1KWIA

Crystal structure analysis of the cathelicidin motif of protegrins
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
85
Chain Sequence
ALSYREAVLRAVDRLNEQSSEANLYRLLELDGTPKPVSFTVKETVCPRPTRQPPELCDFKENGRVKQCVGTVTLDPLDITCNEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Protegrin-3 Precursor
publication title Structure of the cathelicidin motif of protegrin-3 precursor: structural insights into the activation mechanism of an antimicrobial protein.
pubmed doi rcsb
source organism Sus scrofa
total genus 21
structure length 85
sequence length 98
ec nomenclature
pdb deposition date 2002-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00666 Cathelicidins Cathelicidin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1kwiA00
1A67A 1GD4A 4ZM8A 2O9UX 3GAXA 3PYJA 1ROAA 2W9PA 4LZIA 1DVDA 2KXGA 1G96A 5LC6A 4N6MA 3QRDA 1TIJA 1R4CA 3K9MC 4N6TA 1N5PA 1NB3I 1EQKA 3UL5A 4N6UA 1KWIA 1CYVA 1FA3A 5EQLA 5LC7A 3KSED 3PXMA 1A90A 3LH4A 1IV9A 2OCTA 5A0OB 1CEWI 3Q2PA 4N6OB 3SVAA 1MOLA 4N6V0 4EYCA 3IMAB 1CYUA 5ELUA 1MNLA 1IV7A 3MWZA 3NX0A 2BO9B 1NB5I 4N6NB 1FUWA 2W9QA 4IT7A 1PFPA 2CH9A 1GD3A 1YVBI 3L0RA 1RN7A 1LXEA 4N6LA 1WNHA 1STFI 4TX4A 3UL6A 1DVCA 4CCVA 3PS8A 1N9JA 3KFQC 3S67A 1M9GA 1N5HA 5ELJA
chains in the Genus database with same CATH superfamily
5D81A 2IY2A 2HMOB 2JQ5A 1GD4A 4WHAA 3EJVA 5JPPA 3BU4A 1BSDA 1FGOA 1CQSA 1BNFA 3FF2A 1YHQ3 3CCL3 3EE1A 1N8QA 3NV0A 1IVVA 2F4YA 2GU1A 2XFTA 1CH0A 2P38A 1BSCA 1DMNA 3DGNA 1W2ZA 1PY3A 2CC3A 2CHCA 4DKIA 1DVDA 1BRKA 2F86B 1G96A 2LQVA 1SJWA 3CCQ3 1IK3A 3KSPA 2IMJA 4GSPA 3IPTA 2KAAA 5TGNA 2ZDJA 1YIJ3 3K5TA 1IQ8A 1IVUA 3K9MC 4N6TA 1EA2A 3AGNA 5AEUB 1UCLA 4RNYA 1V58A 1N5PA 2PZVA 3I563 3MG3A 1NB3I 4CJNA 1HKXA 3K0ZA 3LTBA 4G1MB 1RKYA 1B2MA 6RNTA 2IUKA 3PCSA 1W4NA 1VQK3 4EV5A 1QAFA 1W2B2 1LOXA 5M18A 5IG3A 5LC7A 5AI1A 3BNCA 1M904 1UUGB 2Y74A 2F5WA 3D4AA 3LOYA 1UCJA 3NQYA 3BNEA 2KRTA 4EC6A 1BUQA 3F8XA 1GOYA 1GY5A 7GSPA 4GHOA 3AHSA 2XH9A 2HOHA 4EBGA 3CPW2 2CX0A 3NQZA 2AAEA 1JKGB 1ZS7A 4N6V0 1OH0A 1DYUA 4EV2A 3LXUX 2ML5A 1YGWA 3IMAB 3IJEB 2PNCA 1MNLA 2M7OA 2OQEA 1IV7A 3JUQA 4FCMA 3MWZA 1BNEA 1OHPA 4FMBA 3CPOA 3GZYB 3NX0A 2MC8A 3FG3A 3LT9A 1Q864 3KIIA 1EUIC 3AHWA 3JUMA 3NBJA 3OWUA 4L8PA 4R1KA 5DREA 1WMPA 5AYSC 5IG0A 1RDSA 3DXOA 1B2ZA 4HM4B 4AKYA 1IYYA 1OUNA 4OK0A 2W0QA 2CFGA 1VQN3 3NXJA 2H0HA 3F8HA 4N6NB 1I0XA 4HM8B 3FCSB 2C11A 1Q40B 3SOYA 5AIHA 4CDLA 5STDA 1OCVA 4BTWA 1I2FA 5FW5A 1E3VA 3E99A 3X3YA 3HI7A 3OW22 1NU3A 1SQWA 4L8OA 2QIYA 1RRLA 2CFWA 2CWUA 5BU4A 3NUVA 2F98A 3D5IA 3L0RA 4FMCA 1VQO3 1RCLA 1FW7A 1AVKA 4NPBA 3T0UA 3BLZA 2CK3H 1JNQA 5D83A 1LXEA 7RNTA 1RJOA 3EQQB 3URPA 1TUHA 1WNHA 4BTXA 2SARA 2KCDA 1I8VA 2SBLA 3G8ZA 5BXQA 3MPHA 2BMQB 3STDA 1BNSA 3EBTA 3PS8A 4LMIA 2IA7A 2K3DA 5RNTA 2ZL8A 1YNVX 3V99A 1LNHA 1JBTA 1WMOA 3I0YA 3OWYA 3X40A 2WOFA 2YFLB 4RZMA 2FXTA 1MWSA 3ECFA 2KF4A 1GY6A 1B2XA 1BSAA 1IDPA 3DY5A 1BRSA 1W00A 1BSEA 4KFEA 5G1KA 2P05A 3X3XA 2ZA4A 1JN5A 5IEPA 1LOWA 4ZM8A 2FNQA 2W56A 4BU4A 1W6CA 1YJ93 4RNZA 3S28A 5BIRA 3GAXA 2STDA 3WHOA 3LTCA 1BIRA 1JB2A 4GL6A 4HM1B 3SEDA 2WOHA 5AEWB 4R9LA 1FYSA 1V74A 1VQ73 3RDEA 1LNIA 4N6MA 4AKZA 3G4S3 2A15A 3FLJA 1RNTA 1G0TA 1TIJA 6GSPA 1Q7Y4 3AGOA 5AYRB 3CCJ3 1KSIA 1OF5B 3EHCA 1JJ22 3SX1A 1RN4A 2RFRA 1OPYA 1A2KA 1D6YA 4K90B 3NV0B 2CW9A 1OACA 2R41A 3SXXA 5JPUA 4MJDA 1JBSA 1QALA 1O7HB 2XEPA 2R4IA 3CMA3 1UI7A 1DMMA 1FA3A 1W01A 2CG0A 8CHOA 5EQLA 3KKGA 4O02B 5HGRA 2HMJB 1T2HA 5G2GA 4MMYB 1RGEA 4U13A 1ULJB 5A0OB 2P0MA 1KC84 1BRGA 3SVAA 1AVLA 1IT7A 2QGUA 3FZWA 1FGTA 1LQMB 1ZX2A 3LMLA 4MMZB 8RNTA 2CG1A 2UGIA 3EX9A 1VQ43 1N9EA 5IG5A 1ZO2A 5G1LA 1RTUA 3BIRA 4CPKA 1QJGA 1YIT3 2BU4A 3RGAA 3EBYA 3F9SA 4OUQA 2OOVC 3WOFB 2UUGC 1B2SA 2BO9B 1A2VA 1NWWA 1QAKA 4MMXB 3LTDA 1PYLA 1T2IA 4LGQA 1RMSA 2HMKB 1BRHA 2XGNA 3JUOA 3PZWA 2HMNB 3ZG5A 2OWPA 3CC43 1V57A 2GSPA 5BVBA 2W9QA 1DE3A 1OGZA 4IT7A 3A5EA 3N8BA 2XSHB 1MGRA 2XR8B 4J9AA 4BL3A 5JBSA 5KP1A 4BL2A 3GZBA 4HM0B 1PFPA 2CKFB 5GSPA 2L1SA 4KT3B 1VQ83 3G16A 5KP4A 1BNRA 2H0IA 3GZRA 1B3SA 3V92A 4BIRA 1GD3A 4QWTA 5EEOA 1MWUA 9RNTA 1E3RA 1UCKA 3CNMA 3SOAA 2W03A 3DGMA 2ZHXB 3BNDA 1RGCA 4WP5A 3BNBA 1QVF2 5IF6A 1RN7A 1RGFA 1ULIB 3K63A 1FZUA 1O7MB 2GU3A 1B2UA 3LZAA 4JF8A 1STFI 2B1XB 3F40A 4WFOA 1YJN3 1W7CA 3D3LA 1DVCA 4HM2B 3G0KA 3SYUA 1I0VA 1N9JA 1HZ1A 1B20A 4O3VA 2YX9A 3UNLA 3S67A 2K0MA 1VQ63 1DETA 4XBXA 1M9GA 4XDVA 4XB5A 4OVMA 3MYTA 1PU4A 4JRFA 2IUJA 3LT8A 3CCU3 2B24B 3UJMA 2H0GA 1RLSA 1BRIA 3GSPA 3CC73 1Q42A 4K1VA 1U5OA 3JVCA 1U8CB 1O7GB 2O9UX 1S5AA 3DMCA 3ROBA 2RNTA 3ZG0A 1MWRA 1JB5A 3PYJA 1BVIA 1TU5A 1DMQA 2W9PA 1EG9B 1E97A 2KXGA 2CFKA 3F14A 2Z7AA 1B21A 3CCE3 2IYJA 2CWVA 3FSDA 3N9HA 4HKVB 4AEQA 3OWSA 3ZFZA 4EW5A 3MSOA 1F8NA 2JDIH 1YGEA 1R4CA 4HAAA 4H3UA 3WODG 4I5QA 1JN5B 1SIHA 2W6JH 5CF2A 2GBXB 3HOHA 3B4PA 3CXC2 2Z6BA 4Q53A 2W56B 5CF1A 3GRDA 3NBRA 4HM5B 2C4BA 5D82A 4K61A 4O8SA 1EQKA 1ZGXA 1X1YA 4N6UA 4PEJA 1GOVA 1TFKA 1N8R4 1OGXA 1EKMA 1O7PB 4HM6B 4RBNA 3FG1A 1A2PA 4EXRA 3J7Yd 2GEXA 1I3IA 1FUTA 3OX9A 1UUWB 3KSED 1TRQA 1WQLB 3HIGA 1A90A 5M1AA 1JZDA 1IU7A 3SLUA 1UUVB 1FGMA 3CNXA 3PCRA 4J8TA 5CLKA 3WA3A 2UX0A 3Q2PA 4H61A 1VQ53 1RGGA 1VQQA 3EN8A 4NHFA 1MOLA 1US1A 3OXAA 4X2HA 1VQL3 3A76A 5AIIA 2F99A 3DM8A 1Q824 1QVG2 4EYCA 3EF8A 4IPBA 3CME3 1YJW3 2XSOB 1ASKA 2D1WA 3AMOA 2RCDA 3MG2A 2YFJB 3O8YA 1SPUA 1WTHA 5KP3A 3VF1A 1BANA 1UCIA 3GZXB 3NBBA 3WA2X 1WMNA 3EC9A 3N54B 1MWTA 4HJLB 1UGHI 3TDGA 2Z76A 4HYZA 1I2GA 3WOEB 4WWUC 1GMPA 1SARA 1W6GA 3JUPA 3F7XA 1AQZA 4WYKA 4XBYA 3VGNA 3KCHA 3DGYA 1GYBA 3ALAA 3D5GA 3U97A 1IQYA 4KFFA 1QMAA 3DGOA 2AADA 1BRNL 1LOYA 1BRJA 1FGQA 1T5YA 1YVBI 4FMDA 2OOVA 1D6UA 1OF5A 1O7NB 2Y73A 4LYLB 3X41A 3FF0A 1IVWA 4FMAA 4KVHA 1L5GB 1BU4A 2KF5A 3UB1A 2F5MA 3CD63 2CIUA 1JRQA 4XBTA 3CCR3 1GOUA 4TX4A 3UL6A 2XF3A 4HZ9B 1YVSA 1UI8A 2INXA 1I70A 4HOHA 1GMQA 5IW9A 2J8XB 3QK9A 1S723 1RGKA 3KFQC 4IIAA 1RNBA 3S29A 1TRPA 3WMDA 2CWTA 2Q07A 1RGLA 3CU3A 3FG4A 3JUNA 1N5HA 4XM4A 1TJDA 1RGAA 2RGQA 3KZTA 3DH2A 4HM7B 1M1K4 3MG1A 3K7CA 1ROVA 1JZOA 5M19A 1GMRA 4HVNA 3KN4A 1W6YA 2XFSA 1A67A 4I4KA 2K54A 1G02A 5IG4A 1BAOA 5CXOA 2BMOB 2RBIA 3VSYA 1K41A 4R4KA 1TP6A 4HBRA 5HOHA 3KE7A 1OHSA 1UGIA 2WGQA 1K28A 1EEJA 1STDA 1BNJA 2E2TA 4RNTA 1ROAA 1UW1A 1GS3A 1NNVA 3F7SA 3Q3FA 3G713 1FGRA 1SIIA 2D42A 2GXFA 4LZIA 3S27A 1LOVA 4BTYA 1YI23 1RGHA 1ISKA 3NHXA 1BNIA 5LC6A 2BNGA 3ER7A 3HIIA 1HYFA 2KF6A 1RRHA 1BUJA 1Y4KA 3QRDA 1B27A 1X1WA 2P0XA 6STDA 1JBRA 3LYGA 1IT8A 1HU9A 4J5GA 2OTJ3 3D79A 2BMRB 1TFOA 1C7HA 4FCZA 3Q1CA 1Q7HA 4GB5A 5DRVA 1RSNA 3FH1A 1KQS2 1BGSA 3FGYA 3B4OA 4KZ1A 1C54A 2GEYA 1X1XA 1BOXA 3HK4A 4R9KA 3DZLA 1D6ZA 1JKGA 3BB9A 2XRXB 1M1XB 3UL5A 5AIGA 1KD14 2OQEC 1KWIA 3OV4A 2O3OA 2RSXA 2I9WA 1X1UA 3DGLA 1CYVA 7STDA 3PXMA 1Q814 2BIRA 3LH4A 1IV9A 2OCTA 2C10A 1Q9EA 1IQXA 1CEWI 3H3HA 2CFDA 2ML6A 1FUSA 4N6OB 3RGRA 1RCKA 1AR0A 5AIFA 4LSOA 1IVXA 2WO0A 4K1UA 4L7KA 1Q40A 4KFDA 5IENA 3WR2A 1TTOA 1CYUA 5ELUA 3B7CA 3MKIA 1NDOB 3V98A 1UDII 3GWRA 3LTAA 1Z1SA 1J2BA 1NB5I 4FR9A 1LVNA 2W04A 1VQP3 1BNGA 2KF3A 1LRAA 1W5ZA 3NM7A 1VQ93 3HX8A 2QA43 1FUWA 2BHMA 2FGTA 2WGOA 1AY7A 4NREA 5I97A 4O2HA 3CCM3 3CCS3 5EVHA 3G6E3 1MGWA 3H51A 3X42A 3EN1B 4HM3B 3D9RA 3NM2A 2F56A 3AMOB 4XDWA 3CCV3 3I553 4ILFA 1LQGC 1NO3A 1BSBA 2CH9A 1RN1A 3DUKA 5IEOA 2Z77A 3T8NA 1GY7A 2L4VA 2V1LA 2HMMB 2MF7A 1R4YA 2GBWB 3EB8A 4N3VA 3T8UA 3B8LA 3S5CA 2BT3A 4N6LA 1RHLA 2W2CA 1GSPA 3RNTA 3Q90A 4WYKB 3X3ZA 4FCJA 5FGOA 1K8A4 3CC23 1K9M4 1T3BA 3WDGB 2CX1A 3U1WA 4HZBB 1W02A 1JV2B 4CCVA 2OTL3 1AV4A 2P09A 3HZPA 4R80A 2E2VA 5CK6A 2QEX3 1VZZA 4J5KA 3M8CA 1I3FA 4MEIA 2LYXA 3PGBA 4STDA 4X2OA 1K734 1O7WB 2XGLA 5IERA 1OHOA 2YFIB 4LEHA 4ORLA 1I2EA 2E2UA 1NJI4 2HMLB 5ELJA 1VQM3 3MHEA 1JB4A 2CFLA 3FKAA
chains in the Genus database with same CATH topology
5D81A 2HMOB 2JQ5A 1GD4A 4WHAA 3EJVA 5JPPA 1FGOA 1CQSA 3FF2A 1YHQ3 3CCL3 3EE1A 1N8QA 3NV0A 1IVVA 2GU1A 2XFTA 2P38A 1DMNA 3DGNA 1W2ZA 2CC3A 2CHCA 1DVDA 2F86B 1G96A 2LQVA 1SJWA 3CCQ3 1IK3A 3KSPA 2IMJA 3IPTA 5TGNA 2ZDJA 1YIJ3 3K5TA 1IQ8A 1IVUA 3K9MC 4N6TA 1EA2A 5AEUB 4RNYA 1N5PA 2PZVA 3I563 3MG3A 1NB3I 1HKXA 3K0ZA 3LTBA 4G1MB 1RKYA 2IUKA 3PCSA 1W4NA 1VQK3 4EV5A 1QAFA 1W2B2 1LOXA 5IG3A 5LC7A 5AI1A 3BNCA 1M904 2Y74A 3LOYA 3NQYA 3BNEA 2KRTA 4EC6A 1BUQA 3F8XA 1GY5A 2XH9A 3CPW2 4EBGA 3NQZA 1JKGB 4N6V0 1OH0A 1DYUA 4EV2A 3LXUX 2ML5A 3IMAB 3IJEB 2PNCA 1MNLA 2M7OA 2OQEA 1IV7A 3JUQA 4FCMA 3MWZA 1OHPA 4FMBA 3CPOA 3GZYB 3NX0A 2MC8A 3FG3A 3LT9A 1Q864 3KIIA 5IG5A 3NBJA 3JUMA 3OWUA 4L8PA 4R1KA 5DREA 5AYSC 1WMPA 5IG0A 3UJMA 3DXOA 4HM4B 4AKYA 1OUNA 4OK0A 2W0QA 2CFGA 1VQN3 3NXJA 3F8HA 4N6NB 4HM8B 3FCSB 2C11A 1Q40B 3SOYA 5AIHA 4CDLA 5STDA 1OCVA 4BTWA 5FW5A 1E3VA 3E99A 3X3YA 3HI7A 3OW22 1NU3A 1SQWA 4L8OA 2QIYA 1RRLA 2CFWA 2CWUA 3NUVA 2F98A 3L0RA 4FMCA 1VQO3 1AVKA 3T0UA 3BLZA 2CK3H 1JNQA 5D83A 1LXEA 1RJOA 3EQQB 1TUHA 1WNHA 4BTXA 2KCDA 2SBLA 3G8ZA 5BXQA 3MPHA 2BMQB 3STDA 3EBTA 3PS8A 4LMIA 2IA7A 2ZL8A 3V99A 1LNHA 1WMOA 3I0YA 3OWYA 3X40A 2WOFA 2YFLB 4RZMA 2FXTA 3ECFA 1GY6A 1IDPA 3DY5A 1W00A 4KFEA 3X3XA 2P05A 1JN5A 5IEPA 4ZM8A 2FNQA 2W56A 1YJ93 1W6CA 4RNZA 3S28A 3GAXA 2STDA 3LTCA 1JB2A 4GL6A 4HM1B 3SEDA 2WOHA 5AEWB 4R9LA 1V74A 1VQ73 3RDEA 4N6MA 4AKZA 3G4S3 2A15A 3FLJA 1TIJA 1Q7Y4 5AYRB 3CCJ3 1KSIA 1OF5B 3EHCA 1JJ22 3SX1A 2RFRA 1OPYA 1A2KA 1D6YA 4K90B 3NV0B 2CW9A 1OACA 3SXXA 5JPUA 4MJDA 1QALA 1O7HB 2XEPA 2R4IA 3CMA3 1UI7A 1DMMA 1FA3A 1W01A 2CG0A 8CHOA 5EQLA 3KKGA 4O02B 5HGRA 2HMJB 5G2GA 4MMYB 4U13A 1ULJB 5A0OB 2P0MA 1KC84 3SVAA 1AVLA 1IT7A 2QGUA 3FZWA 1FGTA 3LMLA 1ZX2A 4MMZB 2CG1A 3EX9A 1VQ43 1N9EA 1ZO2A 1QJGA 1YIT3 3RGAA 3EBYA 3F9SA 4OUQA 2OOVC 3WOFB 2BO9B 1A2VA 1NWWA 1QAKA 4MMXB 3LTDA 4LGQA 2HMKB 2XGNA 3JUOA 3PZWA 2HMNB 2OWPA 3CC43 5BVBA 2W9QA 1OGZA 4IT7A 3N8BA 2XSHB 2XR8B 5JBSA 4J9AA 5KP1A 3GZBA 4HM0B 1PFPA 2CKFB 1VQ83 3G16A 5KP4A 3V92A 3GZRA 1GD3A 4QWTA 5EEOA 1E3RA 3CNMA 3SOAA 2W03A 3DGMA 3BNDA 4WP5A 3BNBA 1QVF2 5IF6A 1RN7A 1ULIB 3K63A 1O7MB 2GU3A 3LZAA 4JF8A 1STFI 2B1XB 3F40A 4WFOA 1YJN3 1W7CA 3D3LA 1DVCA 4HM2B 3G0KA 1N9JA 4O3VA 2YX9A 3UNLA 3S67A 2K0MA 1VQ63 4XBXA 4XDVA 1M9GA 4XB5A 4OVMA 3MYTA 1PU4A 4JRFA 2IUJA 3LT8A 3CCU3 2B24B 3CC73 1Q42A 4K1VA 1U5OA 3JVCA 1U8CB 1O7GB 2O9UX 1S5AA 3DMCA 3ROBA 1JB5A 3PYJA 1TU5A 1DMQA 2W9PA 1EG9B 1E97A 2KXGA 2CFKA 3F14A 2Z7AA 3CCE3 3FSDA 2CWVA 3N9HA 4HKVB 4AEQA 3OWSA 3MSOA 1F8NA 2JDIH 1YGEA 1R4CA 3WODG 4H3UA 1JN5B 1SIHA 2W6JH 5CF2A 2GBXB 3CXC2 3B4PA 2Z6BA 4Q53A 2W56B 5CF1A 3GRDA 3NBRA 4HM5B 5D82A 4K61A 4O8SA 1EQKA 4N6UA 4PEJA 1TFKA 1N8R4 1OGXA 1EKMA 1O7PB 4HM6B 4RBNA 3FG1A 4EXRA 3J7Yd 2GEXA 3OX9A 1UUWB 3KSED 1WQLB 3HIGA 1A90A 1IU7A 3SLUA 1UUVB 1FGMA 3CNXA 3PCRA 4J8TA 5CLKA 3WA3A 2UX0A 3Q2PA 4H61A 1VQ53 3EN8A 4NHFA 1MOLA 1US1A 3OXAA 4X2HA 1VQL3 3A76A 5AIIA 2F99A 3DM8A 1Q824 1QVG2 4EYCA 3EF8A 4IPBA 3CME3 1YJW3 2XSOB 1ASKA 2D1WA 3AMOA 2RCDA 3MG2A 2YFJB 3O8YA 1SPUA 1WTHA 5KP3A 3VF1A 3GZXB 3NBBA 3WA2X 1WMNA 3EC9A 3N54B 4HJLB 3TDGA 2Z76A 4HYZA 3WOEB 4WWUC 1W6GA 3JUPA 3F7XA 4WYKA 4XBYA 3VGNA 1GYBA 3ALAA 3U97A 1IQYA 4KFFA 1QMAA 3DGOA 1FGQA 1T5YA 1YVBI 4FMDA 2OOVA 1D6UA 1OF5A 1O7NB 2Y73A 3X41A 3FF0A 1IVWA 4FMAA 4KVHA 1L5GB 3UB1A 3CD63 2CIUA 1JRQA 4XBTA 3CCR3 4TX4A 3UL6A 2XF3A 4HZ9B 1UI8A 2INXA 5IW9A 1S723 3QK9A 3KFQC 4IIAA 3S29A 3WMDA 2CWTA 2Q07A 3CU3A 3FG4A 3JUNA 1N5HA 4XM4A 2RGQA 3KZTA 4HM7B 1M1K4 3MG1A 3K7CA 1ROVA 4HVNA 3KN4A 1W6YA 2XFSA 1A67A 4I4KA 2K54A 5IG4A 5CXOA 2BMOB 3VSYA 1K41A 4R4KA 1TP6A 4HBRA 3KE7A 1OHSA 2WGQA 1K28A 1STDA 2E2TA 1ROAA 1GS3A 1UW1A 3F7SA 3G713 1FGRA 1SIIA 2D42A 2GXFA 4LZIA 3S27A 4BTYA 1YI23 1ISKA 3NHXA 5LC6A 2BNGA 3ER7A 3HIIA 1RRHA 1Y4KA 3QRDA 6STDA 2P0XA 3LYGA 1IT8A 1HU9A 2OTJ3 2BMRB 1TFOA 1C7HA 4FCZA 3Q1CA 5DRVA 4GB5A 3FH1A 1KQS2 3FGYA 3B4OA 4KZ1A 2GEYA 3HK4A 4R9KA 3DZLA 1D6ZA 1JKGA 3BB9A 2XRXB 1M1XB 3UL5A 5AIGA 1KD14 2OQEC 1KWIA 3OV4A 2O3OA 2RSXA 2I9WA 3DGLA 1CYVA 7STDA 3PXMA 1Q814 3LH4A 1IV9A 2OCTA 2C10A 1IQXA 1CEWI 3H3HA 2CFDA 2ML6A 4N6OB 3RGRA 1AR0A 5AIFA 4LSOA 1IVXA 2WO0A 4K1UA 4L7KA 1Q40A 4KFDA 5IENA 1CYUA 5ELUA 3B7CA 3MKIA 1NDOB 3V98A 3GWRA 3LTAA 1Z1SA 1J2BA 1NB5I 4FR9A 1LVNA 2W04A 1VQP3 1W5ZA 3NM7A 1VQ93 3HX8A 2QA43 1FUWA 2BHMA 1JB4A 2WGOA 4NREA 5I97A 4O2HA 3CCM3 3CCS3 5EVHA 3G6E3 3H51A 3X42A 3EN1B 4HM3B 3D9RA 3NM2A 3AMOB 4XDWA 3CCV3 3I553 1NO3A 2CH9A 3DUKA 5IEOA 2Z77A 3T8NA 2V1LA 1GY7A 2L4VA 2HMMB 2MF7A 2GBWB 3EB8A 4N3VA 3T8UA 3B8LA 3S5CA 2BT3A 4N6LA 2W2CA 3Q90A 4WYKB 3X3ZA 4FCJA 5FGOA 1K8A4 3CC23 1K9M4 3WDGB 3U1WA 4HZBB 1W02A 1JV2B 4CCVA 2OTL3 1AV4A 2P09A 3HZPA 4R80A 2E2VA 5CK6A 2QEX3 1VZZA 3M8CA 4MEIA 4STDA 2LYXA 3PGBA 1K734 4X2OA 1O7WB 2XGLA 5IERA 1OHOA 2YFIB 4LEHA 4ORLA 2E2UA 1NJI4 2HMLB 5ELJA 1VQM3 3MHEA 2FGTA 2CFLA 3FKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A67 A;  1GD4 A;  4ZM8 A;  2O9U X;  3GAX A;  3PYJ A;  1ROA A;  2W9P A;  4LZI A;  1DVD A;  2KXG A;  1G96 A;  5LC6 A;  4N6M A;  3QRD A;  1TIJ A;  1R4C A;  3K9M C;  4N6T A;  1N5P A;  1NB3 I;  1EQK A;  3UL5 A;  4N6U A;  1KWI A;  1CYV A;  1FA3 A;  5EQL A;  5LC7 A;  3KSE D;  3PXM A;  1A90 A;  3LH4 A;  1IV9 A;  2OCT A;  5A0O B;  1CEW I;  3Q2P A;  4N6O B;  3SVA A;  1MOL A;  4N6V 0;  4EYC A;  3IMA B;  1CYU A;  5ELU A;  1MNL A;  1IV7 A;  3MWZ A;  3NX0 A;  2BO9 B;  1NB5 I;  4N6N B;  1FUW A;  2W9Q A;  4IT7 A;  1PFP A;  2CH9 A;  1GD3 A;  1YVB I;  3L0R A;  1RN7 A;  1LXE A;  4N6L A;  1WNH A;  1STF I;  4TX4 A;  3UL6 A;  1DVC A;  4CCV A;  3PS8 A;  1N9J A;  3KFQ C;  3S67 A;  1M9G A;  1N5H A;  5ELJ A; 
#chains in the Genus database with same CATH topology
 5D81 A;  2IY2 A;  2HMO B;  2JQ5 A;  1GD4 A;  4WHA A;  3EJV A;  5JPP A;  3BU4 A;  1BSD A;  1FGO A;  1CQS A;  1BNF A;  3FF2 A;  1YHQ 3;  3CCL 3;  3EE1 A;  1N8Q A;  3NV0 A;  1IVV A;  2F4Y A;  2GU1 A;  2XFT A;  1CH0 A;  2P38 A;  1BSC A;  1DMN A;  3DGN A;  1W2Z A;  1PY3 A;  2CC3 A;  2CHC A;  4DKI A;  1DVD A;  1BRK A;  2F86 B;  1G96 A;  2LQV A;  1SJW A;  3CCQ 3;  1IK3 A;  3KSP A;  2IMJ A;  4GSP A;  3IPT A;  2KAA A;  5TGN A;  2ZDJ A;  1YIJ 3;  3K5T A;  1IQ8 A;  1IVU A;  3K9M C;  4N6T A;  1EA2 A;  3AGN A;  5AEU B;  1UCL A;  4RNY A;  1V58 A;  1N5P A;  2PZV A;  3I56 3;  3MG3 A;  1NB3 I;  4CJN A;  1HKX A;  3K0Z A;  3LTB A;  4G1M B;  1RKY A;  1B2M A;  6RNT A;  2IUK A;  3PCS A;  1W4N A;  1VQK 3;  4EV5 A;  1QAF A;  1W2B 2;  1LOX A;  5M18 A;  5IG3 A;  5LC7 A;  5AI1 A;  3BNC A;  1M90 4;  1UUG B;  2Y74 A;  2F5W A;  3D4A A;  3LOY A;  1UCJ A;  3NQY A;  3BNE A;  2KRT A;  4EC6 A;  1BUQ A;  3F8X A;  1GOY A;  1GY5 A;  7GSP A;  4GHO A;  3AHS A;  2XH9 A;  2HOH A;  4EBG A;  3CPW 2;  2CX0 A;  3NQZ A;  2AAE A;  1JKG B;  1ZS7 A;  4N6V 0;  1OH0 A;  1DYU A;  4EV2 A;  3LXU X;  2ML5 A;  1YGW A;  3IMA B;  3IJE B;  2PNC A;  1MNL A;  2M7O A;  2OQE A;  1IV7 A;  3JUQ A;  4FCM A;  3MWZ A;  1BNE A;  1OHP A;  4FMB A;  3CPO A;  3GZY B;  3NX0 A;  2MC8 A;  3FG3 A;  3LT9 A;  1Q86 4;  3KII A;  1EUI C;  3AHW A;  3JUM A;  3NBJ A;  3OWU A;  4L8P A;  4R1K A;  5DRE A;  1WMP A;  5AYS C;  5IG0 A;  1RDS A;  3DXO A;  1B2Z A;  4HM4 B;  4AKY A;  1IYY A;  1OUN A;  4OK0 A;  2W0Q A;  2CFG A;  1VQN 3;  3NXJ A;  2H0H A;  3F8H A;  4N6N B;  1I0X A;  4HM8 B;  3FCS B;  2C11 A;  1Q40 B;  3SOY A;  5AIH A;  4CDL A;  5STD A;  1OCV A;  4BTW A;  1I2F A;  5FW5 A;  1E3V A;  3E99 A;  3X3Y A;  3HI7 A;  3OW2 2;  1NU3 A;  1SQW A;  4L8O A;  2QIY A;  1RRL A;  2CFW A;  2CWU A;  5BU4 A;  3NUV A;  2F98 A;  3D5I A;  3L0R A;  4FMC A;  1VQO 3;  1RCL A;  1FW7 A;  1AVK A;  4NPB A;  3T0U A;  3BLZ A;  2CK3 H;  1JNQ A;  5D83 A;  1LXE A;  7RNT A;  1RJO A;  3EQQ B;  3URP A;  1TUH A;  1WNH A;  4BTX A;  2SAR A;  2KCD A;  1I8V A;  2SBL A;  3G8Z A;  5BXQ A;  3MPH A;  2BMQ B;  3STD A;  1BNS A;  3EBT A;  3PS8 A;  4LMI A;  2IA7 A;  2K3D A;  5RNT A;  2ZL8 A;  1YNV X;  3V99 A;  1LNH A;  1JBT A;  1WMO A;  3I0Y A;  3OWY A;  3X40 A;  2WOF A;  2YFL B;  4RZM A;  2FXT A;  1MWS A;  3ECF A;  2KF4 A;  1GY6 A;  1B2X A;  1BSA A;  1IDP A;  3DY5 A;  1BRS A;  1W00 A;  1BSE A;  4KFE A;  5G1K A;  2P05 A;  3X3X A;  2ZA4 A;  1JN5 A;  5IEP A;  1LOW A;  4ZM8 A;  2FNQ A;  2W56 A;  4BU4 A;  1W6C A;  1YJ9 3;  4RNZ A;  3S28 A;  5BIR A;  3GAX A;  2STD A;  3WHO A;  3LTC A;  1BIR A;  1JB2 A;  4GL6 A;  4HM1 B;  3SED A;  2WOH A;  5AEW B;  4R9L A;  1FYS A;  1V74 A;  1VQ7 3;  3RDE A;  1LNI A;  4N6M A;  4AKZ A;  3G4S 3;  2A15 A;  3FLJ A;  1RNT A;  1G0T A;  1TIJ A;  6GSP A;  1Q7Y 4;  3AGO A;  5AYR B;  3CCJ 3;  1KSI A;  1OF5 B;  3EHC A;  1JJ2 2;  3SX1 A;  1RN4 A;  2RFR A;  1OPY A;  1A2K A;  1D6Y A;  4K90 B;  3NV0 B;  2CW9 A;  1OAC A;  2R41 A;  3SXX A;  5JPU A;  4MJD A;  1JBS A;  1QAL A;  1O7H B;  2XEP A;  2R4I A;  3CMA 3;  1UI7 A;  1DMM A;  1FA3 A;  1W01 A;  2CG0 A;  8CHO A;  5EQL A;  3KKG A;  4O02 B;  5HGR A;  2HMJ B;  1T2H A;  5G2G A;  4MMY B;  1RGE A;  4U13 A;  1ULJ B;  5A0O B;  2P0M A;  1KC8 4;  1BRG A;  3SVA A;  1AVL A;  1IT7 A;  2QGU A;  3FZW A;  1FGT A;  1LQM B;  1ZX2 A;  3LML A;  4MMZ B;  8RNT A;  2CG1 A;  2UGI A;  3EX9 A;  1VQ4 3;  1N9E A;  5IG5 A;  1ZO2 A;  5G1L A;  1RTU A;  3BIR A;  4CPK A;  1QJG A;  1YIT 3;  2BU4 A;  3RGA A;  3EBY A;  3F9S A;  4OUQ A;  2OOV C;  3WOF B;  2UUG C;  1B2S A;  2BO9 B;  1A2V A;  1NWW A;  1QAK A;  4MMX B;  3LTD A;  1PYL A;  1T2I A;  4LGQ A;  1RMS A;  2HMK B;  1BRH A;  2XGN A;  3JUO A;  3PZW A;  2HMN B;  3ZG5 A;  2OWP A;  3CC4 3;  1V57 A;  2GSP A;  5BVB A;  2W9Q A;  1DE3 A;  1OGZ A;  4IT7 A;  3A5E A;  3N8B A;  2XSH B;  1MGR A;  2XR8 B;  4J9A A;  4BL3 A;  5JBS A;  5KP1 A;  4BL2 A;  3GZB A;  4HM0 B;  1PFP A;  2CKF B;  5GSP A;  2L1S A;  4KT3 B;  1VQ8 3;  3G16 A;  5KP4 A;  1BNR A;  2H0I A;  3GZR A;  1B3S A;  3V92 A;  4BIR A;  1GD3 A;  4QWT A;  5EEO A;  1MWU A;  9RNT A;  1E3R A;  1UCK A;  3CNM A;  3SOA A;  2W03 A;  3DGM A;  2ZHX B;  3BND A;  1RGC A;  4WP5 A;  3BNB A;  1QVF 2;  5IF6 A;  1RN7 A;  1RGF A;  1ULI B;  3K63 A;  1FZU A;  1O7M B;  2GU3 A;  1B2U A;  3LZA A;  4JF8 A;  1STF I;  2B1X B;  3F40 A;  4WFO A;  1YJN 3;  1W7C A;  3D3L A;  1DVC A;  4HM2 B;  3G0K A;  3SYU A;  1I0V A;  1N9J A;  1HZ1 A;  1B20 A;  4O3V A;  2YX9 A;  3UNL A;  3S67 A;  2K0M A;  1VQ6 3;  1DET A;  4XBX A;  1M9G A;  4XDV A;  4XB5 A;  4OVM A;  3MYT A;  1PU4 A;  4JRF A;  2IUJ A;  3LT8 A;  3CCU 3;  2B24 B;  3UJM A;  2H0G A;  1RLS A;  1BRI A;  3GSP A;  3CC7 3;  1Q42 A;  4K1V A;  1U5O A;  3JVC A;  1U8C B;  1O7G B;  2O9U X;  1S5A A;  3DMC A;  3ROB A;  2RNT A;  3ZG0 A;  1MWR A;  1JB5 A;  3PYJ A;  1BVI A;  1TU5 A;  1DMQ A;  2W9P A;  1EG9 B;  1E97 A;  2KXG A;  2CFK A;  3F14 A;  2Z7A A;  1B21 A;  3CCE 3;  2IYJ A;  2CWV A;  3FSD A;  3N9H A;  4HKV B;  4AEQ A;  3OWS A;  3ZFZ A;  4EW5 A;  3MSO A;  1F8N A;  2JDI H;  1YGE A;  1R4C A;  4HAA A;  4H3U A;  3WOD G;  4I5Q A;  1JN5 B;  1SIH A;  2W6J H;  5CF2 A;  2GBX B;  3HOH A;  3B4P A;  3CXC 2;  2Z6B A;  4Q53 A;  2W56 B;  5CF1 A;  3GRD A;  3NBR A;  4HM5 B;  2C4B A;  5D82 A;  4K61 A;  4O8S A;  1EQK A;  1ZGX A;  1X1Y A;  4N6U A;  4PEJ A;  1GOV A;  1TFK A;  1N8R 4;  1OGX A;  1EKM A;  1O7P B;  4HM6 B;  4RBN A;  3FG1 A;  1A2P A;  4EXR A;  3J7Y d;  2GEX A;  1I3I A;  1FUT A;  3OX9 A;  1UUW B;  3KSE D;  1TRQ A;  1WQL B;  3HIG A;  1A90 A;  5M1A A;  1JZD A;  1IU7 A;  3SLU A;  1UUV B;  1FGM A;  3CNX A;  3PCR A;  4J8T A;  5CLK A;  3WA3 A;  2UX0 A;  3Q2P A;  4H61 A;  1VQ5 3;  1RGG A;  1VQQ A;  3EN8 A;  4NHF A;  1MOL A;  1US1 A;  3OXA A;  4X2H A;  1VQL 3;  3A76 A;  5AII A;  2F99 A;  3DM8 A;  1Q82 4;  1QVG 2;  4EYC A;  3EF8 A;  4IPB A;  3CME 3;  1YJW 3;  2XSO B;  1ASK A;  2D1W A;  3AMO A;  2RCD A;  3MG2 A;  2YFJ B;  3O8Y A;  1SPU A;  1WTH A;  5KP3 A;  3VF1 A;  1BAN A;  1UCI A;  3GZX B;  3NBB A;  3WA2 X;  1WMN A;  3EC9 A;  3N54 B;  1MWT A;  4HJL B;  1UGH I;  3TDG A;  2Z76 A;  4HYZ A;  1I2G A;  3WOE B;  4WWU C;  1GMP A;  1SAR A;  1W6G A;  3JUP A;  3F7X A;  1AQZ A;  4WYK A;  4XBY A;  3VGN A;  3KCH A;  3DGY A;  1GYB A;  3ALA A;  3D5G A;  3U97 A;  1IQY A;  4KFF A;  1QMA A;  3DGO A;  2AAD A;  1BRN L;  1LOY A;  1BRJ A;  1FGQ A;  1T5Y A;  1YVB I;  4FMD A;  2OOV A;  1D6U A;  1OF5 A;  1O7N B;  2Y73 A;  4LYL B;  3X41 A;  3FF0 A;  1IVW A;  4FMA A;  4KVH A;  1L5G B;  1BU4 A;  2KF5 A;  3UB1 A;  2F5M A;  3CD6 3;  2CIU A;  1JRQ A;  4XBT A;  3CCR 3;  1GOU A;  4TX4 A;  3UL6 A;  2XF3 A;  4HZ9 B;  1YVS A;  1UI8 A;  2INX A;  1I70 A;  4HOH A;  1GMQ A;  5IW9 A;  2J8X B;  3QK9 A;  1S72 3;  1RGK A;  3KFQ C;  4IIA A;  1RNB A;  3S29 A;  1TRP A;  3WMD A;  2CWT A;  2Q07 A;  1RGL A;  3CU3 A;  3FG4 A;  3JUN A;  1N5H A;  4XM4 A;  1TJD A;  1RGA A;  2RGQ A;  3KZT A;  3DH2 A;  4HM7 B;  1M1K 4;  3MG1 A;  3K7C A;  1ROV A;  1JZO A;  5M19 A;  1GMR A;  4HVN A;  3KN4 A;  1W6Y A;  2XFS A;  1A67 A;  4I4K A;  2K54 A;  1G02 A;  5IG4 A;  1BAO A;  5CXO A;  2BMO B;  2RBI A;  3VSY A;  1K41 A;  4R4K A;  1TP6 A;  4HBR A;  5HOH A;  3KE7 A;  1OHS A;  1UGI A;  2WGQ A;  1K28 A;  1EEJ A;  1STD A;  1BNJ A;  2E2T A;  4RNT A;  1ROA A;  1UW1 A;  1GS3 A;  1NNV A;  3F7S A;  3Q3F A;  3G71 3;  1FGR A;  1SII A;  2D42 A;  2GXF A;  4LZI A;  3S27 A;  1LOV A;  4BTY A;  1YI2 3;  1RGH A;  1ISK A;  3NHX A;  1BNI A;  5LC6 A;  2BNG A;  3ER7 A;  3HII A;  1HYF A;  2KF6 A;  1RRH A;  1BUJ A;  1Y4K A;  3QRD A;  1B27 A;  1X1W A;  2P0X A;  6STD A;  1JBR A;  3LYG A;  1IT8 A;  1HU9 A;  4J5G A;  2OTJ 3;  3D79 A;  2BMR B;  1TFO A;  1C7H A;  4FCZ A;  3Q1C A;  1Q7H A;  4GB5 A;  5DRV A;  1RSN A;  3FH1 A;  1KQS 2;  1BGS A;  3FGY A;  3B4O A;  4KZ1 A;  1C54 A;  2GEY A;  1X1X A;  1BOX A;  3HK4 A;  4R9K A;  3DZL A;  1D6Z A;  1JKG A;  3BB9 A;  2XRX B;  1M1X B;  3UL5 A;  5AIG A;  1KD1 4;  2OQE C;  1KWI A;  3OV4 A;  2O3O A;  2RSX A;  2I9W A;  1X1U A;  3DGL A;  1CYV A;  7STD A;  3PXM A;  1Q81 4;  2BIR A;  3LH4 A;  1IV9 A;  2OCT A;  2C10 A;  1Q9E A;  1IQX A;  1CEW I;  3H3H A;  2CFD A;  2ML6 A;  1FUS A;  4N6O B;  3RGR A;  1RCK A;  1AR0 A;  5AIF A;  4LSO A;  1IVX A;  2WO0 A;  4K1U A;  4L7K A;  1Q40 A;  4KFD A;  5IEN A;  3WR2 A;  1TTO A;  1CYU A;  5ELU A;  3B7C A;  3MKI A;  1NDO B;  3V98 A;  1UDI I;  3GWR A;  3LTA A;  1Z1S A;  1J2B A;  1NB5 I;  4FR9 A;  1LVN A;  2W04 A;  1VQP 3;  1BNG A;  2KF3 A;  1LRA A;  1W5Z A;  3NM7 A;  1VQ9 3;  3HX8 A;  2QA4 3;  1FUW A;  2BHM A;  2FGT A;  2WGO A;  1AY7 A;  4NRE A;  5I97 A;  4O2H A;  3CCM 3;  3CCS 3;  5EVH A;  3G6E 3;  1MGW A;  3H51 A;  3X42 A;  3EN1 B;  4HM3 B;  3D9R A;  3NM2 A;  2F56 A;  3AMO B;  4XDW A;  3CCV 3;  3I55 3;  4ILF A;  1LQG C;  1NO3 A;  1BSB A;  2CH9 A;  1RN1 A;  3DUK A;  5IEO A;  2Z77 A;  3T8N A;  1GY7 A;  2L4V A;  2V1L A;  2HMM B;  2MF7 A;  1R4Y A;  2GBW B;  3EB8 A;  4N3V A;  3T8U A;  3B8L A;  3S5C A;  2BT3 A;  4N6L A;  1RHL A;  2W2C A;  1GSP A;  3RNT A;  3Q90 A;  4WYK B;  3X3Z A;  4FCJ A;  5FGO A;  1K8A 4;  3CC2 3;  1K9M 4;  1T3B A;  3WDG B;  2CX1 A;  3U1W A;  4HZB B;  1W02 A;  1JV2 B;  4CCV A;  2OTL 3;  1AV4 A;  2P09 A;  3HZP A;  4R80 A;  2E2V A;  5CK6 A;  2QEX 3;  1VZZ A;  4J5K A;  3M8C A;  1I3F A;  4MEI A;  2LYX A;  3PGB A;  4STD A;  4X2O A;  1K73 4;  1O7W B;  2XGL A;  5IER A;  1OHO A;  2YFI B;  4LEH A;  4ORL A;  1I2E A;  2E2U A;  1NJI 4;  2HML B;  5ELJ A;  1VQM 3;  3MHE A;  1JB4 A;  2CFL A;  3FKA A; 
#chains in the Genus database with same CATH homology
 5D81 A;  2HMO B;  2JQ5 A;  1GD4 A;  4WHA A;  3EJV A;  5JPP A;  1FGO A;  1CQS A;  3FF2 A;  1YHQ 3;  3CCL 3;  3EE1 A;  1N8Q A;  3NV0 A;  1IVV A;  2GU1 A;  2XFT A;  2P38 A;  1DMN A;  3DGN A;  1W2Z A;  2CC3 A;  2CHC A;  1DVD A;  2F86 B;  1G96 A;  2LQV A;  1SJW A;  3CCQ 3;  1IK3 A;  3KSP A;  2IMJ A;  3IPT A;  5TGN A;  2ZDJ A;  1YIJ 3;  3K5T A;  1IQ8 A;  1IVU A;  3K9M C;  4N6T A;  1EA2 A;  5AEU B;  4RNY A;  1N5P A;  2PZV A;  3I56 3;  3MG3 A;  1NB3 I;  1HKX A;  3K0Z A;  3LTB A;  4G1M B;  1RKY A;  2IUK A;  3PCS A;  1W4N A;  1VQK 3;  4EV5 A;  1QAF A;  1W2B 2;  1LOX A;  5IG3 A;  5LC7 A;  5AI1 A;  3BNC A;  1M90 4;  2Y74 A;  3LOY A;  3NQY A;  3BNE A;  2KRT A;  4EC6 A;  1BUQ A;  3F8X A;  1GY5 A;  2XH9 A;  3CPW 2;  4EBG A;  3NQZ A;  1JKG B;  4N6V 0;  1OH0 A;  1DYU A;  4EV2 A;  3LXU X;  2ML5 A;  3IMA B;  3IJE B;  2PNC A;  1MNL A;  2M7O A;  2OQE A;  1IV7 A;  3JUQ A;  4FCM A;  3MWZ A;  1OHP A;  4FMB A;  3CPO A;  3GZY B;  3NX0 A;  2MC8 A;  3FG3 A;  3LT9 A;  1Q86 4;  3KII A;  5IG5 A;  3NBJ A;  3JUM A;  3OWU A;  4L8P A;  4R1K A;  5DRE A;  5AYS C;  1WMP A;  5IG0 A;  3UJM A;  3DXO A;  4HM4 B;  4AKY A;  1OUN A;  4OK0 A;  2W0Q A;  2CFG A;  1VQN 3;  3NXJ A;  3F8H A;  4N6N B;  4HM8 B;  3FCS B;  2C11 A;  1Q40 B;  3SOY A;  5AIH A;  4CDL A;  5STD A;  1OCV A;  4BTW A;  5FW5 A;  1E3V A;  3E99 A;  3X3Y A;  3HI7 A;  3OW2 2;  1NU3 A;  1SQW A;  4L8O A;  2QIY A;  1RRL A;  2CFW A;  2CWU A;  3NUV A;  2F98 A;  3L0R A;  4FMC A;  1VQO 3;  1AVK A;  3T0U A;  3BLZ A;  2CK3 H;  1JNQ A;  5D83 A;  1LXE A;  1RJO A;  3EQQ B;  1TUH A;  1WNH A;  4BTX A;  2KCD A;  2SBL A;  3G8Z A;  5BXQ A;  3MPH A;  2BMQ B;  3STD A;  3EBT A;  3PS8 A;  4LMI A;  2IA7 A;  2ZL8 A;  3V99 A;  1LNH A;  1WMO A;  3I0Y A;  3OWY A;  3X40 A;  2WOF A;  2YFL B;  4RZM A;  2FXT A;  3ECF A;  1GY6 A;  1IDP A;  3DY5 A;  1W00 A;  4KFE A;  3X3X A;  2P05 A;  1JN5 A;  5IEP A;  4ZM8 A;  2FNQ A;  2W56 A;  1YJ9 3;  1W6C A;  4RNZ A;  3S28 A;  3GAX A;  2STD A;  3LTC A;  1JB2 A;  4GL6 A;  4HM1 B;  3SED A;  2WOH A;  5AEW B;  4R9L A;  1V74 A;  1VQ7 3;  3RDE A;  4N6M A;  4AKZ A;  3G4S 3;  2A15 A;  3FLJ A;  1TIJ A;  1Q7Y 4;  5AYR B;  3CCJ 3;  1KSI A;  1OF5 B;  3EHC A;  1JJ2 2;  3SX1 A;  2RFR A;  1OPY A;  1A2K A;  1D6Y A;  4K90 B;  3NV0 B;  2CW9 A;  1OAC A;  3SXX A;  5JPU A;  4MJD A;  1QAL A;  1O7H B;  2XEP A;  2R4I A;  3CMA 3;  1UI7 A;  1DMM A;  1FA3 A;  1W01 A;  2CG0 A;  8CHO A;  5EQL A;  3KKG A;  4O02 B;  5HGR A;  2HMJ B;  5G2G A;  4MMY B;  4U13 A;  1ULJ B;  5A0O B;  2P0M A;  1KC8 4;  3SVA A;  1AVL A;  1IT7 A;  2QGU A;  3FZW A;  1FGT A;  3LML A;  1ZX2 A;  4MMZ B;  2CG1 A;  3EX9 A;  1VQ4 3;  1N9E A;  1ZO2 A;  1QJG A;  1YIT 3;  3RGA A;  3EBY A;  3F9S A;  4OUQ A;  2OOV C;  3WOF B;  2BO9 B;  1A2V A;  1NWW A;  1QAK A;  4MMX B;  3LTD A;  4LGQ A;  2HMK B;  2XGN A;  3JUO A;  3PZW A;  2HMN B;  2OWP A;  3CC4 3;  5BVB A;  2W9Q A;  1OGZ A;  4IT7 A;  3N8B A;  2XSH B;  2XR8 B;  5JBS A;  4J9A A;  5KP1 A;  3GZB A;  4HM0 B;  1PFP A;  2CKF B;  1VQ8 3;  3G16 A;  5KP4 A;  3V92 A;  3GZR A;  1GD3 A;  4QWT A;  5EEO A;  1E3R A;  3CNM A;  3SOA A;  2W03 A;  3DGM A;  3BND A;  4WP5 A;  3BNB A;  1QVF 2;  5IF6 A;  1RN7 A;  1ULI B;  3K63 A;  1O7M B;  2GU3 A;  3LZA A;  4JF8 A;  1STF I;  2B1X B;  3F40 A;  4WFO A;  1YJN 3;  1W7C A;  3D3L A;  1DVC A;  4HM2 B;  3G0K A;  1N9J A;  4O3V A;  2YX9 A;  3UNL A;  3S67 A;  2K0M A;  1VQ6 3;  4XBX A;  4XDV A;  1M9G A;  4XB5 A;  4OVM A;  3MYT A;  1PU4 A;  4JRF A;  2IUJ A;  3LT8 A;  3CCU 3;  2B24 B;  3CC7 3;  1Q42 A;  4K1V A;  1U5O A;  3JVC A;  1U8C B;  1O7G B;  2O9U X;  1S5A A;  3DMC A;  3ROB A;  1JB5 A;  3PYJ A;  1TU5 A;  1DMQ A;  2W9P A;  1EG9 B;  1E97 A;  2KXG A;  2CFK A;  3F14 A;  2Z7A A;  3CCE 3;  3FSD A;  2CWV A;  3N9H A;  4HKV B;  4AEQ A;  3OWS A;  3MSO A;  1F8N A;  2JDI H;  1YGE A;  1R4C A;  3WOD G;  4H3U A;  1JN5 B;  1SIH A;  2W6J H;  5CF2 A;  2GBX B;  3CXC 2;  3B4P A;  2Z6B A;  4Q53 A;  2W56 B;  5CF1 A;  3GRD A;  3NBR A;  4HM5 B;  5D82 A;  4K61 A;  4O8S A;  1EQK A;  4N6U A;  4PEJ A;  1TFK A;  1N8R 4;  1OGX A;  1EKM A;  1O7P B;  4HM6 B;  4RBN A;  3FG1 A;  4EXR A;  3J7Y d;  2GEX A;  3OX9 A;  1UUW B;  3KSE D;  1WQL B;  3HIG A;  1A90 A;  1IU7 A;  3SLU A;  1UUV B;  1FGM A;  3CNX A;  3PCR A;  4J8T A;  5CLK A;  3WA3 A;  2UX0 A;  3Q2P A;  4H61 A;  1VQ5 3;  3EN8 A;  4NHF A;  1MOL A;  1US1 A;  3OXA A;  4X2H A;  1VQL 3;  3A76 A;  5AII A;  2F99 A;  3DM8 A;  1Q82 4;  1QVG 2;  4EYC A;  3EF8 A;  4IPB A;  3CME 3;  1YJW 3;  2XSO B;  1ASK A;  2D1W A;  3AMO A;  2RCD A;  3MG2 A;  2YFJ B;  3O8Y A;  1SPU A;  1WTH A;  5KP3 A;  3VF1 A;  3GZX B;  3NBB A;  3WA2 X;  1WMN A;  3EC9 A;  3N54 B;  4HJL B;  3TDG A;  2Z76 A;  4HYZ A;  3WOE B;  4WWU C;  1W6G A;  3JUP A;  3F7X A;  4WYK A;  4XBY A;  3VGN A;  1GYB A;  3ALA A;  3U97 A;  1IQY A;  4KFF A;  1QMA A;  3DGO A;  1FGQ A;  1T5Y A;  1YVB I;  4FMD A;  2OOV A;  1D6U A;  1OF5 A;  1O7N B;  2Y73 A;  3X41 A;  3FF0 A;  1IVW A;  4FMA A;  4KVH A;  1L5G B;  3UB1 A;  3CD6 3;  2CIU A;  1JRQ A;  4XBT A;  3CCR 3;  4TX4 A;  3UL6 A;  2XF3 A;  4HZ9 B;  1UI8 A;  2INX A;  5IW9 A;  1S72 3;  3QK9 A;  3KFQ C;  4IIA A;  3S29 A;  3WMD A;  2CWT A;  2Q07 A;  3CU3 A;  3FG4 A;  3JUN A;  1N5H A;  4XM4 A;  2RGQ A;  3KZT A;  4HM7 B;  1M1K 4;  3MG1 A;  3K7C A;  1ROV A;  4HVN A;  3KN4 A;  1W6Y A;  2XFS A;  1A67 A;  4I4K A;  2K54 A;  5IG4 A;  5CXO A;  2BMO B;  3VSY A;  1K41 A;  4R4K A;  1TP6 A;  4HBR A;  3KE7 A;  1OHS A;  2WGQ A;  1K28 A;  1STD A;  2E2T A;  1ROA A;  1GS3 A;  1UW1 A;  3F7S A;  3G71 3;  1FGR A;  1SII A;  2D42 A;  2GXF A;  4LZI A;  3S27 A;  4BTY A;  1YI2 3;  1ISK A;  3NHX A;  5LC6 A;  2BNG A;  3ER7 A;  3HII A;  1RRH A;  1Y4K A;  3QRD A;  6STD A;  2P0X A;  3LYG A;  1IT8 A;  1HU9 A;  2OTJ 3;  2BMR B;  1TFO A;  1C7H A;  4FCZ A;  3Q1C A;  5DRV A;  4GB5 A;  3FH1 A;  1KQS 2;  3FGY A;  3B4O A;  4KZ1 A;  2GEY A;  3HK4 A;  4R9K A;  3DZL A;  1D6Z A;  1JKG A;  3BB9 A;  2XRX B;  1M1X B;  3UL5 A;  5AIG A;  1KD1 4;  2OQE C;  1KWI A;  3OV4 A;  2O3O A;  2RSX A;  2I9W A;  3DGL A;  1CYV A;  7STD A;  3PXM A;  1Q81 4;  3LH4 A;  1IV9 A;  2OCT A;  2C10 A;  1IQX A;  1CEW I;  3H3H A;  2CFD A;  2ML6 A;  4N6O B;  3RGR A;  1AR0 A;  5AIF A;  4LSO A;  1IVX A;  2WO0 A;  4K1U A;  4L7K A;  1Q40 A;  4KFD A;  5IEN A;  1CYU A;  5ELU A;  3B7C A;  3MKI A;  1NDO B;  3V98 A;  3GWR A;  3LTA A;  1Z1S A;  1J2B A;  1NB5 I;  4FR9 A;  1LVN A;  2W04 A;  1VQP 3;  1W5Z A;  3NM7 A;  1VQ9 3;  3HX8 A;  2QA4 3;  1FUW A;  2BHM A;  1JB4 A;  2WGO A;  4NRE A;  5I97 A;  4O2H A;  3CCM 3;  3CCS 3;  5EVH A;  3G6E 3;  3H51 A;  3X42 A;  3EN1 B;  4HM3 B;  3D9R A;  3NM2 A;  3AMO B;  4XDW A;  3CCV 3;  3I55 3;  1NO3 A;  2CH9 A;  3DUK A;  5IEO A;  2Z77 A;  3T8N A;  2V1L A;  1GY7 A;  2L4V A;  2HMM B;  2MF7 A;  2GBW B;  3EB8 A;  4N3V A;  3T8U A;  3B8L A;  3S5C A;  2BT3 A;  4N6L A;  2W2C A;  3Q90 A;  4WYK B;  3X3Z A;  4FCJ A;  5FGO A;  1K8A 4;  3CC2 3;  1K9M 4;  3WDG B;  3U1W A;  4HZB B;  1W02 A;  1JV2 B;  4CCV A;  2OTL 3;  1AV4 A;  2P09 A;  3HZP A;  4R80 A;  2E2V A;  5CK6 A;  2QEX 3;  1VZZ A;  3M8C A;  4MEI A;  4STD A;  2LYX A;  3PGB A;  1K73 4;  4X2O A;  1O7W B;  2XGL A;  5IER A;  1OHO A;  2YFI B;  4LEH A;  4ORL A;  2E2U A;  1NJI 4;  2HML B;  5ELJ A;  1VQM 3;  3MHE A;  2FGT A;  2CFL A;  3FKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...