA 3CC23 2CIUA 2CFLA 1NB5I 1TFKA 1RRLA 4AEQA 3PGBA 3MG2A 3SLUA 3MHEA 1D6YA 3RDEA 1OGXA 3JUOA 3I0YA 1A90A 4X2HA 2HMLB 3ALAA 1K734 4HZBB 2GBXB 3LOYA 1RRHA 1NWWA 3WA2X 4ORLA 1O7WB 1D6UA 2XSHB 3X3ZA 1CYUA 1VQN3 2OWPA 2LYXA 4N6V0 3KZTA 5IG3A 3GZRA 4OVMA 3GZBA 4HM8B 1YJN3 3WODG 1VQK3 2W56A 3B8LA 3NM2A 1FGQA 1O7NB 1T5YA 2Y74A 2IUKA 5JPUA 2CWTA 2CC3A 2CH9A 4HKVB 3G713 1PU4A 1IQYA 4FMAA 4R80A 3CCJ3 3F7XA 4HBRA 5LC6A 3I563 2WO0A 2YFLB 1YI23 3S27A 2CG0A 3FGYA 4PEJA 3VF1A 3FG3A 2LQVA 1D6ZA 1JB5A 1UI8A 4K90B 5CK6A 3CC43 2KRTA 1UW1A 1JB2A 3LH4A 4O8SA 5BVBA 2C10A 1Q864 1GY7A 3CCQ3 3JUNA 2GEXA 3S67A 1ISKA 3GAXA 3OX9A 3DZLA 1FGMA 2XFSA 1LNHA 3Q2PA 3NBJA 4O3VA 7STDA 3CD63 2GU1A 3KSED 3N54B 4KZ1A 2XH9A 3HZPA 4HM6B 1O7HB 1L5GB 3SEDA 1MNLA 4L7KA 3NQZA 2XGLA 3CPW2 4IPBA 2D42A 4N6OB 3V99A 3JVCA 3X40A 3EHCA 1K9M4 2BO9B 1A2KA 3D9RA 1M1XB 3BNCA 3FZWA 3HIIA 5IENA 2OTL3 4RNZA 1O7MB 5D83A 5IG4A 1OGZA 2K54A 3L0RA 3NQYA 3NV0B 3CCU3 1AR0A 1FGOA 3I553 1YJW3 5LC7A 3CCE3 1SPUA 1FA3A 1OPYA 2BMRB 1UUWB 3NBRA 1VQ73 1IT7A 3QK9A 4O02B 3CMA3 2HMOB 1RKYA 2KXGA 2O3OA 3PYJA 3B7CA 5IG5A 3U1WA 1OF5B 2XR8B 1GY5A 2GU3A 5AEUB 3CCL3 2D1WA 3NXJA 3NHXA 5HGRA 1JJ22 1OHSA 4MMYB 1QVF2 2L4VA 3S29A 1DMMA 1STDA 5STDA 2B24B 3EQQB 2OQEC 1IVUA 1ULIB 1FGTA 1IVXA 1UI7A 3MPHA 4QWTA 1OUNA 1N5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROA A;  1A90 A;  1CYV A;  1N5H A;  1CYU A;  2W9Q A;  4N6V 0;  1DVD A;  4ZM8 A;  1TIJ A;  3MWZ A;  1GD4 A;  1R4C A;  2CH9 A;  4IT7 A;  1GD3 A;  4EYC A;  1PFP A;  5LC6 A;  3NX0 A;  1YVB I;  2O9U X;  5A0O B;  3LH4 A;  3PXM A;  4N6L A;  1G96 A;  3KFQ C;  5EQL A;  4N6N B;  4N6U A;  3S67 A;  3GAX A;  3Q2P A;  4N6T A;  3KSE D;  1STF I;  2W9P A;  1M9G A;  1MNL A;  1DVC A;  4N6O B;  1NB3 I;  4N6M A;  2BO9 B;  1FUW A;  3PS8 A;  4TX4 A;  3L0R A;  1MOL A;  5ELU A;  1LXE A;  4LZI A;  5LC7 A;  1IV7 A;  1IV9 A;  1N9J A;  1FA3 A;  1CEW I;  1WNH A;  1KWI A;  3UL6 A;  1EQK A;  2KXG A;  3PYJ A;  1RN7 A;  4CCV A;  1A67 A;  3UL5 A;  2OCT A;  5ELJ A;  3SVA A;  3K9M C;  1NB5 I;  3QRD A;  3IMA B;  1N5P A; 
#chains in the Genus database with same CATH topology
 1US1 A;  1N8R 4;  1F8N A;  1K41 A;  4K1V A;  1TP6 A;  4WP5 A;  3EC9 A;  2HMK B;  2CK3 H;  2ZL8 A;  3G0K A;  1I0V A;  1W6Y A;  2XEP A;  5FW5 A;  1VQP 3;  2F99 A;  5G2G A;  4MMZ B;  1B21 A;  3OW2 2;  3GRD A;  3SOA A;  3ER7 A;  3DMC A;  4RNT A;  4XBX A;  1JBR A;  4ZM8 A;  4CDL A;  1IK3 A;  1B2M A;  1BAN A;  3GWR A;  1V74 A;  3AGO A;  1KQS 2;  1N8Q A;  1CH0 A;  2H0I A;  2XF3 A;  2CFW A;  2OOV C;  3T0U A;  4KT3 B;  5HOH A;  3CNM A;  1GD4 A;  1IYY A;  1BSE A;  3Q90 A;  1R4C A;  3JUP A;  5IW9 A;  3FLJ A;  1B2S A;  1ZX2 A;  2K0M A;  2CFK A;  3EE1 A;  3D4A A;  2BIR A;  3PCS A;  5M18 A;  2CWV A;  1EEJ A;  3F8H A;  1EA2 A;  4KFF A;  1ROV A;  1IDP A;  4HVN A;  1X1X A;  3DGY A;  4BIR A;  4BL2 A;  2O9U X;  4FMD A;  3B4P A;  3OXA A;  1M1K 4;  4R1K A;  1A2P A;  1OHO A;  2IYJ A;  5IF6 A;  1OAC A;  1MWS A;  1UCI A;  3A5E A;  1RSN A;  2P0M A;  1Q9E A;  4MJD A;  5D82 A;  4WWU C;  3EB8 A;  3DXO A;  3FSD A;  1G96 A;  1MWT A;  1W01 A;  3KN4 A;  3NM7 A;  5KP4 A;  1YIT 3;  3VGN A;  1YHQ 3;  1VQM 3;  4HYZ A;  2Z76 A;  2Z77 A;  4RZM A;  1BIR A;  3OWY A;  1BNG A;  1ZO2 A;  3CME 3;  3U97 A;  1S5A A;  3X3X A;  1IQ8 A;  2E2U A;  2E2T A;  2RGQ A;  2BHM A;  1UCJ A;  1NNV A;  4HJL B;  2IY2 A;  3G8Z A;  1B27 A;  3F9S A;  2W9P A;  2QGU A;  4WYK A;  5D81 A;  2AAD A;  2GBW B;  1K8A 4;  3DGL A;  3IPT A;  1AQZ A;  3MG3 A;  3GSP A;  1KC8 4;  2FXT A;  1BNJ A;  1RGG A;  3EX9 A;  4GHO A;  2HMJ B;  1SQW A;  1YIJ 3;  1JRQ A;  3DUK A;  3RNT A;  1BNF A;  4WHA A;  1KSI A;  2Z6B A;  2CG1 A;  2CFG A;  4GB5 A;  2M7O A;  1JZO A;  3PS8 A;  4CJN A;  3D5G A;  4TX4 A;  1J2B A;  1VQO 3;  2IMJ A;  3WOE B;  5BIR A;  1C7H A;  5DRE A;  2IUJ A;  1M90 4;  3WA3 A;  2Z7A A;  1I0X A;  1LXE A;  4LZI A;  3UB1 A;  2OTJ 3;  1Z1S A;  3Q3F A;  1QVG 2;  3MYT A;  1Q81 4;  2JQ5 A;  2W03 A;  3GZY B;  1JZD A;  2ZDJ A;  3KSP A;  3OWS A;  5KP1 A;  3G6E 3;  1WNH A;  4HZ9 B;  3RGA A;  3SX1 A;  3SYU A;  1TRQ A;  3AHW A;  2C11 A;  3AMO A;  1KWI A;  1LOY A;  3UL6 A;  3F40 A;  3BLZ A;  4FCZ A;  1QAL A;  3M8C A;  3ROB A;  5RNT A;  1JN5 A;  2CHC A;  2PNC A;  2W56 B;  3DGO A;  3ZFZ A;  4I5Q A;  3CCV 3;  1GMQ A;  1YJ9 3;  1IU7 A;  4H61 A;  4HAA A;  3WDG B;  4EV5 A;  2R41 A;  3T8U A;  1BSA A;  3HX8 A;  4STD A;  2OCT A;  4FCM A;  3GZX B;  1I2E A;  5ELJ A;  3BU4 A;  1BRN L;  1LOV A;  2P0X A;  3DY5 A;  2Y73 A;  4JF8 A;  3LZA A;  3CCS 3;  1E3R A;  2E2V A;  3FF2 A;  3ECF A;  3QRD A;  4HM7 B;  3IMA B;  1E3V A;  2CFD A;  3AHS A;  3N8B A;  2JDI H;  1UUV B;  1DE3 A;  3LTD A;  1Q40 A;  5IEO A;  2AAE A;  3CCM 3;  3TDG A;  1Q82 4;  4EC6 A;  3OV4 A;  1X1W A;  1A2V A;  1T3B A;  1O7G B;  2CW9 A;  4LSO A;  6STD A;  4G1M B;  1C54 A;  5IER A;  1IQX A;  2WOH A;  1OCV A;  1EUI C;  1GOU A;  1CYV A;  1N5H A;  2RFR A;  3PZW A;  4HM0 B;  4R9L A;  1W7C A;  1BVI A;  6RNT A;  1JNQ A;  4J8T A;  2V1L A;  5JPP A;  3J7Y d;  3EF8 A;  3HI7 A;  4XM4 A;  3X42 A;  1RN1 A;  4HM2 B;  1GMR A;  3SOY A;  5CLK A;  3NUV A;  1BSC A;  1TJD A;  4OK0 A;  2IA7 A;  1JKG B;  2H0H A;  3K7C A;  2BU4 A;  1X1U A;  2PZV A;  4EBG A;  3LXU X;  4IT7 A;  1JBS A;  1GD3 A;  4L8P A;  2XSO B;  1PFP A;  4GSP A;  4JRF A;  3CPO A;  4HM4 B;  3NX0 A;  2YFJ B;  4Q53 A;  1JBT A;  2QA4 3;  4BTW A;  2W0Q A;  2BT3 A;  2P09 A;  3LYG A;  1LNI A;  4FMB A;  4FMC A;  3KE7 A;  5G1L A;  2C4B A;  5EVH A;  4J5G A;  4WFO A;  1CQS A;  3H51 A;  1YNV X;  3A76 A;  5EQL A;  3CC7 3;  4HM5 B;  2GEY A;  4FCJ A;  1IVV A;  4O2H A;  4X2O A;  4N6U A;  2HMN B;  1HU9 A;  4EW5 A;  6GSP A;  4CPK A;  1BUQ A;  4N6T A;  1BSB A;  2J8X B;  1LOX A;  5CXO A;  3DGN A;  1PYL A;  3HIG A;  3WR2 A;  3KII A;  1TUH A;  2HMM B;  2XGN A;  3KKG A;  1GS3 A;  3EBT A;  3V98 A;  2W6J H;  8CHO A;  1W2Z A;  4N6M A;  1EG9 B;  2A15 A;  3DGM A;  3DM8 A;  3MKI A;  3O8Y A;  1RN4 A;  4KFD A;  3X3Y A;  1RGF A;  5BXQ A;  2GXF A;  5DRV A;  2L1S A;  4IIA A;  4H3U A;  1RJO A;  1MOL A;  1WTH A;  2FNQ A;  1U5O A;  4I4K A;  4XDW A;  1BNE A;  5ELU A;  1JB4 A;  1ASK A;  4XBY A;  1SIH A;  1B20 A;  3Q1C A;  2OQE A;  2ZHX B;  2INX A;  1IV7 A;  1GOY A;  1ZGX A;  1N9J A;  1RGK A;  2F5W A;  2WGO A;  1S72 3;  4R4K A;  2F98 A;  4BTX A;  1BRG A;  1UCK A;  1UGI A;  4NRE A;  5JBS A;  2BNG A;  2F56 A;  1VQ4 3;  1GYB A;  3G4S 3;  4XB5 A;  1RN7 A;  1BRS A;  3URP A;  2RSX A;  3EN8 A;  4CCV A;  1RHL A;  3UL5 A;  3V92 A;  3B4O A;  1RGL A;  1MWU A;  3UNL A;  2SBL A;  5CF1 A;  3FG1 A;  2UUG C;  3JUQ A;  2RCD A;  4KVH A;  1FUT A;  2KAA A;  2KF4 A;  4J9A A;  3K9M C;  5IEP A;  5IG0 A;  4FR9 A;  3LTB A;  3FCS B;  5M1A A;  3WMD A;  2SAR A;  3K5T A;  2QEX 3;  1RCL A;  2OOV A;  1WMO A;  1N9E A;  1B2Z A;  1ROA A;  3F8X A;  2ZA4 A;  1VQL 3;  3PCR A;  1YGE A;  1LQG C;  1RGC A;  3NV0 A;  1NO3 A;  4BTY A;  3CCR 3;  8RNT A;  3G16 A;  3MSO A;  3VSY A;  4BL3 A;  1Y4K A;  3LTA A;  2BMQ B;  1W02 A;  4GL6 A;  1X1Y A;  3LML A;  1SII A;  4LGQ A;  1UGH I;  3BNB A;  1PY3 A;  1EKM A;  3JUM A;  1I3F A;  2STD A;  1BNR A;  2W9Q A;  1DMN A;  4RBN A;  1DVD A;  1VQ6 3;  1GY6 A;  3OWU A;  1B3S A;  1W6C A;  4EXR A;  2WGQ A;  1OF5 A;  3S5C A;  4WYK B;  1LVN A;  9RNT A;  1TIJ A;  3X41 A;  3MWZ A;  5AI1 A;  1VQ5 3;  2CWU A;  3LT9 A;  1MGR A;  5AEW B;  4MEI A;  1AY7 A;  2FGT A;  4EV2 A;  5AYS C;  2P05 A;  3T8N A;  1QJG A;  3N9H A;  5AII A;  1IVW A;  1UUG B;  3IJE B;  4NPB A;  5AYR B;  3ZG5 A;  1ULJ B;  4EYC A;  3BNE A;  1FUS A;  3UJM A;  3F7S A;  1WMN A;  1JKG A;  5EEO A;  1DMQ A;  1YVB I;  2F86 B;  5GSP A;  3BIR A;  4KFE A;  5AIG A;  1YVS A;  3RGR A;  1QMA A;  1V58 A;  3K63 A;  1VZZ A;  2F5M A;  3FH1 A;  2YX9 A;  3HOH A;  4K1U A;  1BRH A;  3D3L A;  4HM3 B;  2W2C A;  5A0O B;  3BB9 A;  2XFT A;  3PXM A;  1AVK A;  3AGN A;  4L8O A;  4LMI A;  4N6L A;  4MMX B;  2CX0 A;  3KFQ C;  4NHF A;  2WOF A;  2ML5 A;  1HKX A;  1W2B 2;  5CF2 A;  2XRX B;  3EN1 B;  4HOH A;  3AMO B;  1LQM B;  4N6N B;  2R4I A;  2MC8 A;  1KD1 4;  1SJW A;  5AIF A;  1JN5 B;  4LEH A;  1WMP A;  3CNX A;  1T2H A;  1AV4 A;  5TGN A;  1BNI A;  1VQQ A;  3K0Z A;  4AKY A;  1W5Z A;  2KCD A;  1Q42 A;  1STF I;  2H0G A;  2KF3 A;  1TRP A;  5M19 A;  3LT8 A;  1DYU A;  1M9G A;  4XDV A;  2UX0 A;  1OHP A;  4K61 A;  3F14 A;  1IT8 A;  3S28 A;  1AVL A;  2I9W A;  2QIY A;  1DVC A;  2YFI B;  1O7P B;  1WQL B;  1W4N A;  3EJV A;  1NB3 I;  1QAK A;  3BND A;  1OH0 A;  1K28 A;  1RMS A;  1W6G A;  1I2F A;  3MG1 A;  1FUW A;  1BGS A;  4HM1 B;  3KCH A;  1U8C B;  1NU3 A;  2W04 A;  3H3H A;  1Q40 B;  1TFO A;  5AIH A;  4RNY A;  1Q7H A;  3WOF B;  2BMO B;  1LOW A;  3E99 A;  1RNT A;  5FGO A;  3LTC A;  1TU5 A;  1NJI 4;  2CKF B;  4N3V A;  1JV2 B;  1IV9 A;  5I97 A;  1BNS A;  1CEW I;  1RGA A;  3FG4 A;  1VQ8 3;  1T2I A;  4U13 A;  3CU3 A;  2B1X B;  2MF7 A;  1EQK A;  3STD A;  3SXX A;  3EBY A;  4AKZ A;  2ML6 A;  1RGE A;  1E97 A;  3NBB A;  5KP3 A;  3CXC 2;  3FF0 A;  4R9K A;  4LYL B;  1FGR A;  3HK4 A;  4XBT A;  1BOX A;  1QAF A;  1W00 A;  2P38 A;  3FKA A;  1NDO B;  3SVA A;  1VQ9 3;  1Q7Y 4;  2Q07 A;  4OUQ A;  3CC2 3;  1ZS7 A;  2CIU A;  2CFL A;  1NB5 I;  1TFK A;  5BU4 A;  1RRL A;  4AEQ A;  3PGB A;  3MG2 A;  3SLU A;  3MHE A;  1D6Y A;  3RDE A;  1OGX A;  3D79 A;  3JUO A;  3I0Y A;  1A90 A;  4X2H A;  2HML B;  3ALA A;  1K73 4;  4HZB B;  1GOV A;  2GBX B;  3LOY A;  1RNB A;  2RNT A;  1RRH A;  1BRJ A;  1NWW A;  3WA2 X;  1I2G A;  1O7W B;  1D6U A;  1MGW A;  2XSH B;  1V57 A;  4ORL A;  1I8V A;  3X3Z A;  1CYU A;  1VQN 3;  2OWP A;  2LYX A;  4N6V 0;  1FZU A;  3KZT A;  5IG3 A;  2F4Y A;  3D5I A;  3GZR A;  4OVM A;  3GZB A;  4HM8 B;  1YJN 3;  3WOD G;  1VQK 3;  2W56 A;  1TTO A;  3B8L A;  1DET A;  3NM2 A;  1FGQ A;  1O7N B;  1BUJ A;  1RTU A;  1T5Y A;  2Y74 A;  2IUK A;  5JPU A;  2CWT A;  2K3D A;  2CC3 A;  2CH9 A;  4HKV B;  3G71 3;  1B2U A;  2RBI A;  1PU4 A;  1IQY A;  4FMA A;  4R80 A;  1BU4 A;  3F7X A;  3CCJ 3;  4HBR A;  5LC6 A;  3I56 3;  2WO0 A;  2YFL B;  1YI2 3;  3S27 A;  2CG0 A;  3FGY A;  1UCL A;  1FYS A;  4PEJ A;  3VF1 A;  3FG3 A;  2LQV A;  1D6Z A;  1JB5 A;  1I70 A;  1UI8 A;  4K90 B;  5CK6 A;  1G0T A;  3CC4 3;  2KRT A;  1UW1 A;  1JB2 A;  4ILF A;  3LH4 A;  4O8S A;  2KF5 A;  5BVB A;  2C10 A;  7GSP A;  1Q86 4;  1BRI A;  2CX1 A;  1GY7 A;  3CCQ 3;  3JUN A;  2GEX A;  3S67 A;  1ISK A;  2KF6 A;  3GAX A;  3OX9 A;  1FW7 A;  3ZG0 A;  1GSP A;  1RCK A;  1FGM A;  2XFS A;  1LNH A;  3DZL A;  3NBJ A;  3Q2P A;  4O3V A;  7STD A;  2GU1 A;  1MWR A;  3KSE D;  3N54 B;  3CD6 3;  4KZ1 A;  2XH9 A;  1SAR A;  3HZP A;  1BRK A;  4HM6 B;  1O7H B;  1L5G B;  3SED A;  1MNL A;  1G02 A;  4L7K A;  3NQZ A;  1UDI I;  2XGL A;  3CPW 2;  3DH2 A;  1YGW A;  4IPB A;  4BU4 A;  2D42 A;  4N6O B;  3V99 A;  3WHO A;  3JVC A;  3X40 A;  3EHC A;  5G1K A;  1K9M 4;  2BO9 B;  1A2K A;  3D9R A;  1M1X B;  3BNC A;  3FZW A;  1BSD A;  3HII A;  5IEN A;  2OTL 3;  4RNZ A;  1O7M B;  5D83 A;  5IG4 A;  1OGZ A;  2K54 A;  3L0R A;  3NQY A;  3NV0 B;  1A67 A;  3CCU 3;  2HOH A;  4J5K A;  1AR0 A;  1FGO A;  3I55 3;  1YJW 3;  1RDS A;  5LC7 A;  4DKI A;  3CCE 3;  1SPU A;  1FA3 A;  1OPY A;  2BMR B;  1UUW B;  1B2X A;  3NBR A;  1VQ7 3;  1IT7 A;  3QK9 A;  4O02 B;  3CMA 3;  2HMO B;  2UGI A;  1I3I A;  1GMP A;  2KXG A;  2O3O A;  3PYJ A;  1RKY A;  3B7C A;  5IG5 A;  3U1W A;  1OF5 B;  2XR8 B;  1GY5 A;  2GU3 A;  5AEU B;  1RGH A;  2GSP A;  3CCL 3;  2D1W A;  3NXJ A;  3NHX A;  5HGR A;  1BAO A;  1OHS A;  1JJ2 2;  4MMY B;  1QVF 2;  2L4V A;  3S29 A;  1DMM A;  1LRA A;  1STD A;  5STD A;  2B24 B;  3EQQ B;  1R4Y A;  2OQE C;  1IVU A;  1ULI B;  1FGT A;  1IVX A;  1UI7 A;  3MPH A;  1RLS A;  1HZ1 A;  4QWT A;  7RNT A;  1OUN A;  1HYF A;  1N5P A; 
#chains in the Genus database with same CATH homology
 1US1 A;  1N8R 4;  1F8N A;  1K41 A;  4K1V A;  1TP6 A;  4WP5 A;  3EC9 A;  2HMK B;  2CK3 H;  2ZL8 A;  3G0K A;  1W6Y A;  2XEP A;  5FW5 A;  1VQP 3;  2F99 A;  5G2G A;  4MMZ B;  3OW2 2;  3GRD A;  3SOA A;  3ER7 A;  3DMC A;  4XBX A;  4ZM8 A;  4CDL A;  1IK3 A;  3GWR A;  1V74 A;  1KQS 2;  1N8Q A;  2XF3 A;  2CFW A;  2OOV C;  3T0U A;  3CNM A;  1GD4 A;  3Q90 A;  1R4C A;  3JUP A;  5IW9 A;  3FLJ A;  1ZX2 A;  2K0M A;  2CFK A;  3EE1 A;  3PCS A;  2CWV A;  3F8H A;  1EA2 A;  4KFF A;  1ROV A;  1IDP A;  4HVN A;  2O9U X;  4FMD A;  3B4P A;  3OXA A;  1M1K 4;  4R1K A;  1OHO A;  5IF6 A;  1OAC A;  2P0M A;  4MJD A;  5D82 A;  4WWU C;  3EB8 A;  3DXO A;  3FSD A;  1G96 A;  1W01 A;  3KN4 A;  1YIT 3;  3NM7 A;  5KP4 A;  3VGN A;  1YHQ 3;  1VQM 3;  4HYZ A;  2Z76 A;  2Z77 A;  4RZM A;  3OWY A;  1ZO2 A;  3CME 3;  3U97 A;  1S5A A;  3X3X A;  1IQ8 A;  2E2U A;  2E2T A;  2RGQ A;  2BHM A;  4HJL B;  3G8Z A;  3F9S A;  2W9P A;  2QGU A;  4WYK A;  5D81 A;  2GBW B;  1K8A 4;  3DGL A;  3IPT A;  3MG3 A;  1KC8 4;  2FXT A;  3EX9 A;  2HMJ B;  1SQW A;  1YIJ 3;  1JRQ A;  3DUK A;  4WHA A;  1KSI A;  2Z6B A;  2CG1 A;  2CFG A;  4GB5 A;  2M7O A;  3PS8 A;  4TX4 A;  1J2B A;  1VQO 3;  2IMJ A;  3WOE B;  1C7H A;  5DRE A;  2IUJ A;  1M90 4;  3WA3 A;  2Z7A A;  1LXE A;  4LZI A;  3UB1 A;  2OTJ 3;  1Z1S A;  1QVG 2;  3MYT A;  1Q81 4;  2JQ5 A;  2W03 A;  3GZY B;  3KSP A;  2ZDJ A;  3OWS A;  5KP1 A;  3G6E 3;  1WNH A;  4HZ9 B;  3RGA A;  3SX1 A;  2C11 A;  3AMO A;  1KWI A;  3UL6 A;  3F40 A;  3BLZ A;  4FCZ A;  1QAL A;  3M8C A;  3ROB A;  1JN5 A;  2CHC A;  2PNC A;  2W56 B;  3DGO A;  1YJ9 3;  3CCV 3;  1A67 A;  1IU7 A;  4H61 A;  3WDG B;  4EV5 A;  3T8U A;  4STD A;  3HX8 A;  2OCT A;  4FCM A;  3GZX B;  5ELJ A;  2P0X A;  3DY5 A;  2Y73 A;  4JF8 A;  3LZA A;  3CCS 3;  1E3R A;  2E2V A;  3FF2 A;  3ECF A;  3QRD A;  4HM7 B;  3IMA B;  2CFD A;  1E3V A;  3N8B A;  2JDI H;  1UUV B;  3LTD A;  1Q40 A;  5IEO A;  3CCM 3;  1Q82 4;  3TDG A;  4EC6 A;  3OV4 A;  1A2V A;  4LSO A;  1O7G B;  2CW9 A;  6STD A;  4G1M B;  5IER A;  1IQX A;  2WOH A;  1OCV A;  1CYV A;  1N5H A;  2RFR A;  3PZW A;  4HM0 B;  4R9L A;  1W7C A;  1JNQ A;  4J8T A;  2V1L A;  5JPP A;  3J7Y d;  3EF8 A;  3HI7 A;  4XM4 A;  3X42 A;  4HM2 B;  3SOY A;  5CLK A;  3NUV A;  4OK0 A;  2IA7 A;  1JKG B;  3K7C A;  2PZV A;  4EBG A;  3LXU X;  4IT7 A;  1GD3 A;  4L8P A;  2XSO B;  1PFP A;  4JRF A;  3CPO A;  4HM4 B;  3NX0 A;  2YFJ B;  4Q53 A;  2QA4 3;  4BTW A;  2W0Q A;  2BT3 A;  2P09 A;  3LYG A;  4FMB A;  4FMC A;  3KE7 A;  5EVH A;  4WFO A;  1CQS A;  3H51 A;  3A76 A;  5EQL A;  3CC7 3;  4HM5 B;  2GEY A;  4FCJ A;  1IVV A;  4O2H A;  4X2O A;  4N6U A;  2HMN B;  1HU9 A;  1BUQ A;  4N6T A;  1LOX A;  5CXO A;  3DGN A;  3HIG A;  3KII A;  1TUH A;  2HMM B;  2XGN A;  3KKG A;  1GS3 A;  3EBT A;  3V98 A;  2W6J H;  8CHO A;  1W2Z A;  4N6M A;  1EG9 B;  2A15 A;  3DGM A;  3DM8 A;  3MKI A;  3O8Y A;  4KFD A;  3X3Y A;  5BXQ A;  2GXF A;  5DRV A;  4IIA A;  4H3U A;  1RJO A;  1MOL A;  1WTH A;  2FNQ A;  1U5O A;  4I4K A;  4XDW A;  5ELU A;  1JB4 A;  1ASK A;  4XBY A;  1SIH A;  3Q1C A;  2OQE A;  2INX A;  1IV7 A;  2WGO A;  1N9J A;  1S72 3;  4R4K A;  2F98 A;  4BTX A;  4NRE A;  5JBS A;  2BNG A;  1VQ4 3;  1GYB A;  3G4S 3;  4XB5 A;  1RN7 A;  4CCV A;  2RSX A;  3EN8 A;  3UL5 A;  3V92 A;  3B4O A;  3UNL A;  2SBL A;  5CF1 A;  3FG1 A;  3JUQ A;  2RCD A;  4KVH A;  5IEP A;  4J9A A;  3K9M C;  5IG0 A;  4FR9 A;  3LTB A;  3FCS B;  3WMD A;  3K5T A;  2QEX 3;  2OOV A;  1WMO A;  1N9E A;  1ROA A;  3F8X A;  1VQL 3;  3PCR A;  1YGE A;  3NV0 A;  4BTY A;  3CCR 3;  1NO3 A;  3G16 A;  3MSO A;  3VSY A;  1Y4K A;  3LTA A;  2BMQ B;  1W02 A;  4GL6 A;  3LML A;  4LGQ A;  1SII A;  3BNB A;  3JUM A;  1EKM A;  2STD A;  2W9Q A;  1DMN A;  4RBN A;  1DVD A;  1VQ6 3;  1GY6 A;  3OWU A;  1W6C A;  4EXR A;  2WGQ A;  1OF5 A;  3S5C A;  4WYK B;  1LVN A;  1TIJ A;  3X41 A;  3MWZ A;  5AI1 A;  1VQ5 3;  2CWU A;  3LT9 A;  5AEW B;  4MEI A;  2FGT A;  4EV2 A;  5AYS C;  2P05 A;  3T8N A;  1QJG A;  3N9H A;  5AII A;  1IVW A;  4EYC A;  3IJE B;  5AYR B;  1ULJ B;  3BNE A;  3UJM A;  3F7S A;  1WMN A;  1JKG A;  5EEO A;  1DMQ A;  1YVB I;  2F86 B;  4KFE A;  5AIG A;  3RGR A;  1QMA A;  3K63 A;  1VZZ A;  3FH1 A;  2YX9 A;  4K1U A;  4HM3 B;  3D3L A;  5A0O B;  2W2C A;  3BB9 A;  2XFT A;  3PXM A;  1AVK A;  4L8O A;  4LMI A;  4N6L A;  4NHF A;  4MMX B;  3KFQ C;  2WOF A;  2ML5 A;  1HKX A;  1W2B 2;  5CF2 A;  2XRX B;  3EN1 B;  3AMO B;  4N6N B;  2R4I A;  2MC8 A;  1KD1 4;  1SJW A;  5AIF A;  1JN5 B;  4LEH A;  1WMP A;  3CNX A;  1AV4 A;  5TGN A;  3K0Z A;  4AKY A;  1W5Z A;  2KCD A;  1Q42 A;  1STF I;  3LT8 A;  1DYU A;  1M9G A;  4XDV A;  2UX0 A;  1OHP A;  4K61 A;  3F14 A;  1IT8 A;  3S28 A;  1AVL A;  2I9W A;  2QIY A;  1DVC A;  2YFI B;  1O7P B;  1WQL B;  1W4N A;  3EJV A;  1NB3 I;  1QAK A;  3BND A;  1OH0 A;  1K28 A;  1W6G A;  3MG1 A;  1FUW A;  4HM1 B;  1U8C B;  1NU3 A;  2W04 A;  3H3H A;  1Q40 B;  1TFO A;  5AIH A;  4RNY A;  3WOF B;  2BMO B;  3E99 A;  1TU5 A;  5FGO A;  3LTC A;  1NJI 4;  2CKF B;  4N3V A;  1JV2 B;  1IV9 A;  5I97 A;  1CEW I;  3FG4 A;  1VQ8 3;  4U13 A;  3CU3 A;  2B1X B;  2MF7 A;  1EQK A;  3STD A;  3SXX A;  3EBY A;  4AKZ A;  2ML6 A;  1E97 A;  3NBB A;  5KP3 A;  3CXC 2;  3FF0 A;  4R9K A;  1FGR A;  3HK4 A;  4XBT A;  1QAF A;  1W00 A;  2P38 A;  3FKA A;  1NDO B;  3SVA A;  1VQ9 3;  1Q7Y 4;  2Q07 A;  4OUQ A;  3CC2 3;  2CIU A;  2CFL A;  1NB5 I;  1TFK A;  1RRL A;  4AEQ A;  3PGB A;  3MG2 A;  3SLU A;  3MHE A;  1D6Y A;  3RDE A;  1OGX A;  3JUO A;  3I0Y A;  1A90 A;  4X2H A;  2HML B;  3ALA A;  1K73 4;  4HZB B;  2GBX B;  3LOY A;  1RRH A;  1NWW A;  3WA2 X;  4ORL A;  1O7W B;  1D6U A;  2XSH B;  3X3Z A;  1CYU A;  1VQN 3;  2OWP A;  2LYX A;  4N6V 0;  3KZT A;  5IG3 A;  3GZR A;  4OVM A;  3GZB A;  4HM8 B;  1YJN 3;  3WOD G;  1VQK 3;  2W56 A;  3B8L A;  3NM2 A;  1FGQ A;  1O7N B;  1T5Y A;  2Y74 A;  2IUK A;  5JPU A;  2CWT A;  2CC3 A;  2CH9 A;  4HKV B;  3G71 3;  1PU4 A;  1IQY A;  4FMA A;  4R80 A;  3CCJ 3;  3F7X A;  4HBR A;  5LC6 A;  3I56 3;  2WO0 A;  2YFL B;  1YI2 3;  3S27 A;  2CG0 A;  3FGY A;  4PEJ A;  3VF1 A;  3FG3 A;  2LQV A;  1D6Z A;  1JB5 A;  1UI8 A;  4K90 B;  5CK6 A;  3CC4 3;  2KRT A;  1UW1 A;  1JB2 A;  3LH4 A;  4O8S A;  5BVB A;  2C10 A;  1Q86 4;  1GY7 A;  3CCQ 3;  3JUN A;  2GEX A;  3S67 A;  1ISK A;  3GAX A;  3OX9 A;  3DZL A;  1FGM A;  2XFS A;  1LNH A;  3Q2P A;  3NBJ A;  4O3V A;  7STD A;  3CD6 3;  2GU1 A;  3KSE D;  3N54 B;  4KZ1 A;  2XH9 A;  3HZP A;  4HM6 B;  1O7H B;  1L5G B;  3SED A;  1MNL A;  4L7K A;  3NQZ A;  2XGL A;  3CPW 2;  4IPB A;  2D42 A;  4N6O B;  3V99 A;  3JVC A;  3X40 A;  3EHC A;  1K9M 4;  2BO9 B;  1A2K A;  3D9R A;  1M1X B;  3BNC A;  3FZW A;  3HII A;  5IEN A;  2OTL 3;  4RNZ A;  1O7M B;  5D83 A;  5IG4 A;  1OGZ A;  2K54 A;  3L0R A;  3NQY A;  3NV0 B;  3CCU 3;  1AR0 A;  1FGO A;  3I55 3;  1YJW 3;  5LC7 A;  3CCE 3;  1SPU A;  1FA3 A;  1OPY A;  2BMR B;  1UUW B;  3NBR A;  1VQ7 3;  1IT7 A;  3QK9 A;  4O02 B;  3CMA 3;  2HMO B;  1RKY A;  2KXG A;  2O3O A;  3PYJ A;  3B7C A;  5IG5 A;  3U1W A;  1OF5 B;  2XR8 B;  1GY5 A;  2GU3 A;  5AEU B;  3CCL 3;  2D1W A;  3NXJ A;  3NHX A;  5HGR A;  1JJ2 2;  1OHS A;  4MMY B;  1QVF 2;  2L4V A;  3S29 A;  1DMM A;  1STD A;  5STD A;  2B24 B;  3EQQ B;  2OQE C;  1IVU A;  1ULI B;  1FGT A;  1IVX A;  1UI7 A;  3MPH A;  4QWT A;  1OUN A;  1N5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...