1YHQ3

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
3 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1yhq300
1YI23 1M1K4 2QEX3 1KD14 1YJW3 1NJI4 3CPW2 1JJ22 3G6E3 1Q824 3CCV3 3G713 3CXC2 2OTJ3 3CCR3 1K8A4 1N8R4 1M904 1QVG2 3CCM3 1VQL3 3CMA3 3CC23 1VQ83 3CCS3 3G4S3 1VQK3 1VQ63 3I553 3CCE3 1YJ93 1VQO3 1KC84 1VQ53 1VQ93 3OW22 3CCQ3 3CC73 3CCJ3 1K9M4 1Q7Y4 1Q864 1VQN3 1KQS2 1VQM3 3CCU3 1VQP3 1Q814 1YIJ3 2OTL3 3CD63 1QVF2 3CME3 1S723 1YJN3 1YIT3 1VQ73 1YHQ3 1K734 3I563 1VQ43 1W2B2 3CC43 2QA43 3CCL3
chains in the Genus database with same CATH superfamily
4XBTA 4IT7A 5IEOA 4EV2A 1Q40A 3K5TA 4WFOA 2C11A 1B2MA 2H0GA 5ELUA 1LOWA 2CFGA 4NPBA 2KCDA 3NQZA 1MNLA 3FCSB 5JPPA 1JB2A 4IPBA 3GSPA 1Q9EA 3FKAA 1JKGA 2KRTA 4K61A 3MG1A 4HYZA 3NQYA 6STDA 3UL5A 3HOHA 1W6GA 2BU4A 2HMNB 3HIIA 1LXEA 3UNLA 4CCVA 2AADA 3B4PA 4CJNA 2C10A 3EHCA 2O9UX 1RN4A 2H0HA 2L4VA 1YHQ3 2OQEC 3KSPA 2WGOA 5D83A 1G96A 1Q40B 1I3IA 3AHWA 3CCL3 3FGYA 2QEX3 1B2XA 2CC3A 1LOVA 3DM8A 3EN8A 3ZFZA 2Y74A 2XSOB 4KFDA 1NWWA 1Q824 1WMOA 1UI8A 4EW5A 3NBBA 1LVNA 4EXRA 1W2ZA 3F40A 4HM3B 1JKGB 1KWIA 1AV4A 1VQ63 3O8YA 3CCE3 2BIRA 1ZS7A 2W6JH 1GOYA 3LMLA 3VF1A 5LC6A 4J5KA 1VQM3 1Q814 4OUQA 1YIJ3 1OPYA 5AIGA 3EF8A 1FGOA 2CG1A 2WOHA 2FXTA 2ML5A 3A5EA 3PZWA 1B2SA 2K0MA 3JUPA 1X1XA 2GBWB 2XF3A 3D5IA 1M1K4 4AKZA 1GMPA 1NB3I 4MJDA 2CHCA 2CH9A 1DE3A 2INXA 3CPW2 1DMNA 2OOVC 5HGRA 3SOYA 2SBLA 1IVXA 1Q42A 1GY6A 1W5ZA 3E99A 3BLZA 3BB9A 4X2OA 3LT9A 1RCKA 1RNTA 3S27A 3CCM3 1DMMA 1YGEA 2F4YA 4FMCA 1IVWA 4ORLA 3CCS3 5D81A 1HZ1A 4O8SA 5IERA 1YJ93 3CNMA 4RNZA 1QJGA 2IY2A 1BSAA 1MOLA 2GEYA 3G16A 5CLKA 2E2TA 3NX0A 3FZWA 5STDA 5EEOA 4HBRA 2XR8B 3OXAA 5AYSC 1S5AA 1SIIA 2JQ5A 5IENA 2GU3A 1BNJA 2B1XB 1FGQA 3DGYA 1NO3A 1LNIA 3EJVA 3STDA 3X3ZA 5BIRA 3I0YA 4EC6A 1RRLA 3EBYA 4STDA 3MG3A 5M18A 1GS3A 2HMOB 3B7CA 4HM8B 1YVBI 4OVMA 1YJW3 1B2UA 1FGRA 1UUVB 3F7SA 3M8CA 1JN5A 1SPUA 1U5OA 3G6E3 3GZXB 3OWYA 4HOHA 5GSPA 1BNEA 1IT7A 3LTBA 3CMA3 4HKVB 4N6LA 4J9AA 3DUKA 1MWRA 1VQ83 3N8BA 3S5CA 4H3UA 1B2ZA 2STDA 4H61A 1VQK3 3NUVA 1QAFA 5M1AA 4BTXA 3WODG 3HIGA 3PXMA 3PGBA 4GL6A 2I9WA 1RLSA 3D5GA 4KFFA 2F5WA 4JF8A 3MG2A 3T8NA 1IT8A 4IIAA 3L0RA 3SXXA 1W4NA 4OK0A 3OX9A 3G8ZA 1OHPA 3FLJA 2LYXA 1JN5B 3DMCA 3T0UA 1WNHA 1BSDA 1N9JA 1SARA 1VQQA 2SARA 3WA2X 5BVBA 3V98A 5CF2A 3CCV3 3D4AA 3SOAA 2CIUA 8CHOA 4BL3A 1RKYA 2F5MA 3IMAB 3K7CA 2F98A 2Z7AA 1NU3A 4RNTA 1O7PB 4N6MA 3F7XA 3SYUA 2K3DA 3X3XA 3RNTA 1UUWB 4G1MB 1IDPA 4QWTA 1BRJA 2L1SA 4XBXA 3HX8A 3K9MC 1YJN3 1S723 1K734 4N6UA 3CNXA 5CK6A 2AAEA 1IVUA 3SEDA 1D6YA 1YI23 1O7NB 5JPUA 1K28A 2CFKA 1I70A 1BSEA 1K41A 3GWRA 1JJ22 1OHSA 5IEPA 3KKGA 4DKIA 2RBIA 1I2FA 5DRVA 5IF6A 3U1WA 2Z76A 2XSHB 3LZAA 1RGFA 4XDVA 5HOHA 1C7HA 5G1LA 4JRFA 1TRPA 1I0VA 1FUTA 1LQGC 1ULIB 3CCQ3 1K9M4 3IJEB 1UI7A 3LTCA 2P05A 4GHOA 3S29A 3GZBA 2XGLA 1IU7A 1EQKA 1OCVA 1DMQA 3CME3 4XB5A 2KF6A 3ECFA 1E3RA 1GMRA 1LOXA 1TFKA 5D82A 3WOFB 4J8TA 1RN7A 2QGUA 1UW1A 1A90A 3ROBA 3KN4A 3URPA 1BNRA 1RGGA 2D42A 1Y4KA 1FYSA 4HM7B 4HM4B 1N5HA 2UUGC 3V92A 2CWTA 1UCKA 1W6CA 4N6V0 4NHFA 1W6YA 5IG3A 5KP4A 1E97A 1W01A 4O3VA 3LH4A 1LQMB 1O7GB 1UGHI 2ML6A 1WMPA 3CCU3 4L8PA 3AHSA 4MMYB 1J2BA 2RCDA 1GD4A 3F14A 1BSBA 3MSOA 2W03A 4GSPA 1RTUA 3EBTA 6GSPA 1FA3A 4XBYA 4BU4A 2HMKB 1TUHA 1GYBA 5LC7A 4RZMA 2MC8A 2FNQA 3MPHA 4R4KA 1V57A 1KD14 3UJMA 4RNYA 1L5GB 2UX0A 1NB5I 3NBRA 4AKYA 2XFTA 3ZG5A 4O02B 2OTJ3 4HM6B 1RCLA 1YNVX 3CCR3 5I97A 2CFLA 5DREA 3PS8A 5CXOA 4PEJA 2P09A 1HYFA 3EC9A 1ROAA 4N3VA 3N54B 1JB4A 1X1YA 2RNTA 4R9KA 1ISKA 2BNGA 4HM5B 3H51A 1V58A 1DETA 4HM1B 1OF5A 3RDEA 4EYCA 1GD3A 3WMDA 1Q7Y4 1B20A 1BRGA 2HMLB 4FCZA 7RNTA 1EUIC 5IG4A 1AVKA 1NDOB 4K1VA 1BANA 2CW9A 3CC43 1DVCA 2CX1A 2UGIA 4FMDA 5IG5A 1BOXA 1Q7HA 1PFPA 1BRIA 1GOUA 1BNIA 3TDGA 1EG9B 1JBSA 1CYVA 1TRQA 3DZLA 4N6TA 3NM7A 1OHOA 1ROVA 4GB5A 2GEXA 4BIRA 4ZM8A 2MF7A 4FCMA 3NBJA 3RGAA 1RGAA 4LZIA 1RGCA 1T3BA 3AGOA 2CWUA 1E3VA 1I0XA 1OF5B 1OACA 2FGTA 3D9RA 1DVDA 2BT3A 1RMSA 1BVIA 4BTYA 1IQ8A 1VQ53 1VQ93 5AIHA 1TU5A 2ZL8A 4LEHA 1LOYA 4KZ1A 3KIIA 3S67A 3FF0A 1QVF2 4R1KA 2GSPA 1YIT3 1BNFA 1FGTA 3WA3A 1VQ43 4LYLB 3UB1A 1BGSA 2A15A 3ZG0A 2R4IA 4J5GA 5FGOA 3SVAA 4CPKA 1BNSA 5RNTA 1CYUA 3DGMA 3IPTA 1A2PA 1ZGXA 1NJI4 3FF2A 1JNQA 2CX0A 1MGRA 3MHEA 1GOVA 3LTDA 1IK3A 3BNCA 3CPOA 1G0TA 3EB8A 1U8CB 3PYJA 4XM4A 2ZA4A 3GAXA 1I8VA 3GZRA 2XFSA 1KSIA 3CC23 4L7KA 1AVLA 4WYKA 2XGNA 1RGLA 1IV9A 1WTHA 2F56A 2HMJB 2W2CA 1TIJA 2O3OA 1B3SA 3DGNA 4L8OA 1VQP3 1RGEA 4KT3B 3X3YA 3CD63 1M9GA 1BRNL 1UCJA 1HU9A 1VQ73 1QMAA 3I563 1I2GA 1IV7A 2E2UA 4WWUC 2BO9B 2CG0A 3X40A 1JZOA 1SIHA 3DGLA 1UDII 4KFEA 4MMXB 5BU4A 2KF3A 1F8NA 1TJDA 3GZYB 3B4OA 3JVCA 4I5QA 1GSPA 1RJOA 3EQQB 3DY5A 4EBGA 3U97A 3DGOA 2RSXA 3X42A 1EA2A 2M7OA 1T2HA 1SQWA 1M904 1QVG2 4WYKB 3G4S3 5KP3A 5EVHA 4HZBB 3UL6A 5CF1A 1BUQA 3BNDA 1KC84 5G2GA 2WGQA 3MKIA 3JUMA 1W00A 5AYRB 1O7MB 3DXOA 2W04A 1OGXA 4O2HA 1VQN3 1I2EA 5IW9A 2CWVA 5AEUB 1B21A 2D1WA 1N8QA 3B8LA 3T8UA 3X41A 2OOVA 1JRQA 2CFDA 3SLUA 1FZUA 1FUSA 1HKXA 1YVSA 4R80A 3Q3FA 4FMBA 1GMQA 1BAOA 5G1KA 2V1LA 3HK4A 5TGNA 3LOYA 1AQZA 4BL2A 1QALA 7GSPA 4EV5A 2W9PA 3QK9A 1A2VA 1N8R4 3ER7A 4LGQA 1UCLA 3WOEB 1M1XB 2BHMA 1N5PA 3FG1A 1WMNA 3S28A 1X1WA 1OUNA 1R4YA 2B24B 2QIYA 4N6OB 1IYYA 2W0QA 2KF5A 1TP6A 1W02A 3EX9A 2YFIB 1ZX2A 4I4KA 1V74A 1FUWA 3LT8A 3WR2A 1JB5A 3LTAA 3EN1B 1JZDA 2XEPA 3JUNA 1RGKA 2IUJA 3K0ZA 5AEWB 2ZHXB 1G02A 1W7CA 1UUGB 3AMOA 1PU4A 1US1A 4TX4A 1LRAA 1CQSA 3VGNA 1MGWA 2GXFA 2RFRA 3F8HA 1PYLA 3CXC2 1ZO2A 1T5YA 1X1UA 3OWSA 1NNVA 4N6NB 2IYJA 3FH1A 3KCHA 2Q07A 3LYGA 3I553 2CK3H 1STFI 1STDA 2BMQB 1VQO3 1MWSA 4WP5A 5EQLA 3DH2A 4BTWA 3J7Yd 4HJLB 3CC73 3OWUA 1RNBA 1Q864 3VSYA 1JBRA 4WHAA 2WOFA 1OH0A 2PNCA 4HAAA 5IG0A 4KVHA 7STDA 1YGWA 4X2HA 3QRDA 2YFJB 3MYTA 3AMOB 1B27A 2BMOB 1CH0A 2C4BA 4HVNA 2P0MA 5AI1A 1BNGA 4LMIA 3N9HA 1SJWA 1QAKA 3F8XA 4NREA 2Z6BA 4ILFA 3Q90A 3D3LA 2KAAA 3WHOA 1R4CA 1WQLB 5JBSA 1VZZA 3EE1A 3GRDA 3ALAA 1BRSA 3H3HA 3K63A 3BNBA 2OCTA 1GY7A 2PZVA 3PCRA 3PCSA 4Q53A 1I3FA 4U13A 1IQXA 1UGIA 2HMMB 6RNTA 1RN1A 1DYUA 2LQVA 1MWUA 2W56A 3FG3A 5AIIA 1CEWI 3HZPA 1D6UA 2IA7A 2K54A 3Q2PA 5AIFA 3FSDA 2W9QA 2J8XB 2JDIH 2HOHA 2CFWA 2E2VA 2IUKA 3NV0A 9RNTA 3BIRA 1T2IA 2P0XA 2Y73A 5FW5A 5BXQA 4CDLA 2R41A 1BRKA 2KF4A 1TFOA 1FW7A 1TTOA 4MEIA 1O7WB 1FGMA 1Z1SA 3SX1A 3WDGB 3G713 3RGRA 1VQL3 2F99A 1BSCA 3NM2A 1C54A 2Z77A 3MWZA 3HI7A 1AR0A 2XH9A 2W56B 1RDSA 1IVVA 2GU1A 2BMRB 4FR9A 2CKFB 3JUQA 1JV2B 1OGZA 4K1UA 1MWTA 2RGQA 1KQS2 2OQEA 3V99A 2OWPA 1EKMA 3FG4A 1BRHA 3NHXA 2F86B 2OTL3 1RSNA 3NV0B 1A67A 1D6ZA 4RBNA 2YFLB 1LNHA 2YX9A 1RGHA 3JUOA 3OV4A 4FMAA 2QA43 1BUJA 2P38A 3NXJA 2IMJA 3BU4A 2H0IA 1PY3A 1GY5A 3F9SA 1RRHA 4FCJA 4R9LA 1ULJB 3BNEA 3KSED 1RHLA 2ZDJA 2XRXB 4XDWA 8RNTA 1N9EA 4K90B 1K8A4 5KP1A 2WO0A 4HM2B 1JBTA 5A0OB 3G0KA 3LXUX 1UCIA 3KZTA 1AY7A 1BIRA 4HM0B 2GBXB 3OW22 1EEJA 3CCJ3 4LSOA 3A76A 2KXGA 4MMZB 3KFQC 3CU3A 4HZ9B 3KE7A 1BU4A 1IQYA 3D79A 1A2KA 1W2B2 1ASKA 5ELJA 1O7HB 5M19A 4AEQA 3AGNA 3Q1CA
chains in the Genus database with same CATH topology
4XBTA 4IT7A 5IEOA 4EV2A 1Q40A 3K5TA 4WFOA 2C11A 5ELUA 2CFGA 2KCDA 3NQZA 1MNLA 3FCSB 5JPPA 1JB2A 4IPBA 3FKAA 1JKGA 2KRTA 4K61A 3MG1A 4HYZA 3NQYA 6STDA 3UL5A 1W6GA 2HMNB 3UNLA 3HIIA 1LXEA 4CCVA 3B4PA 2C10A 3EHCA 2O9UX 2L4VA 1YHQ3 2OQEC 3KSPA 2WGOA 5D83A 1G96A 1Q40B 3CCL3 3FGYA 2QEX3 3DM8A 2CC3A 3EN8A 2Y74A 2XSOB 4KFDA 1NWWA 1Q824 1WMOA 1UI8A 3NBBA 1LVNA 4EXRA 1W2ZA 3F40A 4HM3B 1JKGB 1KWIA 1AV4A 1VQ63 3O8YA 3CCE3 2W6JH 3LMLA 3VF1A 5LC6A 1VQM3 1Q814 4OUQA 1YIJ3 1OPYA 5AIGA 3EF8A 1FGOA 2CG1A 2WOHA 2FXTA 2ML5A 3PZWA 2K0MA 3JUPA 2GBWB 2XF3A 1M1K4 4AKZA 1NB3I 4MJDA 2CHCA 2CH9A 2INXA 3CPW2 1DMNA 2OOVC 5HGRA 3SOYA 2SBLA 1IVXA 1Q42A 1GY6A 1W5ZA 3E99A 3BLZA 3BB9A 4X2OA 3LT9A 3S27A 3CCM3 1DMMA 1YGEA 4FMCA 4ORLA 1IVWA 3CCS3 5D81A 5IERA 4O8SA 1YJ93 3CNMA 4RNZA 1QJGA 3G16A 1MOLA 5CLKA 2GEYA 2E2TA 3NX0A 3FZWA 5STDA 5EEOA 4HBRA 2XR8B 3OXAA 5AYSC 1S5AA 1SIIA 2JQ5A 5IENA 2GU3A 2B1XB 3EJVA 1FGQA 3STDA 1NO3A 3X3ZA 3I0YA 4EC6A 1RRLA 3EBYA 4STDA 3MG3A 1GS3A 2HMOB 3B7CA 4HM8B 1YVBI 4OVMA 1YJW3 1FGRA 1UUVB 3F7SA 3M8CA 1JN5A 1SPUA 1U5OA 3G6E3 3GZXB 3OWYA 1IT7A 3LTBA 3CMA3 4HKVB 4N6LA 4J9AA 3DUKA 1VQ83 3N8BA 3S5CA 4H3UA 2STDA 4H61A 1VQK3 3NUVA 1QAFA 4BTXA 3WODG 3HIGA 3PXMA 3PGBA 4GL6A 2I9WA 4KFFA 4JF8A 3MG2A 3T8NA 1IT8A 4IIAA 3L0RA 3SXXA 1W4NA 4OK0A 3OX9A 3G8ZA 1OHPA 3FLJA 2LYXA 1JN5B 3DMCA 3T0UA 1WNHA 3WA2X 1N9JA 5BVBA 3V98A 5CF2A 3CCV3 3SOAA 2CIUA 8CHOA 1RKYA 3IMAB 3K7CA 2F98A 2Z7AA 1NU3A 1O7PB 4N6MA 3F7XA 3X3XA 1UUWB 4G1MB 1IDPA 4QWTA 4XBXA 3HX8A 3K9MC 1YJN3 1S723 1K734 4N6UA 3CNXA 5CK6A 1IVUA 3SEDA 1D6YA 1YI23 1O7NB 5JPUA 1K28A 2CFKA 1K41A 3GWRA 1JJ22 1OHSA 5IEPA 3KKGA 5DRVA 5IF6A 3U1WA 2Z76A 2XSHB 3LZAA 4XDVA 1C7HA 4JRFA 1ULIB 3CCQ3 1K9M4 3IJEB 1UI7A 3LTCA 2P05A 3S29A 3GZBA 2XGLA 1IU7A 1EQKA 1OCVA 1DMQA 3CME3 4XB5A 3ECFA 1E3RA 1LOXA 1TFKA 5D82A 3WOFB 4J8TA 1RN7A 2QGUA 1UW1A 1A90A 3ROBA 3KN4A 2D42A 1Y4KA 4HM7B 4HM4B 1N5HA 3V92A 2CWTA 4N6V0 1W6CA 4NHFA 1W6YA 5IG3A 5KP4A 1E97A 1W01A 4O3VA 3LH4A 1O7GB 2ML6A 1WMPA 3CCU3 4L8PA 1J2BA 4MMYB 2RCDA 1GD4A 3F14A 3MSOA 2W03A 3EBTA 1FA3A 4XBYA 2HMKB 1TUHA 1GYBA 5LC7A 4RZMA 2MC8A 2FNQA 3MPHA 4R4KA 1KD14 3UJMA 4RNYA 1L5GB 2UX0A 1NB5I 3NBRA 4AKYA 2XFTA 4O02B 2OTJ3 4HM6B 3CCR3 5I97A 2CFLA 5DREA 3PS8A 5CXOA 4PEJA 2P09A 4N3VA 3EC9A 1ROAA 4R9KA 3N54B 1JB4A 1ISKA 2BNGA 4HM5B 3H51A 3RDEA 4HM1B 4EYCA 1OF5A 1GD3A 3WMDA 1Q7Y4 2HMLB 4FCZA 5IG4A 1AVKA 1NDOB 4K1VA 2CW9A 3CC43 1DVCA 4FMDA 5IG5A 1PFPA 3TDGA 1EG9B 1CYVA 4N6TA 3DZLA 3NM7A 1OHOA 1ROVA 4GB5A 2GEXA 4ZM8A 2MF7A 4FCMA 3NBJA 3RGAA 4LZIA 2CWUA 1E3VA 1OF5B 2FGTA 1OACA 3D9RA 1DVDA 2BT3A 4BTYA 1VQ53 1IQ8A 1VQ93 5AIHA 1TU5A 2ZL8A 4LEHA 4KZ1A 3S67A 3KIIA 3FF0A 1QVF2 4R1KA 1YIT3 1VQ43 1FGTA 3WA3A 3UB1A 2A15A 2R4IA 3SVAA 5FGOA 1CYUA 3DGMA 3IPTA 1NJI4 3FF2A 1JNQA 3MHEA 3LTDA 1IK3A 3BNCA 3CPOA 3EB8A 1U8CB 3PYJA 4XM4A 3GAXA 3GZRA 2XFSA 1KSIA 3CC23 4L7KA 1AVLA 4WYKA 2XGNA 1IV9A 1WTHA 2HMJB 2W2CA 1TIJA 2O3OA 3DGNA 4L8OA 1VQP3 3X3YA 3CD63 1M9GA 1HU9A 1VQ73 1QMAA 3I563 1IV7A 2E2UA 4WWUC 2BO9B 2CG0A 3X40A 4KFEA 1SIHA 3DGLA 4MMXB 1F8NA 3GZYB 3B4OA 3JVCA 1RJOA 3EQQB 3DY5A 4EBGA 3U97A 3DGOA 2RSXA 3X42A 1EA2A 2M7OA 1SQWA 1M904 1QVG2 4WYKB 3G4S3 5KP3A 5EVHA 4HZBB 3UL6A 5CF1A 1BUQA 3BNDA 1KC84 5G2GA 2WGQA 3MKIA 3JUMA 1W00A 5AYRB 1O7MB 3DXOA 2W04A 1OGXA 4O2HA 1VQN3 5IW9A 2CWVA 5AEUB 2D1WA 1N8QA 3B8LA 3T8UA 3X41A 2OOVA 1JRQA 2CFDA 3SLUA 1HKXA 4R80A 4FMBA 2V1LA 3HK4A 5TGNA 3LOYA 1QALA 4EV5A 2W9PA 3QK9A 1A2VA 1N8R4 3ER7A 4LGQA 3WOEB 1M1XB 2BHMA 1N5PA 3FG1A 1WMNA 3S28A 1OUNA 2B24B 2QIYA 4N6OB 2W0QA 1TP6A 1W02A 3EX9A 2YFIB 1ZX2A 4I4KA 1V74A 1FUWA 3LT8A 1JB5A 3LTAA 3EN1B 2XEPA 3JUNA 5AEWB 2IUJA 3K0ZA 1W7CA 3AMOA 1PU4A 1US1A 4TX4A 1CQSA 3VGNA 2GXFA 2RFRA 3F8HA 3CXC2 1ZO2A 1T5YA 3OWSA 4N6NB 3FH1A 2Q07A 3LYGA 3I553 2CK3H 1STFI 1STDA 2BMQB 1VQO3 4WP5A 5EQLA 4BTWA 3J7Yd 4HJLB 3CC73 3OWUA 1Q864 3VSYA 4WHAA 2WOFA 1OH0A 2PNCA 5IG0A 7STDA 4KVHA 4X2HA 3QRDA 2YFJB 3MYTA 3AMOB 2BMOB 4HVNA 5AI1A 2P0MA 4LMIA 3N9HA 1SJWA 1QAKA 3F8XA 4NREA 2Z6BA 3Q90A 3D3LA 1R4CA 1WQLB 5JBSA 1VZZA 3EE1A 3GRDA 3ALAA 3PCSA 3H3HA 3K63A 3BNBA 2OCTA 1GY7A 2PZVA 3PCRA 4K90B 4Q53A 4U13A 1IQXA 2HMMB 3FG3A 1DYUA 2LQVA 2W56A 5AIIA 1CEWI 3HZPA 1D6UA 2IA7A 2K54A 3Q2PA 5AIFA 3FSDA 2W9QA 2JDIH 2CFWA 2E2VA 2IUKA 3NV0A 2P0XA 2Y73A 5BXQA 5FW5A 4CDLA 1TFOA 4MEIA 1O7WB 1FGMA 1Z1SA 3SX1A 3WDGB 3G713 3RGRA 1VQL3 2F99A 3NM2A 2Z77A 3MWZA 3HI7A 1AR0A 2XH9A 2W56B 1IVVA 2GU1A 2BMRB 4FR9A 2CKFB 3JUQA 1JV2B 1OGZA 4K1UA 2RGQA 1KQS2 2OQEA 3V99A 2OWPA 1EKMA 3FG4A 3NHXA 2OTL3 2F86B 1A67A 3NV0B 1D6ZA 4RBNA 2YFLB 1LNHA 2YX9A 3JUOA 3OV4A 4FMAA 2QA43 2P38A 3NXJA 2IMJA 1GY5A 3F9SA 1RRHA 4FCJA 4R9LA 1ULJB 3BNEA 3KSED 2ZDJA 2XRXB 4XDWA 1K8A4 1N9EA 5KP1A 2WO0A 4HM2B 5A0OB 3G0KA 3LXUX 3KZTA 4HM0B 2GBXB 3OW22 3CCJ3 4LSOA 3A76A 2KXGA 4MMZB 3KFQC 3CU3A 4HZ9B 3KE7A 1W2B2 1IQYA 1A2KA 1ASKA 5ELJA 1O7HB 4AEQA 3Q1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 3;  1M1K 4;  2QEX 3;  1KD1 4;  1YJW 3;  1NJI 4;  3CPW 2;  1JJ2 2;  3G6E 3;  1Q82 4;  3CCV 3;  3G71 3;  3CXC 2;  2OTJ 3;  3CCR 3;  1K8A 4;  1N8R 4;  1M90 4;  1QVG 2;  3CCM 3;  1VQL 3;  3CMA 3;  3CC2 3;  1VQ8 3;  3CCS 3;  3G4S 3;  1VQK 3;  1VQ6 3;  3I55 3;  3CCE 3;  1YJ9 3;  1VQO 3;  1KC8 4;  1VQ5 3;  1VQ9 3;  3OW2 2;  3CCQ 3;  3CC7 3;  3CCJ 3;  1K9M 4;  1Q7Y 4;  1Q86 4;  1VQN 3;  1KQS 2;  1VQM 3;  3CCU 3;  1VQP 3;  1Q81 4;  1YIJ 3;  2OTL 3;  3CD6 3;  1QVF 2;  3CME 3;  1S72 3;  1YJN 3;  1YIT 3;  1VQ7 3;  1YHQ 3;  1K73 4;  3I56 3;  1VQ4 3;  1W2B 2;  3CC4 3;  2QA4 3;  3CCL 3; 
#chains in the Genus database with same CATH topology
 4XBT A;  4IT7 A;  5IEO A;  4EV2 A;  1Q40 A;  3K5T A;  4WFO A;  2C11 A;  1B2M A;  2H0G A;  5ELU A;  1LOW A;  2CFG A;  4NPB A;  2KCD A;  3NQZ A;  1MNL A;  3FCS B;  5JPP A;  1JB2 A;  4IPB A;  3GSP A;  1Q9E A;  3FKA A;  1JKG A;  2KRT A;  4K61 A;  3MG1 A;  4HYZ A;  3NQY A;  6STD A;  3UL5 A;  3HOH A;  1W6G A;  2BU4 A;  2HMN B;  3HII A;  1LXE A;  3UNL A;  4CCV A;  2AAD A;  3B4P A;  4CJN A;  2C10 A;  3EHC A;  2O9U X;  1RN4 A;  2H0H A;  2L4V A;  1YHQ 3;  2OQE C;  3KSP A;  2WGO A;  5D83 A;  1G96 A;  1Q40 B;  1I3I A;  3AHW A;  3CCL 3;  3FGY A;  2QEX 3;  1B2X A;  2CC3 A;  1LOV A;  3DM8 A;  3EN8 A;  3ZFZ A;  2Y74 A;  2XSO B;  4KFD A;  1NWW A;  1Q82 4;  1WMO A;  1UI8 A;  4EW5 A;  3NBB A;  1LVN A;  4EXR A;  1W2Z A;  3F40 A;  4HM3 B;  1JKG B;  1KWI A;  1AV4 A;  1VQ6 3;  3O8Y A;  3CCE 3;  2BIR A;  1ZS7 A;  2W6J H;  1GOY A;  3LML A;  3VF1 A;  5LC6 A;  4J5K A;  1VQM 3;  1Q81 4;  4OUQ A;  1YIJ 3;  1OPY A;  5AIG A;  3EF8 A;  1FGO A;  2CG1 A;  2WOH A;  2FXT A;  2ML5 A;  3A5E A;  3PZW A;  1B2S A;  2K0M A;  3JUP A;  1X1X A;  2GBW B;  2XF3 A;  3D5I A;  1M1K 4;  4AKZ A;  1GMP A;  1NB3 I;  4MJD A;  2CHC A;  2CH9 A;  1DE3 A;  2INX A;  3CPW 2;  1DMN A;  2OOV C;  5HGR A;  3SOY A;  2SBL A;  1IVX A;  1Q42 A;  1GY6 A;  1W5Z A;  3E99 A;  3BLZ A;  3BB9 A;  4X2O A;  3LT9 A;  1RCK A;  1RNT A;  3S27 A;  3CCM 3;  1DMM A;  1YGE A;  2F4Y A;  4FMC A;  1IVW A;  4ORL A;  3CCS 3;  5D81 A;  1HZ1 A;  4O8S A;  5IER A;  1YJ9 3;  3CNM A;  4RNZ A;  1QJG A;  2IY2 A;  1BSA A;  1MOL A;  2GEY A;  3G16 A;  5CLK A;  2E2T A;  3NX0 A;  3FZW A;  5STD A;  5EEO A;  4HBR A;  2XR8 B;  3OXA A;  5AYS C;  1S5A A;  1SII A;  2JQ5 A;  5IEN A;  2GU3 A;  1BNJ A;  2B1X B;  1FGQ A;  3DGY A;  1NO3 A;  1LNI A;  3EJV A;  3STD A;  3X3Z A;  5BIR A;  3I0Y A;  4EC6 A;  1RRL A;  3EBY A;  4STD A;  3MG3 A;  5M18 A;  1GS3 A;  2HMO B;  3B7C A;  4HM8 B;  1YVB I;  4OVM A;  1YJW 3;  1B2U A;  1FGR A;  1UUV B;  3F7S A;  3M8C A;  1JN5 A;  1SPU A;  1U5O A;  3G6E 3;  3GZX B;  3OWY A;  4HOH A;  5GSP A;  1BNE A;  1IT7 A;  3LTB A;  3CMA 3;  4HKV B;  4N6L A;  4J9A A;  3DUK A;  1MWR A;  1VQ8 3;  3N8B A;  3S5C A;  4H3U A;  1B2Z A;  2STD A;  4H61 A;  1VQK 3;  3NUV A;  1QAF A;  5M1A A;  4BTX A;  3WOD G;  3HIG A;  3PXM A;  3PGB A;  4GL6 A;  2I9W A;  1RLS A;  3D5G A;  4KFF A;  2F5W A;  4JF8 A;  3MG2 A;  3T8N A;  1IT8 A;  4IIA A;  3L0R A;  3SXX A;  1W4N A;  4OK0 A;  3OX9 A;  3G8Z A;  1OHP A;  3FLJ A;  2LYX A;  1JN5 B;  3DMC A;  3T0U A;  1WNH A;  1BSD A;  1N9J A;  1SAR A;  1VQQ A;  2SAR A;  3WA2 X;  5BVB A;  3V98 A;  5CF2 A;  3CCV 3;  3D4A A;  3SOA A;  2CIU A;  8CHO A;  4BL3 A;  1RKY A;  2F5M A;  3IMA B;  3K7C A;  2F98 A;  2Z7A A;  1NU3 A;  4RNT A;  1O7P B;  4N6M A;  3F7X A;  3SYU A;  2K3D A;  3X3X A;  3RNT A;  1UUW B;  4G1M B;  1IDP A;  4QWT A;  1BRJ A;  2L1S A;  4XBX A;  3HX8 A;  3K9M C;  1YJN 3;  1S72 3;  1K73 4;  4N6U A;  3CNX A;  5CK6 A;  2AAE A;  1IVU A;  3SED A;  1D6Y A;  1YI2 3;  1O7N B;  5JPU A;  1K28 A;  2CFK A;  1I70 A;  1BSE A;  1K41 A;  3GWR A;  1JJ2 2;  1OHS A;  5IEP A;  3KKG A;  4DKI A;  2RBI A;  1I2F A;  5DRV A;  5IF6 A;  3U1W A;  2Z76 A;  2XSH B;  3LZA A;  1RGF A;  4XDV A;  5HOH A;  1C7H A;  5G1L A;  4JRF A;  1TRP A;  1I0V A;  1FUT A;  1LQG C;  1ULI B;  3CCQ 3;  1K9M 4;  3IJE B;  1UI7 A;  3LTC A;  2P05 A;  4GHO A;  3S29 A;  3GZB A;  2XGL A;  1IU7 A;  1EQK A;  1OCV A;  1DMQ A;  3CME 3;  4XB5 A;  2KF6 A;  3ECF A;  1E3R A;  1GMR A;  1LOX A;  1TFK A;  5D82 A;  3WOF B;  4J8T A;  1RN7 A;  2QGU A;  1UW1 A;  1A90 A;  3ROB A;  3KN4 A;  3URP A;  1BNR A;  1RGG A;  2D42 A;  1Y4K A;  1FYS A;  4HM7 B;  4HM4 B;  1N5H A;  2UUG C;  3V92 A;  2CWT A;  1UCK A;  1W6C A;  4N6V 0;  4NHF A;  1W6Y A;  5IG3 A;  5KP4 A;  1E97 A;  1W01 A;  4O3V A;  3LH4 A;  1LQM B;  1O7G B;  1UGH I;  2ML6 A;  1WMP A;  3CCU 3;  4L8P A;  3AHS A;  4MMY B;  1J2B A;  2RCD A;  1GD4 A;  3F14 A;  1BSB A;  3MSO A;  2W03 A;  4GSP A;  1RTU A;  3EBT A;  6GSP A;  1FA3 A;  4XBY A;  4BU4 A;  2HMK B;  1TUH A;  1GYB A;  5LC7 A;  4RZM A;  2MC8 A;  2FNQ A;  3MPH A;  4R4K A;  1V57 A;  1KD1 4;  3UJM A;  4RNY A;  1L5G B;  2UX0 A;  1NB5 I;  3NBR A;  4AKY A;  2XFT A;  3ZG5 A;  4O02 B;  2OTJ 3;  4HM6 B;  1RCL A;  1YNV X;  3CCR 3;  5I97 A;  2CFL A;  5DRE A;  3PS8 A;  5CXO A;  4PEJ A;  2P09 A;  1HYF A;  3EC9 A;  1ROA A;  4N3V A;  3N54 B;  1JB4 A;  1X1Y A;  2RNT A;  4R9K A;  1ISK A;  2BNG A;  4HM5 B;  3H51 A;  1V58 A;  1DET A;  4HM1 B;  1OF5 A;  3RDE A;  4EYC A;  1GD3 A;  3WMD A;  1Q7Y 4;  1B20 A;  1BRG A;  2HML B;  4FCZ A;  7RNT A;  1EUI C;  5IG4 A;  1AVK A;  1NDO B;  4K1V A;  1BAN A;  2CW9 A;  3CC4 3;  1DVC A;  2CX1 A;  2UGI A;  4FMD A;  5IG5 A;  1BOX A;  1Q7H A;  1PFP A;  1BRI A;  1GOU A;  1BNI A;  3TDG A;  1EG9 B;  1JBS A;  1CYV A;  1TRQ A;  3DZL A;  4N6T A;  3NM7 A;  1OHO A;  1ROV A;  4GB5 A;  2GEX A;  4BIR A;  4ZM8 A;  2MF7 A;  4FCM A;  3NBJ A;  3RGA A;  1RGA A;  4LZI A;  1RGC A;  1T3B A;  3AGO A;  2CWU A;  1E3V A;  1I0X A;  1OF5 B;  1OAC A;  2FGT A;  3D9R A;  1DVD A;  2BT3 A;  1RMS A;  1BVI A;  4BTY A;  1IQ8 A;  1VQ5 3;  1VQ9 3;  5AIH A;  1TU5 A;  2ZL8 A;  4LEH A;  1LOY A;  4KZ1 A;  3KII A;  3S67 A;  3FF0 A;  1QVF 2;  4R1K A;  2GSP A;  1YIT 3;  1BNF A;  1FGT A;  3WA3 A;  1VQ4 3;  4LYL B;  3UB1 A;  1BGS A;  2A15 A;  3ZG0 A;  2R4I A;  4J5G A;  5FGO A;  3SVA A;  4CPK A;  1BNS A;  5RNT A;  1CYU A;  3DGM A;  3IPT A;  1A2P A;  1ZGX A;  1NJI 4;  3FF2 A;  1JNQ A;  2CX0 A;  1MGR A;  3MHE A;  1GOV A;  3LTD A;  1IK3 A;  3BNC A;  3CPO A;  1G0T A;  3EB8 A;  1U8C B;  3PYJ A;  4XM4 A;  2ZA4 A;  3GAX A;  1I8V A;  3GZR A;  2XFS A;  1KSI A;  3CC2 3;  4L7K A;  1AVL A;  4WYK A;  2XGN A;  1RGL A;  1IV9 A;  1WTH A;  2F56 A;  2HMJ B;  2W2C A;  1TIJ A;  2O3O A;  1B3S A;  3DGN A;  4L8O A;  1VQP 3;  1RGE A;  4KT3 B;  3X3Y A;  3CD6 3;  1M9G A;  1BRN L;  1UCJ A;  1HU9 A;  1VQ7 3;  1QMA A;  3I56 3;  1I2G A;  1IV7 A;  2E2U A;  4WWU C;  2BO9 B;  2CG0 A;  3X40 A;  1JZO A;  1SIH A;  3DGL A;  1UDI I;  4KFE A;  4MMX B;  5BU4 A;  2KF3 A;  1F8N A;  1TJD A;  3GZY B;  3B4O A;  3JVC A;  4I5Q A;  1GSP A;  1RJO A;  3EQQ B;  3DY5 A;  4EBG A;  3U97 A;  3DGO A;  2RSX A;  3X42 A;  1EA2 A;  2M7O A;  1T2H A;  1SQW A;  1M90 4;  1QVG 2;  4WYK B;  3G4S 3;  5KP3 A;  5EVH A;  4HZB B;  3UL6 A;  5CF1 A;  1BUQ A;  3BND A;  1KC8 4;  5G2G A;  2WGQ A;  3MKI A;  3JUM A;  1W00 A;  5AYR B;  1O7M B;  3DXO A;  2W04 A;  1OGX A;  4O2H A;  1VQN 3;  1I2E A;  5IW9 A;  2CWV A;  5AEU B;  1B21 A;  2D1W A;  1N8Q A;  3B8L A;  3T8U A;  3X41 A;  2OOV A;  1JRQ A;  2CFD A;  3SLU A;  1FZU A;  1FUS A;  1HKX A;  1YVS A;  4R80 A;  3Q3F A;  4FMB A;  1GMQ A;  1BAO A;  5G1K A;  2V1L A;  3HK4 A;  5TGN A;  3LOY A;  1AQZ A;  4BL2 A;  1QAL A;  7GSP A;  4EV5 A;  2W9P A;  3QK9 A;  1A2V A;  1N8R 4;  3ER7 A;  4LGQ A;  1UCL A;  3WOE B;  1M1X B;  2BHM A;  1N5P A;  3FG1 A;  1WMN A;  3S28 A;  1X1W A;  1OUN A;  1R4Y A;  2B24 B;  2QIY A;  4N6O B;  1IYY A;  2W0Q A;  2KF5 A;  1TP6 A;  1W02 A;  3EX9 A;  2YFI B;  1ZX2 A;  4I4K A;  1V74 A;  1FUW A;  3LT8 A;  3WR2 A;  1JB5 A;  3LTA A;  3EN1 B;  1JZD A;  2XEP A;  3JUN A;  1RGK A;  2IUJ A;  3K0Z A;  5AEW B;  2ZHX B;  1G02 A;  1W7C A;  1UUG B;  3AMO A;  1PU4 A;  1US1 A;  4TX4 A;  1LRA A;  1CQS A;  3VGN A;  1MGW A;  2GXF A;  2RFR A;  3F8H A;  1PYL A;  3CXC 2;  1ZO2 A;  1T5Y A;  1X1U A;  3OWS A;  1NNV A;  4N6N B;  2IYJ A;  3FH1 A;  3KCH A;  2Q07 A;  3LYG A;  3I55 3;  2CK3 H;  1STF I;  1STD A;  2BMQ B;  1VQO 3;  1MWS A;  4WP5 A;  5EQL A;  3DH2 A;  4BTW A;  3J7Y d;  4HJL B;  3CC7 3;  3OWU A;  1RNB A;  1Q86 4;  3VSY A;  1JBR A;  4WHA A;  2WOF A;  1OH0 A;  2PNC A;  4HAA A;  5IG0 A;  4KVH A;  7STD A;  1YGW A;  4X2H A;  3QRD A;  2YFJ B;  3MYT A;  3AMO B;  1B27 A;  2BMO B;  1CH0 A;  2C4B A;  4HVN A;  2P0M A;  5AI1 A;  1BNG A;  4LMI A;  3N9H A;  1SJW A;  1QAK A;  3F8X A;  4NRE A;  2Z6B A;  4ILF A;  3Q90 A;  3D3L A;  2KAA A;  3WHO A;  1R4C A;  1WQL B;  5JBS A;  1VZZ A;  3EE1 A;  3GRD A;  3ALA A;  1BRS A;  3H3H A;  3K63 A;  3BNB A;  2OCT A;  1GY7 A;  2PZV A;  3PCR A;  3PCS A;  4Q53 A;  1I3F A;  4U13 A;  1IQX A;  1UGI A;  2HMM B;  6RNT A;  1RN1 A;  1DYU A;  2LQV A;  1MWU A;  2W56 A;  3FG3 A;  5AII A;  1CEW I;  3HZP A;  1D6U A;  2IA7 A;  2K54 A;  3Q2P A;  5AIF A;  3FSD A;  2W9Q A;  2J8X B;  2JDI H;  2HOH A;  2CFW A;  2E2V A;  2IUK A;  3NV0 A;  9RNT A;  3BIR A;  1T2I A;  2P0X A;  2Y73 A;  5FW5 A;  5BXQ A;  4CDL A;  2R41 A;  1BRK A;  2KF4 A;  1TFO A;  1FW7 A;  1TTO A;  4MEI A;  1O7W B;  1FGM A;  1Z1S A;  3SX1 A;  3WDG B;  3G71 3;  3RGR A;  1VQL 3;  2F99 A;  1BSC A;  3NM2 A;  1C54 A;  2Z77 A;  3MWZ A;  3HI7 A;  1AR0 A;  2XH9 A;  2W56 B;  1RDS A;  1IVV A;  2GU1 A;  2BMR B;  4FR9 A;  2CKF B;  3JUQ A;  1JV2 B;  1OGZ A;  4K1U A;  1MWT A;  2RGQ A;  1KQS 2;  2OQE A;  3V99 A;  2OWP A;  1EKM A;  3FG4 A;  1BRH A;  3NHX A;  2F86 B;  2OTL 3;  1RSN A;  3NV0 B;  1A67 A;  1D6Z A;  4RBN A;  2YFL B;  1LNH A;  2YX9 A;  1RGH A;  3JUO A;  3OV4 A;  4FMA A;  2QA4 3;  1BUJ A;  2P38 A;  3NXJ A;  2IMJ A;  3BU4 A;  2H0I A;  1PY3 A;  1GY5 A;  3F9S A;  1RRH A;  4FCJ A;  4R9L A;  1ULJ B;  3BNE A;  3KSE D;  1RHL A;  2ZDJ A;  2XRX B;  4XDW A;  8RNT A;  1N9E A;  4K90 B;  1K8A 4;  5KP1 A;  2WO0 A;  4HM2 B;  1JBT A;  5A0O B;  3G0K A;  3LXU X;  1UCI A;  3KZT A;  1AY7 A;  1BIR A;  4HM0 B;  2GBX B;  3OW2 2;  1EEJ A;  3CCJ 3;  4LSO A;  3A76 A;  2KXG A;  4MMZ B;  3KFQ C;  3CU3 A;  4HZ9 B;  3KE7 A;  1BU4 A;  1IQY A;  3D79 A;  1A2K A;  1W2B 2;  1ASK A;  5ELJ A;  1O7H B;  5M19 A;  4AEQ A;  3AGN A;  3Q1C A; 
#chains in the Genus database with same CATH homology
 4XBT A;  4IT7 A;  5IEO A;  4EV2 A;  1Q40 A;  3K5T A;  4WFO A;  2C11 A;  5ELU A;  2CFG A;  2KCD A;  3NQZ A;  1MNL A;  3FCS B;  5JPP A;  1JB2 A;  4IPB A;  3FKA A;  1JKG A;  2KRT A;  4K61 A;  3MG1 A;  4HYZ A;  3NQY A;  6STD A;  3UL5 A;  1W6G A;  2HMN B;  3UNL A;  3HII A;  1LXE A;  4CCV A;  3B4P A;  2C10 A;  3EHC A;  2O9U X;  2L4V A;  1YHQ 3;  2OQE C;  3KSP A;  2WGO A;  5D83 A;  1G96 A;  1Q40 B;  3CCL 3;  3FGY A;  2QEX 3;  3DM8 A;  2CC3 A;  3EN8 A;  2Y74 A;  2XSO B;  4KFD A;  1NWW A;  1Q82 4;  1WMO A;  1UI8 A;  3NBB A;  1LVN A;  4EXR A;  1W2Z A;  3F40 A;  4HM3 B;  1JKG B;  1KWI A;  1AV4 A;  1VQ6 3;  3O8Y A;  3CCE 3;  2W6J H;  3LML A;  3VF1 A;  5LC6 A;  1VQM 3;  1Q81 4;  4OUQ A;  1YIJ 3;  1OPY A;  5AIG A;  3EF8 A;  1FGO A;  2CG1 A;  2WOH A;  2FXT A;  2ML5 A;  3PZW A;  2K0M A;  3JUP A;  2GBW B;  2XF3 A;  1M1K 4;  4AKZ A;  1NB3 I;  4MJD A;  2CHC A;  2CH9 A;  2INX A;  3CPW 2;  1DMN A;  2OOV C;  5HGR A;  3SOY A;  2SBL A;  1IVX A;  1Q42 A;  1GY6 A;  1W5Z A;  3E99 A;  3BLZ A;  3BB9 A;  4X2O A;  3LT9 A;  3S27 A;  3CCM 3;  1DMM A;  1YGE A;  4FMC A;  4ORL A;  1IVW A;  3CCS 3;  5D81 A;  5IER A;  4O8S A;  1YJ9 3;  3CNM A;  4RNZ A;  1QJG A;  3G16 A;  1MOL A;  5CLK A;  2GEY A;  2E2T A;  3NX0 A;  3FZW A;  5STD A;  5EEO A;  4HBR A;  2XR8 B;  3OXA A;  5AYS C;  1S5A A;  1SII A;  2JQ5 A;  5IEN A;  2GU3 A;  2B1X B;  3EJV A;  1FGQ A;  3STD A;  1NO3 A;  3X3Z A;  3I0Y A;  4EC6 A;  1RRL A;  3EBY A;  4STD A;  3MG3 A;  1GS3 A;  2HMO B;  3B7C A;  4HM8 B;  1YVB I;  4OVM A;  1YJW 3;  1FGR A;  1UUV B;  3F7S A;  3M8C A;  1JN5 A;  1SPU A;  1U5O A;  3G6E 3;  3GZX B;  3OWY A;  1IT7 A;  3LTB A;  3CMA 3;  4HKV B;  4N6L A;  4J9A A;  3DUK A;  1VQ8 3;  3N8B A;  3S5C A;  4H3U A;  2STD A;  4H61 A;  1VQK 3;  3NUV A;  1QAF A;  4BTX A;  3WOD G;  3HIG A;  3PXM A;  3PGB A;  4GL6 A;  2I9W A;  4KFF A;  4JF8 A;  3MG2 A;  3T8N A;  1IT8 A;  4IIA A;  3L0R A;  3SXX A;  1W4N A;  4OK0 A;  3OX9 A;  3G8Z A;  1OHP A;  3FLJ A;  2LYX A;  1JN5 B;  3DMC A;  3T0U A;  1WNH A;  3WA2 X;  1N9J A;  5BVB A;  3V98 A;  5CF2 A;  3CCV 3;  3SOA A;  2CIU A;  8CHO A;  1RKY A;  3IMA B;  3K7C A;  2F98 A;  2Z7A A;  1NU3 A;  1O7P B;  4N6M A;  3F7X A;  3X3X A;  1UUW B;  4G1M B;  1IDP A;  4QWT A;  4XBX A;  3HX8 A;  3K9M C;  1YJN 3;  1S72 3;  1K73 4;  4N6U A;  3CNX A;  5CK6 A;  1IVU A;  3SED A;  1D6Y A;  1YI2 3;  1O7N B;  5JPU A;  1K28 A;  2CFK A;  1K41 A;  3GWR A;  1JJ2 2;  1OHS A;  5IEP A;  3KKG A;  5DRV A;  5IF6 A;  3U1W A;  2Z76 A;  2XSH B;  3LZA A;  4XDV A;  1C7H A;  4JRF A;  1ULI B;  3CCQ 3;  1K9M 4;  3IJE B;  1UI7 A;  3LTC A;  2P05 A;  3S29 A;  3GZB A;  2XGL A;  1IU7 A;  1EQK A;  1OCV A;  1DMQ A;  3CME 3;  4XB5 A;  3ECF A;  1E3R A;  1LOX A;  1TFK A;  5D82 A;  3WOF B;  4J8T A;  1RN7 A;  2QGU A;  1UW1 A;  1A90 A;  3ROB A;  3KN4 A;  2D42 A;  1Y4K A;  4HM7 B;  4HM4 B;  1N5H A;  3V92 A;  2CWT A;  4N6V 0;  1W6C A;  4NHF A;  1W6Y A;  5IG3 A;  5KP4 A;  1E97 A;  1W01 A;  4O3V A;  3LH4 A;  1O7G B;  2ML6 A;  1WMP A;  3CCU 3;  4L8P A;  1J2B A;  4MMY B;  2RCD A;  1GD4 A;  3F14 A;  3MSO A;  2W03 A;  3EBT A;  1FA3 A;  4XBY A;  2HMK B;  1TUH A;  1GYB A;  5LC7 A;  4RZM A;  2MC8 A;  2FNQ A;  3MPH A;  4R4K A;  1KD1 4;  3UJM A;  4RNY A;  1L5G B;  2UX0 A;  1NB5 I;  3NBR A;  4AKY A;  2XFT A;  4O02 B;  2OTJ 3;  4HM6 B;  3CCR 3;  5I97 A;  2CFL A;  5DRE A;  3PS8 A;  5CXO A;  4PEJ A;  2P09 A;  4N3V A;  3EC9 A;  1ROA A;  4R9K A;  3N54 B;  1JB4 A;  1ISK A;  2BNG A;  4HM5 B;  3H51 A;  3RDE A;  4HM1 B;  4EYC A;  1OF5 A;  1GD3 A;  3WMD A;  1Q7Y 4;  2HML B;  4FCZ A;  5IG4 A;  1AVK A;  1NDO B;  4K1V A;  2CW9 A;  3CC4 3;  1DVC A;  4FMD A;  5IG5 A;  1PFP A;  3TDG A;  1EG9 B;  1CYV A;  4N6T A;  3DZL A;  3NM7 A;  1OHO A;  1ROV A;  4GB5 A;  2GEX A;  4ZM8 A;  2MF7 A;  4FCM A;  3NBJ A;  3RGA A;  4LZI A;  2CWU A;  1E3V A;  1OF5 B;  2FGT A;  1OAC A;  3D9R A;  1DVD A;  2BT3 A;  4BTY A;  1VQ5 3;  1IQ8 A;  1VQ9 3;  5AIH A;  1TU5 A;  2ZL8 A;  4LEH A;  4KZ1 A;  3S67 A;  3KII A;  3FF0 A;  1QVF 2;  4R1K A;  1YIT 3;  1VQ4 3;  1FGT A;  3WA3 A;  3UB1 A;  2A15 A;  2R4I A;  3SVA A;  5FGO A;  1CYU A;  3DGM A;  3IPT A;  1NJI 4;  3FF2 A;  1JNQ A;  3MHE A;  3LTD A;  1IK3 A;  3BNC A;  3CPO A;  3EB8 A;  1U8C B;  3PYJ A;  4XM4 A;  3GAX A;  3GZR A;  2XFS A;  1KSI A;  3CC2 3;  4L7K A;  1AVL A;  4WYK A;  2XGN A;  1IV9 A;  1WTH A;  2HMJ B;  2W2C A;  1TIJ A;  2O3O A;  3DGN A;  4L8O A;  1VQP 3;  3X3Y A;  3CD6 3;  1M9G A;  1HU9 A;  1VQ7 3;  1QMA A;  3I56 3;  1IV7 A;  2E2U A;  4WWU C;  2BO9 B;  2CG0 A;  3X40 A;  4KFE A;  1SIH A;  3DGL A;  4MMX B;  1F8N A;  3GZY B;  3B4O A;  3JVC A;  1RJO A;  3EQQ B;  3DY5 A;  4EBG A;  3U97 A;  3DGO A;  2RSX A;  3X42 A;  1EA2 A;  2M7O A;  1SQW A;  1M90 4;  1QVG 2;  4WYK B;  3G4S 3;  5KP3 A;  5EVH A;  4HZB B;  3UL6 A;  5CF1 A;  1BUQ A;  3BND A;  1KC8 4;  5G2G A;  2WGQ A;  3MKI A;  3JUM A;  1W00 A;  5AYR B;  1O7M B;  3DXO A;  2W04 A;  1OGX A;  4O2H A;  1VQN 3;  5IW9 A;  2CWV A;  5AEU B;  2D1W A;  1N8Q A;  3B8L A;  3T8U A;  3X41 A;  2OOV A;  1JRQ A;  2CFD A;  3SLU A;  1HKX A;  4R80 A;  4FMB A;  2V1L A;  3HK4 A;  5TGN A;  3LOY A;  1QAL A;  4EV5 A;  2W9P A;  3QK9 A;  1A2V A;  1N8R 4;  3ER7 A;  4LGQ A;  3WOE B;  1M1X B;  2BHM A;  1N5P A;  3FG1 A;  1WMN A;  3S28 A;  1OUN A;  2B24 B;  2QIY A;  4N6O B;  2W0Q A;  1TP6 A;  1W02 A;  3EX9 A;  2YFI B;  1ZX2 A;  4I4K A;  1V74 A;  1FUW A;  3LT8 A;  1JB5 A;  3LTA A;  3EN1 B;  2XEP A;  3JUN A;  5AEW B;  2IUJ A;  3K0Z A;  1W7C A;  3AMO A;  1PU4 A;  1US1 A;  4TX4 A;  1CQS A;  3VGN A;  2GXF A;  2RFR A;  3F8H A;  3CXC 2;  1ZO2 A;  1T5Y A;  3OWS A;  4N6N B;  3FH1 A;  2Q07 A;  3LYG A;  3I55 3;  2CK3 H;  1STF I;  1STD A;  2BMQ B;  1VQO 3;  4WP5 A;  5EQL A;  4BTW A;  3J7Y d;  4HJL B;  3CC7 3;  3OWU A;  1Q86 4;  3VSY A;  4WHA A;  2WOF A;  1OH0 A;  2PNC A;  5IG0 A;  7STD A;  4KVH A;  4X2H A;  3QRD A;  2YFJ B;  3MYT A;  3AMO B;  2BMO B;  4HVN A;  5AI1 A;  2P0M A;  4LMI A;  3N9H A;  1SJW A;  1QAK A;  3F8X A;  4NRE A;  2Z6B A;  3Q90 A;  3D3L A;  1R4C A;  1WQL B;  5JBS A;  1VZZ A;  3EE1 A;  3GRD A;  3ALA A;  3PCS A;  3H3H A;  3K63 A;  3BNB A;  2OCT A;  1GY7 A;  2PZV A;  3PCR A;  4K90 B;  4Q53 A;  4U13 A;  1IQX A;  2HMM B;  3FG3 A;  1DYU A;  2LQV A;  2W56 A;  5AII A;  1CEW I;  3HZP A;  1D6U A;  2IA7 A;  2K54 A;  3Q2P A;  5AIF A;  3FSD A;  2W9Q A;  2JDI H;  2CFW A;  2E2V A;  2IUK A;  3NV0 A;  2P0X A;  2Y73 A;  5BXQ A;  5FW5 A;  4CDL A;  1TFO A;  4MEI A;  1O7W B;  1FGM A;  1Z1S A;  3SX1 A;  3WDG B;  3G71 3;  3RGR A;  1VQL 3;  2F99 A;  3NM2 A;  2Z77 A;  3MWZ A;  3HI7 A;  1AR0 A;  2XH9 A;  2W56 B;  1IVV A;  2GU1 A;  2BMR B;  4FR9 A;  2CKF B;  3JUQ A;  1JV2 B;  1OGZ A;  4K1U A;  2RGQ A;  1KQS 2;  2OQE A;  3V99 A;  2OWP A;  1EKM A;  3FG4 A;  3NHX A;  2OTL 3;  2F86 B;  1A67 A;  3NV0 B;  1D6Z A;  4RBN A;  2YFL B;  1LNH A;  2YX9 A;  3JUO A;  3OV4 A;  4FMA A;  2QA4 3;  2P38 A;  3NXJ A;  2IMJ A;  1GY5 A;  3F9S A;  1RRH A;  4FCJ A;  4R9L A;  1ULJ B;  3BNE A;  3KSE D;  2ZDJ A;  2XRX B;  4XDW A;  1K8A 4;  1N9E A;  5KP1 A;  2WO0 A;  4HM2 B;  5A0O B;  3G0K A;  3LXU X;  3KZT A;  4HM0 B;  2GBX B;  3OW2 2;  3CCJ 3;  4LSO A;  3A76 A;  2KXG A;  4MMZ B;  3KFQ C;  3CU3 A;  4HZ9 B;  3KE7 A;  1W2B 2;  1IQY A;  1A2K A;  1ASK A;  5ELJ A;  1O7H B;  4AEQ A;  3Q1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...