1YHQ3

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yhq300
1VQO3 1YJN3 3CCQ3 3CPW2 3CCU3 1YJW3 1KQS2 2QA43 1M904 1VQ53 3CCL3 1VQP3 1Q864 1YIT3 1QVF2 1S723 1Q7Y4 1QVG2 1K734 3I553 2QEX3 3CMA3 3CD63 1JJ22 1K8A4 3CC73 3G713 3OW22 1Q824 1VQL3 1YIJ3 3CXC2 3G6E3 1N8R4 1KC84 1VQ43 1YI23 1VQ93 1NJI4 1W2B2 1KD14 1VQ73 1Q814 3CCV3 3CCS3 3CCR3 3CCE3 1VQN3 2OTJ3 1YJ93 1YHQ3 3CC43 1K9M4 1VQ83 3G4S3 3CME3 2OTL3 1VQ63 3CCM3 3CCJ3 1VQK3 3CC23 1VQM3 1M1K4 3I563
chains in the Genus database with same CATH superfamily
4HYZA 1BRSA 3NX0A 5AYRB 3LOYA 4FR9A 1B20A 4WWUC 3K63A 3LT8A 3STDA 5AIFA 2QA43 3V98A 5KP4A 3RDEA 4HJLB 3EHCA 5EEOA 3EE1A 4K61A 1VQ53 1QAFA 2CFGA 4L7KA 1JJ22 4RNZA 1IQYA 1KSIA 3OW22 2O9UX 1SIHA 3K9MC 3X40A 2F5WA 2F86B 3LYGA 2XH9A 3DY5A 2K0MA 3RGRA 6STDA 5EVHA 5IG5A 2O3OA 3K7CA 1BU4A 3AMOB 1W4NA 4O2HA 2HMJB 2BT3A 4N6UA 1AQZA 1W6GA 3OWSA 5IERA 1VQM3 1BRHA 3VSYA 3B4PA 4IIAA 7RNTA 5AEUB 2Z76A 1LOXA 3E99A 5FW5A 1FGTA 4HM3B 3HK4A 1OCVA 3ER7A 1O7HB 4J9AA 2BO9B 4GHOA 3MYTA 3URPA 1VQP3 1V58A 3LXUX 3HIGA 1VQQA 3FH1A 1C54A 1FGQA 1Q9EA 4KVHA 3WHOA 5RNTA 3GZBA 1VQ93 1T2HA 4R9KA 3PXMA 2F5MA 3Q2PA 2BHMA 2P38A 2R41A 4NREA 5IF6A 4CDLA 5M19A 3CCR3 3CNMA 1BSEA 4KZ1A 1CEWI 1DETA 2BMOB 1NB3I 1RNTA 1TFOA 1UI8A 1QMAA 1GMPA 3DGNA 3NHXA 2KF6A 3PCRA 3X3YA 2F98A 1GY6A 1UCLA 2YFLB 3FF2A 2IY2A 2CIUA 1D6ZA 1EA2A 3AGOA 3CU3A 1PYLA 3D5GA 1F8NA 3BNEA 1UCIA 1SPUA 5TGNA 1RDSA 2IUKA 4LMIA 3CC73 2IUJA 3T8UA 3EQQB 1ISKA 1BNGA 1DMMA 3F14A 4JRFA 1MOLA 2XSOB 3D9RA 1BIRA 1Q7HA 1MNLA 5IG3A 2RCDA 4MJDA 2RGQA 3Q90A 3QK9A 1WQLB 3LTDA 1BUQA 2CX1A 2BIRA 5FGOA 1R4YA 5STDA 1UUWB 1V74A 3JUOA 1LXEA 7STDA 2H0GA 5JPPA 1M1K4 1W7CA 3J7Yd 4XM4A 1GOUA 2W6JH 5G1KA 3F8HA 1BUJA 1OPYA 2B24B 1FZUA 1OGZA 4FMCA 2UGIA 1RLSA 2CK3H 1ZX2A 3LH4A 1YIT3 1EEJA 2XEPA 1PU4A 1S5AA 4GB5A 5IG0A 1YGWA 1Q824 3S28A 4BTYA 2CWUA 2HOHA 4STDA 3WA3A 1OF5B 3UNLA 1SIIA 3MG3A 2WOHA 1BSDA 4EW5A 4CCVA 1PFPA 5IEPA 3LT9A 3EC9A 1VQN3 1Q40A 2R4IA 1I0XA 1BNFA 1QAKA 2BU4A 2CH9A 6GSPA 1VQ63 1IU7A 1KWIA 3V99A 1I8VA 1I3IA 1BAOA 4FMDA 2GSPA 1RRHA 3BU4A 3G0KA 1R4CA 1KQS2 1BOXA 1NWWA 3OWYA 3WOEB 4BIRA 1FUWA 1Y4KA 3FZWA 3FSDA 4R9LA 1QVF2 1NNVA 3CD63 5ELJA 3EX9A 4HM4B 1A2PA 3G713 1FUSA 2D1WA 2I9WA 3K5TA 4ZM8A 1N8R4 1YNVX 2W03A 1YVSA 2BMRB 5JPUA 1IK3A 1TRPA 2PNCA 1LOYA 3DGMA 1O7MB 4FCJA 4IT7A 5G1LA 3CCS3 4IPBA 2E2TA 4H3UA 1YJ93 1VZZA 5D81A 1B2MA 2QIYA 3CC43 2HMOB 2E2UA 1GYBA 2H0IA 4WYKA 1AR0A 1TTOA 1BRIA 1RJOA 1O7NB 1TUHA 4I5QA 1B2UA 1JZOA 1YJN3 3X3XA 1JBSA 2F4YA 2XF3A 4LEHA 1LVNA 3KKGA 3EBYA 1B2XA 2IYJA 4EV2A 1O7WB 1CYUA 4R4KA 2W9PA 1S723 4FCMA 1K734 3I553 4R80A 1AV4A 4OUQA 3SOYA 1U8CB 5DREA 4EBGA 2BMQB 2Q07A 4N6TA 3NV0B 1EKMA 1RGLA 3VF1A 8CHOA 4R1KA 1IT7A 2AADA 3OV4A 4LZIA 4BTXA 1RGEA 2WGQA 4LYLB 3VGNA 1DVDA 2CX0A 3GAXA 2XFSA 7GSPA 2INXA 2RNTA 3KSED 1OHOA 1JV2B 2OTJ3 1WMOA 1LOWA 1U5OA 3NBRA 8RNTA 1TU5A 1JNQA 3S5CA 3NUVA 1VQK3 1ASKA 1E3RA 1X1WA 3EN8A 3A76A 3UJMA 2OOVC 2W2CA 3B8LA 1BNSA 2L4VA 1JKGA 4XBYA 5DRVA 2P05A 1N5PA 5IW9A 4WHAA 3JVCA 2ZDJA 2HMNB 2CKFB 1UGIA 3DM8A 1BNEA 3UB1A 2GU3A 2QEX3 3AHWA 1BSCA 1E97A 1DYUA 1RGHA 2W56B 4NPBA 2YX9A 1SJWA 1RGCA 4CJNA 4AKYA 3TDGA 2W0QA 2ZHXB 3SVAA 1NU3A 1KD14 4HM2B 1L5GB 2ML5A 3X41A 1RTUA 4I4KA 4J5KA 2KF4A 4HM7B 2ZL8A 4HVNA 3HX8A 4HM1B 2OQEA 1MWUA 3CNXA 3AHSA 2GEYA 1V57A 3MWZA 3SX1A 2RBIA 2E2VA 2MF7A 2Z6BA 4DKIA 2LYXA 3GZXB 2XFTA 1JB2A 1GY5A 3Q3FA 1W6CA 5BVBA 1A67A 2V1LA 2CHCA 3SYUA 2ZA4A 1HZ1A 1RMSA 1IDPA 1VQL3 1JN5B 2GEXA 4MEIA 4N3VA 1YGEA 5LC6A 3U1WA 5JBSA 1KC84 3G16A 2W9QA 2CFWA 3ECFA 3BIRA 1A90A 4MMYB 2A15A 1FGRA 3MPHA 1W01A 5IG4A 1IQXA 1T5YA 1TIJA 1ZGXA 3MSOA 3NQYA 1GSPA 1ULJB 4NHFA 4OVMA 3DMCA 4N6MA 3UL6A 1YHQ3 1RCKA 1JBTA 1B3SA 1VQ83 1HKXA 4HM0B 4WYKB 5GSPA 1VQO3 1N5HA 2K3DA 3F9SA 3HI7A 1X1XA 3WA2X 1RCLA 1RN7A 1QJGA 1ROAA 3N8BA 4RBNA 1NB5I 1W6YA 2GU1A 2KXGA 1I2FA 1LNIA 3KIIA 4EYCA 1GS3A 3DH2A 2CW9A 4OK0A 3FG1A 2SARA 4BTWA 1YIJ3 1FYSA 1TJDA 2OQEC 1D6YA 1IYYA 1M1XB 1BSAA 2Y74A 3BLZA 1OH0A 3IJEB 1G02A 3AMOA 1CYVA 1MWRA 1Q42A 1WTHA 5CK6A 1ROVA 4K1VA 3EB8A 1OGXA 1YVBI 2AAEA 3G8ZA 3MG1A 4TX4A 1RSNA 4O8SA 4K90B 4FCZA 1UUVB 3I563 1ZO2A 4EC6A 1UW1A 1JKGB 5AIGA 2XR8B 1RHLA 3LTCA 1TFKA 3IPTA 3S27A 1IQ8A 4HM5B 2B1XB 1RN1A 3FG4A 9RNTA 1AVKA 1BNJA 1CH0A 1LRAA 4XBTA 3ROBA 2CWTA 3LMLA 3WR2A 5KP1A 1RGKA 3QRDA 4H61A 2CFLA 3GRDA 1O7GB 2OOVA 4X2HA 4U13A 1DVCA 3PZWA 1IV7A 1K28A 2Z7AA 1D6UA 1HU9A 1ZS7A 3KN4A 3WMDA 1G0TA 1JZDA 3EN1B 2GXFA 3FG3A 3DGLA 1WMNA 1G96A 1TRQA 1UGHI 3CME3 2KAAA 1DMQA 1K41A 2OTL3 2FGTA 3T0UA 1STFI 4KT3B 3ALAA 3PS8A 2ML6A 4BU4A 1B21A 1AVLA 1AY7A 4N6NB 5CXOA 2M7OA 2C4BA 3CCQ3 4CPKA 2OWPA 3RGAA 4XDWA 3FF0A 4QWTA 3F40A 1SQWA 4GL6A 4HBRA 5AI1A 3HIIA 3BB9A 3JUQA 2GBXB 5CF1A 2J8XB 2XGLA 4K1UA 1FA3A 5D83A 4MMZB 1BVIA 2BNGA 1IV9A 2P0XA 1GD3A 1W02A 3GSPA 5M18A 1J2BA 3CXC2 3PCSA 5KP3A 3GWRA 5ELUA 1UCKA 1FUTA 1US1A 1YI23 1I70A 1W2ZA 4JF8A 3OXAA 2CFDA 1BNRA 1RGFA 3SEDA 3UL5A 2KCDA 1Q814 1BRNL 2JDIH 1JRQA 4HOHA 3JUNA 1ULIB 1BRKA 1LQGC 3DGYA 5IENA 1BSBA 4ORLA 2CC3A 2XRXB 3GZYB 3JUPA 4N6OB 1A2KA 4RNTA 5BU4A 1DMNA 4XB5A 1BRJA 1OHSA 3CCU3 1HYFA 1N9JA 1YJW3 1M9GA 1I0VA 3MHEA 4O3VA 4HM8B 3SXXA 1STDA 1FGOA 1RKYA 1DE3A 5BXQA 1BRGA 1LNHA 3FGYA 3NM2A 3CMA3 2F99A 1K8A4 5D82A 3N9HA 3AGNA 4HM6B 5I97A 1OF5A 3NXJA 3D3LA 3T8NA 1NJI4 2STDA 1W2B2 2CWVA 1RRLA 1T3BA 1FW7A 2WGOA 3DUKA 1W5ZA 2KRTA 4N6LA 3EF8A 1Q40B 4WP5A 5A0OB 5G2GA 3OWUA 2XSHB 3RNTA 1EG9B 1W00A 3U97A 1MGRA 1N8QA 2LQVA 1OHPA 1UUGB 3B7CA 4HZBB 3H3HA 3OX9A 1NDOB 5AIHA 3KE7A 1EUIC 2CG0A 1I2GA 5HOHA 2WO0A 1Q864 3FCSB 4KFFA 4GSPA 3DXOA 4BL2A 1EQKA 5AIIA 3BNBA 1N9EA 2FNQA 4RNYA 1BANA 1GMQA 3M8CA 4LGQA 5IEOA 1SARA 4Q53A 1LOVA 1UDII 2FXTA 1VQ73 3CCE3 2F56A 5CLKA 1A2VA 2JQ5A 3D4AA 1FGMA 1O7PB 1C7HA 1B27A 2HMMB 3G4S3 3EBTA 1OUNA 3KSPA 4X2OA 2KF3A 5BIRA 1I3FA 3X3ZA 1WNHA 1X1UA 3CPW2 3HOHA 3EJVA 3NBBA 4ILFA 4WFOA 5LC7A 3SLUA 3CPOA 3S67A 3SOAA 2UUGC 1BNIA 3Q1CA 3CCL3 3HZPA 1JBRA 2CFKA 1E3VA 3LTBA 3NV0A 1GOVA 2H0HA 3KFQC 4HAAA 2WOFA 3FKAA 3BNCA 3WODG 2YFIB 3G6E3 2Z77A 1VQ43 1PY3A 4RZMA 1X1YA 3F7SA 2YFJB 3MKIA 2IA7A 4AKZA 1IVWA 4KFDA 1MWTA 2UX0A 1B2ZA 2D42A 2W04A 1K9M4 1TP6A 3GZRA 3WDGB 1GOYA 4BL3A 1IT8A 1WMPA 4L8OA 4PEJA 2PZVA 1RNBA 2GBWB 2XGNA 3NBJA 4J8TA 2KF5A 3NQZA 3V92A 5CF2A 6RNTA 3KCHA 2P09A 1CQSA 1M904 3L0RA 4O02B 1JB4A 2P0MA 4L8PA 4EXRA 1QVG2 2W56A 2HMLB 4FMBA 1T2IA 1RGAA 2IMJA 4MMXB 3K0ZA 4HZ9B 4J5GA 1RN4A 2K54A 5M1AA 4G1MB 1GY7A 2L1SA 2CG1A 3NM7A 4XBXA 4HKVB 3ZG0A 3ZFZA 3CCV3 1IVVA 1BGSA 3A5EA 2SBLA 2OCTA 2C11A 3F7XA 3KZTA 3CCM3 3MG2A 3CCJ3 3LZAA 3LTAA 1MWSA 1JB5A 1QALA 3N54B 3PYJA 2Y73A 3IMAB 1GD4A 4LSOA 5HGRA 1MGWA 3DGOA 3B4OA 2MC8A 3X42A 1Q7Y4 5EQLA 2HMKB 4N6V0 3H51A 3JUMA 4XDVA 1JN5A 4AEQA 3ZG5A 2QGUA 1IVUA 3WOFB 3S29A 3D79A 5AEWB 2RFRA 3I0YA 3DZLA 4EV5A 3PGBA 2C10A 1LQMB 1GMRA 1IVXA 3FLJA 3O8YA 1OACA 1NO3A 3BNDA 5AYSC 1I2EA 4KFEA 1RGGA 1UCJA 1UI7A 1B2SA 2RSXA 1Z1SA 4FMAA 3CC23 3F8XA 3D5IA
chains in the Genus database with same CATH topology
4HYZA 3NX0A 5AYRB 3LOYA 4FR9A 4WWUC 3K63A 3LT8A 3STDA 5AIFA 2QA43 3V98A 5KP4A 3RDEA 4HJLB 3EHCA 5EEOA 3EE1A 4K61A 1VQ53 1QAFA 2CFGA 4L7KA 1JJ22 4RNZA 1IQYA 1KSIA 3OW22 2O9UX 1SIHA 3K9MC 3X40A 2F86B 3LYGA 2XH9A 3DY5A 2K0MA 3RGRA 6STDA 5EVHA 5IG5A 2O3OA 3K7CA 3AMOB 1W4NA 4O2HA 2HMJB 2BT3A 4N6UA 1W6GA 5IERA 1VQM3 3VSYA 3B4PA 4IIAA 5AEUB 2Z76A 1LOXA 3E99A 5FW5A 1FGTA 4HM3B 3HK4A 1OCVA 3ER7A 1O7HB 4J9AA 2BO9B 3MYTA 1VQP3 3LXUX 3HIGA 3FH1A 1FGQA 4KVHA 3GZBA 1VQ93 4R9KA 3PXMA 3Q2PA 2BHMA 2P38A 4NREA 5IF6A 4CDLA 3CCR3 3CNMA 4KZ1A 1CEWI 2BMOB 1NB3I 1TFOA 1UI8A 1QMAA 3DGNA 3NHXA 3PCRA 3X3YA 2F98A 1GY6A 2YFLB 3FF2A 2CIUA 1D6ZA 1EA2A 3CU3A 1F8NA 3BNEA 1SPUA 5TGNA 2IUKA 4LMIA 3CC73 2IUJA 3T8UA 3EQQB 1ISKA 3F14A 1DMMA 4JRFA 1MOLA 2XSOB 3D9RA 1MNLA 5IG3A 2RCDA 4MJDA 2RGQA 3Q90A 3QK9A 1WQLB 3LTDA 1BUQA 5FGOA 5STDA 1UUWB 1V74A 3JUOA 1LXEA 7STDA 5JPPA 1M1K4 1W7CA 3J7Yd 4XM4A 2W6JH 3F8HA 1OPYA 2B24B 1OGZA 4FMCA 2CK3H 1ZX2A 3LH4A 1YIT3 2XEPA 1PU4A 1S5AA 4GB5A 5IG0A 1Q824 3S28A 4BTYA 2CWUA 4STDA 3WA3A 1OF5B 3UNLA 1SIIA 3MG3A 2WOHA 4CCVA 1PFPA 5IEPA 3LT9A 3EC9A 1VQN3 1Q40A 2R4IA 2CH9A 1QAKA 1VQ63 1IU7A 1KWIA 3V99A 4FMDA 1RRHA 3G0KA 1R4CA 1KQS2 3OWYA 1NWWA 3WOEB 1FUWA 1Y4KA 3FZWA 3FSDA 4R9LA 1QVF2 3CD63 5ELJA 3EX9A 4HM4B 3G713 2D1WA 2I9WA 3K5TA 4ZM8A 1N8R4 2W03A 2BMRB 5JPUA 1IK3A 2PNCA 3DGMA 1O7MB 4FCJA 4IT7A 3CCS3 4IPBA 2E2TA 4H3UA 1YJ93 1VZZA 5D81A 2QIYA 3CC43 2HMOB 2E2UA 1GYBA 4WYKA 1AR0A 1RJOA 1O7NB 1TUHA 1YJN3 3X3XA 2XF3A 4LEHA 1LVNA 3KKGA 3EBYA 4EV2A 1O7WB 1CYUA 4R4KA 2W9PA 1S723 4FCMA 1K734 3I553 4R80A 1AV4A 4OUQA 3SOYA 1U8CB 5DREA 4EBGA 2BMQB 2Q07A 4N6TA 3NV0B 1EKMA 3VF1A 8CHOA 4R1KA 1IT7A 4LZIA 3OV4A 4BTXA 2WGQA 3VGNA 1DVDA 3GAXA 2XFSA 2INXA 3KSED 1OHOA 1JV2B 2OTJ3 1WMOA 1U5OA 3NBRA 1TU5A 1JNQA 3S5CA 3NUVA 1VQK3 1ASKA 1E3RA 3EN8A 3A76A 3UJMA 2OOVC 2W2CA 3B8LA 2L4VA 4XBYA 1JKGA 5DRVA 2P05A 1N5PA 5IW9A 4WHAA 3JVCA 2ZDJA 2HMNB 2CKFB 3DM8A 3UB1A 2GU3A 2QEX3 1E97A 1DYUA 2W56B 2YX9A 1SJWA 4AKYA 3TDGA 2W0QA 3SVAA 1NU3A 1KD14 4HM2B 1L5GB 2ML5A 3X41A 4I4KA 4HM7B 2ZL8A 4HVNA 3HX8A 4HM1B 2OQEA 3CNXA 2GEYA 3SX1A 3MWZA 2E2VA 2MF7A 2Z6BA 2LYXA 3GZXB 2XFTA 1JB2A 1GY5A 1W6CA 5BVBA 1A67A 2V1LA 2CHCA 1IDPA 1VQL3 1JN5B 2GEXA 4MEIA 4N3VA 1YGEA 5LC6A 3U1WA 5JBSA 1KC84 3G16A 2W9QA 2CFWA 3ECFA 1A90A 4MMYB 2A15A 1FGRA 3MPHA 1W01A 5IG4A 1IQXA 1T5YA 1TIJA 3MSOA 3NQYA 4NHFA 1ULJB 4OVMA 5A0OB 1YHQ3 3DMCA 4N6MA 3UL6A 1VQ83 1HKXA 4HM0B 4WYKB 1VQO3 1N5HA 3F9SA 3HI7A 3WA2X 1ROAA 1RN7A 1QJGA 3N8BA 4RBNA 1NB5I 1W6YA 2GU1A 2KXGA 3KIIA 4EYCA 1GS3A 2CW9A 4OK0A 3FG1A 4BTWA 1YIJ3 2OQEC 1D6YA 1M1XB 2Y74A 3BLZA 3IJEB 1OH0A 3AMOA 1CYVA 1Q42A 1WTHA 5CK6A 1ROVA 4K1VA 3EB8A 1OGXA 1YVBI 3G8ZA 3MG1A 4TX4A 4O8SA 4K90B 4FCZA 1UUVB 3I563 1ZO2A 4EC6A 1UW1A 1JKGB 5AIGA 2XR8B 3LTCA 3S27A 1TFKA 3IPTA 1IQ8A 4HM5B 2B1XB 3FG4A 1AVKA 4XBTA 5KP1A 3ROBA 2CWTA 3LMLA 3QRDA 4H61A 2CFLA 3GRDA 1O7GB 2OOVA 4X2HA 4U13A 1DVCA 3PZWA 1IV7A 1K28A 2Z7AA 1D6UA 1HU9A 3KN4A 3WMDA 3EN1B 2GXFA 3FG3A 3DGLA 1WMNA 1G96A 3CME3 1DMQA 1K41A 2OTL3 2FGTA 3T0UA 1STFI 3ALAA 3PS8A 2ML6A 1AVLA 4N6NB 5CXOA 2M7OA 3CCQ3 2OWPA 3RGAA 4XDWA 3FF0A 4QWTA 3F40A 1SQWA 4GL6A 4HBRA 5AI1A 3HIIA 3BB9A 3JUQA 2GBXB 5CF1A 2XGLA 4K1UA 1FA3A 5D83A 4MMZB 2BNGA 2P0XA 1IV9A 1J2BA 1GD3A 1W02A 3CXC2 3PCSA 5KP3A 3GWRA 5ELUA 1US1A 1YI23 4JF8A 1W2ZA 3OXAA 2CFDA 3SEDA 3UL5A 2KCDA 1Q814 2JDIH 1JRQA 3JUNA 1ULIB 5IENA 4ORLA 2CC3A 2XRXB 3GZYB 3JUPA 4N6OB 1A2KA 1DMNA 4XB5A 1OHSA 3CCU3 1YJW3 1N9JA 1M9GA 3MHEA 4O3VA 4HM8B 3SXXA 1STDA 1FGOA 1RKYA 5BXQA 1LNHA 3FGYA 3NM2A 3CMA3 2F99A 1K8A4 5D82A 3N9HA 4HM6B 5I97A 1OF5A 3NXJA 3D3LA 3T8NA 1NJI4 2STDA 1W2B2 2CWVA 1RRLA 2WGOA 3DUKA 1W5ZA 2KRTA 4N6LA 3EF8A 1Q40B 4WP5A 5G2GA 3OWUA 2XSHB 1EG9B 1W00A 3U97A 1N8QA 2LQVA 1OHPA 3B7CA 4HZBB 3H3HA 3OX9A 1NDOB 5AIHA 3KE7A 2CG0A 2WO0A 1Q864 3FCSB 4KFFA 3DXOA 1EQKA 5AIIA 3BNBA 1N9EA 2FNQA 4RNYA 3M8CA 4LGQA 5IEOA 4Q53A 1VQ73 2FXTA 3CCE3 5CLKA 1A2VA 2JQ5A 1FGMA 1O7PB 1C7HA 2HMMB 3G4S3 3EBTA 1OUNA 3KSPA 4X2OA 3X3ZA 1WNHA 3CPW2 3NBBA 3EJVA 4WFOA 5LC7A 3SLUA 3CPOA 3S67A 3SOAA 3Q1CA 3CCL3 3HZPA 2CFKA 1E3VA 3LTBA 3NV0A 3KFQC 2WOFA 3FKAA 3BNCA 3WODG 2YFIB 3G6E3 2Z77A 1VQ43 4RZMA 3F7SA 2YFJB 3MKIA 2IA7A 4AKZA 1IVWA 4KFDA 2UX0A 2D42A 2W04A 1K9M4 1TP6A 3GZRA 3WDGB 1IT8A 1WMPA 4L8OA 4PEJA 2PZVA 2GBWB 2XGNA 3NBJA 4J8TA 3NQZA 3V92A 5CF2A 2P09A 1CQSA 1M904 3L0RA 4O02B 1JB4A 2P0MA 4L8PA 4EXRA 1QVG2 2W56A 2HMLB 4FMBA 2IMJA 4MMXB 3K0ZA 4HZ9B 2K54A 4G1MB 1GY7A 2CG1A 3NM7A 4XBXA 4HKVB 3CCV3 1IVVA 2SBLA 2OCTA 2C11A 3F7XA 3KZTA 3CCM3 3MG2A 3CCJ3 3LZAA 3LTAA 1QALA 1JB5A 3N54B 3PYJA 2Y73A 3IMAB 1GD4A 4LSOA 5HGRA 3DGOA 3B4OA 2MC8A 3X42A 1Q7Y4 5EQLA 2HMKB 4N6V0 3H51A 3JUMA 4XDVA 1JN5A 4AEQA 2QGUA 1IVUA 3WOFB 3S29A 5AEWB 2RFRA 3I0YA 3DZLA 4EV5A 3PGBA 2C10A 1IVXA 3FLJA 3O8YA 1OACA 1NO3A 3BNDA 5AYSC 4KFEA 1UI7A 2RSXA 4FMAA 1Z1SA 3CC23 3F8XA 3OWSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO 3;  1YJN 3;  3CCQ 3;  3CPW 2;  3CCU 3;  1YJW 3;  1KQS 2;  2QA4 3;  1M90 4;  1VQ5 3;  3CCL 3;  1VQP 3;  1Q86 4;  1YIT 3;  1QVF 2;  1S72 3;  1Q7Y 4;  1QVG 2;  1K73 4;  3I55 3;  2QEX 3;  3CMA 3;  3CD6 3;  1JJ2 2;  1K8A 4;  3CC7 3;  3G71 3;  3OW2 2;  1Q82 4;  1VQL 3;  1YIJ 3;  3CXC 2;  3G6E 3;  1N8R 4;  1KC8 4;  1VQ4 3;  1YI2 3;  1VQ9 3;  1NJI 4;  1W2B 2;  1KD1 4;  1VQ7 3;  1Q81 4;  3CCV 3;  3CCS 3;  3CCR 3;  3CCE 3;  1VQN 3;  2OTJ 3;  1YJ9 3;  1YHQ 3;  3CC4 3;  1K9M 4;  1VQ8 3;  3G4S 3;  3CME 3;  2OTL 3;  1VQ6 3;  3CCM 3;  3CCJ 3;  1VQK 3;  3CC2 3;  1VQM 3;  1M1K 4;  3I56 3; 
#chains in the Genus database with same CATH topology
 4HYZ A;  1BRS A;  3NX0 A;  5AYR B;  3LOY A;  4FR9 A;  1B20 A;  4WWU C;  3K63 A;  3LT8 A;  3STD A;  5AIF A;  2QA4 3;  3V98 A;  5KP4 A;  3RDE A;  4HJL B;  3EHC A;  5EEO A;  3EE1 A;  4K61 A;  1VQ5 3;  1QAF A;  2CFG A;  4L7K A;  1JJ2 2;  4RNZ A;  1IQY A;  1KSI A;  3OW2 2;  2O9U X;  1SIH A;  3K9M C;  3X40 A;  2F5W A;  2F86 B;  3LYG A;  2XH9 A;  3DY5 A;  2K0M A;  3RGR A;  6STD A;  5EVH A;  5IG5 A;  2O3O A;  3K7C A;  1BU4 A;  3AMO B;  1W4N A;  4O2H A;  2HMJ B;  2BT3 A;  4N6U A;  1AQZ A;  1W6G A;  3OWS A;  5IER A;  1VQM 3;  1BRH A;  3VSY A;  3B4P A;  4IIA A;  7RNT A;  5AEU B;  2Z76 A;  1LOX A;  3E99 A;  5FW5 A;  1FGT A;  4HM3 B;  3HK4 A;  1OCV A;  3ER7 A;  1O7H B;  4J9A A;  2BO9 B;  4GHO A;  3MYT A;  3URP A;  1VQP 3;  1V58 A;  3LXU X;  3HIG A;  1VQQ A;  3FH1 A;  1C54 A;  1FGQ A;  1Q9E A;  4KVH A;  3WHO A;  5RNT A;  3GZB A;  1VQ9 3;  1T2H A;  4R9K A;  3PXM A;  2F5M A;  3Q2P A;  2BHM A;  2P38 A;  2R41 A;  4NRE A;  5IF6 A;  4CDL A;  5M19 A;  3CCR 3;  3CNM A;  1BSE A;  4KZ1 A;  1CEW I;  1DET A;  2BMO B;  1NB3 I;  1RNT A;  1TFO A;  1UI8 A;  1QMA A;  1GMP A;  3DGN A;  3NHX A;  2KF6 A;  3PCR A;  3X3Y A;  2F98 A;  1GY6 A;  1UCL A;  2YFL B;  3FF2 A;  2IY2 A;  2CIU A;  1D6Z A;  1EA2 A;  3AGO A;  3CU3 A;  1PYL A;  3D5G A;  1F8N A;  3BNE A;  1UCI A;  1SPU A;  5TGN A;  1RDS A;  2IUK A;  4LMI A;  3CC7 3;  2IUJ A;  3T8U A;  3EQQ B;  1ISK A;  1BNG A;  1DMM A;  3F14 A;  4JRF A;  1MOL A;  2XSO B;  3D9R A;  1BIR A;  1Q7H A;  1MNL A;  5IG3 A;  2RCD A;  4MJD A;  2RGQ A;  3Q90 A;  3QK9 A;  1WQL B;  3LTD A;  1BUQ A;  2CX1 A;  2BIR A;  5FGO A;  1R4Y A;  5STD A;  1UUW B;  1V74 A;  3JUO A;  1LXE A;  7STD A;  2H0G A;  5JPP A;  1M1K 4;  1W7C A;  3J7Y d;  4XM4 A;  1GOU A;  2W6J H;  5G1K A;  3F8H A;  1BUJ A;  1OPY A;  2B24 B;  1FZU A;  1OGZ A;  4FMC A;  2UGI A;  1RLS A;  2CK3 H;  1ZX2 A;  3LH4 A;  1YIT 3;  1EEJ A;  2XEP A;  1PU4 A;  1S5A A;  4GB5 A;  5IG0 A;  1YGW A;  1Q82 4;  3S28 A;  4BTY A;  2CWU A;  2HOH A;  4STD A;  3WA3 A;  1OF5 B;  3UNL A;  1SII A;  3MG3 A;  2WOH A;  1BSD A;  4EW5 A;  4CCV A;  1PFP A;  5IEP A;  3LT9 A;  3EC9 A;  1VQN 3;  1Q40 A;  2R4I A;  1I0X A;  1BNF A;  1QAK A;  2BU4 A;  2CH9 A;  6GSP A;  1VQ6 3;  1IU7 A;  1KWI A;  3V99 A;  1I8V A;  1I3I A;  1BAO A;  4FMD A;  2GSP A;  1RRH A;  3BU4 A;  3G0K A;  1R4C A;  1KQS 2;  1BOX A;  1NWW A;  3OWY A;  3WOE B;  4BIR A;  1FUW A;  1Y4K A;  3FZW A;  3FSD A;  4R9L A;  1QVF 2;  1NNV A;  3CD6 3;  5ELJ A;  3EX9 A;  4HM4 B;  1A2P A;  3G71 3;  1FUS A;  2D1W A;  2I9W A;  3K5T A;  4ZM8 A;  1N8R 4;  1YNV X;  2W03 A;  1YVS A;  2BMR B;  5JPU A;  1IK3 A;  1TRP A;  2PNC A;  1LOY A;  3DGM A;  1O7M B;  4FCJ A;  4IT7 A;  5G1L A;  3CCS 3;  4IPB A;  2E2T A;  4H3U A;  1YJ9 3;  1VZZ A;  5D81 A;  1B2M A;  2QIY A;  3CC4 3;  2HMO B;  2E2U A;  1GYB A;  2H0I A;  4WYK A;  1AR0 A;  1TTO A;  1BRI A;  1RJO A;  1O7N B;  1TUH A;  4I5Q A;  1B2U A;  1JZO A;  1YJN 3;  3X3X A;  1JBS A;  2F4Y A;  2XF3 A;  4LEH A;  1LVN A;  3KKG A;  3EBY A;  1B2X A;  2IYJ A;  4EV2 A;  1O7W B;  1CYU A;  4R4K A;  2W9P A;  1S72 3;  4FCM A;  1K73 4;  3I55 3;  4R80 A;  1AV4 A;  4OUQ A;  3SOY A;  1U8C B;  5DRE A;  4EBG A;  2BMQ B;  2Q07 A;  4N6T A;  3NV0 B;  1EKM A;  1RGL A;  3VF1 A;  8CHO A;  4R1K A;  1IT7 A;  2AAD A;  3OV4 A;  4LZI A;  4BTX A;  1RGE A;  2WGQ A;  4LYL B;  3VGN A;  1DVD A;  2CX0 A;  3GAX A;  2XFS A;  7GSP A;  2INX A;  2RNT A;  3KSE D;  1OHO A;  1JV2 B;  2OTJ 3;  1WMO A;  1LOW A;  1U5O A;  3NBR A;  8RNT A;  1TU5 A;  1JNQ A;  3S5C A;  3NUV A;  1VQK 3;  1ASK A;  1E3R A;  1X1W A;  3EN8 A;  3A76 A;  3UJM A;  2OOV C;  2W2C A;  3B8L A;  1BNS A;  2L4V A;  1JKG A;  4XBY A;  5DRV A;  2P05 A;  1N5P A;  5IW9 A;  4WHA A;  3JVC A;  2ZDJ A;  2HMN B;  2CKF B;  1UGI A;  3DM8 A;  1BNE A;  3UB1 A;  2GU3 A;  2QEX 3;  3AHW A;  1BSC A;  1E97 A;  1DYU A;  1RGH A;  2W56 B;  4NPB A;  2YX9 A;  1SJW A;  1RGC A;  4CJN A;  4AKY A;  3TDG A;  2W0Q A;  2ZHX B;  3SVA A;  1NU3 A;  1KD1 4;  4HM2 B;  1L5G B;  2ML5 A;  3X41 A;  1RTU A;  4I4K A;  4J5K A;  2KF4 A;  4HM7 B;  2ZL8 A;  4HVN A;  3HX8 A;  4HM1 B;  2OQE A;  1MWU A;  3CNX A;  3AHS A;  2GEY A;  1V57 A;  3MWZ A;  3SX1 A;  2RBI A;  2E2V A;  2MF7 A;  2Z6B A;  4DKI A;  2LYX A;  3GZX B;  2XFT A;  1JB2 A;  1GY5 A;  3Q3F A;  1W6C A;  5BVB A;  1A67 A;  2V1L A;  2CHC A;  3SYU A;  2ZA4 A;  1HZ1 A;  1RMS A;  1IDP A;  1VQL 3;  1JN5 B;  2GEX A;  4MEI A;  4N3V A;  1YGE A;  5LC6 A;  3U1W A;  5JBS A;  1KC8 4;  3G16 A;  2W9Q A;  2CFW A;  3ECF A;  3BIR A;  1A90 A;  4MMY B;  2A15 A;  1FGR A;  3MPH A;  1W01 A;  5IG4 A;  1IQX A;  1T5Y A;  1TIJ A;  1ZGX A;  3MSO A;  3NQY A;  1GSP A;  1ULJ B;  4NHF A;  4OVM A;  3DMC A;  4N6M A;  3UL6 A;  1YHQ 3;  1RCK A;  1JBT A;  1B3S A;  1VQ8 3;  1HKX A;  4HM0 B;  4WYK B;  5GSP A;  1VQO 3;  1N5H A;  2K3D A;  3F9S A;  3HI7 A;  1X1X A;  3WA2 X;  1RCL A;  1RN7 A;  1QJG A;  1ROA A;  3N8B A;  4RBN A;  1NB5 I;  1W6Y A;  2GU1 A;  2KXG A;  1I2F A;  1LNI A;  3KII A;  4EYC A;  1GS3 A;  3DH2 A;  2CW9 A;  4OK0 A;  3FG1 A;  2SAR A;  4BTW A;  1YIJ 3;  1FYS A;  1TJD A;  2OQE C;  1D6Y A;  1IYY A;  1M1X B;  1BSA A;  2Y74 A;  3BLZ A;  1OH0 A;  3IJE B;  1G02 A;  3AMO A;  1CYV A;  1MWR A;  1Q42 A;  1WTH A;  5CK6 A;  1ROV A;  4K1V A;  3EB8 A;  1OGX A;  1YVB I;  2AAE A;  3G8Z A;  3MG1 A;  4TX4 A;  1RSN A;  4O8S A;  4K90 B;  4FCZ A;  1UUV B;  3I56 3;  1ZO2 A;  4EC6 A;  1UW1 A;  1JKG B;  5AIG A;  2XR8 B;  1RHL A;  3LTC A;  1TFK A;  3IPT A;  3S27 A;  1IQ8 A;  4HM5 B;  2B1X B;  1RN1 A;  3FG4 A;  9RNT A;  1AVK A;  1BNJ A;  1CH0 A;  1LRA A;  4XBT A;  3ROB A;  2CWT A;  3LML A;  3WR2 A;  5KP1 A;  1RGK A;  3QRD A;  4H61 A;  2CFL A;  3GRD A;  1O7G B;  2OOV A;  4X2H A;  4U13 A;  1DVC A;  3PZW A;  1IV7 A;  1K28 A;  2Z7A A;  1D6U A;  1HU9 A;  1ZS7 A;  3KN4 A;  3WMD A;  1G0T A;  1JZD A;  3EN1 B;  2GXF A;  3FG3 A;  3DGL A;  1WMN A;  1G96 A;  1TRQ A;  1UGH I;  3CME 3;  2KAA A;  1DMQ A;  1K41 A;  2OTL 3;  2FGT A;  3T0U A;  1STF I;  4KT3 B;  3ALA A;  3PS8 A;  2ML6 A;  4BU4 A;  1B21 A;  1AVL A;  1AY7 A;  4N6N B;  5CXO A;  2M7O A;  2C4B A;  3CCQ 3;  4CPK A;  2OWP A;  3RGA A;  4XDW A;  3FF0 A;  4QWT A;  3F40 A;  1SQW A;  4GL6 A;  4HBR A;  5AI1 A;  3HII A;  3BB9 A;  3JUQ A;  2GBX B;  5CF1 A;  2J8X B;  2XGL A;  4K1U A;  1FA3 A;  5D83 A;  4MMZ B;  1BVI A;  2BNG A;  1IV9 A;  2P0X A;  1GD3 A;  1W02 A;  3GSP A;  5M18 A;  1J2B A;  3CXC 2;  3PCS A;  5KP3 A;  3GWR A;  5ELU A;  1UCK A;  1FUT A;  1US1 A;  1YI2 3;  1I70 A;  1W2Z A;  4JF8 A;  3OXA A;  2CFD A;  1BNR A;  1RGF A;  3SED A;  3UL5 A;  2KCD A;  1Q81 4;  1BRN L;  2JDI H;  1JRQ A;  4HOH A;  3JUN A;  1ULI B;  1BRK A;  1LQG C;  3DGY A;  5IEN A;  1BSB A;  4ORL A;  2CC3 A;  2XRX B;  3GZY B;  3JUP A;  4N6O B;  1A2K A;  4RNT A;  5BU4 A;  1DMN A;  4XB5 A;  1BRJ A;  1OHS A;  3CCU 3;  1HYF A;  1N9J A;  1YJW 3;  1M9G A;  1I0V A;  3MHE A;  4O3V A;  4HM8 B;  3SXX A;  1STD A;  1FGO A;  1RKY A;  1DE3 A;  5BXQ A;  1BRG A;  1LNH A;  3FGY A;  3NM2 A;  3CMA 3;  2F99 A;  1K8A 4;  5D82 A;  3N9H A;  3AGN A;  4HM6 B;  5I97 A;  1OF5 A;  3NXJ A;  3D3L A;  3T8N A;  1NJI 4;  2STD A;  1W2B 2;  2CWV A;  1RRL A;  1T3B A;  1FW7 A;  2WGO A;  3DUK A;  1W5Z A;  2KRT A;  4N6L A;  3EF8 A;  1Q40 B;  4WP5 A;  5A0O B;  5G2G A;  3OWU A;  2XSH B;  3RNT A;  1EG9 B;  1W00 A;  3U97 A;  1MGR A;  1N8Q A;  2LQV A;  1OHP A;  1UUG B;  3B7C A;  4HZB B;  3H3H A;  3OX9 A;  1NDO B;  5AIH A;  3KE7 A;  1EUI C;  2CG0 A;  1I2G A;  5HOH A;  2WO0 A;  1Q86 4;  3FCS B;  4KFF A;  4GSP A;  3DXO A;  4BL2 A;  1EQK A;  5AII A;  3BNB A;  1N9E A;  2FNQ A;  4RNY A;  1BAN A;  1GMQ A;  3M8C A;  4LGQ A;  5IEO A;  1SAR A;  4Q53 A;  1LOV A;  1UDI I;  2FXT A;  1VQ7 3;  3CCE 3;  2F56 A;  5CLK A;  1A2V A;  2JQ5 A;  3D4A A;  1FGM A;  1O7P B;  1C7H A;  1B27 A;  2HMM B;  3G4S 3;  3EBT A;  1OUN A;  3KSP A;  4X2O A;  2KF3 A;  5BIR A;  1I3F A;  3X3Z A;  1WNH A;  1X1U A;  3CPW 2;  3HOH A;  3EJV A;  3NBB A;  4ILF A;  4WFO A;  5LC7 A;  3SLU A;  3CPO A;  3S67 A;  3SOA A;  2UUG C;  1BNI A;  3Q1C A;  3CCL 3;  3HZP A;  1JBR A;  2CFK A;  1E3V A;  3LTB A;  3NV0 A;  1GOV A;  2H0H A;  3KFQ C;  4HAA A;  2WOF A;  3FKA A;  3BNC A;  3WOD G;  2YFI B;  3G6E 3;  2Z77 A;  1VQ4 3;  1PY3 A;  4RZM A;  1X1Y A;  3F7S A;  2YFJ B;  3MKI A;  2IA7 A;  4AKZ A;  1IVW A;  4KFD A;  1MWT A;  2UX0 A;  1B2Z A;  2D42 A;  2W04 A;  1K9M 4;  1TP6 A;  3GZR A;  3WDG B;  1GOY A;  4BL3 A;  1IT8 A;  1WMP A;  4L8O A;  4PEJ A;  2PZV A;  1RNB A;  2GBW B;  2XGN A;  3NBJ A;  4J8T A;  2KF5 A;  3NQZ A;  3V92 A;  5CF2 A;  6RNT A;  3KCH A;  2P09 A;  1CQS A;  1M90 4;  3L0R A;  4O02 B;  1JB4 A;  2P0M A;  4L8P A;  4EXR A;  1QVG 2;  2W56 A;  2HML B;  4FMB A;  1T2I A;  1RGA A;  2IMJ A;  4MMX B;  3K0Z A;  4HZ9 B;  4J5G A;  1RN4 A;  2K54 A;  5M1A A;  4G1M B;  1GY7 A;  2L1S A;  2CG1 A;  3NM7 A;  4XBX A;  4HKV B;  3ZG0 A;  3ZFZ A;  3CCV 3;  1IVV A;  1BGS A;  3A5E A;  2SBL A;  2OCT A;  2C11 A;  3F7X A;  3KZT A;  3CCM 3;  3MG2 A;  3CCJ 3;  3LZA A;  3LTA A;  1MWS A;  1JB5 A;  1QAL A;  3N54 B;  3PYJ A;  2Y73 A;  3IMA B;  1GD4 A;  4LSO A;  5HGR A;  1MGW A;  3DGO A;  3B4O A;  2MC8 A;  3X42 A;  1Q7Y 4;  5EQL A;  2HMK B;  4N6V 0;  3H51 A;  3JUM A;  4XDV A;  1JN5 A;  4AEQ A;  3ZG5 A;  2QGU A;  1IVU A;  3WOF B;  3S29 A;  3D79 A;  5AEW B;  2RFR A;  3I0Y A;  3DZL A;  4EV5 A;  3PGB A;  2C10 A;  1LQM B;  1GMR A;  1IVX A;  3FLJ A;  3O8Y A;  1OAC A;  1NO3 A;  3BND A;  5AYS C;  1I2E A;  4KFE A;  1RGG A;  1UCJ A;  1UI7 A;  1B2S A;  2RSX A;  1Z1S A;  4FMA A;  3CC2 3;  3F8X A;  3D5I A; 
#chains in the Genus database with same CATH homology
 4HYZ A;  3NX0 A;  5AYR B;  3LOY A;  4FR9 A;  4WWU C;  3K63 A;  3LT8 A;  3STD A;  5AIF A;  2QA4 3;  3V98 A;  5KP4 A;  3RDE A;  4HJL B;  3EHC A;  5EEO A;  3EE1 A;  4K61 A;  1VQ5 3;  1QAF A;  2CFG A;  4L7K A;  1JJ2 2;  4RNZ A;  1IQY A;  1KSI A;  3OW2 2;  2O9U X;  1SIH A;  3K9M C;  3X40 A;  2F86 B;  3LYG A;  2XH9 A;  3DY5 A;  2K0M A;  3RGR A;  6STD A;  5EVH A;  5IG5 A;  2O3O A;  3K7C A;  3AMO B;  1W4N A;  4O2H A;  2HMJ B;  2BT3 A;  4N6U A;  1W6G A;  5IER A;  1VQM 3;  3VSY A;  3B4P A;  4IIA A;  5AEU B;  2Z76 A;  1LOX A;  3E99 A;  5FW5 A;  1FGT A;  4HM3 B;  3HK4 A;  1OCV A;  3ER7 A;  1O7H B;  4J9A A;  2BO9 B;  3MYT A;  1VQP 3;  3LXU X;  3HIG A;  3FH1 A;  1FGQ A;  4KVH A;  3GZB A;  1VQ9 3;  4R9K A;  3PXM A;  3Q2P A;  2BHM A;  2P38 A;  4NRE A;  5IF6 A;  4CDL A;  3CCR 3;  3CNM A;  4KZ1 A;  1CEW I;  2BMO B;  1NB3 I;  1TFO A;  1UI8 A;  1QMA A;  3DGN A;  3NHX A;  3PCR A;  3X3Y A;  2F98 A;  1GY6 A;  2YFL B;  3FF2 A;  2CIU A;  1D6Z A;  1EA2 A;  3CU3 A;  1F8N A;  3BNE A;  1SPU A;  5TGN A;  2IUK A;  4LMI A;  3CC7 3;  2IUJ A;  3T8U A;  3EQQ B;  1ISK A;  3F14 A;  1DMM A;  4JRF A;  1MOL A;  2XSO B;  3D9R A;  1MNL A;  5IG3 A;  2RCD A;  4MJD A;  2RGQ A;  3Q90 A;  3QK9 A;  1WQL B;  3LTD A;  1BUQ A;  5FGO A;  5STD A;  1UUW B;  1V74 A;  3JUO A;  1LXE A;  7STD A;  5JPP A;  1M1K 4;  1W7C A;  3J7Y d;  4XM4 A;  2W6J H;  3F8H A;  1OPY A;  2B24 B;  1OGZ A;  4FMC A;  2CK3 H;  1ZX2 A;  3LH4 A;  1YIT 3;  2XEP A;  1PU4 A;  1S5A A;  4GB5 A;  5IG0 A;  1Q82 4;  3S28 A;  4BTY A;  2CWU A;  4STD A;  3WA3 A;  1OF5 B;  3UNL A;  1SII A;  3MG3 A;  2WOH A;  4CCV A;  1PFP A;  5IEP A;  3LT9 A;  3EC9 A;  1VQN 3;  1Q40 A;  2R4I A;  2CH9 A;  1QAK A;  1VQ6 3;  1IU7 A;  1KWI A;  3V99 A;  4FMD A;  1RRH A;  3G0K A;  1R4C A;  1KQS 2;  3OWY A;  1NWW A;  3WOE B;  1FUW A;  1Y4K A;  3FZW A;  3FSD A;  4R9L A;  1QVF 2;  3CD6 3;  5ELJ A;  3EX9 A;  4HM4 B;  3G71 3;  2D1W A;  2I9W A;  3K5T A;  4ZM8 A;  1N8R 4;  2W03 A;  2BMR B;  5JPU A;  1IK3 A;  2PNC A;  3DGM A;  1O7M B;  4FCJ A;  4IT7 A;  3CCS 3;  4IPB A;  2E2T A;  4H3U A;  1YJ9 3;  1VZZ A;  5D81 A;  2QIY A;  3CC4 3;  2HMO B;  2E2U A;  1GYB A;  4WYK A;  1AR0 A;  1RJO A;  1O7N B;  1TUH A;  1YJN 3;  3X3X A;  2XF3 A;  4LEH A;  1LVN A;  3KKG A;  3EBY A;  4EV2 A;  1O7W B;  1CYU A;  4R4K A;  2W9P A;  1S72 3;  4FCM A;  1K73 4;  3I55 3;  4R80 A;  1AV4 A;  4OUQ A;  3SOY A;  1U8C B;  5DRE A;  4EBG A;  2BMQ B;  2Q07 A;  4N6T A;  3NV0 B;  1EKM A;  3VF1 A;  8CHO A;  4R1K A;  1IT7 A;  4LZI A;  3OV4 A;  4BTX A;  2WGQ A;  3VGN A;  1DVD A;  3GAX A;  2XFS A;  2INX A;  3KSE D;  1OHO A;  1JV2 B;  2OTJ 3;  1WMO A;  1U5O A;  3NBR A;  1TU5 A;  1JNQ A;  3S5C A;  3NUV A;  1VQK 3;  1ASK A;  1E3R A;  3EN8 A;  3A76 A;  3UJM A;  2OOV C;  2W2C A;  3B8L A;  2L4V A;  4XBY A;  1JKG A;  5DRV A;  2P05 A;  1N5P A;  5IW9 A;  4WHA A;  3JVC A;  2ZDJ A;  2HMN B;  2CKF B;  3DM8 A;  3UB1 A;  2GU3 A;  2QEX 3;  1E97 A;  1DYU A;  2W56 B;  2YX9 A;  1SJW A;  4AKY A;  3TDG A;  2W0Q A;  3SVA A;  1NU3 A;  1KD1 4;  4HM2 B;  1L5G B;  2ML5 A;  3X41 A;  4I4K A;  4HM7 B;  2ZL8 A;  4HVN A;  3HX8 A;  4HM1 B;  2OQE A;  3CNX A;  2GEY A;  3SX1 A;  3MWZ A;  2E2V A;  2MF7 A;  2Z6B A;  2LYX A;  3GZX B;  2XFT A;  1JB2 A;  1GY5 A;  1W6C A;  5BVB A;  1A67 A;  2V1L A;  2CHC A;  1IDP A;  1VQL 3;  1JN5 B;  2GEX A;  4MEI A;  4N3V A;  1YGE A;  5LC6 A;  3U1W A;  5JBS A;  1KC8 4;  3G16 A;  2W9Q A;  2CFW A;  3ECF A;  1A90 A;  4MMY B;  2A15 A;  1FGR A;  3MPH A;  1W01 A;  5IG4 A;  1IQX A;  1T5Y A;  1TIJ A;  3MSO A;  3NQY A;  4NHF A;  1ULJ B;  4OVM A;  5A0O B;  1YHQ 3;  3DMC A;  4N6M A;  3UL6 A;  1VQ8 3;  1HKX A;  4HM0 B;  4WYK B;  1VQO 3;  1N5H A;  3F9S A;  3HI7 A;  3WA2 X;  1ROA A;  1RN7 A;  1QJG A;  3N8B A;  4RBN A;  1NB5 I;  1W6Y A;  2GU1 A;  2KXG A;  3KII A;  4EYC A;  1GS3 A;  2CW9 A;  4OK0 A;  3FG1 A;  4BTW A;  1YIJ 3;  2OQE C;  1D6Y A;  1M1X B;  2Y74 A;  3BLZ A;  3IJE B;  1OH0 A;  3AMO A;  1CYV A;  1Q42 A;  1WTH A;  5CK6 A;  1ROV A;  4K1V A;  3EB8 A;  1OGX A;  1YVB I;  3G8Z A;  3MG1 A;  4TX4 A;  4O8S A;  4K90 B;  4FCZ A;  1UUV B;  3I56 3;  1ZO2 A;  4EC6 A;  1UW1 A;  1JKG B;  5AIG A;  2XR8 B;  3LTC A;  3S27 A;  1TFK A;  3IPT A;  1IQ8 A;  4HM5 B;  2B1X B;  3FG4 A;  1AVK A;  4XBT A;  5KP1 A;  3ROB A;  2CWT A;  3LML A;  3QRD A;  4H61 A;  2CFL A;  3GRD A;  1O7G B;  2OOV A;  4X2H A;  4U13 A;  1DVC A;  3PZW A;  1IV7 A;  1K28 A;  2Z7A A;  1D6U A;  1HU9 A;  3KN4 A;  3WMD A;  3EN1 B;  2GXF A;  3FG3 A;  3DGL A;  1WMN A;  1G96 A;  3CME 3;  1DMQ A;  1K41 A;  2OTL 3;  2FGT A;  3T0U A;  1STF I;  3ALA A;  3PS8 A;  2ML6 A;  1AVL A;  4N6N B;  5CXO A;  2M7O A;  3CCQ 3;  2OWP A;  3RGA A;  4XDW A;  3FF0 A;  4QWT A;  3F40 A;  1SQW A;  4GL6 A;  4HBR A;  5AI1 A;  3HII A;  3BB9 A;  3JUQ A;  2GBX B;  5CF1 A;  2XGL A;  4K1U A;  1FA3 A;  5D83 A;  4MMZ B;  2BNG A;  2P0X A;  1IV9 A;  1J2B A;  1GD3 A;  1W02 A;  3CXC 2;  3PCS A;  5KP3 A;  3GWR A;  5ELU A;  1US1 A;  1YI2 3;  4JF8 A;  1W2Z A;  3OXA A;  2CFD A;  3SED A;  3UL5 A;  2KCD A;  1Q81 4;  2JDI H;  1JRQ A;  3JUN A;  1ULI B;  5IEN A;  4ORL A;  2CC3 A;  2XRX B;  3GZY B;  3JUP A;  4N6O B;  1A2K A;  1DMN A;  4XB5 A;  1OHS A;  3CCU 3;  1YJW 3;  1N9J A;  1M9G A;  3MHE A;  4O3V A;  4HM8 B;  3SXX A;  1STD A;  1FGO A;  1RKY A;  5BXQ A;  1LNH A;  3FGY A;  3NM2 A;  3CMA 3;  2F99 A;  1K8A 4;  5D82 A;  3N9H A;  4HM6 B;  5I97 A;  1OF5 A;  3NXJ A;  3D3L A;  3T8N A;  1NJI 4;  2STD A;  1W2B 2;  2CWV A;  1RRL A;  2WGO A;  3DUK A;  1W5Z A;  2KRT A;  4N6L A;  3EF8 A;  1Q40 B;  4WP5 A;  5G2G A;  3OWU A;  2XSH B;  1EG9 B;  1W00 A;  3U97 A;  1N8Q A;  2LQV A;  1OHP A;  3B7C A;  4HZB B;  3H3H A;  3OX9 A;  1NDO B;  5AIH A;  3KE7 A;  2CG0 A;  2WO0 A;  1Q86 4;  3FCS B;  4KFF A;  3DXO A;  1EQK A;  5AII A;  3BNB A;  1N9E A;  2FNQ A;  4RNY A;  3M8C A;  4LGQ A;  5IEO A;  4Q53 A;  1VQ7 3;  2FXT A;  3CCE 3;  5CLK A;  1A2V A;  2JQ5 A;  1FGM A;  1O7P B;  1C7H A;  2HMM B;  3G4S 3;  3EBT A;  1OUN A;  3KSP A;  4X2O A;  3X3Z A;  1WNH A;  3CPW 2;  3NBB A;  3EJV A;  4WFO A;  5LC7 A;  3SLU A;  3CPO A;  3S67 A;  3SOA A;  3Q1C A;  3CCL 3;  3HZP A;  2CFK A;  1E3V A;  3LTB A;  3NV0 A;  3KFQ C;  2WOF A;  3FKA A;  3BNC A;  3WOD G;  2YFI B;  3G6E 3;  2Z77 A;  1VQ4 3;  4RZM A;  3F7S A;  2YFJ B;  3MKI A;  2IA7 A;  4AKZ A;  1IVW A;  4KFD A;  2UX0 A;  2D42 A;  2W04 A;  1K9M 4;  1TP6 A;  3GZR A;  3WDG B;  1IT8 A;  1WMP A;  4L8O A;  4PEJ A;  2PZV A;  2GBW B;  2XGN A;  3NBJ A;  4J8T A;  3NQZ A;  3V92 A;  5CF2 A;  2P09 A;  1CQS A;  1M90 4;  3L0R A;  4O02 B;  1JB4 A;  2P0M A;  4L8P A;  4EXR A;  1QVG 2;  2W56 A;  2HML B;  4FMB A;  2IMJ A;  4MMX B;  3K0Z A;  4HZ9 B;  2K54 A;  4G1M B;  1GY7 A;  2CG1 A;  3NM7 A;  4XBX A;  4HKV B;  3CCV 3;  1IVV A;  2SBL A;  2OCT A;  2C11 A;  3F7X A;  3KZT A;  3CCM 3;  3MG2 A;  3CCJ 3;  3LZA A;  3LTA A;  1QAL A;  1JB5 A;  3N54 B;  3PYJ A;  2Y73 A;  3IMA B;  1GD4 A;  4LSO A;  5HGR A;  3DGO A;  3B4O A;  2MC8 A;  3X42 A;  1Q7Y 4;  5EQL A;  2HMK B;  4N6V 0;  3H51 A;  3JUM A;  4XDV A;  1JN5 A;  4AEQ A;  2QGU A;  1IVU A;  3WOF B;  3S29 A;  5AEW B;  2RFR A;  3I0Y A;  3DZL A;  4EV5 A;  3PGB A;  2C10 A;  1IVX A;  3FLJ A;  3O8Y A;  1OAC A;  1NO3 A;  3BND A;  5AYS C;  4KFE A;  1UI7 A;  2RSX A;  4FMA A;  1Z1S A;  3CC2 3;  3F8X A;  3OWS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...