1IV9A

Crystal structure of single chain monellin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEENGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Monellin
publication title The Effect of Single Chain Derivatization on the Structure and Stability of the Monellin
rcsb
source organism Dioscoreophyllum cumminsii
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1iv9A00
3S67A 1NB3I 1IV7A 1G96A 1R4CA 3K9MC 1EQKA 1YVBI 2O9UX 2W9PA 4N6TA 4CCVA 1IV9A 3GAXA 4N6UA 5A0OB 1M9GA 1TIJA 1RN7A 3KSED 3Q2PA 5ELUA 4N6NB 4ZM8A 4EYCA 1LXEA 4N6MA 1GD4A 4TX4A 1CEWI 3PXMA 1DVCA 3IMAB 3L0RA 1STFI 4N6LA 3NX0A 1PFPA 1A90A 3MWZA 4LZIA 5LC7A 2KXGA 1KWIA 1MNLA 2W9QA 1CYUA 1GD3A 1ROAA 2BO9B 1FA3A 1NB5I 1MOLA 3UL5A 1WNHA 3SVAA 1CYVA 3KFQC 3PS8A 5LC6A 1N5PA 3UL6A 1N9JA 1DVDA 1FUWA 3LH4A 1N5HA 3QRDA 3PYJA 4N6OB 1A67A 2CH9A 4IT7A 2OCTA 4N6V0 5ELJA 5EQLA
chains in the Genus database with same CATH superfamily
3DMCA 4N3VA 2WOFA 1KC84 4FMBA 3FKAA 2XRXB 1W01A 4FR9A 1G96A 1VQ93 1RMSA 3K9MC 2YFJB 2LYXA 2WGQA 5IEOA 3DUKA 2CC3A 2W9PA 1UUGB 2Y73A 4N6TA 4BTYA 3EHCA 4FMDA 2GBXB 2HMNB 2L1SA 3CNMA 1K8A4 1Q864 3WA3A 1ISKA 2CWUA 3GSPA 3D5IA 1UCLA 3KSED 3O8YA 3BNBA 3NBJA 3T8NA 1NNVA 1RGEA 4K90B 4EC6A 2CFDA 1UDII 1FYSA 1LXEA 1US1A 1X1WA 4EYCA 3CCU3 1A2PA 1BRIA 1V58A 1RGLA 4R1KA 5AIFA 4TX4A 1VQ83 1BAOA 4HBRA 3KZTA 4X2OA 4HM8B 1RNBA 4XB5A 2RNTA 1YJW3 5D81A 2KAAA 3WODG 3GRDA 3GZXB 3KE7A 2INXA 6RNTA 7STDA 2SBLA 3EC9A 3G6E3 1UCJA 4HM1B 1GMRA 1I0XA 4EV2A 1GY7A 1JB2A 3WR2A 1UI8A 2BT3A 2C4BA 3NXJA 3LT9A 3CD63 5AEWB 2Y74A 4NREA 1VZZA 3VGNA 2IMJA 3HK4A 1OGXA 4LZIA 6GSPA 4KT3B 4MMXB 2CFGA 2D1WA 1I0VA 2IYJA 2RGQA 3N9HA 3G0KA 4L8PA 1K9M4 1W6YA 4HAAA 2F5MA 4J8TA 5IF6A 5D83A 3V99A 4WYKB 1LOVA 1O7HB 1PY3A 1IVVA 1YVSA 4BIRA 2KF5A 1Q814 5I97A 1FUSA 1W02A 2K54A 3Q1CA 1HKXA 1ULJB 3B8LA 3DZLA 4HVNA 1ROVA 1X1YA 3N8BA 5IENA 1FGQA 5IG0A 1RNTA 1OHOA 2WO0A 2GBWB 1TU5A 1I2FA 3CCJ3 3DGNA 3A5EA 3JUQA 1WNHA 4RZMA 3SVAA 4EBGA 2XH9A 2HMJB 3S28A 5GSPA 2KF4A 1FGMA 3NBRA 2WGOA 1LNIA 4WWUC 4G1MB 4LYLB 4IIAA 1G0TA 1W6GA 3OWSA 1O7WB 1ZO2A 3ROBA 5RNTA 3CCS3 2ZL8A 5EEOA 1LQMB 2XF3A 4JRFA 3JUPA 3UL6A 4DKIA 3TDGA 4MMYB 2HMKB 1BRGA 1BNFA 3PZWA 3DXOA 1N5HA 4BTWA 4OUQA 1SPUA 1A2KA 3OXAA 1Q7HA 4HZBB 1JKGB 2OTL3 3G4S3 3FG3A 1IT7A 1A67A 3EF8A 4BTXA 3QK9A 1YJN3 3ZG0A 3NM7A 2CX1A 4CPKA 1RSNA 1FGOA 3BNCA 2K3DA 4KFFA 3CCV3 1S723 1W6CA 4N6V0 7GSPA 1DYUA 2QGUA 1S5AA 2FGTA 1W5ZA 2OOVC 2BMQB 5KP3A 3CME3 4K1VA 3KKGA 1B2ZA 1VQM3 1D6YA 4ILFA 3MG3A 1BUQA 1R4CA 4HM4B 1A2VA 3S5CA 2QA43 1B20A 2FXTA 2Z77A 1GY6A 1RTUA 4KFDA 4QWTA 3N54B 4LGQA 4WYKA 1SIIA 4EW5A 3WOEB 1CQSA 4HOHA 4R4KA 1B2UA 2HOHA 4EXRA 1MGRA 5G1KA 3GAXA 1FW7A 3JVCA 4N6UA 1UW1A 3SOYA 1M9GA 4OVMA 2GSPA 3FSDA 1V74A 3KN4A 2XSHB 4O8SA 1GMQA 3T0UA 2CWTA 3ER7A 2PNCA 3F7XA 1GSPA 3G16A 5ELUA 1OHPA 2CHCA 4FMCA 1AV4A 3NUVA 1X1UA 4FCZA 2F4YA 4HYZA 3SXXA 1EKMA 1GD4A 1GOVA 1N9EA 1Q40B 4XDWA 1RKYA 1BU4A 1BANA 3X3XA 4MJDA 2Z76A 1OGZA 4WHAA 3A76A 1M904 1GOUA 4X2HA 3D5GA 5TGNA 1HZ1A 5IEPA 3L0RA 1MGWA 2Z6BA 1RGCA 1W7CA 3HOHA 4ORLA 4RNYA 3V92A 3DGOA 1O7MB 3CNXA 3OWYA 2XGLA 1B21A 3LTDA 3Q90A 1PYLA 1MWRA 2KF3A 3F7SA 3G8ZA 3MSOA 1EG9B 2GU1A 3EB8A 1JKGA 2P05A 2CG1A 3X3YA 1B3SA 4AKYA 2CK3H 1ZX2A 2W2CA 1BVIA 3H51A 1G02A 4J5GA 4FCJA 2PZVA 2H0IA 3AGNA 1EUIC 2KCDA 1OUNA 1VQN3 1UGIA 3RNTA 1KQS2 1GD3A 2W56B 4K1UA 1CYUA 4NPBA 9RNTA 2XFSA 4J5KA 4BL2A 1M1K4 3OX9A 1NB5I 3AMOB 3WMDA 4IPBA 4U13A 1DE3A 1X1XA 2Q07A 4XBXA 1OCVA 5JPPA 1HU9A 4L7KA 1RRLA 3NQZA 2ML5A 5AIGA 3UL5A 1TP6A 1STDA 3F9SA 1WMOA 3KSPA 3WDGB 4RNTA 3B7CA 3CC73 2UUGC 1B2MA 5LC6A 4HM3B 6STDA 1N5PA 4HM7B 1IQ8A 1JNQA 1UCKA 4Q53A 2GEXA 1WTHA 3T8UA 3ALAA 2W6JH 5JBSA 3D4AA 2K0MA 2CIUA 3ZFZA 2CW9A 1BOXA 2D42A 1ASKA 2QIYA 3EBYA 1UCIA 3RDEA 1VQ73 1DVDA 1AY7A 2UGIA 3BNDA 4WP5A 2OOVA 3CCM3 1Q40A 1GOYA 2F99A 3F8XA 3LTAA 1NO3A 1T5YA 1OACA 2GEYA 4I4KA 4GL6A 4LEHA 3SOAA 2QEX3 5IERA 4AKZA 4R80A 3LTBA 2P09A 1YGWA 3PYJA 1RGAA 5AYRB 4XBTA 1NDOB 1T3BA 2FNQA 3FG4A 3SLUA 2ZHXB 1U8CB 3U97A 3I553 3CC43 1MWSA 2IA7A 1BNSA 1TFKA 3U1WA 1RLSA 1BIRA 1T2IA 1TUHA 4RNZA 3PCSA 5ELJA 2H0HA 1RN1A 5STDA 5BU4A 3S67A 3F8HA 3MG2A 4HM0B 1TTOA 4BL3A 1N8QA 2BU4A 1Y4KA 2HMMB 3PGBA 1JV2B 4NHFA 5HOHA 2O3OA 3FF0A 1UI7A 2W03A 4GSPA 1NU3A 2A15A 5BIRA 1EQKA 1IDPA 2F98A 2O9UX 3JUMA 2F86B 1BSCA 3FZWA 1IQXA 4CCVA 1IV9A 1RRHA 1EA2A 2CKFB 2IUKA 2AAEA 2BHMA 2W56A 3IJEB 1GY5A 2B24B 1TIJA 3M8CA 2I9WA 1AVKA 1SIHA 3AMOA 1E97A 3Q2PA 1O7GB 4ZM8A 1RDSA 1Q7Y4 1LNHA 4N6MA 3WHOA 1ZGXA 2B1XB 2E2UA 3B4OA 3D9RA 1K41A 1CEWI 3K63A 1AR0A 1U5OA 3PXMA 1OPYA 3NQYA 5M19A 1Q42A 3G713 2BMRB 3RGRA 4EV5A 1I2GA 1BSBA 1I3FA 1WQLB 3MG1A 1VQ43 1W2ZA 4H3UA 2XGNA 1STFI 3HIGA 2YFIB 1M1XB 2KRTA 1YJ93 1DMQA 1QALA 2C10A 1LOXA 2SARA 1A90A 3BLZA 3K5TA 1BSAA 1SJWA 1QVG2 2F5WA 1F8NA 3HZPA 3JUOA 1LQGC 1TJDA 3NV0B 5CLKA 2WOHA 3SX1A 1O7PB 3EQQB 1ZS7A 2OWPA 4LSOA 1KWIA 1LOYA 3NM2A 2YFLB 3ECFA 2BNGA 1LOWA 2OQEC 2W9QA 4H61A 4CJNA 3ZG5A 1MWTA 5JPUA 1Q824 1YNVX 2V1LA 3DGLA 2R41A 1FGTA 3LZAA 5M1AA 3SEDA 3X41A 1ROAA 1JN5B 2YX9A 3IPTA 5DRVA 5EVHA 1R4YA 3UJMA 3VF1A 3CPW2 1FA3A 4PEJA 3LMLA 1PU4A 1MOLA 2C11A 3EX9A 5D82A 2RCDA 3EN1B 1JZOA 4HJLB 1CYVA 1RCKA 1Z1SA 2MF7A 1HYFA 1WMNA 1C7HA 3JUNA 3KFQC 3PS8A 3AHSA 2RFRA 1BSDA 1FUTA 4XDVA 1ULIB 2MC8A 2JQ5A 1BNRA 1GYBA 4HKVB 1VQ63 4O3VA 1RGGA 3HIIA 3DH2A 3CU3A 2STDA 4GHOA 3Q3FA 1BGSA 3S29A 3X3ZA 4KVHA 1YGEA 5BXQA 3MPHA 1QVF2 3F14A 2KF6A 1QJGA 1IYYA 4R9LA 4HM2B 2OTJ3 3URPA 1RGKA 4WFOA 3AHWA 5BVBA 3LOYA 4HM5B 3K0ZA 1GMPA 3OV4A 4FCMA 4XM4A 1FZUA 4R9KA 1VQ53 3H3HA 5G2GA 2CH9A 2J8XB 4IT7A 1W4NA 1IK3A 1D6UA 2CX0A 2AADA 1RCLA 5AI1A 1JBSA 1KSIA 1QMAA 4AEQA 2OCTA 1C54A 1W00A 2IY2A 2H0GA 1JZDA 2GXFA 1NB3I 3CMA3 4RBNA 1D6ZA 1IV7A 2CFKA 2M7OA 3NV0A 1YHQ3 1AQZA 3CCL3 3DM8A 1LVNA 5CF1A 5IG3A 3GWRA 4O02B 5KP1A 4JF8A 3EE1A 8CHOA 3FCSB 1YVBI 1CH0A 2BIRA 4J9AA 1TRPA 1IU7A 5CF2A 1BRJA 2P38A 2F56A 1VQQA 1WMPA 8RNTA 3EN8A 1EEJA 2CFWA 5FGOA 3HX8A 5DREA 5A0OB 3GZYB 1Q9EA 1JN5A 1MWUA 3RGAA 1IVUA 1RN7A 1VQP3 3WOFB 3F40A 4GB5A 5IG5A 1RJOA 3CXC2 1K28A 3WA2X 4N6NB 1IVXA 1DMNA 1BRSA 1NJI4 3B4PA 2ML6A 5IG4A 3CCE3 3EJVA 3S27A 5IW9A 5KP4A 4CDLA 1B2XA 2P0MA 1YIT3 1OF5B 1IVWA 3BU4A 2E2VA 1AVLA 1DVCA 3DGMA 3IMAB 3GZBA 1IT8A 1BRNL 2IUJA 1OH0A 4N6LA 4HZ9B 2OQEA 3DGYA 3NX0A 5AYSC 3NHXA 4FMAA 1QAFA 1PFPA 4I5QA 2RBIA 3MYTA 1SQWA 4BU4A 1BRKA 3D3LA 4L8OA 1TRQA 3FF2A 1N8R4 2JDIH 3KCHA 1UGHI 2W0QA 5M18A 3MWZA 1GS3A 1LRAA 2CG0A 3E99A 3OW22 5LC7A 2R4IA 3I0YA 2KXGA 1MNLA 1NWWA 3AGOA 1QAKA 3CPOA 3PCRA 1JJ22 3LTCA 2CFLA 4KFEA 1IQYA 2BMOB 5AIHA 1FGRA 2Z7AA 4HM6B 2ZDJA 3UB1A 3BB9A 4KZ1A 1RGHA 1E3RA 2BO9B 2UX0A 2XR8B 3STDA 1KD14 1V57A 3HI7A 3MKIA 1JB4A 2L4VA 2GU3A 1VQO3 3NBBA 1UUWB 1J2BA 1B27A 2LQVA 1W2B2 1I2EA 5FW5A 3CCQ3 1I8VA 4MEIA 2E2TA 1E3VA 2P0XA 3GZRA 3BIRA 1I70A 1T2HA 4K61A 1DETA 3MHEA 2XEPA 5G1LA 1BNEA 3I563 3FG1A 3LT8A 3K7CA 3FLJA 1JRQA 4OK0A 5CXOA 1N9JA 1O7NB 4STDA 1RHLA 2CWVA 5CK6A 2W04A 3X42A 3UNLA 1YIJ3 1BRHA 1FUWA 4LMIA 3LXUX 1BNJA 1L5GB 7RNTA 3FH1A 2ZA4A 2RSXA 1RGFA 3LH4A 1OF5A 1RN4A 2HMLB 2XFTA 3CCR3 5AEUB 3X40A 5HGRA 3QRDA 1I3IA 1BNIA 1BSEA 3FGYA 4N6OB 4XBYA 1JBTA 1K734 1BUJA 3LYGA 3CC23 3KIIA 1YI23 3VSYA 2XSOB 1JB5A 3D79A 1TFOA 1UUVB 2HMOB 3DY5A 3OWUA 3V98A 3J7Yd 1VQK3 1VQL3 1JBRA 4MMZB 1SARA 5EQLA 1BNGA 1DMMA 1OHSA 3SYUA 3BNEA 5AIIA 4O2HA 3EBTA 1B2SA
chains in the Genus database with same CATH topology
3DMCA 4N3VA 2WOFA 1KC84 4FMBA 3FKAA 2XRXB 1W01A 4FR9A 1G96A 1VQ93 3K9MC 2YFJB 2LYXA 2WGQA 5IEOA 3DUKA 2CC3A 2W9PA 2Y73A 4N6TA 4BTYA 3EHCA 4FMDA 2GBXB 2HMNB 3CNMA 1K8A4 1Q864 3WA3A 1ISKA 2CWUA 3KSED 3O8YA 3BNBA 3NBJA 3T8NA 4EC6A 4K90B 2CFDA 4EYCA 1LXEA 1US1A 3CCU3 4R1KA 5AIFA 1VQ83 4TX4A 4HBRA 3KZTA 4X2OA 4HM8B 4XB5A 1YJW3 5D81A 3WODG 3GRDA 3GZXB 3KE7A 2INXA 2SBLA 3EC9A 3G6E3 4HM1B 4EV2A 1GY7A 1JB2A 1UI8A 2BT3A 3NXJA 3LT9A 3CD63 5AEWB 2Y74A 4NREA 1VZZA 3VGNA 2IMJA 3HK4A 1OGXA 4LZIA 4MMXB 2CFGA 2D1WA 2RGQA 3N9HA 1K9M4 3G0KA 4L8PA 1W6YA 4J8TA 5IF6A 5D83A 3V99A 4WYKB 1O7HB 1IVVA 5I97A 1W02A 2K54A 3Q1CA 1HKXA 1ULJB 3B8LA 3DZLA 4HVNA 1ROVA 3N8BA 5IENA 1FGQA 5IG0A 1OHOA 2WO0A 2GBWB 1TU5A 3CCJ3 3DGNA 3JUQA 1WNHA 4RZMA 3SVAA 4EBGA 2XH9A 2HMJB 3S28A 1FGMA 3NBRA 2WGOA 4WWUC 4G1MB 4IIAA 1W6GA 3OWSA 1O7WB 1ZO2A 3ROBA 3CCS3 2ZL8A 5EEOA 2XF3A 4JRFA 3JUPA 3UL6A 3TDGA 4MMYB 2HMKB 3PZWA 3DXOA 1N5HA 4BTWA 4OUQA 1SPUA 1A2KA 3OXAA 4HZBB 2OTL3 1JKGB 3G4S3 3FG3A 1IT7A 1A67A 3EF8A 4BTXA 3QK9A 1YJN3 3NM7A 3BNCA 1FGOA 4KFFA 3CCV3 1S723 1W6CA 4N6V0 1DYUA 2QGUA 2FGTA 1S5AA 1W5ZA 2OOVC 2BMQB 5KP3A 3CME3 4K1VA 3KKGA 1VQM3 1D6YA 3MG3A 1BUQA 1R4CA 4HM4B 1A2VA 3S5CA 2QA43 2FXTA 2Z77A 1GY6A 4KFDA 4QWTA 3N54B 4LGQA 4WYKA 1SIIA 3WOEB 1CQSA 4R4KA 4EXRA 3GAXA 3JVCA 4N6UA 1UW1A 3SOYA 1M9GA 4OVMA 3FSDA 1V74A 3KN4A 2XSHB 4O8SA 3T0UA 2CWTA 3ER7A 2PNCA 3F7XA 3G16A 5ELUA 1OHPA 2CHCA 4FMCA 1AV4A 3NUVA 4FCZA 3SXXA 7STDA 4HYZA 1Q814 1EKMA 1GD4A 4XDWA 1N9EA 1Q40B 1RKYA 3X3XA 4MJDA 2Z76A 1OGZA 4WHAA 3A76A 1M904 4X2HA 5TGNA 5IEPA 3L0RA 2Z6BA 1W7CA 4ORLA 4RNYA 3V92A 3DGOA 1O7MB 3CNXA 3OWYA 2XGLA 3LTDA 3Q90A 3F7SA 3G8ZA 3MSOA 1EG9B 2GU1A 3EB8A 1JKGA 2P05A 2CG1A 3X3YA 4AKYA 2CK3H 1ZX2A 2W2CA 3H51A 4FCJA 2PZVA 2KCDA 1OUNA 1VQN3 1KQS2 1CYUA 1GD3A 2W56B 4K1UA 1M1K4 1NB5I 2XFSA 3OX9A 3AMOB 3WMDA 4IPBA 4U13A 2Q07A 4XBXA 1OCVA 5JPPA 1HU9A 4L7KA 1RRLA 3NQZA 2ML5A 5AIGA 3UL5A 1TP6A 1STDA 3F9SA 1WMOA 3KSPA 3WDGB 3B7CA 3CC73 5LC6A 4HM3B 6STDA 1N5PA 4HM7B 1IQ8A 1JNQA 4Q53A 2GEXA 1WTHA 3T8UA 3ALAA 2W6JH 5JBSA 2K0MA 2CIUA 2CW9A 2QIYA 2D42A 1ASKA 3EBYA 1VQ73 1DVDA 3RDEA 3BNDA 4WP5A 2OOVA 3CCM3 1Q40A 2F99A 3F8XA 3LTAA 1NO3A 1T5YA 1OACA 2GEYA 4I4KA 4GL6A 4LEHA 3SOAA 2QEX3 5IERA 4AKZA 4R80A 3LTBA 2P09A 3PYJA 5AYRB 4XBTA 1NDOB 2FNQA 3FG4A 3SLUA 1U8CB 3U97A 3I553 3CC43 2IA7A 1TFKA 3U1WA 5ELJA 1TUHA 4RNZA 3PCSA 5STDA 3S67A 3F8HA 3MG2A 4HM0B 1N8QA 1Y4KA 2HMMB 3PGBA 1JV2B 4NHFA 2O3OA 3FF0A 1UI7A 2W03A 1EQKA 1NU3A 2A15A 1IDPA 2F98A 2O9UX 3JUMA 2F86B 3FZWA 4CCVA 1IQXA 1IV9A 1RRHA 1EA2A 2CKFB 2IUKA 2BHMA 2W56A 3IJEB 1GY5A 2B24B 1TIJA 3M8CA 2I9WA 1AVKA 1SIHA 3AMOA 1E97A 3Q2PA 1O7GB 4ZM8A 1Q7Y4 1LNHA 4N6MA 2B1XB 2E2UA 3B4OA 3D9RA 1K41A 1CEWI 3K63A 1AR0A 1U5OA 3PXMA 1OPYA 3NQYA 1Q42A 3G713 2BMRB 3RGRA 4EV5A 1VQ43 1WQLB 3MG1A 1W2ZA 4H3UA 2XGNA 1STFI 3HIGA 2YFIB 1M1XB 2KRTA 1YJ93 1DMQA 1QALA 2C10A 1LOXA 1A90A 3BLZA 3K5TA 1SJWA 1QVG2 1F8NA 3HZPA 3JUOA 3NV0B 5CLKA 2WOHA 3SX1A 1O7PB 3EQQB 2OWPA 4LSOA 1KWIA 3NM2A 2YFLB 3ECFA 2BNGA 2OQEC 2W9QA 4H61A 5JPUA 1Q824 2V1LA 3DGLA 3LZAA 1FGTA 3SEDA 3X41A 1ROAA 1JN5B 2YX9A 3IPTA 5DRVA 5EVHA 3UJMA 3VF1A 3CPW2 1FA3A 4PEJA 3LMLA 1PU4A 1MOLA 2C11A 3EX9A 5D82A 2RCDA 3EN1B 4HJLB 1CYVA 1Z1SA 2MF7A 1WMNA 1C7HA 3JUNA 3KFQC 3PS8A 2RFRA 2MC8A 4XDVA 1ULIB 2JQ5A 1GYBA 4HKVB 1VQ63 4O3VA 3HIIA 3CU3A 2STDA 3S29A 3X3ZA 4KVHA 1YGEA 5BXQA 3MPHA 1QVF2 3F14A 1QJGA 4R9LA 4HM2B 2OTJ3 4WFOA 5BVBA 3LOYA 4HM5B 3K0ZA 4FCMA 3OV4A 4XM4A 4R9KA 1VQ53 3H3HA 5G2GA 2CH9A 4IT7A 1W4NA 1IK3A 1D6UA 5AI1A 1KSIA 1QMAA 4AEQA 2OCTA 1W00A 2GXFA 1NB3I 3CMA3 4RBNA 1D6ZA 1IV7A 2CFKA 2M7OA 3NV0A 1YHQ3 3CCL3 3DM8A 1LVNA 5CF1A 5IG3A 3GWRA 4O02B 5KP1A 4JF8A 3EE1A 8CHOA 3FCSB 1YVBI 4J9AA 1IU7A 5CF2A 2P38A 1WMPA 3EN8A 2CFWA 5FGOA 3HX8A 5DREA 5A0OB 3GZYB 1JN5A 3RGAA 1IVUA 1RN7A 1VQP3 3WOFB 3F40A 4GB5A 5IG5A 1RJOA 3CXC2 1K28A 3WA2X 4N6NB 1IVXA 1DMNA 1NJI4 3B4PA 2ML6A 5IG4A 3CCE3 3EJVA 3S27A 5IW9A 5KP4A 4CDLA 2P0MA 1YIT3 1OF5B 1IVWA 2E2VA 1AVLA 1DVCA 3DGMA 3IMAB 3GZBA 1IT8A 2IUJA 1OH0A 4N6LA 4HZ9B 2OQEA 3NX0A 5AYSC 3NHXA 4FMAA 1QAFA 1PFPA 3MYTA 1SQWA 3D3LA 4L8OA 3FF2A 1N8R4 2JDIH 2W0QA 3MWZA 1GS3A 3E99A 2CG0A 3OW22 5LC7A 2R4IA 3I0YA 2KXGA 1MNLA 1NWWA 3CPOA 1QAKA 3PCRA 1JJ22 3LTCA 2CFLA 4KFEA 1IQYA 2BMOB 5AIHA 1FGRA 2Z7AA 4HM6B 2ZDJA 3UB1A 3BB9A 4KZ1A 1E3RA 2BO9B 2UX0A 2XR8B 3STDA 1KD14 3HI7A 3MKIA 1JB4A 2L4VA 2GU3A 1VQO3 3NBBA 1UUWB 1J2BA 2LQVA 1W2B2 5FW5A 3CCQ3 4MEIA 2E2TA 1E3VA 2P0XA 3GZRA 4K61A 3MHEA 2XEPA 3I563 3FG1A 3LT8A 3K7CA 3FLJA 1JRQA 4OK0A 5CXOA 1N9JA 1O7NB 4STDA 2CWVA 5CK6A 2W04A 3X42A 3UNLA 1YIJ3 1FUWA 4LMIA 3LXUX 1L5GB 3FH1A 3LH4A 2RSXA 1OF5A 2HMLB 2XFTA 3CCR3 5AEUB 3X40A 5HGRA 3QRDA 3FGYA 4N6OB 4XBYA 1K734 3LYGA 3CC23 3KIIA 1YI23 3VSYA 2XSOB 1JB5A 1TFOA 1UUVB 2HMOB 3DY5A 3OWUA 3V98A 3J7Yd 1VQK3 1VQL3 4MMZB 5EQLA 1DMMA 1OHSA 3BNEA 5AIIA 4O2HA 3EBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S67 A;  1NB3 I;  1IV7 A;  1G96 A;  1R4C A;  3K9M C;  1EQK A;  1YVB I;  2O9U X;  2W9P A;  4N6T A;  4CCV A;  1IV9 A;  3GAX A;  4N6U A;  5A0O B;  1M9G A;  1TIJ A;  1RN7 A;  3KSE D;  3Q2P A;  5ELU A;  4N6N B;  4ZM8 A;  4EYC A;  1LXE A;  4N6M A;  1GD4 A;  4TX4 A;  1CEW I;  3PXM A;  1DVC A;  3IMA B;  3L0R A;  1STF I;  4N6L A;  3NX0 A;  1PFP A;  1A90 A;  3MWZ A;  4LZI A;  5LC7 A;  2KXG A;  1KWI A;  1MNL A;  2W9Q A;  1CYU A;  1GD3 A;  1ROA A;  2BO9 B;  1FA3 A;  1NB5 I;  1MOL A;  3UL5 A;  1WNH A;  3SVA A;  1CYV A;  3KFQ C;  3PS8 A;  5LC6 A;  1N5P A;  3UL6 A;  1N9J A;  1DVD A;  1FUW A;  3LH4 A;  1N5H A;  3QRD A;  3PYJ A;  4N6O B;  1A67 A;  2CH9 A;  4IT7 A;  2OCT A;  4N6V 0;  5ELJ A;  5EQL A; 
#chains in the Genus database with same CATH topology
 3DMC A;  4N3V A;  2WOF A;  1KC8 4;  4FMB A;  3FKA A;  2XRX B;  1W01 A;  4FR9 A;  1G96 A;  1VQ9 3;  1RMS A;  3K9M C;  2YFJ B;  2LYX A;  2WGQ A;  5IEO A;  3DUK A;  2CC3 A;  2W9P A;  1UUG B;  2Y73 A;  4N6T A;  4BTY A;  3EHC A;  4FMD A;  2GBX B;  2HMN B;  2L1S A;  3CNM A;  1K8A 4;  1Q86 4;  3WA3 A;  1ISK A;  2CWU A;  3GSP A;  3D5I A;  1UCL A;  3KSE D;  3O8Y A;  3BNB A;  3NBJ A;  3T8N A;  1NNV A;  1RGE A;  4K90 B;  4EC6 A;  2CFD A;  1UDI I;  1FYS A;  1LXE A;  1US1 A;  1X1W A;  4EYC A;  3CCU 3;  1A2P A;  1BRI A;  1V58 A;  1RGL A;  4R1K A;  5AIF A;  4TX4 A;  1VQ8 3;  1BAO A;  4HBR A;  3KZT A;  4X2O A;  4HM8 B;  1RNB A;  4XB5 A;  2RNT A;  1YJW 3;  5D81 A;  2KAA A;  3WOD G;  3GRD A;  3GZX B;  3KE7 A;  2INX A;  6RNT A;  7STD A;  2SBL A;  3EC9 A;  3G6E 3;  1UCJ A;  4HM1 B;  1GMR A;  1I0X A;  4EV2 A;  1GY7 A;  1JB2 A;  3WR2 A;  1UI8 A;  2BT3 A;  2C4B A;  3NXJ A;  3LT9 A;  3CD6 3;  5AEW B;  2Y74 A;  4NRE A;  1VZZ A;  3VGN A;  2IMJ A;  3HK4 A;  1OGX A;  4LZI A;  6GSP A;  4KT3 B;  4MMX B;  2CFG A;  2D1W A;  1I0V A;  2IYJ A;  2RGQ A;  3N9H A;  3G0K A;  4L8P A;  1K9M 4;  1W6Y A;  4HAA A;  2F5M A;  4J8T A;  5IF6 A;  5D83 A;  3V99 A;  4WYK B;  1LOV A;  1O7H B;  1PY3 A;  1IVV A;  1YVS A;  4BIR A;  2KF5 A;  1Q81 4;  5I97 A;  1FUS A;  1W02 A;  2K54 A;  3Q1C A;  1HKX A;  1ULJ B;  3B8L A;  3DZL A;  4HVN A;  1ROV A;  1X1Y A;  3N8B A;  5IEN A;  1FGQ A;  5IG0 A;  1RNT A;  1OHO A;  2WO0 A;  2GBW B;  1TU5 A;  1I2F A;  3CCJ 3;  3DGN A;  3A5E A;  3JUQ A;  1WNH A;  4RZM A;  3SVA A;  4EBG A;  2XH9 A;  2HMJ B;  3S28 A;  5GSP A;  2KF4 A;  1FGM A;  3NBR A;  2WGO A;  1LNI A;  4WWU C;  4G1M B;  4LYL B;  4IIA A;  1G0T A;  1W6G A;  3OWS A;  1O7W B;  1ZO2 A;  3ROB A;  5RNT A;  3CCS 3;  2ZL8 A;  5EEO A;  1LQM B;  2XF3 A;  4JRF A;  3JUP A;  3UL6 A;  4DKI A;  3TDG A;  4MMY B;  2HMK B;  1BRG A;  1BNF A;  3PZW A;  3DXO A;  1N5H A;  4BTW A;  4OUQ A;  1SPU A;  1A2K A;  3OXA A;  1Q7H A;  4HZB B;  1JKG B;  2OTL 3;  3G4S 3;  3FG3 A;  1IT7 A;  1A67 A;  3EF8 A;  4BTX A;  3QK9 A;  1YJN 3;  3ZG0 A;  3NM7 A;  2CX1 A;  4CPK A;  1RSN A;  1FGO A;  3BNC A;  2K3D A;  4KFF A;  3CCV 3;  1S72 3;  1W6C A;  4N6V 0;  7GSP A;  1DYU A;  2QGU A;  1S5A A;  2FGT A;  1W5Z A;  2OOV C;  2BMQ B;  5KP3 A;  3CME 3;  4K1V A;  3KKG A;  1B2Z A;  1VQM 3;  1D6Y A;  4ILF A;  3MG3 A;  1BUQ A;  1R4C A;  4HM4 B;  1A2V A;  3S5C A;  2QA4 3;  1B20 A;  2FXT A;  2Z77 A;  1GY6 A;  1RTU A;  4KFD A;  4QWT A;  3N54 B;  4LGQ A;  4WYK A;  1SII A;  4EW5 A;  3WOE B;  1CQS A;  4HOH A;  4R4K A;  1B2U A;  2HOH A;  4EXR A;  1MGR A;  5G1K A;  3GAX A;  1FW7 A;  3JVC A;  4N6U A;  1UW1 A;  3SOY A;  1M9G A;  4OVM A;  2GSP A;  3FSD A;  1V74 A;  3KN4 A;  2XSH B;  4O8S A;  1GMQ A;  3T0U A;  2CWT A;  3ER7 A;  2PNC A;  3F7X A;  1GSP A;  3G16 A;  5ELU A;  1OHP A;  2CHC A;  4FMC A;  1AV4 A;  3NUV A;  1X1U A;  4FCZ A;  2F4Y A;  4HYZ A;  3SXX A;  1EKM A;  1GD4 A;  1GOV A;  1N9E A;  1Q40 B;  4XDW A;  1RKY A;  1BU4 A;  1BAN A;  3X3X A;  4MJD A;  2Z76 A;  1OGZ A;  4WHA A;  3A76 A;  1M90 4;  1GOU A;  4X2H A;  3D5G A;  5TGN A;  1HZ1 A;  5IEP A;  3L0R A;  1MGW A;  2Z6B A;  1RGC A;  1W7C A;  3HOH A;  4ORL A;  4RNY A;  3V92 A;  3DGO A;  1O7M B;  3CNX A;  3OWY A;  2XGL A;  1B21 A;  3LTD A;  3Q90 A;  1PYL A;  1MWR A;  2KF3 A;  3F7S A;  3G8Z A;  3MSO A;  1EG9 B;  2GU1 A;  3EB8 A;  1JKG A;  2P05 A;  2CG1 A;  3X3Y A;  1B3S A;  4AKY A;  2CK3 H;  1ZX2 A;  2W2C A;  1BVI A;  3H51 A;  1G02 A;  4J5G A;  4FCJ A;  2PZV A;  2H0I A;  3AGN A;  1EUI C;  2KCD A;  1OUN A;  1VQN 3;  1UGI A;  3RNT A;  1KQS 2;  1GD3 A;  2W56 B;  4K1U A;  1CYU A;  4NPB A;  9RNT A;  2XFS A;  4J5K A;  4BL2 A;  1M1K 4;  3OX9 A;  1NB5 I;  3AMO B;  3WMD A;  4IPB A;  4U13 A;  1DE3 A;  1X1X A;  2Q07 A;  4XBX A;  1OCV A;  5JPP A;  1HU9 A;  4L7K A;  1RRL A;  3NQZ A;  2ML5 A;  5AIG A;  3UL5 A;  1TP6 A;  1STD A;  3F9S A;  1WMO A;  3KSP A;  3WDG B;  4RNT A;  3B7C A;  3CC7 3;  2UUG C;  1B2M A;  5LC6 A;  4HM3 B;  6STD A;  1N5P A;  4HM7 B;  1IQ8 A;  1JNQ A;  1UCK A;  4Q53 A;  2GEX A;  1WTH A;  3T8U A;  3ALA A;  2W6J H;  5JBS A;  3D4A A;  2K0M A;  2CIU A;  3ZFZ A;  2CW9 A;  1BOX A;  2D42 A;  1ASK A;  2QIY A;  3EBY A;  1UCI A;  3RDE A;  1VQ7 3;  1DVD A;  1AY7 A;  2UGI A;  3BND A;  4WP5 A;  2OOV A;  3CCM 3;  1Q40 A;  1GOY A;  2F99 A;  3F8X A;  3LTA A;  1NO3 A;  1T5Y A;  1OAC A;  2GEY A;  4I4K A;  4GL6 A;  4LEH A;  3SOA A;  2QEX 3;  5IER A;  4AKZ A;  4R80 A;  3LTB A;  2P09 A;  1YGW A;  3PYJ A;  1RGA A;  5AYR B;  4XBT A;  1NDO B;  1T3B A;  2FNQ A;  3FG4 A;  3SLU A;  2ZHX B;  1U8C B;  3U97 A;  3I55 3;  3CC4 3;  1MWS A;  2IA7 A;  1BNS A;  1TFK A;  3U1W A;  1RLS A;  1BIR A;  1T2I A;  1TUH A;  4RNZ A;  3PCS A;  5ELJ A;  2H0H A;  1RN1 A;  5STD A;  5BU4 A;  3S67 A;  3F8H A;  3MG2 A;  4HM0 B;  1TTO A;  4BL3 A;  1N8Q A;  2BU4 A;  1Y4K A;  2HMM B;  3PGB A;  1JV2 B;  4NHF A;  5HOH A;  2O3O A;  3FF0 A;  1UI7 A;  2W03 A;  4GSP A;  1NU3 A;  2A15 A;  5BIR A;  1EQK A;  1IDP A;  2F98 A;  2O9U X;  3JUM A;  2F86 B;  1BSC A;  3FZW A;  1IQX A;  4CCV A;  1IV9 A;  1RRH A;  1EA2 A;  2CKF B;  2IUK A;  2AAE A;  2BHM A;  2W56 A;  3IJE B;  1GY5 A;  2B24 B;  1TIJ A;  3M8C A;  2I9W A;  1AVK A;  1SIH A;  3AMO A;  1E97 A;  3Q2P A;  1O7G B;  4ZM8 A;  1RDS A;  1Q7Y 4;  1LNH A;  4N6M A;  3WHO A;  1ZGX A;  2B1X B;  2E2U A;  3B4O A;  3D9R A;  1K41 A;  1CEW I;  3K63 A;  1AR0 A;  1U5O A;  3PXM A;  1OPY A;  3NQY A;  5M19 A;  1Q42 A;  3G71 3;  2BMR B;  3RGR A;  4EV5 A;  1I2G A;  1BSB A;  1I3F A;  1WQL B;  3MG1 A;  1VQ4 3;  1W2Z A;  4H3U A;  2XGN A;  1STF I;  3HIG A;  2YFI B;  1M1X B;  2KRT A;  1YJ9 3;  1DMQ A;  1QAL A;  2C10 A;  1LOX A;  2SAR A;  1A90 A;  3BLZ A;  3K5T A;  1BSA A;  1SJW A;  1QVG 2;  2F5W A;  1F8N A;  3HZP A;  3JUO A;  1LQG C;  1TJD A;  3NV0 B;  5CLK A;  2WOH A;  3SX1 A;  1O7P B;  3EQQ B;  1ZS7 A;  2OWP A;  4LSO A;  1KWI A;  1LOY A;  3NM2 A;  2YFL B;  3ECF A;  2BNG A;  1LOW A;  2OQE C;  2W9Q A;  4H61 A;  4CJN A;  3ZG5 A;  1MWT A;  5JPU A;  1Q82 4;  1YNV X;  2V1L A;  3DGL A;  2R41 A;  1FGT A;  3LZA A;  5M1A A;  3SED A;  3X41 A;  1ROA A;  1JN5 B;  2YX9 A;  3IPT A;  5DRV A;  5EVH A;  1R4Y A;  3UJM A;  3VF1 A;  3CPW 2;  1FA3 A;  4PEJ A;  3LML A;  1PU4 A;  1MOL A;  2C11 A;  3EX9 A;  5D82 A;  2RCD A;  3EN1 B;  1JZO A;  4HJL B;  1CYV A;  1RCK A;  1Z1S A;  2MF7 A;  1HYF A;  1WMN A;  1C7H A;  3JUN A;  3KFQ C;  3PS8 A;  3AHS A;  2RFR A;  1BSD A;  1FUT A;  4XDV A;  1ULI B;  2MC8 A;  2JQ5 A;  1BNR A;  1GYB A;  4HKV B;  1VQ6 3;  4O3V A;  1RGG A;  3HII A;  3DH2 A;  3CU3 A;  2STD A;  4GHO A;  3Q3F A;  1BGS A;  3S29 A;  3X3Z A;  4KVH A;  1YGE A;  5BXQ A;  3MPH A;  1QVF 2;  3F14 A;  2KF6 A;  1QJG A;  1IYY A;  4R9L A;  4HM2 B;  2OTJ 3;  3URP A;  1RGK A;  4WFO A;  3AHW A;  5BVB A;  3LOY A;  4HM5 B;  3K0Z A;  1GMP A;  3OV4 A;  4FCM A;  4XM4 A;  1FZU A;  4R9K A;  1VQ5 3;  3H3H A;  5G2G A;  2CH9 A;  2J8X B;  4IT7 A;  1W4N A;  1IK3 A;  1D6U A;  2CX0 A;  2AAD A;  1RCL A;  5AI1 A;  1JBS A;  1KSI A;  1QMA A;  4AEQ A;  2OCT A;  1C54 A;  1W00 A;  2IY2 A;  2H0G A;  1JZD A;  2GXF A;  1NB3 I;  3CMA 3;  4RBN A;  1D6Z A;  1IV7 A;  2CFK A;  2M7O A;  3NV0 A;  1YHQ 3;  1AQZ A;  3CCL 3;  3DM8 A;  1LVN A;  5CF1 A;  5IG3 A;  3GWR A;  4O02 B;  5KP1 A;  4JF8 A;  3EE1 A;  8CHO A;  3FCS B;  1YVB I;  1CH0 A;  2BIR A;  4J9A A;  1TRP A;  1IU7 A;  5CF2 A;  1BRJ A;  2P38 A;  2F56 A;  1VQQ A;  1WMP A;  8RNT A;  3EN8 A;  1EEJ A;  2CFW A;  5FGO A;  3HX8 A;  5DRE A;  5A0O B;  3GZY B;  1Q9E A;  1JN5 A;  1MWU A;  3RGA A;  1IVU A;  1RN7 A;  1VQP 3;  3WOF B;  3F40 A;  4GB5 A;  5IG5 A;  1RJO A;  3CXC 2;  1K28 A;  3WA2 X;  4N6N B;  1IVX A;  1DMN A;  1BRS A;  1NJI 4;  3B4P A;  2ML6 A;  5IG4 A;  3CCE 3;  3EJV A;  3S27 A;  5IW9 A;  5KP4 A;  4CDL A;  1B2X A;  2P0M A;  1YIT 3;  1OF5 B;  1IVW A;  3BU4 A;  2E2V A;  1AVL A;  1DVC A;  3DGM A;  3IMA B;  3GZB A;  1IT8 A;  1BRN L;  2IUJ A;  1OH0 A;  4N6L A;  4HZ9 B;  2OQE A;  3DGY A;  3NX0 A;  5AYS C;  3NHX A;  4FMA A;  1QAF A;  1PFP A;  4I5Q A;  2RBI A;  3MYT A;  1SQW A;  4BU4 A;  1BRK A;  3D3L A;  4L8O A;  1TRQ A;  3FF2 A;  1N8R 4;  2JDI H;  3KCH A;  1UGH I;  2W0Q A;  5M18 A;  3MWZ A;  1GS3 A;  1LRA A;  2CG0 A;  3E99 A;  3OW2 2;  5LC7 A;  2R4I A;  3I0Y A;  2KXG A;  1MNL A;  1NWW A;  3AGO A;  1QAK A;  3CPO A;  3PCR A;  1JJ2 2;  3LTC A;  2CFL A;  4KFE A;  1IQY A;  2BMO B;  5AIH A;  1FGR A;  2Z7A A;  4HM6 B;  2ZDJ A;  3UB1 A;  3BB9 A;  4KZ1 A;  1RGH A;  1E3R A;  2BO9 B;  2UX0 A;  2XR8 B;  3STD A;  1KD1 4;  1V57 A;  3HI7 A;  3MKI A;  1JB4 A;  2L4V A;  2GU3 A;  1VQO 3;  3NBB A;  1UUW B;  1J2B A;  1B27 A;  2LQV A;  1W2B 2;  1I2E A;  5FW5 A;  3CCQ 3;  1I8V A;  4MEI A;  2E2T A;  1E3V A;  2P0X A;  3GZR A;  3BIR A;  1I70 A;  1T2H A;  4K61 A;  1DET A;  3MHE A;  2XEP A;  5G1L A;  1BNE A;  3I56 3;  3FG1 A;  3LT8 A;  3K7C A;  3FLJ A;  1JRQ A;  4OK0 A;  5CXO A;  1N9J A;  1O7N B;  4STD A;  1RHL A;  2CWV A;  5CK6 A;  2W04 A;  3X42 A;  3UNL A;  1YIJ 3;  1BRH A;  1FUW A;  4LMI A;  3LXU X;  1BNJ A;  1L5G B;  7RNT A;  3FH1 A;  2ZA4 A;  2RSX A;  1RGF A;  3LH4 A;  1OF5 A;  1RN4 A;  2HML B;  2XFT A;  3CCR 3;  5AEU B;  3X40 A;  5HGR A;  3QRD A;  1I3I A;  1BNI A;  1BSE A;  3FGY A;  4N6O B;  4XBY A;  1JBT A;  1K73 4;  1BUJ A;  3LYG A;  3CC2 3;  3KII A;  1YI2 3;  3VSY A;  2XSO B;  1JB5 A;  3D79 A;  1TFO A;  1UUV B;  2HMO B;  3DY5 A;  3OWU A;  3V98 A;  3J7Y d;  1VQK 3;  1VQL 3;  1JBR A;  4MMZ B;  1SAR A;  5EQL A;  1BNG A;  1DMM A;  1OHS A;  3SYU A;  3BNE A;  5AII A;  4O2H A;  3EBT A;  1B2S A; 
#chains in the Genus database with same CATH homology
 3DMC A;  4N3V A;  2WOF A;  1KC8 4;  4FMB A;  3FKA A;  2XRX B;  1W01 A;  4FR9 A;  1G96 A;  1VQ9 3;  3K9M C;  2YFJ B;  2LYX A;  2WGQ A;  5IEO A;  3DUK A;  2CC3 A;  2W9P A;  2Y73 A;  4N6T A;  4BTY A;  3EHC A;  4FMD A;  2GBX B;  2HMN B;  3CNM A;  1K8A 4;  1Q86 4;  3WA3 A;  1ISK A;  2CWU A;  3KSE D;  3O8Y A;  3BNB A;  3NBJ A;  3T8N A;  4EC6 A;  4K90 B;  2CFD A;  4EYC A;  1LXE A;  1US1 A;  3CCU 3;  4R1K A;  5AIF A;  1VQ8 3;  4TX4 A;  4HBR A;  3KZT A;  4X2O A;  4HM8 B;  4XB5 A;  1YJW 3;  5D81 A;  3WOD G;  3GRD A;  3GZX B;  3KE7 A;  2INX A;  2SBL A;  3EC9 A;  3G6E 3;  4HM1 B;  4EV2 A;  1GY7 A;  1JB2 A;  1UI8 A;  2BT3 A;  3NXJ A;  3LT9 A;  3CD6 3;  5AEW B;  2Y74 A;  4NRE A;  1VZZ A;  3VGN A;  2IMJ A;  3HK4 A;  1OGX A;  4LZI A;  4MMX B;  2CFG A;  2D1W A;  2RGQ A;  3N9H A;  1K9M 4;  3G0K A;  4L8P A;  1W6Y A;  4J8T A;  5IF6 A;  5D83 A;  3V99 A;  4WYK B;  1O7H B;  1IVV A;  5I97 A;  1W02 A;  2K54 A;  3Q1C A;  1HKX A;  1ULJ B;  3B8L A;  3DZL A;  4HVN A;  1ROV A;  3N8B A;  5IEN A;  1FGQ A;  5IG0 A;  1OHO A;  2WO0 A;  2GBW B;  1TU5 A;  3CCJ 3;  3DGN A;  3JUQ A;  1WNH A;  4RZM A;  3SVA A;  4EBG A;  2XH9 A;  2HMJ B;  3S28 A;  1FGM A;  3NBR A;  2WGO A;  4WWU C;  4G1M B;  4IIA A;  1W6G A;  3OWS A;  1O7W B;  1ZO2 A;  3ROB A;  3CCS 3;  2ZL8 A;  5EEO A;  2XF3 A;  4JRF A;  3JUP A;  3UL6 A;  3TDG A;  4MMY B;  2HMK B;  3PZW A;  3DXO A;  1N5H A;  4BTW A;  4OUQ A;  1SPU A;  1A2K A;  3OXA A;  4HZB B;  2OTL 3;  1JKG B;  3G4S 3;  3FG3 A;  1IT7 A;  1A67 A;  3EF8 A;  4BTX A;  3QK9 A;  1YJN 3;  3NM7 A;  3BNC A;  1FGO A;  4KFF A;  3CCV 3;  1S72 3;  1W6C A;  4N6V 0;  1DYU A;  2QGU A;  2FGT A;  1S5A A;  1W5Z A;  2OOV C;  2BMQ B;  5KP3 A;  3CME 3;  4K1V A;  3KKG A;  1VQM 3;  1D6Y A;  3MG3 A;  1BUQ A;  1R4C A;  4HM4 B;  1A2V A;  3S5C A;  2QA4 3;  2FXT A;  2Z77 A;  1GY6 A;  4KFD A;  4QWT A;  3N54 B;  4LGQ A;  4WYK A;  1SII A;  3WOE B;  1CQS A;  4R4K A;  4EXR A;  3GAX A;  3JVC A;  4N6U A;  1UW1 A;  3SOY A;  1M9G A;  4OVM A;  3FSD A;  1V74 A;  3KN4 A;  2XSH B;  4O8S A;  3T0U A;  2CWT A;  3ER7 A;  2PNC A;  3F7X A;  3G16 A;  5ELU A;  1OHP A;  2CHC A;  4FMC A;  1AV4 A;  3NUV A;  4FCZ A;  3SXX A;  7STD A;  4HYZ A;  1Q81 4;  1EKM A;  1GD4 A;  4XDW A;  1N9E A;  1Q40 B;  1RKY A;  3X3X A;  4MJD A;  2Z76 A;  1OGZ A;  4WHA A;  3A76 A;  1M90 4;  4X2H A;  5TGN A;  5IEP A;  3L0R A;  2Z6B A;  1W7C A;  4ORL A;  4RNY A;  3V92 A;  3DGO A;  1O7M B;  3CNX A;  3OWY A;  2XGL A;  3LTD A;  3Q90 A;  3F7S A;  3G8Z A;  3MSO A;  1EG9 B;  2GU1 A;  3EB8 A;  1JKG A;  2P05 A;  2CG1 A;  3X3Y A;  4AKY A;  2CK3 H;  1ZX2 A;  2W2C A;  3H51 A;  4FCJ A;  2PZV A;  2KCD A;  1OUN A;  1VQN 3;  1KQS 2;  1CYU A;  1GD3 A;  2W56 B;  4K1U A;  1M1K 4;  1NB5 I;  2XFS A;  3OX9 A;  3AMO B;  3WMD A;  4IPB A;  4U13 A;  2Q07 A;  4XBX A;  1OCV A;  5JPP A;  1HU9 A;  4L7K A;  1RRL A;  3NQZ A;  2ML5 A;  5AIG A;  3UL5 A;  1TP6 A;  1STD A;  3F9S A;  1WMO A;  3KSP A;  3WDG B;  3B7C A;  3CC7 3;  5LC6 A;  4HM3 B;  6STD A;  1N5P A;  4HM7 B;  1IQ8 A;  1JNQ A;  4Q53 A;  2GEX A;  1WTH A;  3T8U A;  3ALA A;  2W6J H;  5JBS A;  2K0M A;  2CIU A;  2CW9 A;  2QIY A;  2D42 A;  1ASK A;  3EBY A;  1VQ7 3;  1DVD A;  3RDE A;  3BND A;  4WP5 A;  2OOV A;  3CCM 3;  1Q40 A;  2F99 A;  3F8X A;  3LTA A;  1NO3 A;  1T5Y A;  1OAC A;  2GEY A;  4I4K A;  4GL6 A;  4LEH A;  3SOA A;  2QEX 3;  5IER A;  4AKZ A;  4R80 A;  3LTB A;  2P09 A;  3PYJ A;  5AYR B;  4XBT A;  1NDO B;  2FNQ A;  3FG4 A;  3SLU A;  1U8C B;  3U97 A;  3I55 3;  3CC4 3;  2IA7 A;  1TFK A;  3U1W A;  5ELJ A;  1TUH A;  4RNZ A;  3PCS A;  5STD A;  3S67 A;  3F8H A;  3MG2 A;  4HM0 B;  1N8Q A;  1Y4K A;  2HMM B;  3PGB A;  1JV2 B;  4NHF A;  2O3O A;  3FF0 A;  1UI7 A;  2W03 A;  1EQK A;  1NU3 A;  2A15 A;  1IDP A;  2F98 A;  2O9U X;  3JUM A;  2F86 B;  3FZW A;  4CCV A;  1IQX A;  1IV9 A;  1RRH A;  1EA2 A;  2CKF B;  2IUK A;  2BHM A;  2W56 A;  3IJE B;  1GY5 A;  2B24 B;  1TIJ A;  3M8C A;  2I9W A;  1AVK A;  1SIH A;  3AMO A;  1E97 A;  3Q2P A;  1O7G B;  4ZM8 A;  1Q7Y 4;  1LNH A;  4N6M A;  2B1X B;  2E2U A;  3B4O A;  3D9R A;  1K41 A;  1CEW I;  3K63 A;  1AR0 A;  1U5O A;  3PXM A;  1OPY A;  3NQY A;  1Q42 A;  3G71 3;  2BMR B;  3RGR A;  4EV5 A;  1VQ4 3;  1WQL B;  3MG1 A;  1W2Z A;  4H3U A;  2XGN A;  1STF I;  3HIG A;  2YFI B;  1M1X B;  2KRT A;  1YJ9 3;  1DMQ A;  1QAL A;  2C10 A;  1LOX A;  1A90 A;  3BLZ A;  3K5T A;  1SJW A;  1QVG 2;  1F8N A;  3HZP A;  3JUO A;  3NV0 B;  5CLK A;  2WOH A;  3SX1 A;  1O7P B;  3EQQ B;  2OWP A;  4LSO A;  1KWI A;  3NM2 A;  2YFL B;  3ECF A;  2BNG A;  2OQE C;  2W9Q A;  4H61 A;  5JPU A;  1Q82 4;  2V1L A;  3DGL A;  3LZA A;  1FGT A;  3SED A;  3X41 A;  1ROA A;  1JN5 B;  2YX9 A;  3IPT A;  5DRV A;  5EVH A;  3UJM A;  3VF1 A;  3CPW 2;  1FA3 A;  4PEJ A;  3LML A;  1PU4 A;  1MOL A;  2C11 A;  3EX9 A;  5D82 A;  2RCD A;  3EN1 B;  4HJL B;  1CYV A;  1Z1S A;  2MF7 A;  1WMN A;  1C7H A;  3JUN A;  3KFQ C;  3PS8 A;  2RFR A;  2MC8 A;  4XDV A;  1ULI B;  2JQ5 A;  1GYB A;  4HKV B;  1VQ6 3;  4O3V A;  3HII A;  3CU3 A;  2STD A;  3S29 A;  3X3Z A;  4KVH A;  1YGE A;  5BXQ A;  3MPH A;  1QVF 2;  3F14 A;  1QJG A;  4R9L A;  4HM2 B;  2OTJ 3;  4WFO A;  5BVB A;  3LOY A;  4HM5 B;  3K0Z A;  4FCM A;  3OV4 A;  4XM4 A;  4R9K A;  1VQ5 3;  3H3H A;  5G2G A;  2CH9 A;  4IT7 A;  1W4N A;  1IK3 A;  1D6U A;  5AI1 A;  1KSI A;  1QMA A;  4AEQ A;  2OCT A;  1W00 A;  2GXF A;  1NB3 I;  3CMA 3;  4RBN A;  1D6Z A;  1IV7 A;  2CFK A;  2M7O A;  3NV0 A;  1YHQ 3;  3CCL 3;  3DM8 A;  1LVN A;  5CF1 A;  5IG3 A;  3GWR A;  4O02 B;  5KP1 A;  4JF8 A;  3EE1 A;  8CHO A;  3FCS B;  1YVB I;  4J9A A;  1IU7 A;  5CF2 A;  2P38 A;  1WMP A;  3EN8 A;  2CFW A;  5FGO A;  3HX8 A;  5DRE A;  5A0O B;  3GZY B;  1JN5 A;  3RGA A;  1IVU A;  1RN7 A;  1VQP 3;  3WOF B;  3F40 A;  4GB5 A;  5IG5 A;  1RJO A;  3CXC 2;  1K28 A;  3WA2 X;  4N6N B;  1IVX A;  1DMN A;  1NJI 4;  3B4P A;  2ML6 A;  5IG4 A;  3CCE 3;  3EJV A;  3S27 A;  5IW9 A;  5KP4 A;  4CDL A;  2P0M A;  1YIT 3;  1OF5 B;  1IVW A;  2E2V A;  1AVL A;  1DVC A;  3DGM A;  3IMA B;  3GZB A;  1IT8 A;  2IUJ A;  1OH0 A;  4N6L A;  4HZ9 B;  2OQE A;  3NX0 A;  5AYS C;  3NHX A;  4FMA A;  1QAF A;  1PFP A;  3MYT A;  1SQW A;  3D3L A;  4L8O A;  3FF2 A;  1N8R 4;  2JDI H;  2W0Q A;  3MWZ A;  1GS3 A;  3E99 A;  2CG0 A;  3OW2 2;  5LC7 A;  2R4I A;  3I0Y A;  2KXG A;  1MNL A;  1NWW A;  3CPO A;  1QAK A;  3PCR A;  1JJ2 2;  3LTC A;  2CFL A;  4KFE A;  1IQY A;  2BMO B;  5AIH A;  1FGR A;  2Z7A A;  4HM6 B;  2ZDJ A;  3UB1 A;  3BB9 A;  4KZ1 A;  1E3R A;  2BO9 B;  2UX0 A;  2XR8 B;  3STD A;  1KD1 4;  3HI7 A;  3MKI A;  1JB4 A;  2L4V A;  2GU3 A;  1VQO 3;  3NBB A;  1UUW B;  1J2B A;  2LQV A;  1W2B 2;  5FW5 A;  3CCQ 3;  4MEI A;  2E2T A;  1E3V A;  2P0X A;  3GZR A;  4K61 A;  3MHE A;  2XEP A;  3I56 3;  3FG1 A;  3LT8 A;  3K7C A;  3FLJ A;  1JRQ A;  4OK0 A;  5CXO A;  1N9J A;  1O7N B;  4STD A;  2CWV A;  5CK6 A;  2W04 A;  3X42 A;  3UNL A;  1YIJ 3;  1FUW A;  4LMI A;  3LXU X;  1L5G B;  3FH1 A;  3LH4 A;  2RSX A;  1OF5 A;  2HML B;  2XFT A;  3CCR 3;  5AEU B;  3X40 A;  5HGR A;  3QRD A;  3FGY A;  4N6O B;  4XBY A;  1K73 4;  3LYG A;  3CC2 3;  3KII A;  1YI2 3;  3VSY A;  2XSO B;  1JB5 A;  1TFO A;  1UUV B;  2HMO B;  3DY5 A;  3OWU A;  3V98 A;  3J7Y d;  1VQK 3;  1VQL 3;  4MMZ B;  5EQL A;  1DMM A;  1OHS A;  3BNE A;  5AII A;  4O2H A;  3EBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...