1OCVA

The f116w mutant structure of ketosteroid isomerase from comamonas testosteroni
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALWGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Origin of the Different Ph Activity Profile in Two Homologous Ketosteroid Isomerases
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Ketosteroid isomerase
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ocvA00
1O7GB 2PZVA 5IG0A 3DM8A 1JN5B 3EBYA 3K0ZA 3OWYA 3G8ZA 1STDA 3MSOA 4HKVB 1GS3A 5DREA 2F99A 2IMJA 1O7WB 4IIAA 3EHCA 4HM6B 4R9LA 3MG3A 4WP5A 2HMJB 2INXA 5KP3A 3EC9A 3OXAA 3MKIA 4HM4B 1O7NB 5CXOA 1K41A 1AR0A 2HMLB 2HMKB 1C7HA 1UUVB 2STDA 3B4OA 3KKGA 1TP6A 3EN1B 3DXOA 1SJWA 3FSDA 1JKGA 1A2KA 5TGNA 3LZAA 4XDWA 1UUWB 3BLZA 3M8CA 3EQQB 5AIFA 2I9WA 4HZ9B 1BUQA 3FF2A 1JN5A 2BMOB 3CNMA 3IPTA 4X2OA 4HZBB 2BNGA 4FCJA 5BVBA 3ROBA 3B8LA 2HMNB 4XM4A 3VSYA 4L8PA 2JQ5A 1DMQA 3Q90A 4WYKB 5JPUA 3K7CA 1OHSA 3JUQA 2A15A 3DMCA 5STDA 2CKFB 5EVHA 3MHEA 1VZZA 3FKAA 4MJDA 4XB5A 2B1XB 1O7MB 4LMIA 1O7PB 1OH0A 3VGNA 3HK4A 4WWUC 3JUMA 3HZPA 2OWPA 2F86B 1EG9B 3GZYB 3ER7A 3MG1A 4HM3B 3GRDA 1U5OA 4STDA 3EBTA 3RGAA 2GXFA 3CNXA 2QIYA 3STDA 1CQSA 4K1UA 4HM8B 1GY5A 1OF5B 3GZXB 4XDVA 3FH1A 2R4IA 3ECFA 3H51A 4R9KA 5AIHA 4WYKA 3EJVA 3F40A 3KE7A 1DMMA 4H3UA 1NU3A 1OGXA 4HM5B 3JUOA 3F8HA 1IDPA 3UNLA 4R1KA 2HMMB 3EF8A 3FGYA 2XRXB 6STDA 3FF0A 3F7SA 1ULIB 3G16A 1JB2A 1QJGA 1ZO2A 1GY7A 3FLJA 2XR8B 1GYBA 3CPOA 7STDA 4HM0B 2F98A 3T8NA 5CK6A 3S5CA 2QGUA 1OHOA 8CHOA 1ULJB 1NWWA 1ZX2A 4HM2B 1DMNA 5AEWB 4LEHA 3MYTA 5IG4A 1GY6A 4XBYA 1W00A 3GZBA 1OF5A 1ASKA 3F14A 3KZTA 1OCVA 1Q40B 3MG2A 3F9SA 5D83A 4X2HA 4HVNA 3CU3A 3T8UA 1Z1SA 3OWUA 3EN8A 4L7KA 3SEDA 1WQLB 4I4KA 5CF2A 4N3VA 5KP1A 1W02A 3FZWA 3DUKA 4PEJA 4GB5A 5AIGA 2W2CA 3JUPA 4KVHA 3KSPA 1TUHA 5HGRA 4XBTA 3B4PA 5IERA 3DZLA 5D81A 2YFIB 5IG5A 5CF1A 4OVMA 4LGQA 1QMAA 3E99A 3NXJA 5KP4A 2XSHB 3NV0B 4U13A 2RGQA 2GEYA 4HJLB 2GBXB 5IEOA 3NM2A 1HKXA 2GBWB 3G0KA 4K1VA 1JB4A 5AI1A 1NDOB 3RGRA 3OWSA 1Q40A 3B7CA 4RZMA 2XSOB 5G2GA 3NHXA 1OPYA 2UX0A 1W6YA 5CLKA 5IEPA 1W01A 4XBXA 4OUQA 3OV4A 2RCDA 3NBRA 3F8XA 3H3HA 1Q42A 1EA2A 5IG3A 1JB5A 4Q53A 5JPPA 3F7XA 2YFJB 4FCMA 4HM7B 5IENA 2CHCA 3OX9A 1S5AA 3NV0A 3EX9A 2GEXA 2HMOB 3GWRA 3SOAA 3LYGA 1E3VA 5BXQA 2B24B 3JUNA 1O7HB 3WMDA 4J9AA 3GZRA 2K54A 5DRVA 2Z7AA 3A76A 5IF6A 3UJMA 4J8TA 5FW5A 5D82A 2Z77A 2Z76A 4CDLA 1OUNA 2BMQB 1E3RA 2RFRA 3SOYA 1JKGB 3HX8A 2BMRB 5AEUB 2YFLB 4ORLA 1OGZA 4L8OA 3D9RA 3I0YA 3BB9A 3NUVA 1E97A 5AIIA 4HM1B 1OHPA 1ISKA
chains in the Genus database with same CATH superfamily
5M18A 1O7GB 2KF4A 2PZVA 5IG0A 1YIT3 3DM8A 2CFGA 4RNZA 1JN5B 1ZS7A 3Q3FA 2W0QA 3EBYA 3K0ZA 3X3YA 4EW5A 1JJ22 3OWYA 2CFLA 1GD4A 3O8YA 4N6V0 1IQYA 3NQYA 3G8ZA 1BSBA 1RGEA 3HI7A 1TRQA 1IYYA 3U1WA 1STDA 3MSOA 1BSDA 1RGLA 1JZOA 2WGOA 4HKVB 1GS3A 4MEIA 1ROAA 5DREA 1X1WA 2CIUA 3G4S3 3SVAA 2F99A 2IMJA 3VF1A 1BVIA 1O7WB 2CK3H 2OTL3 4IIAA 4AKYA 3EHCA 3MWZA 4HM6B 4KFFA 4R9LA 3NX0A 4O3VA 3MG3A 4KT3B 4WP5A 3NM7A 1PU4A 3UL5A 2P38A 2ZDJA 3BU4A 2HMJB 2INXA 2CG0A 5KP3A 3EC9A 1JRQA 5G1KA 1TJDA 4EC6A 4HBRA 3OXAA 3LMLA 1RHLA 2MF7A 3X41A 4KZ1A 3L0RA 1BNEA 1I2EA 1W2ZA 2OCTA 1O7NB 3BNEA 3MKIA 4HM4B 5CXOA 1PFPA 1K41A 1AR0A 1A2VA 2HMLB 4K61A 4EXRA 2HMKB 1RNBA 1C7HA 1UUVB 2STDA 3B4OA 3KKGA 5ELUA 3CCL3 1QALA 2MC8A 3URPA 1IVXA 2WO0A 1TP6A 4GSPA 3EN1B 3DXOA 2OOVA 1SJWA 3FSDA 1JKGA 2Q07A 1WMNA 3U97A 4BIRA 1FGRA 1L5GB 1SQWA 3EB8A 4I5QA 5ELJA 1B27A 3WR2A 1RGGA 2YX9A 1A2KA 3D4AA 3AMOB 3NBBA 1I2GA 5TGNA 5BU4A 2BHMA 3LZAA 4XDWA 1M1K4 1N5HA 3S29A 2FXTA 2Y74A 3HOHA 5M1AA 1UUWB 1SARA 1BRGA 1VQK3 3SYUA 1OACA 1J2BA 3BLZA 1FUWA 3M8CA 4N6MA 1A67A 3CC73 3EQQB 2OTJ3 1BNGA 1BNSA 1V57A 1RCKA 5AIFA 3A5EA 2I9WA 4HZ9B 3DGOA 3UB1A 3MPHA 5M19A 3CXC2 1BUQA 2O3OA 3FF2A 1WTHA 1A90A 1W2B2 1JN5A 2ML6A 3LTCA 4HYZA 2OQEA 3V99A 4CCVA 1KC84 3T0UA 2BMOB 3CNMA 1YHQ3 4NPBA 2AADA 3IPTA 4X2OA 2K0MA 3PGBA 3BIRA 3CMA3 3PZWA 1BGSA 4EV5A 5IW9A 4HZBB 2BNGA 4FCJA 3CD63 1NO3A 2E2VA 2C4BA 3BNBA 1BSEA 1B2MA 3UL6A 5BVBA 3ROBA 1B20A 2RBIA 4J5KA 1HU9A 4QWTA 1B2UA 1JV2B 2XH9A 4JRFA 2CG1A 1Q864 3HIGA 2P09A 3B8LA 1HZ1A 4O2HA 4EYCA 3FG3A 3Q1CA 2IA7A 2CWUA 2FGTA 2HMNB 1Q9EA 1V58A 1W6GA 1YGEA 2GU3A 1MWRA 4JF8A 4L8PA 4XM4A 5AYSC 3VSYA 3ZFZA 5GSPA 1DVDA 2JQ5A 1D6UA 1DMQA 3Q90A 1RN1A 4WYKB 5JPUA 3G6E3 3K7CA 1OHSA 3KSED 1YNVX 2D42A 5A0OB 2CFWA 2KCDA 3JUQA 1FW7A 2A15A 3D3LA 2W03A 4BL2A 3DMCA 3CC43 5STDA 2CKFB 5FGOA 1KQS2 1RGKA 1RRHA 3CCJ3 4GL6A 5EVHA 3MHEA 1VZZA 3FKAA 1TRPA 1UDII 2BO9B 4MJDA 4XB5A 2B1XB 1T2HA 1KD14 1O7MB 2H0IA 4LMIA 3NBJA 1DYUA 1O7PB 1OH0A 2CC3A 1R4YA 5HOHA 1KWIA 2W9QA 3VGNA 3HK4A 3CME3 3AMOA 1I2FA 3N9HA 1LQMB 4WWUC 3GSPA 2J8XB 1FUSA 3JUMA 3HZPA 4TX4A 1QVG2 1BNRA 2OWPA 1KSIA 4R4KA 1IU7A 2F86B 1EG9B 3PS8A 3D5GA 1Q814 1U8CB 2H0GA 3GZYB 3S27A 5JBSA 2RSXA 3ER7A 2CWTA 1RKYA 1N8R4 1BRIA 3MG1A 4HM3B 1VQ53 2CW9A 1BNFA 3GRDA 1AVLA 1JZDA 1U5OA 4CPKA 2F5WA 4STDA 2JDIH 2KRTA 4DKIA 2P0XA 1TFKA 3EBTA 1MWTA 1N9EA 2GXFA 3RGAA 1G0TA 1FGMA 3CC23 3X3XA 1RGHA 3CNXA 3IMAB 2QIYA 2W9PA 3V98A 3V92A 3STDA 1CQSA 4K1UA 6RNTA 1UCLA 1NB3I 2KF5A 4HM8B 1BRJA 1RCLA 1IQ8A 2F5MA 3WDGB 1GY5A 2WGQA 4BTWA 3DGYA 4IPBA 3J7Yd 4N6OB 1N9JA 3LXUX 1YJ93 2D1WA 1GMPA 1OF5B 2C10A 2IUKA 1FYSA 1LVNA 1MOLA 3EE1A 3GZXB 3LTDA 1YVBI 2BT3A 4WFOA 4XDVA 1RJOA 3GAXA 2IY2A 3FH1A 2R41A 2R4IA 3ECFA 3H51A 3S67A 1UCKA 4R9KA 3CCS3 1VQ43 5AIHA 4WYKA 3EJVA 4MMXB 3F40A 3KE7A 3K63A 1DMMA 4H3UA 1RGCA 1NU3A 3KCHA 1VQ63 1B2SA 1OGXA 3Q2PA 3D5IA 1HYFA 1WMPA 2CFKA 4HM5B 3WHOA 1TFOA 3JUOA 1EQKA 1I3FA 3F8HA 2W56B 4FMDA 1IDPA 3G713 3UNLA 1SIHA 2E2UA 4R1KA 1JNQA 2HMMB 1US1A 1IVUA 3BNDA 3EF8A 3FGYA 1GSPA 1UCIA 2XRXB 1I3IA 2FNQA 3SLUA 6STDA 1FGOA 1SPUA 3LT8A 1EUIC 3FF0A 4N6UA 1YVSA 1K9M4 3F7SA 1W6CA 3QK9A 2Y73A 1I0XA 1ULIB 3JVCA 3G16A 1CEWI 1FGQA 1QJGA 1ZO2A 1JB2A 1LOYA 1GY7A 1GYBA 2XR8B 3AGNA 3CPOA 3FLJA 7RNTA 1BNJA 4HM0B 2F98A 3T8NA 5CK6A 1AV4A 3S5CA 3PCRA 3RNTA 1K734 1RLSA 2K3DA 5LC7A 1VQL3 1C54A 3CCM3 2QGUA 1LRAA 1K28A 3DY5A 1OHOA 8CHOA 1BNIA 1ULJB 1NWWA 7STDA 3K9MC 1GMQA 4EBGA 1STFI 1UCJA 1Q824 2UGIA 1FGTA 1ZX2A 2V1LA 1FUTA 1VQ93 4BTXA 4HM2B 1DMNA 1B3SA 4LZIA 3RDEA 4CJNA 5AEWB 3I553 5G1LA 4LEHA 3MYTA 4N6LA 5IG4A 1VQM3 1GY6A 1DVCA 1UI8A 4XBYA 2IYJA 1W00A 1IQXA 1Q7HA 3GZBA 3CCU3 2ZHXB 1VQQA 3CCV3 1OF5A 1ASKA 1JBRA 1CYVA 3F14A 1T2IA 3KZTA 1AVKA 1OCVA 1Q40B 3MG2A 3F9SA 3TDGA 3I563 1MNLA 1RN4A 5D83A 4X2HA 4HVNA 1M9GA 3CU3A 4LYLB 2XFTA 3T8UA 1GOVA 1Z1SA 3OW22 3OWUA 1IV7A 1MGRA 2BU4A 5I97A 1RSNA 1W7CA 3EN8A 4L7KA 1LXEA 3SEDA 1IT8A 1PY3A 1WQLB 4I4KA 4RBNA 4OK0A 2F4YA 1BSAA 5CF2A 4N3VA 1VQP3 4HAAA 4NREA 5KP1A 1W02A 2W56A 1CYUA 3FZWA 1YJW3 4ILFA 1BRHA 4FCZA 3DUKA 1NNVA 1T3BA 3QRDA 1ROVA 4PEJA 2KXGA 1QVF2 4GB5A 1F8NA 3HIIA 3DGMA 1X1UA 5AIGA 1G96A 1B2ZA 1SIIA 2CH9A 2W2CA 3JUPA 4KVHA 3KSPA 1TUHA 2CWVA 1RN7A 5HGRA 1RTUA 1M1XB 1UUGB 2IUJA 3CCQ3 4XBTA 3B4PA 5IERA 3PYJA 3DZLA 1FA3A 2KF3A 5D81A 4BTYA 3AHWA 2YFIB 2L1SA 2SBLA 3CCR3 1UI7A 1EEJA 1BAOA 5IG5A 1IV9A 2XGNA 4AEQA 2SARA 3PXMA 3ZG0A 2AAEA 2KF6A 1DETA 3AHSA 5CF1A 9RNTA 2W04A 3DGLA 2UUGC 3CCE3 1BUJA 1AQZA 4OVMA 4LGQA 3WA3A 4BU4A 3LH4A 1BU4A 3DH2A 1AY7A 1QMAA 4K90B 4MMYB 1I8VA 3ALAA 3E99A 2H0HA 3NXJA 5KP4A 2XSHB 3NV0B 2PNCA 4U13A 2RGQA 1IT7A 1RGAA 2GEYA 4HJLB 2XGLA 2GBXB 5IEOA 2P05A 3NM2A 1HKXA 1RMSA 3WOEB 2GBWB 3LOYA 3LTAA 3G0KA 4K1VA 1JB4A 1S723 2ZA4A 1X1YA 2ML5A 2W6JH 5AI1A 1EKMA 1NDOB 4O8SA 3RGRA 3OWSA 5AYRB 1Q40A 1VQO3 3B7CA 4RNTA 2XSOB 4RZMA 5G2GA 1VQ83 3NHXA 3N8BA 2BIRA 1OPYA 4N6TA 5LC6A 1YJN3 4J5GA 2UX0A 1W6YA 3WA2X 3X3ZA 1UGIA 1VQ73 4KFEA 1RGFA 4AKZA 3FG1A 4WHAA 2OOVC 2KAAA 5CLKA 1W01A 1YGWA 1BSCA 4XBXA 4OUQA 3WODG 5IEPA 1BRKA 3OV4A 2WOFA 2RCDA 7GSPA 1LOWA 2CX0A 1LOXA 5RNTA 2P0MA 3NBRA 2LQVA 2LYXA 3F8XA 3H3HA 1I70A 1DE3A 1PYLA 1BIRA 1Q42A 1GMRA 4EV2A 1JBSA 3KN4A 1EA2A 1TIJA 5IG3A 3X40A 2OQEC 3CPW2 3DGNA 1Y4KA 1JB5A 1UW1A 4FMBA 3SX1A 4Q53A 1IK3A 2L4VA 4IT7A 6GSPA 5JPPA 3N54B 3F7XA 1QAFA 2C11A 1BRNL 3LT9A 2YFJB 4FCMA 5EEOA 4RNYA 2CX1A 4HM7B 5IENA 2CHCA 1R4CA 3SXXA 1D6ZA 4ZM8A 3OX9A 1LNIA 2GSPA 1S5AA 1MWSA 1GD3A 3NV0A 3EX9A 1B21A 2O9UX 1X1XA 1MWUA 1TU5A 1NJI4 1D6YA 2F56A 4KFDA 3BNCA 1W5ZA 2GEXA 3NQZA 1M904 2HMOB 1Q7Y4 3GWRA 1LQGC 4FR9A 3SOAA 2HOHA 3LTBA 2M7OA 3LYGA 4H61A 1YI23 3KFQC 1E3VA 2RNTA 3PCSA 1QAKA 3WOFB 2B24B 5BXQA 1GOYA 3JUNA 1ZGXA 1O7HB 1W4NA 1BRSA 3K5TA 3WMDA 1JBTA 4N6NB 1BANA 3X42A 3KIIA 1LOVA 4FMAA 1GOUA 1IVVA 3GZRA 1LNHA 2K54A 4J9AA 5EQLA 5DRVA 1YIJ3 2Z7AA 1VQN3 1MGWA 4NHFA 1N5PA 4HOHA 3A76A 4FMCA 2ZL8A 1I0VA 4R80A 8RNTA 1TTOA 5IF6A 1K8A4 1G02A 3UJMA 3S28A 1NB5I 2XFSA 1V74A 4J8TA 5FW5A 4O02B 5D82A 2Z77A 1WMOA 2Z76A 4CDLA 1OUNA 2BMQB 5BIRA 1E3RA 2RFRA 2XEPA 3AGOA 1RNTA 3SOYA 1JKGB 1N8QA 1FZUA 2Z6BA 1RDSA 2E2TA 3HX8A 3FG4A 1B2XA 4LSOA 1RRLA 4G1MB 1A2PA 2QEX3 2GU1A 2WOHA 2QA43 2BMRB 5AEUB 2YFLB 1WNHA 4ORLA 1OGZA 4L8OA 1IVWA 3D9RA 2XF3A 3I0YA 3ZG5A 1BOXA 3BB9A 3D79A 1E97A 3IJEB 3NUVA 4MMZB 4GHOA 4HM1B 1T5YA 1UGHI 3FCSB 5AIIA 4BL3A 1OHPA 1ISKA 2CFDA 1CH0A
chains in the Genus database with same CATH topology
1O7GB 1YIT3 2PZVA 5IG0A 3DM8A 2CFGA 4RNZA 1JN5B 2W0QA 3EBYA 3K0ZA 3X3YA 1JJ22 3OWYA 2CFLA 1GD4A 3O8YA 4N6V0 1IQYA 3NQYA 3G8ZA 3HI7A 3U1WA 1STDA 3MSOA 2WGOA 4HKVB 1GS3A 4MEIA 1ROAA 5DREA 3G4S3 2CIUA 3SVAA 2F99A 2IMJA 3VF1A 1O7WB 2CK3H 2OTL3 4IIAA 4AKYA 3EHCA 3MWZA 4HM6B 4KFFA 4R9LA 3NX0A 4O3VA 3MG3A 4WP5A 3NM7A 1PU4A 3UL5A 2P38A 2ZDJA 2HMJB 2INXA 2CG0A 5KP3A 3EC9A 1JRQA 4EC6A 4HBRA 3OXAA 3LMLA 3X41A 2MF7A 4KZ1A 3L0RA 1W2ZA 3MKIA 2OCTA 1O7NB 3BNEA 4HM4B 5CXOA 1PFPA 1K41A 1AR0A 1A2VA 2HMLB 4K61A 4EXRA 2HMKB 1C7HA 1UUVB 2STDA 3B4OA 3KKGA 5ELUA 3CCL3 1QALA 2MC8A 1IVXA 2WO0A 1TP6A 3EN1B 3DXOA 2OOVA 1SJWA 3FSDA 1JKGA 2Q07A 1WMNA 3U97A 1FGRA 1L5GB 1SQWA 3EB8A 5ELJA 2YX9A 1A2KA 3NBBA 3AMOB 5TGNA 2BHMA 3LZAA 4XDWA 1M1K4 1N5HA 3S29A 2FXTA 2Y74A 1UUWB 1VQK3 1OACA 1J2BA 3BLZA 1FUWA 3M8CA 4N6MA 1A67A 3CC73 3EQQB 2OTJ3 5AIFA 2I9WA 4HZ9B 3DGOA 3UB1A 3MPHA 3CXC2 1BUQA 2O3OA 3FF2A 1WTHA 1A90A 1W2B2 1JN5A 2ML6A 3LTCA 4HYZA 2OQEA 3V99A 4CCVA 1KC84 3T0UA 2BMOB 3CNMA 1YHQ3 3IPTA 4X2OA 2K0MA 3PGBA 3CMA3 3PZWA 5IW9A 4EV5A 4HZBB 2BNGA 4FCJA 3CD63 1NO3A 2E2VA 3BNBA 3UL6A 5BVBA 3ROBA 4QWTA 1HU9A 1JV2B 2XH9A 1Q864 4JRFA 2CG1A 3HIGA 2P09A 3B8LA 4O2HA 4EYCA 3FG3A 3Q1CA 2IA7A 2CWUA 2FGTA 2HMNB 1W6GA 4JF8A 1YGEA 2GU3A 4XM4A 3VSYA 4L8PA 5AYSC 2QA43 1DVDA 2JQ5A 1D6UA 1DMQA 3Q90A 4WYKB 5JPUA 3G6E3 3K7CA 1OHSA 3KSED 2D42A 5A0OB 2CFWA 2KCDA 3JUQA 2A15A 3D3LA 2W03A 3DMCA 3CC43 5STDA 2CKFB 5FGOA 1KQS2 1RRHA 3CCJ3 4GL6A 5EVHA 3MHEA 1VZZA 3FKAA 2BO9B 4MJDA 4XB5A 2B1XB 1KD14 1O7MB 4LMIA 3NBJA 1DYUA 1O7PB 1OH0A 2CC3A 1KWIA 2W9QA 3VGNA 3HK4A 3CME3 3AMOA 3N9HA 4WWUC 3JUMA 3HZPA 4TX4A 1QVG2 2OWPA 1KSIA 4R4KA 1IU7A 2F86B 1EG9B 1Q814 1U8CB 3GZYB 3S27A 1RKYA 5JBSA 2RSXA 3ER7A 2CWTA 1N8R4 3MG1A 4HM3B 1VQ53 2CW9A 3GRDA 1AVLA 1U5OA 4STDA 2JDIH 2KRTA 2P0XA 1TFKA 3EBTA 1N9EA 3RGAA 2GXFA 1FGMA 3CC23 3X3XA 3CNXA 3IMAB 2QIYA 2W9PA 3V98A 3V92A 3STDA 1CQSA 4K1UA 1NB3I 4HM8B 1IQ8A 3WDGB 1GY5A 2WGQA 4BTWA 4IPBA 3J7Yd 4N6OB 1N9JA 3LXUX 1YJ93 2D1WA 2C10A 1OF5B 2IUKA 1LVNA 1MOLA 3EE1A 3GZXB 3LTDA 1YVBI 2BT3A 4WFOA 4XDVA 1RJOA 3GAXA 3FH1A 2R4IA 3ECFA 3H51A 3S67A 3CCS3 4R9KA 1VQ43 5AIHA 4WYKA 3EJVA 4MMXB 3F40A 3KE7A 3K63A 1DMMA 4H3UA 1NU3A 1VQ63 1OGXA 3Q2PA 4HM5B 1WMPA 2CFKA 1TFOA 3JUOA 1EQKA 3F8HA 2W56B 4FMDA 1IDPA 3G713 3UNLA 1SIHA 2E2UA 4R1KA 1JNQA 2HMMB 1US1A 1IVUA 3BNDA 3EF8A 3FGYA 2XRXB 6STDA 2FNQA 3SLUA 1FGOA 1SPUA 3LT8A 3FF0A 4N6UA 1K9M4 3F7SA 1W6CA 3QK9A 2Y73A 1ULIB 3JVCA 3G16A 1CEWI 1FGQA 1QJGA 1ZO2A 1JB2A 1GY7A 2XR8B 1GYBA 3FLJA 3CPOA 3PS8A 7STDA 4HM0B 2F98A 3T8NA 5CK6A 1AV4A 3S5CA 3PCRA 1K734 5LC7A 1VQL3 3CCM3 2QGUA 1K28A 3DY5A 1OHOA 8CHOA 1ULJB 1NWWA 3K9MC 4EBGA 1STFI 1Q824 1VQ93 1FGTA 1ZX2A 2V1LA 4BTXA 4HM2B 1DMNA 4LZIA 3RDEA 5AEWB 3I553 4LEHA 3MYTA 4N6LA 5IG4A 1VQM3 1GY6A 1DVCA 1UI8A 4XBYA 1W00A 1IQXA 3GZBA 3CCU3 3CCV3 1OF5A 1ASKA 1CYVA 3F14A 3KZTA 1AVKA 1OCVA 1Q40B 3MG2A 3F9SA 3TDGA 3I563 1MNLA 5D83A 4X2HA 4HVNA 1M9GA 3CU3A 2XFTA 3T8UA 1Z1SA 3OW22 3OWUA 1IV7A 5I97A 1W7CA 3EN8A 4L7KA 1LXEA 3SEDA 1IT8A 1WQLB 4I4KA 4RBNA 4OK0A 5CF2A 4N3VA 1VQP3 5KP1A 4NREA 1W02A 2W56A 1CYUA 3FZWA 1YJW3 4FCZA 3DUKA 3QRDA 1ROVA 4PEJA 2KXGA 1QVF2 4GB5A 1F8NA 3HIIA 3DGMA 5AIGA 1G96A 1SIIA 2CH9A 2W2CA 3JUPA 4KVHA 3KSPA 1TUHA 2CWVA 1RN7A 5HGRA 1M1XB 2IUJA 3CCQ3 4XBTA 3B4PA 5IERA 3PYJA 3DZLA 1FA3A 5D81A 4BTYA 2YFIB 2SBLA 3CCR3 1UI7A 5IG5A 1IV9A 2XGNA 4AEQA 3PXMA 5CF1A 3CCE3 2W04A 3DGLA 4OVMA 4LGQA 3WA3A 3LH4A 1QMAA 4K90B 4MMYB 3ALAA 3E99A 3NXJA 5KP4A 2XSHB 3NV0B 2PNCA 4U13A 2RGQA 1IT7A 2GEYA 4HJLB 2XGLA 2GBXB 5IEOA 2P05A 3NM2A 1HKXA 3WOEB 2GBWB 3LOYA 3LTAA 3G0KA 4K1VA 1JB4A 1S723 2ML5A 2W6JH 5AI1A 1EKMA 1NDOB 4O8SA 3RGRA 3OWSA 5AYRB 1Q40A 1VQO3 3B7CA 2XSOB 4RZMA 5G2GA 1VQ83 3NHXA 3N8BA 4N6TA 1OPYA 1YJN3 5LC6A 3X3ZA 2UX0A 1W6YA 3WA2X 1VQ73 4KFEA 4AKZA 3FG1A 4WHAA 2OOVC 5CLKA 3WODG 1W01A 5IEPA 4XBXA 4OUQA 3OV4A 2WOFA 2RCDA 1LOXA 2P0MA 3NBRA 2LQVA 2LYXA 3F8XA 3H3HA 1Q42A 4EV2A 3KN4A 1EA2A 1TIJA 5IG3A 3X40A 2OQEC 3CPW2 3DGNA 1Y4KA 1JB5A 1UW1A 4FMBA 3SX1A 4Q53A 1IK3A 2L4VA 4IT7A 5JPPA 3N54B 3F7XA 1QAFA 2C11A 3LT9A 2YFJB 4FCMA 5EEOA 4RNYA 4HM7B 5IENA 2CHCA 1R4CA 3SXXA 1D6ZA 4ZM8A 3OX9A 1S5AA 1GD3A 3NV0A 3EX9A 2O9UX 1TU5A 1NJI4 1D6YA 4KFDA 3BNCA 1W5ZA 2GEXA 3NQZA 1M904 2HMOB 1Q7Y4 3GWRA 4FR9A 3SOAA 3LTBA 2M7OA 3LYGA 4H61A 1YI23 3KFQC 1E3VA 3PCSA 1QAKA 3WOFB 2B24B 5BXQA 3JUNA 1O7HB 1W4NA 3K5TA 3WMDA 4N6NB 3X42A 3KIIA 4FMAA 4J9AA 1IVVA 3GZRA 1LNHA 2K54A 5EQLA 5DRVA 1YIJ3 2Z7AA 1VQN3 4NHFA 1N5PA 3A76A 4FMCA 2ZL8A 4R80A 5IF6A 1K8A4 3UJMA 1NB5I 3S28A 2XFSA 1V74A 4J8TA 5FW5A 4O02B 5D82A 2Z77A 1WMOA 2Z76A 4CDLA 1OUNA 2BMQB 1E3RA 2RFRA 2XEPA 3SOYA 1JKGB 1N8QA 2Z6BA 2E2TA 3HX8A 3FG4A 4LSOA 1RRLA 4G1MB 2QEX3 2GU1A 2WOHA 2BMRB 5AEUB 2YFLB 1WNHA 4ORLA 1OGZA 4L8OA 1IVWA 3D9RA 2XF3A 3I0YA 3BB9A 3NUVA 4MMZB 1E97A 3IJEB 5AIIA 4HM1B 1T5YA 3FCSB 1OHPA 1ISKA 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7G B;  2PZV A;  5IG0 A;  3DM8 A;  1JN5 B;  3EBY A;  3K0Z A;  3OWY A;  3G8Z A;  1STD A;  3MSO A;  4HKV B;  1GS3 A;  5DRE A;  2F99 A;  2IMJ A;  1O7W B;  4IIA A;  3EHC A;  4HM6 B;  4R9L A;  3MG3 A;  4WP5 A;  2HMJ B;  2INX A;  5KP3 A;  3EC9 A;  3OXA A;  3MKI A;  4HM4 B;  1O7N B;  5CXO A;  1K41 A;  1AR0 A;  2HML B;  2HMK B;  1C7H A;  1UUV B;  2STD A;  3B4O A;  3KKG A;  1TP6 A;  3EN1 B;  3DXO A;  1SJW A;  3FSD A;  1JKG A;  1A2K A;  5TGN A;  3LZA A;  4XDW A;  1UUW B;  3BLZ A;  3M8C A;  3EQQ B;  5AIF A;  2I9W A;  4HZ9 B;  1BUQ A;  3FF2 A;  1JN5 A;  2BMO B;  3CNM A;  3IPT A;  4X2O A;  4HZB B;  2BNG A;  4FCJ A;  5BVB A;  3ROB A;  3B8L A;  2HMN B;  4XM4 A;  3VSY A;  4L8P A;  2JQ5 A;  1DMQ A;  3Q90 A;  4WYK B;  5JPU A;  3K7C A;  1OHS A;  3JUQ A;  2A15 A;  3DMC A;  5STD A;  2CKF B;  5EVH A;  3MHE A;  1VZZ A;  3FKA A;  4MJD A;  4XB5 A;  2B1X B;  1O7M B;  4LMI A;  1O7P B;  1OH0 A;  3VGN A;  3HK4 A;  4WWU C;  3JUM A;  3HZP A;  2OWP A;  2F86 B;  1EG9 B;  3GZY B;  3ER7 A;  3MG1 A;  4HM3 B;  3GRD A;  1U5O A;  4STD A;  3EBT A;  3RGA A;  2GXF A;  3CNX A;  2QIY A;  3STD A;  1CQS A;  4K1U A;  4HM8 B;  1GY5 A;  1OF5 B;  3GZX B;  4XDV A;  3FH1 A;  2R4I A;  3ECF A;  3H51 A;  4R9K A;  5AIH A;  4WYK A;  3EJV A;  3F40 A;  3KE7 A;  1DMM A;  4H3U A;  1NU3 A;  1OGX A;  4HM5 B;  3JUO A;  3F8H A;  1IDP A;  3UNL A;  4R1K A;  2HMM B;  3EF8 A;  3FGY A;  2XRX B;  6STD A;  3FF0 A;  3F7S A;  1ULI B;  3G16 A;  1JB2 A;  1QJG A;  1ZO2 A;  1GY7 A;  3FLJ A;  2XR8 B;  1GYB A;  3CPO A;  7STD A;  4HM0 B;  2F98 A;  3T8N A;  5CK6 A;  3S5C A;  2QGU A;  1OHO A;  8CHO A;  1ULJ B;  1NWW A;  1ZX2 A;  4HM2 B;  1DMN A;  5AEW B;  4LEH A;  3MYT A;  5IG4 A;  1GY6 A;  4XBY A;  1W00 A;  3GZB A;  1OF5 A;  1ASK A;  3F14 A;  3KZT A;  1OCV A;  1Q40 B;  3MG2 A;  3F9S A;  5D83 A;  4X2H A;  4HVN A;  3CU3 A;  3T8U A;  1Z1S A;  3OWU A;  3EN8 A;  4L7K A;  3SED A;  1WQL B;  4I4K A;  5CF2 A;  4N3V A;  5KP1 A;  1W02 A;  3FZW A;  3DUK A;  4PEJ A;  4GB5 A;  5AIG A;  2W2C A;  3JUP A;  4KVH A;  3KSP A;  1TUH A;  5HGR A;  4XBT A;  3B4P A;  5IER A;  3DZL A;  5D81 A;  2YFI B;  5IG5 A;  5CF1 A;  4OVM A;  4LGQ A;  1QMA A;  3E99 A;  3NXJ A;  5KP4 A;  2XSH B;  3NV0 B;  4U13 A;  2RGQ A;  2GEY A;  4HJL B;  2GBX B;  5IEO A;  3NM2 A;  1HKX A;  2GBW B;  3G0K A;  4K1V A;  1JB4 A;  5AI1 A;  1NDO B;  3RGR A;  3OWS A;  1Q40 A;  3B7C A;  4RZM A;  2XSO B;  5G2G A;  3NHX A;  1OPY A;  2UX0 A;  1W6Y A;  5CLK A;  5IEP A;  1W01 A;  4XBX A;  4OUQ A;  3OV4 A;  2RCD A;  3NBR A;  3F8X A;  3H3H A;  1Q42 A;  1EA2 A;  5IG3 A;  1JB5 A;  4Q53 A;  5JPP A;  3F7X A;  2YFJ B;  4FCM A;  4HM7 B;  5IEN A;  2CHC A;  3OX9 A;  1S5A A;  3NV0 A;  3EX9 A;  2GEX A;  2HMO B;  3GWR A;  3SOA A;  3LYG A;  1E3V A;  5BXQ A;  2B24 B;  3JUN A;  1O7H B;  3WMD A;  4J9A A;  3GZR A;  2K54 A;  5DRV A;  2Z7A A;  3A76 A;  5IF6 A;  3UJM A;  4J8T A;  5FW5 A;  5D82 A;  2Z77 A;  2Z76 A;  4CDL A;  1OUN A;  2BMQ B;  1E3R A;  2RFR A;  3SOY A;  1JKG B;  3HX8 A;  2BMR B;  5AEU B;  2YFL B;  4ORL A;  1OGZ A;  4L8O A;  3D9R A;  3I0Y A;  3BB9 A;  3NUV A;  1E97 A;  5AII A;  4HM1 B;  1OHP A;  1ISK A; 
#chains in the Genus database with same CATH topology
 5M18 A;  1O7G B;  2KF4 A;  2PZV A;  5IG0 A;  1YIT 3;  3DM8 A;  2CFG A;  4RNZ A;  1JN5 B;  1ZS7 A;  3Q3F A;  2W0Q A;  3EBY A;  3K0Z A;  3X3Y A;  4EW5 A;  1JJ2 2;  3OWY A;  2CFL A;  1GD4 A;  3O8Y A;  4N6V 0;  1IQY A;  3NQY A;  3G8Z A;  1BSB A;  1RGE A;  3HI7 A;  1TRQ A;  1IYY A;  3U1W A;  1STD A;  3MSO A;  1BSD A;  1RGL A;  1JZO A;  2WGO A;  4HKV B;  1GS3 A;  4MEI A;  1ROA A;  5DRE A;  1X1W A;  2CIU A;  3G4S 3;  3SVA A;  2F99 A;  2IMJ A;  3VF1 A;  1BVI A;  1O7W B;  2CK3 H;  2OTL 3;  4IIA A;  4AKY A;  3EHC A;  3MWZ A;  4HM6 B;  4KFF A;  4R9L A;  3NX0 A;  4O3V A;  3MG3 A;  4KT3 B;  4WP5 A;  3NM7 A;  1PU4 A;  3UL5 A;  2P38 A;  2ZDJ A;  3BU4 A;  2HMJ B;  2INX A;  2CG0 A;  5KP3 A;  3EC9 A;  1JRQ A;  5G1K A;  1TJD A;  4EC6 A;  4HBR A;  3OXA A;  3LML A;  1RHL A;  2MF7 A;  3X41 A;  4KZ1 A;  3L0R A;  1BNE A;  1I2E A;  1W2Z A;  2OCT A;  1O7N B;  3BNE A;  3MKI A;  4HM4 B;  5CXO A;  1PFP A;  1K41 A;  1AR0 A;  1A2V A;  2HML B;  4K61 A;  4EXR A;  2HMK B;  1RNB A;  1C7H A;  1UUV B;  2STD A;  3B4O A;  3KKG A;  5ELU A;  3CCL 3;  1QAL A;  2MC8 A;  3URP A;  1IVX A;  2WO0 A;  1TP6 A;  4GSP A;  3EN1 B;  3DXO A;  2OOV A;  1SJW A;  3FSD A;  1JKG A;  2Q07 A;  1WMN A;  3U97 A;  4BIR A;  1FGR A;  1L5G B;  1SQW A;  3EB8 A;  4I5Q A;  5ELJ A;  1B27 A;  3WR2 A;  1RGG A;  2YX9 A;  1A2K A;  3D4A A;  3AMO B;  3NBB A;  1I2G A;  5TGN A;  5BU4 A;  2BHM A;  3LZA A;  4XDW A;  1M1K 4;  1N5H A;  3S29 A;  2FXT A;  2Y74 A;  3HOH A;  5M1A A;  1UUW B;  1SAR A;  1BRG A;  1VQK 3;  3SYU A;  1OAC A;  1J2B A;  3BLZ A;  1FUW A;  3M8C A;  4N6M A;  1A67 A;  3CC7 3;  3EQQ B;  2OTJ 3;  1BNG A;  1BNS A;  1V57 A;  1RCK A;  5AIF A;  3A5E A;  2I9W A;  4HZ9 B;  3DGO A;  3UB1 A;  3MPH A;  5M19 A;  3CXC 2;  1BUQ A;  2O3O A;  3FF2 A;  1WTH A;  1A90 A;  1W2B 2;  1JN5 A;  2ML6 A;  3LTC A;  4HYZ A;  2OQE A;  3V99 A;  4CCV A;  1KC8 4;  3T0U A;  2BMO B;  3CNM A;  1YHQ 3;  4NPB A;  2AAD A;  3IPT A;  4X2O A;  2K0M A;  3PGB A;  3BIR A;  3CMA 3;  3PZW A;  1BGS A;  4EV5 A;  5IW9 A;  4HZB B;  2BNG A;  4FCJ A;  3CD6 3;  1NO3 A;  2E2V A;  2C4B A;  3BNB A;  1BSE A;  1B2M A;  3UL6 A;  5BVB A;  3ROB A;  1B20 A;  2RBI A;  4J5K A;  1HU9 A;  4QWT A;  1B2U A;  1JV2 B;  2XH9 A;  4JRF A;  2CG1 A;  1Q86 4;  3HIG A;  2P09 A;  3B8L A;  1HZ1 A;  4O2H A;  4EYC A;  3FG3 A;  3Q1C A;  2IA7 A;  2CWU A;  2FGT A;  2HMN B;  1Q9E A;  1V58 A;  1W6G A;  1YGE A;  2GU3 A;  1MWR A;  4JF8 A;  4L8P A;  4XM4 A;  5AYS C;  3VSY A;  3ZFZ A;  5GSP A;  1DVD A;  2JQ5 A;  1D6U A;  1DMQ A;  3Q90 A;  1RN1 A;  4WYK B;  5JPU A;  3G6E 3;  3K7C A;  1OHS A;  3KSE D;  1YNV X;  2D42 A;  5A0O B;  2CFW A;  2KCD A;  3JUQ A;  1FW7 A;  2A15 A;  3D3L A;  2W03 A;  4BL2 A;  3DMC A;  3CC4 3;  5STD A;  2CKF B;  5FGO A;  1KQS 2;  1RGK A;  1RRH A;  3CCJ 3;  4GL6 A;  5EVH A;  3MHE A;  1VZZ A;  3FKA A;  1TRP A;  1UDI I;  2BO9 B;  4MJD A;  4XB5 A;  2B1X B;  1T2H A;  1KD1 4;  1O7M B;  2H0I A;  4LMI A;  3NBJ A;  1DYU A;  1O7P B;  1OH0 A;  2CC3 A;  1R4Y A;  5HOH A;  1KWI A;  2W9Q A;  3VGN A;  3HK4 A;  3CME 3;  3AMO A;  1I2F A;  3N9H A;  1LQM B;  4WWU C;  3GSP A;  2J8X B;  1FUS A;  3JUM A;  3HZP A;  4TX4 A;  1QVG 2;  1BNR A;  2OWP A;  1KSI A;  4R4K A;  1IU7 A;  2F86 B;  1EG9 B;  3PS8 A;  3D5G A;  1Q81 4;  1U8C B;  2H0G A;  3GZY B;  3S27 A;  5JBS A;  2RSX A;  3ER7 A;  2CWT A;  1RKY A;  1N8R 4;  1BRI A;  3MG1 A;  4HM3 B;  1VQ5 3;  2CW9 A;  1BNF A;  3GRD A;  1AVL A;  1JZD A;  1U5O A;  4CPK A;  2F5W A;  4STD A;  2JDI H;  2KRT A;  4DKI A;  2P0X A;  1TFK A;  3EBT A;  1MWT A;  1N9E A;  2GXF A;  3RGA A;  1G0T A;  1FGM A;  3CC2 3;  3X3X A;  1RGH A;  3CNX A;  3IMA B;  2QIY A;  2W9P A;  3V98 A;  3V92 A;  3STD A;  1CQS A;  4K1U A;  6RNT A;  1UCL A;  1NB3 I;  2KF5 A;  4HM8 B;  1BRJ A;  1RCL A;  1IQ8 A;  2F5M A;  3WDG B;  1GY5 A;  2WGQ A;  4BTW A;  3DGY A;  4IPB A;  3J7Y d;  4N6O B;  1N9J A;  3LXU X;  1YJ9 3;  2D1W A;  1GMP A;  1OF5 B;  2C10 A;  2IUK A;  1FYS A;  1LVN A;  1MOL A;  3EE1 A;  3GZX B;  3LTD A;  1YVB I;  2BT3 A;  4WFO A;  4XDV A;  1RJO A;  3GAX A;  2IY2 A;  3FH1 A;  2R41 A;  2R4I A;  3ECF A;  3H51 A;  3S67 A;  1UCK A;  4R9K A;  3CCS 3;  1VQ4 3;  5AIH A;  4WYK A;  3EJV A;  4MMX B;  3F40 A;  3KE7 A;  3K63 A;  1DMM A;  4H3U A;  1RGC A;  1NU3 A;  3KCH A;  1VQ6 3;  1B2S A;  1OGX A;  3Q2P A;  3D5I A;  1HYF A;  1WMP A;  2CFK A;  4HM5 B;  3WHO A;  1TFO A;  3JUO A;  1EQK A;  1I3F A;  3F8H A;  2W56 B;  4FMD A;  1IDP A;  3G71 3;  3UNL A;  1SIH A;  2E2U A;  4R1K A;  1JNQ A;  2HMM B;  1US1 A;  1IVU A;  3BND A;  3EF8 A;  3FGY A;  1GSP A;  1UCI A;  2XRX B;  1I3I A;  2FNQ A;  3SLU A;  6STD A;  1FGO A;  1SPU A;  3LT8 A;  1EUI C;  3FF0 A;  4N6U A;  1YVS A;  1K9M 4;  3F7S A;  1W6C A;  3QK9 A;  2Y73 A;  1I0X A;  1ULI B;  3JVC A;  3G16 A;  1CEW I;  1FGQ A;  1QJG A;  1ZO2 A;  1JB2 A;  1LOY A;  1GY7 A;  1GYB A;  2XR8 B;  3AGN A;  3CPO A;  3FLJ A;  7RNT A;  1BNJ A;  4HM0 B;  2F98 A;  3T8N A;  5CK6 A;  1AV4 A;  3S5C A;  3PCR A;  3RNT A;  1K73 4;  1RLS A;  2K3D A;  5LC7 A;  1VQL 3;  1C54 A;  3CCM 3;  2QGU A;  1LRA A;  1K28 A;  3DY5 A;  1OHO A;  8CHO A;  1BNI A;  1ULJ B;  1NWW A;  7STD A;  3K9M C;  1GMQ A;  4EBG A;  1STF I;  1UCJ A;  1Q82 4;  2UGI A;  1FGT A;  1ZX2 A;  2V1L A;  1FUT A;  1VQ9 3;  4BTX A;  4HM2 B;  1DMN A;  1B3S A;  4LZI A;  3RDE A;  4CJN A;  5AEW B;  3I55 3;  5G1L A;  4LEH A;  3MYT A;  4N6L A;  5IG4 A;  1VQM 3;  1GY6 A;  1DVC A;  1UI8 A;  4XBY A;  2IYJ A;  1W00 A;  1IQX A;  1Q7H A;  3GZB A;  3CCU 3;  2ZHX B;  1VQQ A;  3CCV 3;  1OF5 A;  1ASK A;  1JBR A;  1CYV A;  3F14 A;  1T2I A;  3KZT A;  1AVK A;  1OCV A;  1Q40 B;  3MG2 A;  3F9S A;  3TDG A;  3I56 3;  1MNL A;  1RN4 A;  5D83 A;  4X2H A;  4HVN A;  1M9G A;  3CU3 A;  4LYL B;  2XFT A;  3T8U A;  1GOV A;  1Z1S A;  3OW2 2;  3OWU A;  1IV7 A;  1MGR A;  2BU4 A;  5I97 A;  1RSN A;  1W7C A;  3EN8 A;  4L7K A;  1LXE A;  3SED A;  1IT8 A;  1PY3 A;  1WQL B;  4I4K A;  4RBN A;  4OK0 A;  2F4Y A;  1BSA A;  5CF2 A;  4N3V A;  1VQP 3;  4HAA A;  4NRE A;  5KP1 A;  1W02 A;  2W56 A;  1CYU A;  3FZW A;  1YJW 3;  4ILF A;  1BRH A;  4FCZ A;  3DUK A;  1NNV A;  1T3B A;  3QRD A;  1ROV A;  4PEJ A;  2KXG A;  1QVF 2;  4GB5 A;  1F8N A;  3HII A;  3DGM A;  1X1U A;  5AIG A;  1G96 A;  1B2Z A;  1SII A;  2CH9 A;  2W2C A;  3JUP A;  4KVH A;  3KSP A;  1TUH A;  2CWV A;  1RN7 A;  5HGR A;  1RTU A;  1M1X B;  1UUG B;  2IUJ A;  3CCQ 3;  4XBT A;  3B4P A;  5IER A;  3PYJ A;  3DZL A;  1FA3 A;  2KF3 A;  5D81 A;  4BTY A;  3AHW A;  2YFI B;  2L1S A;  2SBL A;  3CCR 3;  1UI7 A;  1EEJ A;  1BAO A;  5IG5 A;  1IV9 A;  2XGN A;  4AEQ A;  2SAR A;  3PXM A;  3ZG0 A;  2AAE A;  2KF6 A;  1DET A;  3AHS A;  5CF1 A;  9RNT A;  2W04 A;  3DGL A;  2UUG C;  3CCE 3;  1BUJ A;  1AQZ A;  4OVM A;  4LGQ A;  3WA3 A;  4BU4 A;  3LH4 A;  1BU4 A;  3DH2 A;  1AY7 A;  1QMA A;  4K90 B;  4MMY B;  1I8V A;  3ALA A;  3E99 A;  2H0H A;  3NXJ A;  5KP4 A;  2XSH B;  3NV0 B;  2PNC A;  4U13 A;  2RGQ A;  1IT7 A;  1RGA A;  2GEY A;  4HJL B;  2XGL A;  2GBX B;  5IEO A;  2P05 A;  3NM2 A;  1HKX A;  1RMS A;  3WOE B;  2GBW B;  3LOY A;  3LTA A;  3G0K A;  4K1V A;  1JB4 A;  1S72 3;  2ZA4 A;  1X1Y A;  2ML5 A;  2W6J H;  5AI1 A;  1EKM A;  1NDO B;  4O8S A;  3RGR A;  3OWS A;  5AYR B;  1Q40 A;  1VQO 3;  3B7C A;  4RNT A;  2XSO B;  4RZM A;  5G2G A;  1VQ8 3;  3NHX A;  3N8B A;  2BIR A;  1OPY A;  4N6T A;  5LC6 A;  1YJN 3;  4J5G A;  2UX0 A;  1W6Y A;  3WA2 X;  3X3Z A;  1UGI A;  1VQ7 3;  4KFE A;  1RGF A;  4AKZ A;  3FG1 A;  4WHA A;  2OOV C;  2KAA A;  5CLK A;  1W01 A;  1YGW A;  1BSC A;  4XBX A;  4OUQ A;  3WOD G;  5IEP A;  1BRK A;  3OV4 A;  2WOF A;  2RCD A;  7GSP A;  1LOW A;  2CX0 A;  1LOX A;  5RNT A;  2P0M A;  3NBR A;  2LQV A;  2LYX A;  3F8X A;  3H3H A;  1I70 A;  1DE3 A;  1PYL A;  1BIR A;  1Q42 A;  1GMR A;  4EV2 A;  1JBS A;  3KN4 A;  1EA2 A;  1TIJ A;  5IG3 A;  3X40 A;  2OQE C;  3CPW 2;  3DGN A;  1Y4K A;  1JB5 A;  1UW1 A;  4FMB A;  3SX1 A;  4Q53 A;  1IK3 A;  2L4V A;  4IT7 A;  6GSP A;  5JPP A;  3N54 B;  3F7X A;  1QAF A;  2C11 A;  1BRN L;  3LT9 A;  2YFJ B;  4FCM A;  5EEO A;  4RNY A;  2CX1 A;  4HM7 B;  5IEN A;  2CHC A;  1R4C A;  3SXX A;  1D6Z A;  4ZM8 A;  3OX9 A;  1LNI A;  2GSP A;  1S5A A;  1MWS A;  1GD3 A;  3NV0 A;  3EX9 A;  1B21 A;  2O9U X;  1X1X A;  1MWU A;  1TU5 A;  1NJI 4;  1D6Y A;  2F56 A;  4KFD A;  3BNC A;  1W5Z A;  2GEX A;  3NQZ A;  1M90 4;  2HMO B;  1Q7Y 4;  3GWR A;  1LQG C;  4FR9 A;  3SOA A;  2HOH A;  3LTB A;  2M7O A;  3LYG A;  4H61 A;  1YI2 3;  3KFQ C;  1E3V A;  2RNT A;  3PCS A;  1QAK A;  3WOF B;  2B24 B;  5BXQ A;  1GOY A;  3JUN A;  1ZGX A;  1O7H B;  1W4N A;  1BRS A;  3K5T A;  3WMD A;  1JBT A;  4N6N B;  1BAN A;  3X42 A;  3KII A;  1LOV A;  4FMA A;  1GOU A;  1IVV A;  3GZR A;  1LNH A;  2K54 A;  4J9A A;  5EQL A;  5DRV A;  1YIJ 3;  2Z7A A;  1VQN 3;  1MGW A;  4NHF A;  1N5P A;  4HOH A;  3A76 A;  4FMC A;  2ZL8 A;  1I0V A;  4R80 A;  8RNT A;  1TTO A;  5IF6 A;  1K8A 4;  1G02 A;  3UJM A;  3S28 A;  1NB5 I;  2XFS A;  1V74 A;  4J8T A;  5FW5 A;  4O02 B;  5D82 A;  2Z77 A;  1WMO A;  2Z76 A;  4CDL A;  1OUN A;  2BMQ B;  5BIR A;  1E3R A;  2RFR A;  2XEP A;  3AGO A;  1RNT A;  3SOY A;  1JKG B;  1N8Q A;  1FZU A;  2Z6B A;  1RDS A;  2E2T A;  3HX8 A;  3FG4 A;  1B2X A;  4LSO A;  1RRL A;  4G1M B;  1A2P A;  2QEX 3;  2GU1 A;  2WOH A;  2QA4 3;  2BMR B;  5AEU B;  2YFL B;  1WNH A;  4ORL A;  1OGZ A;  4L8O A;  1IVW A;  3D9R A;  2XF3 A;  3I0Y A;  3ZG5 A;  1BOX A;  3BB9 A;  3D79 A;  1E97 A;  3IJE B;  3NUV A;  4MMZ B;  4GHO A;  4HM1 B;  1T5Y A;  1UGH I;  3FCS B;  5AII A;  4BL3 A;  1OHP A;  1ISK A;  2CFD A;  1CH0 A; 
#chains in the Genus database with same CATH homology
 1O7G B;  1YIT 3;  2PZV A;  5IG0 A;  3DM8 A;  2CFG A;  4RNZ A;  1JN5 B;  2W0Q A;  3EBY A;  3K0Z A;  3X3Y A;  1JJ2 2;  3OWY A;  2CFL A;  1GD4 A;  3O8Y A;  4N6V 0;  1IQY A;  3NQY A;  3G8Z A;  3HI7 A;  3U1W A;  1STD A;  3MSO A;  2WGO A;  4HKV B;  1GS3 A;  4MEI A;  1ROA A;  5DRE A;  3G4S 3;  2CIU A;  3SVA A;  2F99 A;  2IMJ A;  3VF1 A;  1O7W B;  2CK3 H;  2OTL 3;  4IIA A;  4AKY A;  3EHC A;  3MWZ A;  4HM6 B;  4KFF A;  4R9L A;  3NX0 A;  4O3V A;  3MG3 A;  4WP5 A;  3NM7 A;  1PU4 A;  3UL5 A;  2P38 A;  2ZDJ A;  2HMJ B;  2INX A;  2CG0 A;  5KP3 A;  3EC9 A;  1JRQ A;  4EC6 A;  4HBR A;  3OXA A;  3LML A;  3X41 A;  2MF7 A;  4KZ1 A;  3L0R A;  1W2Z A;  3MKI A;  2OCT A;  1O7N B;  3BNE A;  4HM4 B;  5CXO A;  1PFP A;  1K41 A;  1AR0 A;  1A2V A;  2HML B;  4K61 A;  4EXR A;  2HMK B;  1C7H A;  1UUV B;  2STD A;  3B4O A;  3KKG A;  5ELU A;  3CCL 3;  1QAL A;  2MC8 A;  1IVX A;  2WO0 A;  1TP6 A;  3EN1 B;  3DXO A;  2OOV A;  1SJW A;  3FSD A;  1JKG A;  2Q07 A;  1WMN A;  3U97 A;  1FGR A;  1L5G B;  1SQW A;  3EB8 A;  5ELJ A;  2YX9 A;  1A2K A;  3NBB A;  3AMO B;  5TGN A;  2BHM A;  3LZA A;  4XDW A;  1M1K 4;  1N5H A;  3S29 A;  2FXT A;  2Y74 A;  1UUW B;  1VQK 3;  1OAC A;  1J2B A;  3BLZ A;  1FUW A;  3M8C A;  4N6M A;  1A67 A;  3CC7 3;  3EQQ B;  2OTJ 3;  5AIF A;  2I9W A;  4HZ9 B;  3DGO A;  3UB1 A;  3MPH A;  3CXC 2;  1BUQ A;  2O3O A;  3FF2 A;  1WTH A;  1A90 A;  1W2B 2;  1JN5 A;  2ML6 A;  3LTC A;  4HYZ A;  2OQE A;  3V99 A;  4CCV A;  1KC8 4;  3T0U A;  2BMO B;  3CNM A;  1YHQ 3;  3IPT A;  4X2O A;  2K0M A;  3PGB A;  3CMA 3;  3PZW A;  5IW9 A;  4EV5 A;  4HZB B;  2BNG A;  4FCJ A;  3CD6 3;  1NO3 A;  2E2V A;  3BNB A;  3UL6 A;  5BVB A;  3ROB A;  4QWT A;  1HU9 A;  1JV2 B;  2XH9 A;  1Q86 4;  4JRF A;  2CG1 A;  3HIG A;  2P09 A;  3B8L A;  4O2H A;  4EYC A;  3FG3 A;  3Q1C A;  2IA7 A;  2CWU A;  2FGT A;  2HMN B;  1W6G A;  4JF8 A;  1YGE A;  2GU3 A;  4XM4 A;  3VSY A;  4L8P A;  5AYS C;  2QA4 3;  1DVD A;  2JQ5 A;  1D6U A;  1DMQ A;  3Q90 A;  4WYK B;  5JPU A;  3G6E 3;  3K7C A;  1OHS A;  3KSE D;  2D42 A;  5A0O B;  2CFW A;  2KCD A;  3JUQ A;  2A15 A;  3D3L A;  2W03 A;  3DMC A;  3CC4 3;  5STD A;  2CKF B;  5FGO A;  1KQS 2;  1RRH A;  3CCJ 3;  4GL6 A;  5EVH A;  3MHE A;  1VZZ A;  3FKA A;  2BO9 B;  4MJD A;  4XB5 A;  2B1X B;  1KD1 4;  1O7M B;  4LMI A;  3NBJ A;  1DYU A;  1O7P B;  1OH0 A;  2CC3 A;  1KWI A;  2W9Q A;  3VGN A;  3HK4 A;  3CME 3;  3AMO A;  3N9H A;  4WWU C;  3JUM A;  3HZP A;  4TX4 A;  1QVG 2;  2OWP A;  1KSI A;  4R4K A;  1IU7 A;  2F86 B;  1EG9 B;  1Q81 4;  1U8C B;  3GZY B;  3S27 A;  1RKY A;  5JBS A;  2RSX A;  3ER7 A;  2CWT A;  1N8R 4;  3MG1 A;  4HM3 B;  1VQ5 3;  2CW9 A;  3GRD A;  1AVL A;  1U5O A;  4STD A;  2JDI H;  2KRT A;  2P0X A;  1TFK A;  3EBT A;  1N9E A;  3RGA A;  2GXF A;  1FGM A;  3CC2 3;  3X3X A;  3CNX A;  3IMA B;  2QIY A;  2W9P A;  3V98 A;  3V92 A;  3STD A;  1CQS A;  4K1U A;  1NB3 I;  4HM8 B;  1IQ8 A;  3WDG B;  1GY5 A;  2WGQ A;  4BTW A;  4IPB A;  3J7Y d;  4N6O B;  1N9J A;  3LXU X;  1YJ9 3;  2D1W A;  2C10 A;  1OF5 B;  2IUK A;  1LVN A;  1MOL A;  3EE1 A;  3GZX B;  3LTD A;  1YVB I;  2BT3 A;  4WFO A;  4XDV A;  1RJO A;  3GAX A;  3FH1 A;  2R4I A;  3ECF A;  3H51 A;  3S67 A;  3CCS 3;  4R9K A;  1VQ4 3;  5AIH A;  4WYK A;  3EJV A;  4MMX B;  3F40 A;  3KE7 A;  3K63 A;  1DMM A;  4H3U A;  1NU3 A;  1VQ6 3;  1OGX A;  3Q2P A;  4HM5 B;  1WMP A;  2CFK A;  1TFO A;  3JUO A;  1EQK A;  3F8H A;  2W56 B;  4FMD A;  1IDP A;  3G71 3;  3UNL A;  1SIH A;  2E2U A;  4R1K A;  1JNQ A;  2HMM B;  1US1 A;  1IVU A;  3BND A;  3EF8 A;  3FGY A;  2XRX B;  6STD A;  2FNQ A;  3SLU A;  1FGO A;  1SPU A;  3LT8 A;  3FF0 A;  4N6U A;  1K9M 4;  3F7S A;  1W6C A;  3QK9 A;  2Y73 A;  1ULI B;  3JVC A;  3G16 A;  1CEW I;  1FGQ A;  1QJG A;  1ZO2 A;  1JB2 A;  1GY7 A;  2XR8 B;  1GYB A;  3FLJ A;  3CPO A;  3PS8 A;  7STD A;  4HM0 B;  2F98 A;  3T8N A;  5CK6 A;  1AV4 A;  3S5C A;  3PCR A;  1K73 4;  5LC7 A;  1VQL 3;  3CCM 3;  2QGU A;  1K28 A;  3DY5 A;  1OHO A;  8CHO A;  1ULJ B;  1NWW A;  3K9M C;  4EBG A;  1STF I;  1Q82 4;  1VQ9 3;  1FGT A;  1ZX2 A;  2V1L A;  4BTX A;  4HM2 B;  1DMN A;  4LZI A;  3RDE A;  5AEW B;  3I55 3;  4LEH A;  3MYT A;  4N6L A;  5IG4 A;  1VQM 3;  1GY6 A;  1DVC A;  1UI8 A;  4XBY A;  1W00 A;  1IQX A;  3GZB A;  3CCU 3;  3CCV 3;  1OF5 A;  1ASK A;  1CYV A;  3F14 A;  3KZT A;  1AVK A;  1OCV A;  1Q40 B;  3MG2 A;  3F9S A;  3TDG A;  3I56 3;  1MNL A;  5D83 A;  4X2H A;  4HVN A;  1M9G A;  3CU3 A;  2XFT A;  3T8U A;  1Z1S A;  3OW2 2;  3OWU A;  1IV7 A;  5I97 A;  1W7C A;  3EN8 A;  4L7K A;  1LXE A;  3SED A;  1IT8 A;  1WQL B;  4I4K A;  4RBN A;  4OK0 A;  5CF2 A;  4N3V A;  1VQP 3;  5KP1 A;  4NRE A;  1W02 A;  2W56 A;  1CYU A;  3FZW A;  1YJW 3;  4FCZ A;  3DUK A;  3QRD A;  1ROV A;  4PEJ A;  2KXG A;  1QVF 2;  4GB5 A;  1F8N A;  3HII A;  3DGM A;  5AIG A;  1G96 A;  1SII A;  2CH9 A;  2W2C A;  3JUP A;  4KVH A;  3KSP A;  1TUH A;  2CWV A;  1RN7 A;  5HGR A;  1M1X B;  2IUJ A;  3CCQ 3;  4XBT A;  3B4P A;  5IER A;  3PYJ A;  3DZL A;  1FA3 A;  5D81 A;  4BTY A;  2YFI B;  2SBL A;  3CCR 3;  1UI7 A;  5IG5 A;  1IV9 A;  2XGN A;  4AEQ A;  3PXM A;  5CF1 A;  3CCE 3;  2W04 A;  3DGL A;  4OVM A;  4LGQ A;  3WA3 A;  3LH4 A;  1QMA A;  4K90 B;  4MMY B;  3ALA A;  3E99 A;  3NXJ A;  5KP4 A;  2XSH B;  3NV0 B;  2PNC A;  4U13 A;  2RGQ A;  1IT7 A;  2GEY A;  4HJL B;  2XGL A;  2GBX B;  5IEO A;  2P05 A;  3NM2 A;  1HKX A;  3WOE B;  2GBW B;  3LOY A;  3LTA A;  3G0K A;  4K1V A;  1JB4 A;  1S72 3;  2ML5 A;  2W6J H;  5AI1 A;  1EKM A;  1NDO B;  4O8S A;  3RGR A;  3OWS A;  5AYR B;  1Q40 A;  1VQO 3;  3B7C A;  2XSO B;  4RZM A;  5G2G A;  1VQ8 3;  3NHX A;  3N8B A;  4N6T A;  1OPY A;  1YJN 3;  5LC6 A;  3X3Z A;  2UX0 A;  1W6Y A;  3WA2 X;  1VQ7 3;  4KFE A;  4AKZ A;  3FG1 A;  4WHA A;  2OOV C;  5CLK A;  3WOD G;  1W01 A;  5IEP A;  4XBX A;  4OUQ A;  3OV4 A;  2WOF A;  2RCD A;  1LOX A;  2P0M A;  3NBR A;  2LQV A;  2LYX A;  3F8X A;  3H3H A;  1Q42 A;  4EV2 A;  3KN4 A;  1EA2 A;  1TIJ A;  5IG3 A;  3X40 A;  2OQE C;  3CPW 2;  3DGN A;  1Y4K A;  1JB5 A;  1UW1 A;  4FMB A;  3SX1 A;  4Q53 A;  1IK3 A;  2L4V A;  4IT7 A;  5JPP A;  3N54 B;  3F7X A;  1QAF A;  2C11 A;  3LT9 A;  2YFJ B;  4FCM A;  5EEO A;  4RNY A;  4HM7 B;  5IEN A;  2CHC A;  1R4C A;  3SXX A;  1D6Z A;  4ZM8 A;  3OX9 A;  1S5A A;  1GD3 A;  3NV0 A;  3EX9 A;  2O9U X;  1TU5 A;  1NJI 4;  1D6Y A;  4KFD A;  3BNC A;  1W5Z A;  2GEX A;  3NQZ A;  1M90 4;  2HMO B;  1Q7Y 4;  3GWR A;  4FR9 A;  3SOA A;  3LTB A;  2M7O A;  3LYG A;  4H61 A;  1YI2 3;  3KFQ C;  1E3V A;  3PCS A;  1QAK A;  3WOF B;  2B24 B;  5BXQ A;  3JUN A;  1O7H B;  1W4N A;  3K5T A;  3WMD A;  4N6N B;  3X42 A;  3KII A;  4FMA A;  4J9A A;  1IVV A;  3GZR A;  1LNH A;  2K54 A;  5EQL A;  5DRV A;  1YIJ 3;  2Z7A A;  1VQN 3;  4NHF A;  1N5P A;  3A76 A;  4FMC A;  2ZL8 A;  4R80 A;  5IF6 A;  1K8A 4;  3UJM A;  1NB5 I;  3S28 A;  2XFS A;  1V74 A;  4J8T A;  5FW5 A;  4O02 B;  5D82 A;  2Z77 A;  1WMO A;  2Z76 A;  4CDL A;  1OUN A;  2BMQ B;  1E3R A;  2RFR A;  2XEP A;  3SOY A;  1JKG B;  1N8Q A;  2Z6B A;  2E2T A;  3HX8 A;  3FG4 A;  4LSO A;  1RRL A;  4G1M B;  2QEX 3;  2GU1 A;  2WOH A;  2BMR B;  5AEU B;  2YFL B;  1WNH A;  4ORL A;  1OGZ A;  4L8O A;  1IVW A;  3D9R A;  2XF3 A;  3I0Y A;  3BB9 A;  3NUV A;  4MMZ B;  1E97 A;  3IJE B;  5AII A;  4HM1 B;  1T5Y A;  3FCS B;  1OHP A;  1ISK A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...