1IV9A

Crystal structure of single chain monellin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEENGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin
publication title The Effect of Single Chain Derivatization on the Structure and Stability of the Monellin
rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 20
structure length 96
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1iv9A00
4N6V0 3SVAA 3GAXA 5EQLA 1TIJA 1YVBI 5LC6A 4N6OB 1CEWI 3QRDA 3KFQC 3S67A 1GD4A 1N5PA 3PS8A 1STFI 1WNHA 4LZIA 2W9PA 1IV9A 3Q2PA 3NX0A 4N6NB 1R4CA 2BO9B 3MWZA 3K9MC 1N5HA 4N6UA 1FUWA 1MNLA 1A90A 1DVDA 2CH9A 4CCVA 1PFPA 3LH4A 2KXGA 4ZM8A 1RN7A 5ELUA 1MOLA 3L0RA 2O9UX 3PYJA 1DVCA 1N9JA 1NB3I 5ELJA 5LC7A 1FA3A 1M9GA 2W9QA 3KSED 4N6TA 5A0OB 1ROAA 1EQKA 3UL6A 1IV7A 4N6LA 1KWIA 4IT7A 1A67A 4TX4A 1GD3A 2OCTA 3PXMA 3IMAB 1LXEA 1CYUA 4EYCA 4N6MA 1CYVA 1NB5I 1G96A 3UL5A
chains in the Genus database with same CATH superfamily
1Q814 4EV5A 1FGQA 5CXOA 1FGRA 4KFFA 4HM7B 3GAXA 4N3VA 3OW22 1T5YA 2M7OA 2BMOB 1C54A 2ZA4A 2W2CA 4WYKB 1VQ63 1RGGA 3AMOA 1GMRA 5STDA 1GOYA 1VQ53 1YIT3 3IPTA 3NQZA 1MWRA 1SPUA 1CEWI 1LOWA 3FKAA 3KFQC 1O7NB 3QRDA 3S67A 1K9M4 3KE7A 1GS3A 2WO0A 3CME3 3NBRA 1BAOA 7GSPA 4WYKA 4HM2B 1LRAA 4FMCA 1A2KA 3CNXA 3K7CA 3SX1A 1B3SA 3HIGA 4IPBA 1WNHA 4LZIA 3FGYA 1Z1SA 4MMXB 3SXXA 2GBXB 2L1SA 1UCIA 4BL3A 4N6NB 1R4CA 1O7PB 2BO9B 4R80A 1KQS2 1ZO2A 3BNDA 1JBTA 1FUTA 3CCL3 3CCR3 1TU5A 2ZHXB 4WWUC 7RNTA 3MHEA 4HBRA 1FUWA 2K54A 5JPPA 4JF8A 1QAKA 2HMNB 1DVDA 4OUQA 1VQM3 1B2ZA 3CNMA 2P05A 3GWRA 1Q7HA 1SARA 2IY2A 2ML5A 1BU4A 1OHSA 1YJN3 1BNIA 1OF5B 1PFPA 1VQQA 1LQGC 2CX0A 2XH9A 5M19A 1Q864 2LYXA 1RMSA 1JRQA 1RN7A 3LTDA 4CPKA 3NBJA 5AYSC 1ISKA 1K28A 1N8R4 1DE3A 1JV2B 1OH0A 3FSDA 3RNTA 2AAEA 5ELUA 4EW5A 1MOLA 3L0RA 3PCSA 3JUMA 4XBTA 1I2GA 3LTCA 3X3ZA 1DVCA 2Z77A 1OHPA 4HM3B 3JUNA 2OWPA 3UB1A 4QWTA 2OTJ3 2HMJB 3H51A 1OF5A 2IA7A 2IUKA 2Y74A 1BRGA 1W6YA 2CWTA 2ZDJA 3GSPA 3IJEB 4G1MB 5AIIA 2INXA 1RCKA 1V58A 1JBRA 2RGQA 1BRHA 3MG3A 3WOFB 2PNCA 3I563 1EA2A 4N6TA 8CHOA 3EBYA 2IYJA 3G0KA 3KKGA 2KCDA 1EQKA 3UL6A 2Q07A 1R4YA 4RNZA 1EG9B 1WMPA 3JUQA 3N9HA 2BT3A 3G8ZA 1RLSA 1IQ8A 1FGTA 4LYLB 1BRJA 2H0GA 2HMMB 3WR2A 3GZXB 3ECFA 4XDWA 1WQLB 1G0TA 1GMPA 3J7Yd 1HYFA 4R9LA 3G4S3 3NUVA 1A67A 3LT9A 1GD3A 1KSIA 3HIIA 4J8TA 4TX4A 2RNTA 1QJGA 3VSYA 4MMZB 1BSBA 1ZX2A 1RRHA 1E3RA 3D5IA 3PXMA 1BNEA 3ZG0A 2QGUA 3OV4A 1U8CB 4GSPA 4BTWA 2XSOB 1TTOA 3F9SA 3IMAB 4RNYA 1JJ22 1UUWB 1W02A 1OGXA 1O7WB 1Q40B 1YGEA 4HJLB 1IT7A 3B8LA 5IF6A 4AEQA 4EYCA 3LMLA 1CYUA 2J8XB 1CYVA 3FF2A 2A15A 1GOVA 2F86B 5KP3A 3F7XA 1GYBA 4BL2A 1IQXA 4FCJA 3RGAA 3DMCA 1TFKA 2GXFA 5IEOA 3CC43 3DM8A 4XB5A 7STDA 4N6V0 3CU3A 1Q40A 3BNCA 1RNBA 5EEOA 3G6E3 2F98A 4XM4A 1AR0A 1OPYA 4ILFA 3WA3A 1O7GB 1B2SA 3GZYB 3CXC2 5AIFA 4U13A 1N8QA 3D9RA 3RDEA 4BIRA 5HOHA 5BVBA 1JBSA 1RCLA 5IG4A 2OQEA 2CFLA 1ZGXA 4LGQA 1GOUA 1W6GA 4FMBA 1GD4A 1I0XA 1I8VA 3EB8A 3GRDA 3E99A 1JNQA 1EEJA 3AHWA 3N54B 2XF3A 1F8NA 1FYSA 3CCJ3 3OX9A 1HU9A 3EHCA 3I0YA 4I4KA 4JRFA 1BNRA 1UCJA 1RSNA 1YIJ3 1IVVA 3QK9A 4HZBB 1YVSA 2H0HA 3NQYA 2CC3A 5AI1A 2KF4A 1JB2A 3NM2A 3S27A 3JUPA 1I3FA 3EN1B 3S28A 3K9MC 2XFSA 4HYZA 1B2MA 1BUJA 1W5ZA 3LYGA 1JZOA 3EN8A 1RGAA 1BSEA 4CDLA 2B1XB 2D42A 3T0UA 1FUSA 1FGOA 1BNJA 1AVKA 2Y73A 1O7HB 2KF5A 4HM6B 3X40A 4MJDA 1BIRA 2F56A 3DGNA 2KXGA 4FCMA 5IERA 1VQ73 1OUNA 3LXUX 3LT8A 3T8NA 1NU3A 5AEUB 3MG2A 2E2VA 2E2TA 2CX1A 3WHOA 1OHOA 2RFRA 1LOVA 1YNVX 2E2UA 4EXRA 4I5QA 3KN4A 1YJ93 2L4VA 3WMDA 3F14A 3DZLA 4CJNA 1FA3A 2YX9A 5AIHA 3SYUA 2HMLB 3HOHA 2XSHB 1RGHA 2HMKB 3DY5A 4MMYB 2XEPA 4BU4A 2LQVA 1JN5B 2WOFA 2QA43 3CPOA 3DGMA 1RGCA 2CHCA 4K1UA 2P38A 3X41A 4LEHA 2F5MA 4O8SA 4FCZA 4J5GA 4X2OA 2XFTA 5FGOA 1GSPA 3U1WA 1VQK3 1BVIA 1KWIA 4IT7A 1IQYA 4FR9A 4KT3B 1L5GB 4HAAA 1I3IA 1V57A 1BRKA 1JN5A 4WFOA 2CIUA 4AKZA 5BU4A 1UUGB 4XDVA 3OWUA 3M8CA 5M18A 4L8PA 2RCDA 3KCHA 3MYTA 1BOXA 3FG3A 2YFJB 3VF1A 3CCE3 1OGZA 1NJI4 1Q42A 5IG0A 1LXEA 2CWUA 1W4NA 5AIGA 5TGNA 3CD63 4N6MA 1M1K4 1IVUA 1EUIC 1NB5I 2W03A 5EVHA 3UL5A 4KFDA 1FZUA 2SBLA 2KAAA 4PEJA 3ALAA 5AEWB 1VQ43 5D81A 4HOHA 2JDIH 4DKIA 2IMJA 1MGWA 1G02A 4AKYA 1VZZA 2HOHA 4XBXA 3TDGA 3X42A 2W6JH 1RHLA 4HM4B 1ASKA 1D6UA 1W00A 4NREA 5AYRB 1T2IA 1WMNA 3EX9A 3KSPA 2OOVA 1YI23 1K8A4 4STDA 3U97A 2D1WA 3FG1A 3K63A 4HZ9B 5CK6A 5LC6A 1IU7A 1DYUA 1NO3A 2I9WA 1X1UA 3CCV3 4GHOA 1TJDA 5D83A 4EV2A 3FF0A 5JPUA 2HMOB 5HGRA 1BRNL 1N9EA 3PS8A 3NHXA 1JKGB 1VQL3 2CWVA 2F4YA 1UGIA 4MEIA 1RRLA 1W7CA 1JB4A 2KF3A 3X3YA 2RSXA 1IT8A 2OQEC 3GZRA 4NHFA 1ULIB 1I70A 8RNTA 1IV9A 3DGLA 3NX0A 1CQSA 1VQO3 1U5OA 5G2GA 2K0MA 1QMAA 2C11A 3FG4A 4K61A 1JKGA 1N5HA 2MC8A 3SOYA 5IENA 4ORLA 5GSPA 1LVNA 3WOEB 2B24B 4N6UA 3ZG5A 3JUOA 1W2ZA 4H3UA 1MNLA 4FMDA 1BGSA 2V1LA 4NPBA 3HZPA 3ER7A 2FXTA 3DGOA 1TRQA 2Z76A 3DH2A 3FCSB 4RZMA 3BB9A 6GSPA 5IEPA 1X1YA 2SARA 4K1VA 3LH4A 2BHMA 3FH1A 4ZM8A 2XGLA 1B2UA 2KF6A 2OTL3 1LOYA 3KZTA 3T8UA 3D3LA 3A76A 1UI7A 2BMRB 4KZ1A 1MWUA 3AGNA 4LSOA 2O9UX 5JBSA 1OCVA 3LTBA 2C10A 1N9JA 1D6ZA 1AV4A 3EJVA 3NXJA 3D4AA 5ELJA 5IW9A 1GMQA 2R4IA 1GY6A 1UCKA 3X3XA 3DGYA 1M9GA 1MWTA 1TFOA 3D5GA 1LNHA 4H61A 6STDA 5IG3A 1IYYA 2CFKA 2FGTA 1DMNA 2K3DA 4IIAA 1I0VA 2C4BA 2W56B 1IK3A 3KIIA 1JB5A 3MPHA 1X1XA 1TRPA 5A0OB 2GU1A 1QALA 3ZFZA 1IV7A 1SIIA 1O7MB 3LOYA 1IDPA 3BLZA 2WGOA 2CFDA 3K5TA 3B4PA 1LOXA 2IUJA 1BANA 2CFGA 2W56A 2JQ5A 2UGIA 3CCM3 2GU3A 3EC9A 2W04A 2F5WA 5RNTA 1KC84 1D6YA 3CC73 3BIRA 1RKYA 4O3VA 1VQN3 3NBBA 1QVF2 4J9AA 3B7CA 1OACA 3WODG 1RGLA 1RGKA 3SOAA 3CCS3 3OXAA 5KP4A 4GL6A 1UUVB 3B4OA 2R41A 1S723 4K90B 3F7SA 3LTAA 2P0MA 5DRVA 4GB5A 1BRIA 3EF8A 2CG0A 5CLKA 2ML6A 3V98A 5D82A 1JZDA 1W6CA 1G96A 3S5CA 4LMIA 3WDGB 5KP1A 1YJW3 1UCLA 3LZAA 4L7KA 2MF7A 3URPA 3D79A 3JVCA 4J5KA 1S5AA 4KVHA 3CCU3 3STDA 3EE1A 3SVAA 3A5EA 3UNLA 1B27A 3PGBA 2PZVA 1BSAA 1RJOA 5BIRA 1M904 2CK3H 3GZBA 5EQLA 4HM5B 9RNTA 1BNGA 1T3BA 1TIJA 3F40A 1FGMA 3Q1CA 1SIHA 1LQMB 1YVBI 2UUGC 4EC6A 2BMQB 1V74A 1DMMA 4N6OB 2FNQA 4HM1B 1IVXA 1RDSA 4OK0A 1GY5A 3PCRA 1I2FA 2BU4A 1N5PA 3FLJA 2H0IA 1Q9EA 4HVNA 1QAFA 3BU4A 3EBTA 4O2HA 2CG1A 2XGNA 3FZWA 1SQWA 3G16A 1FW7A 2OOVC 3K0ZA 3HI7A 1STFI 1VQP3 1CH0A 1STDA 2RBIA 2W9PA 1TP6A 1B21A 1UW1A 3F8HA 3F8XA 2XR8B 3Q2PA 3SLUA 1NWWA 1ROVA 1I2EA 5DREA 1SJWA 4HM0B 1AVLA 2KRTA 5CF2A 1A2VA 3MWZA 1BUQA 3O8YA 4WP5A 5IG5A 1ULJB 1HZ1A 4R1KA 1NDOB 1A90A 3RGRA 4KFEA 2CH9A 1VQ83 3V92A 1J2BA 1AY7A 4CCVA 2BNGA 3CC23 3UJMA 3HX8A 3SEDA 4BTYA 5FW5A 1PY3A 1WMOA 2BIRA 1RNTA 1X1WA 1RTUA 2XRXB 2CKFB 1K41A 3AHSA 3H3HA 3MKIA 3BNEA 2GBWB 3EQQB 1W2B2 1Q824 1C7HA 3PYJA 2YFIB 2WGQA 4R9KA 3G713 2GEXA 2Z6BA 1NB3I 4R4KA 2GEYA 5LC7A 3HK4A 1BNSA 3PZWA 1WTHA 2WOHA 1EKMA 2F99A 1BRSA 1TUHA 4HKVB 2W9QA 3V99A 1M1XB 1E3VA 2YFLB 5CF1A 3KSED 1RN1A 3DXOA 3WA2X 5I97A 1RN4A 1B20A 2Z7AA 4L8OA 4X2HA 4WHAA 2W0QA 2STDA 5BXQA 1PU4A 1ROAA 1YHQ3 2O3OA 3CCQ3 3Q90A 4RBNA 1UDII 3ROBA 2GSPA 3BNBA 1US1A 1AQZA 3OWYA 2CW9A 3MG1A 3MSOA 4N6LA 1B2XA 2UX0A 1VQ93 3NM7A 1GY7A 1RGFA 4RNTA 1E97A 3NV0B 3OWSA 5M1AA 4XBYA 3N8BA 4BTXA 2P0XA 4Q53A 1DMQA 1Q7Y4 5G1LA 1HKXA 1W01A 4FMAA 3I553 4O02B 3CPW2 2OCTA 1MGRA 1PYLA 2QEX3 1Y4KA 4OVMA 4HM8B 3DUKA 2QIYA 1LNIA 1RGEA 1YGWA 1NNVA 3AGOA 5G1KA 4EBGA 2CFWA 1A2PA 3NV0A 1UGHI 1K734 3Q3FA 1BSCA 3VGNA 1ZS7A 1BNFA 1KD14 1MWSA 1IVWA 2P09A 3S29A 2AADA 1T2HA 1DETA 1BSDA 3AMOB 6RNTA 3CMA3 1UI8A 1QVG2 2ZL8A
chains in the Genus database with same CATH topology
1Q814 4EV5A 1FGQA 5CXOA 1FGRA 4KFFA 4HM7B 3GAXA 4N3VA 3OW22 1T5YA 2M7OA 2BMOB 4WYKB 2W2CA 1VQ63 3AMOA 5STDA 1VQ53 1YIT3 3IPTA 3NQZA 1SPUA 1CEWI 3FKAA 3KFQC 3QRDA 1O7NB 3S67A 1K9M4 3KE7A 1GS3A 2WO0A 3CME3 3NBRA 4WYKA 4HM2B 4FMCA 1A2KA 3CNXA 3K7CA 3SX1A 3HIGA 4IPBA 1WNHA 4LZIA 3FGYA 1Z1SA 4MMXB 3SXXA 2GBXB 4N6NB 1R4CA 1O7PB 2BO9B 4R80A 1KQS2 1ZO2A 3BNDA 3CCL3 3CCR3 1TU5A 4WWUC 3MHEA 4HBRA 1FUWA 2K54A 5JPPA 4JF8A 1QAKA 2HMNB 1DVDA 4OUQA 1VQM3 3CNMA 2P05A 3GWRA 2ML5A 1OHSA 1YJN3 1OF5B 1PFPA 1Q864 2XH9A 2LYXA 1RN7A 1JRQA 3LTDA 1ISKA 3NBJA 5AYSC 1K28A 1N8R4 1JV2B 1OH0A 3FSDA 5ELUA 1MOLA 3L0RA 3PCSA 3JUMA 4XBTA 3LTCA 3X3ZA 1DVCA 2Z77A 1OHPA 4HM3B 3JUNA 2OWPA 3UB1A 4QWTA 2OTJ3 2HMJB 3H51A 1OF5A 2IA7A 2IUKA 2Y74A 2CWTA 1W6YA 2ZDJA 3IJEB 4G1MB 5AIIA 2INXA 2RGQA 3MG3A 3WOFB 2PNCA 3I563 1EA2A 4N6TA 8CHOA 3EBYA 3G0KA 3KKGA 2KCDA 1EQKA 3UL6A 2Q07A 4RNZA 1EG9B 1WMPA 3JUQA 3N9HA 2BT3A 3G8ZA 1IQ8A 1FGTA 2HMMB 3GZXB 3ECFA 4XDWA 1WQLB 3J7Yd 4R9LA 3G4S3 3NUVA 1A67A 3LT9A 1GD3A 1KSIA 3HIIA 4J8TA 4TX4A 3VSYA 1QJGA 4MMZB 1ZX2A 1RRHA 1E3RA 3PXMA 2QGUA 3OV4A 1U8CB 4BTWA 2XSOB 3F9SA 3IMAB 4RNYA 1JJ22 1UUWB 1W02A 1OGXA 1O7WB 1Q40B 1YGEA 4HJLB 1IT7A 3B8LA 5IF6A 4AEQA 4EYCA 3LMLA 1CYUA 1CYVA 1UI8A 3FF2A 2A15A 2F86B 5KP3A 3F7XA 1GYBA 1IQXA 4FCJA 3RGAA 3DMCA 1TFKA 2GXFA 5IEOA 3CC43 3DM8A 4XB5A 7STDA 4N6V0 3CU3A 1Q40A 3BNCA 5EEOA 3G6E3 2F98A 4XM4A 1AR0A 1OPYA 3WA3A 1O7GB 3GZYB 3CXC2 5AIFA 4U13A 1N8QA 3D9RA 3RDEA 5BVBA 5IG4A 2OQEA 2CFLA 4LGQA 1W6GA 4FMBA 1GD4A 3EB8A 3GRDA 3E99A 1JNQA 3N54B 2XF3A 1F8NA 3CCJ3 3OX9A 1HU9A 3EHCA 3I0YA 4I4KA 4JRFA 1YIJ3 1IVVA 3QK9A 4HZBB 3NQYA 2CC3A 5AI1A 1JB2A 3NM2A 3S27A 3JUPA 3S28A 3EN1B 3K9MC 2XFSA 4HYZA 1W5ZA 3LYGA 3EN8A 4CDLA 2B1XB 2D42A 3T0UA 1FGOA 1AVKA 2Y73A 1O7HB 4HM6B 3X40A 4MJDA 3DGNA 2KXGA 4FCMA 5IERA 1VQ73 1OUNA 3LXUX 3LT8A 3T8NA 1NU3A 5AEUB 3MG2A 2E2VA 2E2TA 1OHOA 2RFRA 2E2UA 4EXRA 3KN4A 1YJ93 2L4VA 3WMDA 3F14A 3DZLA 1FA3A 2YX9A 5AIHA 2HMLB 2XSHB 2HMKB 3DY5A 4MMYB 2XEPA 2LQVA 1JN5B 2WOFA 2QA43 3CPOA 3DGMA 2CHCA 4K1UA 2P38A 3X41A 4LEHA 4O8SA 4FCZA 4X2OA 2XFTA 5FGOA 3U1WA 1VQK3 1KWIA 4IT7A 1IQYA 4FR9A 1L5GB 1JN5A 4WFOA 2CIUA 4AKZA 4XDVA 3OWUA 3M8CA 4L8PA 2RCDA 3MYTA 3VF1A 3FG3A 3CCE3 2YFJB 1OGZA 1NJI4 1Q42A 5IG0A 1LXEA 2CWUA 1W4NA 5AIGA 5TGNA 3CD63 4N6MA 1M1K4 1IVUA 1NB5I 2W03A 5EVHA 3UL5A 4KFDA 2SBLA 4PEJA 3ALAA 5AEWB 1VQ43 5D81A 2JDIH 2IMJA 4AKYA 1VZZA 4XBXA 3TDGA 3X42A 2W6JH 4HM4B 1ASKA 1D6UA 1W00A 4NREA 5AYRB 1WMNA 3EX9A 3KSPA 2OOVA 1YI23 1K8A4 4STDA 3U97A 2D1WA 3FG1A 3K63A 4HZ9B 5CK6A 5LC6A 1IU7A 1DYUA 1NO3A 2I9WA 3CCV3 5D83A 4EV2A 3FF0A 5JPUA 5HGRA 1N9EA 3PS8A 3NHXA 1JKGB 1VQL3 2CWVA 4MEIA 1RRLA 1W7CA 1JB4A 3X3YA 2RSXA 1IT8A 2OQEC 3GZRA 4NHFA 1ULIB 1IV9A 3DGLA 3NX0A 1CQSA 1VQO3 1U5OA 5G2GA 2K0MA 1QMAA 2C11A 3FG4A 4K61A 1JKGA 1N5HA 2MC8A 3SOYA 5IENA 4ORLA 1LVNA 3WOEB 2B24B 4N6UA 3JUOA 1W2ZA 4H3UA 1MNLA 4FMDA 2V1LA 3HZPA 3ER7A 2FXTA 3DGOA 2Z76A 3FCSB 4RZMA 3BB9A 5IEPA 4K1VA 3LH4A 2BHMA 3FH1A 4ZM8A 2XGLA 2OTL3 3KZTA 3T8UA 3D3LA 3A76A 1UI7A 2BMRB 4KZ1A 4LSOA 2O9UX 5JBSA 1OCVA 3LTBA 2C10A 1N9JA 1D6ZA 1AV4A 3EJVA 3NXJA 5IW9A 5ELJA 2R4IA 1GY6A 3X3XA 1M9GA 1TFOA 5IG3A 4H61A 1LNHA 6STDA 2CFKA 2FGTA 1DMNA 4IIAA 1IK3A 2W56B 3KIIA 1JB5A 3MPHA 5A0OB 2GU1A 1QALA 1IV7A 1SIIA 1O7MB 3LOYA 1IDPA 3BLZA 2WGOA 2CFDA 3K5TA 3B4PA 1LOXA 2IUJA 2CFGA 2W56A 2JQ5A 3CCM3 2GU3A 3EC9A 2W04A 1KC84 1D6YA 3CC73 1RKYA 4O3VA 1VQN3 3NBBA 1QVF2 4J9AA 3B7CA 1OACA 3WODG 3SOAA 3CCS3 3OXAA 5KP4A 4GL6A 1UUVB 3B4OA 1S723 4K90B 3F7SA 3LTAA 2P0MA 5DRVA 4GB5A 3EF8A 2CG0A 5CLKA 2ML6A 3V98A 5D82A 1W6CA 1YJW3 1G96A 3S5CA 4LMIA 3WDGB 5KP1A 3LZAA 4L7KA 2MF7A 3JVCA 1S5AA 4KVHA 3CCU3 3STDA 3EE1A 3SVAA 3UNLA 3PGBA 2PZVA 1RJOA 1M904 2CK3H 3GZBA 5EQLA 4HM5B 1TIJA 3F40A 1FGMA 3Q1CA 1SIHA 1YVBI 4EC6A 2BMQB 1V74A 1DMMA 4N6OB 2FNQA 4HM1B 1IVXA 4OK0A 1GY5A 3PCRA 3FLJA 1N5PA 4HVNA 1QAFA 3EBTA 4O2HA 2CG1A 2XGNA 3FZWA 1SQWA 3G16A 2OOVC 3K0ZA 3HI7A 1STFI 1VQP3 1STDA 2W9PA 1TP6A 1UW1A 3F8HA 3F8XA 2XR8B 3Q2PA 3SLUA 1NWWA 1ROVA 5DREA 1SJWA 4HM0B 1AVLA 2KRTA 5CF2A 1A2VA 3MWZA 1BUQA 3O8YA 4WP5A 5IG5A 1ULJB 4R1KA 1NDOB 1A90A 3RGRA 4KFEA 2CH9A 1VQ83 3V92A 1J2BA 4CCVA 2BNGA 3CC23 3UJMA 3HX8A 3SEDA 4BTYA 5FW5A 1WMOA 2XRXB 2CKFB 1K41A 3H3HA 3MKIA 3BNEA 2GBWB 3EQQB 1W2B2 1Q824 1C7HA 3PYJA 2YFIB 2WGQA 4R9KA 3G713 2GEXA 2Z6BA 1NB3I 4R4KA 2GEYA 5LC7A 3HK4A 3PZWA 1WTHA 2WOHA 1EKMA 2F99A 1TUHA 4HKVB 2W9QA 3V99A 1M1XB 1E3VA 2YFLB 5CF1A 3KSED 3DXOA 3WA2X 5I97A 2Z7AA 4X2HA 4L8OA 4WHAA 2W0QA 2STDA 5BXQA 1PU4A 1ROAA 1YHQ3 2O3OA 3CCQ3 3Q90A 4RBNA 3ROBA 3BNBA 3OWYA 1US1A 2CW9A 3MG1A 3MSOA 4N6LA 2UX0A 1VQ93 3NM7A 1GY7A 1E97A 3NV0B 3OWSA 4XBYA 3N8BA 4BTXA 2P0XA 4Q53A 1DMQA 1Q7Y4 3I553 1HKXA 1W01A 4FMAA 4O02B 3CPW2 2OCTA 2QEX3 1Y4KA 4OVMA 4HM8B 3DUKA 2QIYA 4EBGA 2CFWA 3NV0A 1K734 3VGNA 1KD14 3S29A 1IVWA 2P09A 3AMOB 3CMA3 2HMOB 1QVG2 2ZL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6V 0;  3SVA A;  3GAX A;  5EQL A;  1TIJ A;  1YVB I;  5LC6 A;  4N6O B;  1CEW I;  3QRD A;  3KFQ C;  3S67 A;  1GD4 A;  1N5P A;  3PS8 A;  1STF I;  1WNH A;  4LZI A;  2W9P A;  1IV9 A;  3Q2P A;  3NX0 A;  4N6N B;  1R4C A;  2BO9 B;  3MWZ A;  3K9M C;  1N5H A;  4N6U A;  1FUW A;  1MNL A;  1A90 A;  1DVD A;  2CH9 A;  4CCV A;  1PFP A;  3LH4 A;  2KXG A;  4ZM8 A;  1RN7 A;  5ELU A;  1MOL A;  3L0R A;  2O9U X;  3PYJ A;  1DVC A;  1N9J A;  1NB3 I;  5ELJ A;  5LC7 A;  1FA3 A;  1M9G A;  2W9Q A;  3KSE D;  4N6T A;  5A0O B;  1ROA A;  1EQK A;  3UL6 A;  1IV7 A;  4N6L A;  1KWI A;  4IT7 A;  1A67 A;  4TX4 A;  1GD3 A;  2OCT A;  3PXM A;  3IMA B;  1LXE A;  1CYU A;  4EYC A;  4N6M A;  1CYV A;  1NB5 I;  1G96 A;  3UL5 A; 
#chains in the Genus database with same CATH topology
 1Q81 4;  4EV5 A;  1FGQ A;  5CXO A;  1FGR A;  4KFF A;  4HM7 B;  3GAX A;  4N3V A;  3OW2 2;  1T5Y A;  2M7O A;  2BMO B;  1C54 A;  2ZA4 A;  2W2C A;  4WYK B;  1VQ6 3;  1RGG A;  3AMO A;  1GMR A;  5STD A;  1GOY A;  1VQ5 3;  1YIT 3;  3IPT A;  3NQZ A;  1MWR A;  1SPU A;  1CEW I;  1LOW A;  3FKA A;  3KFQ C;  1O7N B;  3QRD A;  3S67 A;  1K9M 4;  3KE7 A;  1GS3 A;  2WO0 A;  3CME 3;  3NBR A;  1BAO A;  7GSP A;  4WYK A;  4HM2 B;  1LRA A;  4FMC A;  1A2K A;  3CNX A;  3K7C A;  3SX1 A;  1B3S A;  3HIG A;  4IPB A;  1WNH A;  4LZI A;  3FGY A;  1Z1S A;  4MMX B;  3SXX A;  2GBX B;  2L1S A;  1UCI A;  4BL3 A;  4N6N B;  1R4C A;  1O7P B;  2BO9 B;  4R80 A;  1KQS 2;  1ZO2 A;  3BND A;  1JBT A;  1FUT A;  3CCL 3;  3CCR 3;  1TU5 A;  2ZHX B;  4WWU C;  7RNT A;  3MHE A;  4HBR A;  1FUW A;  2K54 A;  5JPP A;  4JF8 A;  1QAK A;  2HMN B;  1DVD A;  4OUQ A;  1VQM 3;  1B2Z A;  3CNM A;  2P05 A;  3GWR A;  1Q7H A;  1SAR A;  2IY2 A;  2ML5 A;  1BU4 A;  1OHS A;  1YJN 3;  1BNI A;  1OF5 B;  1PFP A;  1VQQ A;  1LQG C;  2CX0 A;  2XH9 A;  5M19 A;  1Q86 4;  2LYX A;  1RMS A;  1JRQ A;  1RN7 A;  3LTD A;  4CPK A;  3NBJ A;  5AYS C;  1ISK A;  1K28 A;  1N8R 4;  1DE3 A;  1JV2 B;  1OH0 A;  3FSD A;  3RNT A;  2AAE A;  5ELU A;  4EW5 A;  1MOL A;  3L0R A;  3PCS A;  3JUM A;  4XBT A;  1I2G A;  3LTC A;  3X3Z A;  1DVC A;  2Z77 A;  1OHP A;  4HM3 B;  3JUN A;  2OWP A;  3UB1 A;  4QWT A;  2OTJ 3;  2HMJ B;  3H51 A;  1OF5 A;  2IA7 A;  2IUK A;  2Y74 A;  1BRG A;  1W6Y A;  2CWT A;  2ZDJ A;  3GSP A;  3IJE B;  4G1M B;  5AII A;  2INX A;  1RCK A;  1V58 A;  1JBR A;  2RGQ A;  1BRH A;  3MG3 A;  3WOF B;  2PNC A;  3I56 3;  1EA2 A;  4N6T A;  8CHO A;  3EBY A;  2IYJ A;  3G0K A;  3KKG A;  2KCD A;  1EQK A;  3UL6 A;  2Q07 A;  1R4Y A;  4RNZ A;  1EG9 B;  1WMP A;  3JUQ A;  3N9H A;  2BT3 A;  3G8Z A;  1RLS A;  1IQ8 A;  1FGT A;  4LYL B;  1BRJ A;  2H0G A;  2HMM B;  3WR2 A;  3GZX B;  3ECF A;  4XDW A;  1WQL B;  1G0T A;  1GMP A;  3J7Y d;  1HYF A;  4R9L A;  3G4S 3;  3NUV A;  1A67 A;  3LT9 A;  1GD3 A;  1KSI A;  3HII A;  4J8T A;  4TX4 A;  2RNT A;  1QJG A;  3VSY A;  4MMZ B;  1BSB A;  1ZX2 A;  1RRH A;  1E3R A;  3D5I A;  3PXM A;  1BNE A;  3ZG0 A;  2QGU A;  3OV4 A;  1U8C B;  4GSP A;  4BTW A;  2XSO B;  1TTO A;  3F9S A;  3IMA B;  4RNY A;  1JJ2 2;  1UUW B;  1W02 A;  1OGX A;  1O7W B;  1Q40 B;  1YGE A;  4HJL B;  1IT7 A;  3B8L A;  5IF6 A;  4AEQ A;  4EYC A;  3LML A;  1CYU A;  2J8X B;  1CYV A;  3FF2 A;  2A15 A;  1GOV A;  2F86 B;  5KP3 A;  3F7X A;  1GYB A;  4BL2 A;  1IQX A;  4FCJ A;  3RGA A;  3DMC A;  1TFK A;  2GXF A;  5IEO A;  3CC4 3;  3DM8 A;  4XB5 A;  7STD A;  4N6V 0;  3CU3 A;  1Q40 A;  3BNC A;  1RNB A;  5EEO A;  3G6E 3;  2F98 A;  4XM4 A;  1AR0 A;  1OPY A;  4ILF A;  3WA3 A;  1O7G B;  1B2S A;  3GZY B;  3CXC 2;  5AIF A;  4U13 A;  1N8Q A;  3D9R A;  3RDE A;  4BIR A;  5HOH A;  5BVB A;  1JBS A;  1RCL A;  5IG4 A;  2OQE A;  2CFL A;  1ZGX A;  4LGQ A;  1GOU A;  1W6G A;  4FMB A;  1GD4 A;  1I0X A;  1I8V A;  3EB8 A;  3GRD A;  3E99 A;  1JNQ A;  1EEJ A;  3AHW A;  3N54 B;  2XF3 A;  1F8N A;  1FYS A;  3CCJ 3;  3OX9 A;  1HU9 A;  3EHC A;  3I0Y A;  4I4K A;  4JRF A;  1BNR A;  1UCJ A;  1RSN A;  1YIJ 3;  1IVV A;  3QK9 A;  4HZB B;  1YVS A;  2H0H A;  3NQY A;  2CC3 A;  5AI1 A;  2KF4 A;  1JB2 A;  3NM2 A;  3S27 A;  3JUP A;  1I3F A;  3EN1 B;  3S28 A;  3K9M C;  2XFS A;  4HYZ A;  1B2M A;  1BUJ A;  1W5Z A;  3LYG A;  1JZO A;  3EN8 A;  1RGA A;  1BSE A;  4CDL A;  2B1X B;  2D42 A;  3T0U A;  1FUS A;  1FGO A;  1BNJ A;  1AVK A;  2Y73 A;  1O7H B;  2KF5 A;  4HM6 B;  3X40 A;  4MJD A;  1BIR A;  2F56 A;  3DGN A;  2KXG A;  4FCM A;  5IER A;  1VQ7 3;  1OUN A;  3LXU X;  3LT8 A;  3T8N A;  1NU3 A;  5AEU B;  3MG2 A;  2E2V A;  2E2T A;  2CX1 A;  3WHO A;  1OHO A;  2RFR A;  1LOV A;  1YNV X;  2E2U A;  4EXR A;  4I5Q A;  3KN4 A;  1YJ9 3;  2L4V A;  3WMD A;  3F14 A;  3DZL A;  4CJN A;  1FA3 A;  2YX9 A;  5AIH A;  3SYU A;  2HML B;  3HOH A;  2XSH B;  1RGH A;  2HMK B;  3DY5 A;  4MMY B;  2XEP A;  4BU4 A;  2LQV A;  1JN5 B;  2WOF A;  2QA4 3;  3CPO A;  3DGM A;  1RGC A;  2CHC A;  4K1U A;  2P38 A;  3X41 A;  4LEH A;  2F5M A;  4O8S A;  4FCZ A;  4J5G A;  4X2O A;  2XFT A;  5FGO A;  1GSP A;  3U1W A;  1VQK 3;  1BVI A;  1KWI A;  4IT7 A;  1IQY A;  4FR9 A;  4KT3 B;  1L5G B;  4HAA A;  1I3I A;  1V57 A;  1BRK A;  1JN5 A;  4WFO A;  2CIU A;  4AKZ A;  5BU4 A;  1UUG B;  4XDV A;  3OWU A;  3M8C A;  5M18 A;  4L8P A;  2RCD A;  3KCH A;  3MYT A;  1BOX A;  3FG3 A;  2YFJ B;  3VF1 A;  3CCE 3;  1OGZ A;  1NJI 4;  1Q42 A;  5IG0 A;  1LXE A;  2CWU A;  1W4N A;  5AIG A;  5TGN A;  3CD6 3;  4N6M A;  1M1K 4;  1IVU A;  1EUI C;  1NB5 I;  2W03 A;  5EVH A;  3UL5 A;  4KFD A;  1FZU A;  2SBL A;  2KAA A;  4PEJ A;  3ALA A;  5AEW B;  1VQ4 3;  5D81 A;  4HOH A;  2JDI H;  4DKI A;  2IMJ A;  1MGW A;  1G02 A;  4AKY A;  1VZZ A;  2HOH A;  4XBX A;  3TDG A;  3X42 A;  2W6J H;  1RHL A;  4HM4 B;  1ASK A;  1D6U A;  1W00 A;  4NRE A;  5AYR B;  1T2I A;  1WMN A;  3EX9 A;  3KSP A;  2OOV A;  1YI2 3;  1K8A 4;  4STD A;  3U97 A;  2D1W A;  3FG1 A;  3K63 A;  4HZ9 B;  5CK6 A;  5LC6 A;  1IU7 A;  1DYU A;  1NO3 A;  2I9W A;  1X1U A;  3CCV 3;  4GHO A;  1TJD A;  5D83 A;  4EV2 A;  3FF0 A;  5JPU A;  2HMO B;  5HGR A;  1BRN L;  1N9E A;  3PS8 A;  3NHX A;  1JKG B;  1VQL 3;  2CWV A;  2F4Y A;  1UGI A;  4MEI A;  1RRL A;  1W7C A;  1JB4 A;  2KF3 A;  3X3Y A;  2RSX A;  1IT8 A;  2OQE C;  3GZR A;  4NHF A;  1ULI B;  1I70 A;  8RNT A;  1IV9 A;  3DGL A;  3NX0 A;  1CQS A;  1VQO 3;  1U5O A;  5G2G A;  2K0M A;  1QMA A;  2C11 A;  3FG4 A;  4K61 A;  1JKG A;  1N5H A;  2MC8 A;  3SOY A;  5IEN A;  4ORL A;  5GSP A;  1LVN A;  3WOE B;  2B24 B;  4N6U A;  3ZG5 A;  3JUO A;  1W2Z A;  4H3U A;  1MNL A;  4FMD A;  1BGS A;  2V1L A;  4NPB A;  3HZP A;  3ER7 A;  2FXT A;  3DGO A;  1TRQ A;  2Z76 A;  3DH2 A;  3FCS B;  4RZM A;  3BB9 A;  6GSP A;  5IEP A;  1X1Y A;  2SAR A;  4K1V A;  3LH4 A;  2BHM A;  3FH1 A;  4ZM8 A;  2XGL A;  1B2U A;  2KF6 A;  2OTL 3;  1LOY A;  3KZT A;  3T8U A;  3D3L A;  3A76 A;  1UI7 A;  2BMR B;  4KZ1 A;  1MWU A;  3AGN A;  4LSO A;  2O9U X;  5JBS A;  1OCV A;  3LTB A;  2C10 A;  1N9J A;  1D6Z A;  1AV4 A;  3EJV A;  3NXJ A;  3D4A A;  5ELJ A;  5IW9 A;  1GMQ A;  2R4I A;  1GY6 A;  1UCK A;  3X3X A;  3DGY A;  1M9G A;  1MWT A;  1TFO A;  3D5G A;  1LNH A;  4H61 A;  6STD A;  5IG3 A;  1IYY A;  2CFK A;  2FGT A;  1DMN A;  2K3D A;  4IIA A;  1I0V A;  2C4B A;  2W56 B;  1IK3 A;  3KII A;  1JB5 A;  3MPH A;  1X1X A;  1TRP A;  5A0O B;  2GU1 A;  1QAL A;  3ZFZ A;  1IV7 A;  1SII A;  1O7M B;  3LOY A;  1IDP A;  3BLZ A;  2WGO A;  2CFD A;  3K5T A;  3B4P A;  1LOX A;  2IUJ A;  1BAN A;  2CFG A;  2W56 A;  2JQ5 A;  2UGI A;  3CCM 3;  2GU3 A;  3EC9 A;  2W04 A;  2F5W A;  5RNT A;  1KC8 4;  1D6Y A;  3CC7 3;  3BIR A;  1RKY A;  4O3V A;  1VQN 3;  3NBB A;  1QVF 2;  4J9A A;  3B7C A;  1OAC A;  3WOD G;  1RGL A;  1RGK A;  3SOA A;  3CCS 3;  3OXA A;  5KP4 A;  4GL6 A;  1UUV B;  3B4O A;  2R41 A;  1S72 3;  4K90 B;  3F7S A;  3LTA A;  2P0M A;  5DRV A;  4GB5 A;  1BRI A;  3EF8 A;  2CG0 A;  5CLK A;  2ML6 A;  3V98 A;  5D82 A;  1JZD A;  1W6C A;  1G96 A;  3S5C A;  4LMI A;  3WDG B;  5KP1 A;  1YJW 3;  1UCL A;  3LZA A;  4L7K A;  2MF7 A;  3URP A;  3D79 A;  3JVC A;  4J5K A;  1S5A A;  4KVH A;  3CCU 3;  3STD A;  3EE1 A;  3SVA A;  3A5E A;  3UNL A;  1B27 A;  3PGB A;  2PZV A;  1BSA A;  1RJO A;  5BIR A;  1M90 4;  2CK3 H;  3GZB A;  5EQL A;  4HM5 B;  9RNT A;  1BNG A;  1T3B A;  1TIJ A;  3F40 A;  1FGM A;  3Q1C A;  1SIH A;  1LQM B;  1YVB I;  2UUG C;  4EC6 A;  2BMQ B;  1V74 A;  1DMM A;  4N6O B;  2FNQ A;  4HM1 B;  1IVX A;  1RDS A;  4OK0 A;  1GY5 A;  3PCR A;  1I2F A;  2BU4 A;  1N5P A;  3FLJ A;  2H0I A;  1Q9E A;  4HVN A;  1QAF A;  3BU4 A;  3EBT A;  4O2H A;  2CG1 A;  2XGN A;  3FZW A;  1SQW A;  3G16 A;  1FW7 A;  2OOV C;  3K0Z A;  3HI7 A;  1STF I;  1VQP 3;  1CH0 A;  1STD A;  2RBI A;  2W9P A;  1TP6 A;  1B21 A;  1UW1 A;  3F8H A;  3F8X A;  2XR8 B;  3Q2P A;  3SLU A;  1NWW A;  1ROV A;  1I2E A;  5DRE A;  1SJW A;  4HM0 B;  1AVL A;  2KRT A;  5CF2 A;  1A2V A;  3MWZ A;  1BUQ A;  3O8Y A;  4WP5 A;  5IG5 A;  1ULJ B;  1HZ1 A;  4R1K A;  1NDO B;  1A90 A;  3RGR A;  4KFE A;  2CH9 A;  1VQ8 3;  3V92 A;  1J2B A;  1AY7 A;  4CCV A;  2BNG A;  3CC2 3;  3UJM A;  3HX8 A;  3SED A;  4BTY A;  5FW5 A;  1PY3 A;  1WMO A;  2BIR A;  1RNT A;  1X1W A;  1RTU A;  2XRX B;  2CKF B;  1K41 A;  3AHS A;  3H3H A;  3MKI A;  3BNE A;  2GBW B;  3EQQ B;  1W2B 2;  1Q82 4;  1C7H A;  3PYJ A;  2YFI B;  2WGQ A;  4R9K A;  3G71 3;  2GEX A;  2Z6B A;  1NB3 I;  4R4K A;  2GEY A;  5LC7 A;  3HK4 A;  1BNS A;  3PZW A;  1WTH A;  2WOH A;  1EKM A;  2F99 A;  1BRS A;  1TUH A;  4HKV B;  2W9Q A;  3V99 A;  1M1X B;  1E3V A;  2YFL B;  5CF1 A;  3KSE D;  1RN1 A;  3DXO A;  3WA2 X;  5I97 A;  1RN4 A;  1B20 A;  2Z7A A;  4L8O A;  4X2H A;  4WHA A;  2W0Q A;  2STD A;  5BXQ A;  1PU4 A;  1ROA A;  1YHQ 3;  2O3O A;  3CCQ 3;  3Q90 A;  4RBN A;  1UDI I;  3ROB A;  2GSP A;  3BNB A;  1US1 A;  1AQZ A;  3OWY A;  2CW9 A;  3MG1 A;  3MSO A;  4N6L A;  1B2X A;  2UX0 A;  1VQ9 3;  3NM7 A;  1GY7 A;  1RGF A;  4RNT A;  1E97 A;  3NV0 B;  3OWS A;  5M1A A;  4XBY A;  3N8B A;  4BTX A;  2P0X A;  4Q53 A;  1DMQ A;  1Q7Y 4;  5G1L A;  1HKX A;  1W01 A;  4FMA A;  3I55 3;  4O02 B;  3CPW 2;  2OCT A;  1MGR A;  1PYL A;  2QEX 3;  1Y4K A;  4OVM A;  4HM8 B;  3DUK A;  2QIY A;  1LNI A;  1RGE A;  1YGW A;  1NNV A;  3AGO A;  5G1K A;  4EBG A;  2CFW A;  1A2P A;  3NV0 A;  1UGH I;  1K73 4;  3Q3F A;  1BSC A;  3VGN A;  1ZS7 A;  1BNF A;  1KD1 4;  1MWS A;  1IVW A;  2P09 A;  3S29 A;  2AAD A;  1T2H A;  1DET A;  1BSD A;  3AMO B;  6RNT A;  3CMA 3;  1UI8 A;  1QVG 2;  2ZL8 A; 
#chains in the Genus database with same CATH homology
 1Q81 4;  4EV5 A;  1FGQ A;  5CXO A;  1FGR A;  4KFF A;  4HM7 B;  3GAX A;  4N3V A;  3OW2 2;  1T5Y A;  2M7O A;  2BMO B;  4WYK B;  2W2C A;  1VQ6 3;  3AMO A;  5STD A;  1VQ5 3;  1YIT 3;  3IPT A;  3NQZ A;  1SPU A;  1CEW I;  3FKA A;  3KFQ C;  3QRD A;  1O7N B;  3S67 A;  1K9M 4;  3KE7 A;  1GS3 A;  2WO0 A;  3CME 3;  3NBR A;  4WYK A;  4HM2 B;  4FMC A;  1A2K A;  3CNX A;  3K7C A;  3SX1 A;  3HIG A;  4IPB A;  1WNH A;  4LZI A;  3FGY A;  1Z1S A;  4MMX B;  3SXX A;  2GBX B;  4N6N B;  1R4C A;  1O7P B;  2BO9 B;  4R80 A;  1KQS 2;  1ZO2 A;  3BND A;  3CCL 3;  3CCR 3;  1TU5 A;  4WWU C;  3MHE A;  4HBR A;  1FUW A;  2K54 A;  5JPP A;  4JF8 A;  1QAK A;  2HMN B;  1DVD A;  4OUQ A;  1VQM 3;  3CNM A;  2P05 A;  3GWR A;  2ML5 A;  1OHS A;  1YJN 3;  1OF5 B;  1PFP A;  1Q86 4;  2XH9 A;  2LYX A;  1RN7 A;  1JRQ A;  3LTD A;  1ISK A;  3NBJ A;  5AYS C;  1K28 A;  1N8R 4;  1JV2 B;  1OH0 A;  3FSD A;  5ELU A;  1MOL A;  3L0R A;  3PCS A;  3JUM A;  4XBT A;  3LTC A;  3X3Z A;  1DVC A;  2Z77 A;  1OHP A;  4HM3 B;  3JUN A;  2OWP A;  3UB1 A;  4QWT A;  2OTJ 3;  2HMJ B;  3H51 A;  1OF5 A;  2IA7 A;  2IUK A;  2Y74 A;  2CWT A;  1W6Y A;  2ZDJ A;  3IJE B;  4G1M B;  5AII A;  2INX A;  2RGQ A;  3MG3 A;  3WOF B;  2PNC A;  3I56 3;  1EA2 A;  4N6T A;  8CHO A;  3EBY A;  3G0K A;  3KKG A;  2KCD A;  1EQK A;  3UL6 A;  2Q07 A;  4RNZ A;  1EG9 B;  1WMP A;  3JUQ A;  3N9H A;  2BT3 A;  3G8Z A;  1IQ8 A;  1FGT A;  2HMM B;  3GZX B;  3ECF A;  4XDW A;  1WQL B;  3J7Y d;  4R9L A;  3G4S 3;  3NUV A;  1A67 A;  3LT9 A;  1GD3 A;  1KSI A;  3HII A;  4J8T A;  4TX4 A;  3VSY A;  1QJG A;  4MMZ B;  1ZX2 A;  1RRH A;  1E3R A;  3PXM A;  2QGU A;  3OV4 A;  1U8C B;  4BTW A;  2XSO B;  3F9S A;  3IMA B;  4RNY A;  1JJ2 2;  1UUW B;  1W02 A;  1OGX A;  1O7W B;  1Q40 B;  1YGE A;  4HJL B;  1IT7 A;  3B8L A;  5IF6 A;  4AEQ A;  4EYC A;  3LML A;  1CYU A;  1CYV A;  1UI8 A;  3FF2 A;  2A15 A;  2F86 B;  5KP3 A;  3F7X A;  1GYB A;  1IQX A;  4FCJ A;  3RGA A;  3DMC A;  1TFK A;  2GXF A;  5IEO A;  3CC4 3;  3DM8 A;  4XB5 A;  7STD A;  4N6V 0;  3CU3 A;  1Q40 A;  3BNC A;  5EEO A;  3G6E 3;  2F98 A;  4XM4 A;  1AR0 A;  1OPY A;  3WA3 A;  1O7G B;  3GZY B;  3CXC 2;  5AIF A;  4U13 A;  1N8Q A;  3D9R A;  3RDE A;  5BVB A;  5IG4 A;  2OQE A;  2CFL A;  4LGQ A;  1W6G A;  4FMB A;  1GD4 A;  3EB8 A;  3GRD A;  3E99 A;  1JNQ A;  3N54 B;  2XF3 A;  1F8N A;  3CCJ 3;  3OX9 A;  1HU9 A;  3EHC A;  3I0Y A;  4I4K A;  4JRF A;  1YIJ 3;  1IVV A;  3QK9 A;  4HZB B;  3NQY A;  2CC3 A;  5AI1 A;  1JB2 A;  3NM2 A;  3S27 A;  3JUP A;  3S28 A;  3EN1 B;  3K9M C;  2XFS A;  4HYZ A;  1W5Z A;  3LYG A;  3EN8 A;  4CDL A;  2B1X B;  2D42 A;  3T0U A;  1FGO A;  1AVK A;  2Y73 A;  1O7H B;  4HM6 B;  3X40 A;  4MJD A;  3DGN A;  2KXG A;  4FCM A;  5IER A;  1VQ7 3;  1OUN A;  3LXU X;  3LT8 A;  3T8N A;  1NU3 A;  5AEU B;  3MG2 A;  2E2V A;  2E2T A;  1OHO A;  2RFR A;  2E2U A;  4EXR A;  3KN4 A;  1YJ9 3;  2L4V A;  3WMD A;  3F14 A;  3DZL A;  1FA3 A;  2YX9 A;  5AIH A;  2HML B;  2XSH B;  2HMK B;  3DY5 A;  4MMY B;  2XEP A;  2LQV A;  1JN5 B;  2WOF A;  2QA4 3;  3CPO A;  3DGM A;  2CHC A;  4K1U A;  2P38 A;  3X41 A;  4LEH A;  4O8S A;  4FCZ A;  4X2O A;  2XFT A;  5FGO A;  3U1W A;  1VQK 3;  1KWI A;  4IT7 A;  1IQY A;  4FR9 A;  1L5G B;  1JN5 A;  4WFO A;  2CIU A;  4AKZ A;  4XDV A;  3OWU A;  3M8C A;  4L8P A;  2RCD A;  3MYT A;  3VF1 A;  3FG3 A;  3CCE 3;  2YFJ B;  1OGZ A;  1NJI 4;  1Q42 A;  5IG0 A;  1LXE A;  2CWU A;  1W4N A;  5AIG A;  5TGN A;  3CD6 3;  4N6M A;  1M1K 4;  1IVU A;  1NB5 I;  2W03 A;  5EVH A;  3UL5 A;  4KFD A;  2SBL A;  4PEJ A;  3ALA A;  5AEW B;  1VQ4 3;  5D81 A;  2JDI H;  2IMJ A;  4AKY A;  1VZZ A;  4XBX A;  3TDG A;  3X42 A;  2W6J H;  4HM4 B;  1ASK A;  1D6U A;  1W00 A;  4NRE A;  5AYR B;  1WMN A;  3EX9 A;  3KSP A;  2OOV A;  1YI2 3;  1K8A 4;  4STD A;  3U97 A;  2D1W A;  3FG1 A;  3K63 A;  4HZ9 B;  5CK6 A;  5LC6 A;  1IU7 A;  1DYU A;  1NO3 A;  2I9W A;  3CCV 3;  5D83 A;  4EV2 A;  3FF0 A;  5JPU A;  5HGR A;  1N9E A;  3PS8 A;  3NHX A;  1JKG B;  1VQL 3;  2CWV A;  4MEI A;  1RRL A;  1W7C A;  1JB4 A;  3X3Y A;  2RSX A;  1IT8 A;  2OQE C;  3GZR A;  4NHF A;  1ULI B;  1IV9 A;  3DGL A;  3NX0 A;  1CQS A;  1VQO 3;  1U5O A;  5G2G A;  2K0M A;  1QMA A;  2C11 A;  3FG4 A;  4K61 A;  1JKG A;  1N5H A;  2MC8 A;  3SOY A;  5IEN A;  4ORL A;  1LVN A;  3WOE B;  2B24 B;  4N6U A;  3JUO A;  1W2Z A;  4H3U A;  1MNL A;  4FMD A;  2V1L A;  3HZP A;  3ER7 A;  2FXT A;  3DGO A;  2Z76 A;  3FCS B;  4RZM A;  3BB9 A;  5IEP A;  4K1V A;  3LH4 A;  2BHM A;  3FH1 A;  4ZM8 A;  2XGL A;  2OTL 3;  3KZT A;  3T8U A;  3D3L A;  3A76 A;  1UI7 A;  2BMR B;  4KZ1 A;  4LSO A;  2O9U X;  5JBS A;  1OCV A;  3LTB A;  2C10 A;  1N9J A;  1D6Z A;  1AV4 A;  3EJV A;  3NXJ A;  5IW9 A;  5ELJ A;  2R4I A;  1GY6 A;  3X3X A;  1M9G A;  1TFO A;  5IG3 A;  4H61 A;  1LNH A;  6STD A;  2CFK A;  2FGT A;  1DMN A;  4IIA A;  1IK3 A;  2W56 B;  3KII A;  1JB5 A;  3MPH A;  5A0O B;  2GU1 A;  1QAL A;  1IV7 A;  1SII A;  1O7M B;  3LOY A;  1IDP A;  3BLZ A;  2WGO A;  2CFD A;  3K5T A;  3B4P A;  1LOX A;  2IUJ A;  2CFG A;  2W56 A;  2JQ5 A;  3CCM 3;  2GU3 A;  3EC9 A;  2W04 A;  1KC8 4;  1D6Y A;  3CC7 3;  1RKY A;  4O3V A;  1VQN 3;  3NBB A;  1QVF 2;  4J9A A;  3B7C A;  1OAC A;  3WOD G;  3SOA A;  3CCS 3;  3OXA A;  5KP4 A;  4GL6 A;  1UUV B;  3B4O A;  1S72 3;  4K90 B;  3F7S A;  3LTA A;  2P0M A;  5DRV A;  4GB5 A;  3EF8 A;  2CG0 A;  5CLK A;  2ML6 A;  3V98 A;  5D82 A;  1W6C A;  1YJW 3;  1G96 A;  3S5C A;  4LMI A;  3WDG B;  5KP1 A;  3LZA A;  4L7K A;  2MF7 A;  3JVC A;  1S5A A;  4KVH A;  3CCU 3;  3STD A;  3EE1 A;  3SVA A;  3UNL A;  3PGB A;  2PZV A;  1RJO A;  1M90 4;  2CK3 H;  3GZB A;  5EQL A;  4HM5 B;  1TIJ A;  3F40 A;  1FGM A;  3Q1C A;  1SIH A;  1YVB I;  4EC6 A;  2BMQ B;  1V74 A;  1DMM A;  4N6O B;  2FNQ A;  4HM1 B;  1IVX A;  4OK0 A;  1GY5 A;  3PCR A;  3FLJ A;  1N5P A;  4HVN A;  1QAF A;  3EBT A;  4O2H A;  2CG1 A;  2XGN A;  3FZW A;  1SQW A;  3G16 A;  2OOV C;  3K0Z A;  3HI7 A;  1STF I;  1VQP 3;  1STD A;  2W9P A;  1TP6 A;  1UW1 A;  3F8H A;  3F8X A;  2XR8 B;  3Q2P A;  3SLU A;  1NWW A;  1ROV A;  5DRE A;  1SJW A;  4HM0 B;  1AVL A;  2KRT A;  5CF2 A;  1A2V A;  3MWZ A;  1BUQ A;  3O8Y A;  4WP5 A;  5IG5 A;  1ULJ B;  4R1K A;  1NDO B;  1A90 A;  3RGR A;  4KFE A;  2CH9 A;  1VQ8 3;  3V92 A;  1J2B A;  4CCV A;  2BNG A;  3CC2 3;  3UJM A;  3HX8 A;  3SED A;  4BTY A;  5FW5 A;  1WMO A;  2XRX B;  2CKF B;  1K41 A;  3H3H A;  3MKI A;  3BNE A;  2GBW B;  3EQQ B;  1W2B 2;  1Q82 4;  1C7H A;  3PYJ A;  2YFI B;  2WGQ A;  4R9K A;  3G71 3;  2GEX A;  2Z6B A;  1NB3 I;  4R4K A;  2GEY A;  5LC7 A;  3HK4 A;  3PZW A;  1WTH A;  2WOH A;  1EKM A;  2F99 A;  1TUH A;  4HKV B;  2W9Q A;  3V99 A;  1M1X B;  1E3V A;  2YFL B;  5CF1 A;  3KSE D;  3DXO A;  3WA2 X;  5I97 A;  2Z7A A;  4X2H A;  4L8O A;  4WHA A;  2W0Q A;  2STD A;  5BXQ A;  1PU4 A;  1ROA A;  1YHQ 3;  2O3O A;  3CCQ 3;  3Q90 A;  4RBN A;  3ROB A;  3BNB A;  3OWY A;  1US1 A;  2CW9 A;  3MG1 A;  3MSO A;  4N6L A;  2UX0 A;  1VQ9 3;  3NM7 A;  1GY7 A;  1E97 A;  3NV0 B;  3OWS A;  4XBY A;  3N8B A;  4BTX A;  2P0X A;  4Q53 A;  1DMQ A;  1Q7Y 4;  3I55 3;  1HKX A;  1W01 A;  4FMA A;  4O02 B;  3CPW 2;  2OCT A;  2QEX 3;  1Y4K A;  4OVM A;  4HM8 B;  3DUK A;  2QIY A;  4EBG A;  2CFW A;  3NV0 A;  1K73 4;  3VGN A;  1KD1 4;  3S29 A;  1IVW A;  2P09 A;  3AMO B;  3CMA 3;  2HMO B;  1QVG 2;  2ZL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...