1OCVA

The f116w mutant structure of ketosteroid isomerase from comamonas testosteroni
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALWGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ketosteroid isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Origin of the Different Ph Activity Profile in Two Homologous Ketosteroid Isomerases
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ocvA00
1E97A 4XBXA 2XRXB 5CXOA 3VGNA 2B1XB 3MYTA 2HMNB 3RGRA 3OV4A 3K7CA 4J9AA 4HVNA 3NV0B 4HM7B 2BMRB 2GEXA 7STDA 4R9LA 2K54A 3S5CA 1BUQA 3STDA 3CU3A 5KP4A 5AEUB 3A76A 3FF0A 3GZXB 2I9WA 2IMJA 4U13A 1GY6A 1S5AA 5D81A 5BXQA 3FGYA 1DMNA 3GRDA 3HK4A 2CKFB 1W00A 1A2KA 5TGNA 1VZZA 2HMKB 2W2CA 3BLZA 4XBTA 3LYGA 4X2OA 5IG5A 1Q40A 1O7GB 3DM8A 1Q42A 1ZX2A 4HZBB 4KVHA 3JUOA 1CQSA 3KKGA 1NWWA 3DZLA 5CK6A 4WYKA 1WQLB 3KE7A 3WMDA 2YFIB 3D9RA 1Z1SA 1DMQA 4HM1B 8CHOA 3FZWA 5KP3A 3CNXA 1W02A 4HM0B 1Q40B 3MG3A 3FH1A 3OX9A 4XBYA 4LEHA 3DXOA 3MG2A 4RZMA 4HJLB 4R1KA 3FKAA 5DREA 1OGXA 1O7PB 3EBYA 2UX0A 5JPPA 1ISKA 1DMMA 2RCDA 3SOAA 3NM2A 1GY5A 2Z7AA 4L8OA 1E3RA 3ER7A 2GBXB 3JUMA 3G8ZA 5IEOA 4MJDA 3FSDA 4K1VA 5AIHA 3SEDA 1OPYA 2HMMB 1TP6A 4HM2B 2Z77A 5DRVA 4OUQA 1W6YA 4HM3B 2BNGA 2RFRA 5BVBA 1IDPA 3K0ZA 5AIFA 4HM6B 5IENA 3BB9A 2XSOB 1AR0A 1JB2A 4FCJA 1ULJB 3KZTA 3OXAA 2YFLB 3GWRA 1OUNA 3G16A 5D83A 2F99A 3RGAA 3EN8A 3OWYA 4OVMA 4K1UA 5AIGA 1JN5A 4J8TA 1OF5A 2R4IA 3JUQA 5AI1A 2RGQA 1NU3A 3F7SA 4LGQA 3F14A 4N3VA 1TUHA 3HX8A 1OHOA 4CDLA 4L8PA 5AEWB 1O7HB 3NUVA 1C7HA 3CNMA 3NXJA 5CLKA 2HMOB 1SJWA 3NBRA 3EX9A 2JQ5A 3H3HA 1JN5B 3EN1B 3F40A 1ZO2A 4HKVB 3G0KA 4XM4A 3LZAA 5CF1A 1ULIB 1O7WB 3NV0A 4PEJA 2BMOB 4WP5A 2F98A 3FF2A 1K41A 1E3VA 3OWUA 4XB5A 3F8XA 3EJVA 1EG9B 3IPTA 4WYKB 3MG1A 3Q90A 5G2GA 5CF2A 3UJMA 2XSHB 3M8CA 3B7CA 3EQQB 3I0YA 3ECFA 3NHXA 6STDA 2PZVA 4HM4B 5IG0A 3SOYA 4WWUC 3OWSA 2YFJB 3B4PA 5IF6A 3ROBA 1JB5A 3GZRA 1EA2A 5HGRA 5JPUA 3EF8A 3HZPA 3DUKA 1GY7A 1O7MB 2CHCA 1HKXA 2BMQB 1NDOB 3GZYB 4I4KA 4H3UA 1JB4A 3F9SA 3UNLA 4XDVA 1U5OA 2B24B 4FCMA 2A15A 3DMCA 4LMIA 2GEYA 3MSOA 4Q53A 5IERA 4HM5B 2INXA 5KP1A 1JKGA 5STDA 4ORLA 2QIYA 5IG3A 3GZBA 3CPOA 3H51A 3MHEA 1W01A 5AIIA 3EC9A 2GXFA 3F7XA 1OGZA 1OH0A 5FW5A 4R9KA 2STDA 1UUWB 2XR8B 2F86B 4L7KA 3VSYA 1STDA 3KSPA 3FLJA 2Z76A 1OCVA 1ASKA 3E99A 4X2HA 1OF5B 1O7NB 3EHCA 4STDA 1GYBA 4HM8B 1GS3A 1JKGB 3JUNA 3JUPA 3B8LA 4GB5A 4XDWA 3T8NA 3B4OA 3F8HA 3T8UA 2QGUA 2OWPA 1UUVB 2HMLB 5IG4A 3MKIA 4IIAA 5IEPA 4HZ9B 2HMJB 1QMAA 5D82A 5EVHA 1OHSA 3EBTA 1OHPA 2GBWB 1QJGA
chains in the Genus database with same CATH superfamily
1E97A 1WMNA 1ZS7A 4XBXA 3SX1A 1CEWI 3D4AA 3X3ZA 2XRXB 1LOWA 5CXOA 1BRJA 1US1A 3EE1A 1BSDA 2B1XB 3VGNA 3MYTA 2HMNB 4KZ1A 3RGRA 1TIJA 1UCIA 4WFOA 2FGTA 3OV4A 1I2GA 1BNGA 3K7CA 4J9AA 3FG4A 4HVNA 3D3LA 1HU9A 1X1XA 2W6JH 3NV0B 4TX4A 4HM7B 2BMRB 2GEXA 4KFDA 4BU4A 7STDA 2RBIA 1SQWA 2K54A 4HBRA 4R9LA 1EKMA 2BO9B 2GSPA 3GAXA 3S5CA 5IW9A 1ROVA 4MMXB 1D6UA 1BUQA 1IVUA 3STDA 3MPHA 3CU3A 1VQM3 2CX1A 5KP4A 1FZUA 3WODG 5AEUB 3A76A 1RRHA 3FF0A 1VQ83 3GZXB 5RNTA 4RBNA 1RCKA 2I9WA 3G6E3 2IMJA 4U13A 1FUSA 1GY6A 1RDSA 1S5AA 2OQEC 5D81A 3FGYA 1RNTA 5BXQA 1JZOA 7RNTA 1BUJA 1DMNA 1FW7A 3U97A 3GRDA 3HK4A 2CKFB 1JBSA 1W00A 1KD14 2CH9A 1A2KA 4O8SA 1OACA 3CC73 1GD3A 1JBRA 1PFPA 1FUTA 1I3FA 1L5GB 5TGNA 1G02A 1UCLA 1VZZA 2HMKB 4NREA 3V92A 1YJW3 2ML6A 2W2CA 3BLZA 4XBTA 1BNEA 2XH9A 3LYGA 1BSCA 4X2OA 1IQ8A 2CWVA 2OTJ3 5IG5A 1G96A 3D5GA 1Q40A 4BIRA 1X1YA 1O7GB 1GMQA 3DM8A 3UL5A 1NB5I 2W9QA 1STFI 3DGNA 2E2UA 1A67A 1U8CB 1Q42A 1FGOA 1ZX2A 1CYUA 1M1XB 3LTDA 1MWRA 2XFTA 1BGSA 4NHFA 3CCV3 1VQN3 4J5KA 4FMBA 4HZBB 1V74A 3CCL3 4KVHA 4O2HA 3WA2X 3BU4A 2XEPA 1RN4A 1YIJ3 2K0MA 3Q2PA 3JUOA 1DVDA 1K28A 1RGGA 1QAFA 3KCHA 1N5HA 1K8A4 1CQSA 5AYRB 4CCVA 3KKGA 1BRKA 2W03A 3BNDA 1MGRA 1NWWA 2L4VA 3NM7A 3DZLA 3O8YA 1RTUA 1LOXA 4H61A 1IQYA 4GHOA 1JRQA 3K9MC 5CK6A 5BU4A 4WYKA 3JVCA 1IVXA 3ALAA 3SLUA 1B2SA 1BNIA 1WQLB 3KE7A 5ELUA 1BSBA 3WMDA 2YFIB 3N54B 3D9RA 1Z1SA 4AKZA 5JBSA 1YHQ3 1DMQA 2Y74A 4HM1B 3CMA3 8CHOA 3PCSA 3SVAA 1BU4A 3FZWA 5KP3A 3CNXA 1FGRA 2CG0A 4HAAA 1W02A 4HM0B 1Q40B 3MG3A 1M1K4 1I8VA 3FH1A 4AEQA 1W7CA 3OX9A 2PNCA 4XBYA 2UGIA 3NBJA 4LEHA 5G1KA 1T2HA 1VQO3 3DXOA 3GSPA 3TDGA 5GSPA 3MG2A 1Q9EA 3I563 4RZMA 1NJI4 1C54A 4HJLB 4R1KA 3FKAA 3WR2A 2W56A 2W9PA 4K90B 5DREA 1OGXA 2CFGA 2P0MA 3T0UA 2KCDA 3WOFB 1O7PB 3EBYA 2UX0A 1JNQA 5JPPA 1IK3A 1ISKA 1DMMA 2RCDA 2ZA4A 1X1WA 3URPA 3SOAA 1RN1A 3NM2A 4OK0A 1GY5A 1AVKA 2CW9A 2CX0A 2Z7AA 3V98A 1UI7A 3PZWA 4L8OA 1RRLA 1PU4A 1E3RA 1AQZA 3Q3FA 3ER7A 4N6TA 3HIIA 4NPBA 1FYSA 2GBXB 2BU4A 3JUMA 1VQQA 4QWTA 2MC8A 1RSNA 6GSPA 3LTCA 3G8ZA 1VQK3 2SARA 1RN7A 4N6LA 4MJDA 5IEOA 1EQKA 3FSDA 4K1VA 1M9GA 1NNVA 3DH2A 5AIHA 1B27A 3Q1CA 3SEDA 3KFQC 1OPYA 2HMMB 1JJ22 1FA3A 1TP6A 4HM2B 2C10A 5A0OB 1WNHA 2BHMA 1B2XA 1VQ93 1UCJA 1BAOA 1WMOA 1BRGA 1GOVA 1YGWA 2Z77A 5DRVA 4BTWA 4OUQA 2W0QA 1UI8A 2CFLA 1FUWA 3FCSB 1W6YA 4HM3B 2BNGA 2RFRA 5BVBA 1IDPA 4MMZB 3K0ZA 1N8R4 1B3SA 5AIFA 4HM6B 1MWTA 4R4KA 2BIRA 5IENA 1DYUA 3BB9A 2OTL3 1RGKA 2XSOB 3BNEA 1B2ZA 3LOYA 1VQ73 1AR0A 2ZDJA 1JB2A 1JZDA 4FCJA 4KFFA 1VQ53 4HOHA 1IVVA 4IT7A 1ULJB 4FR9A 4R80A 2RSXA 3KZTA 3CCE3 3FG3A 1Q824 3OXAA 3X42A 3G713 4JF8A 1I0XA 2YFLB 1B2MA 3PS8A 5M18A 3GWRA 4GL6A 1OUNA 3G4S3 1HYFA 1A2VA 1YGEA 2F5WA 3AHSA 3G16A 5D83A 2F99A 3RNTA 3RGAA 1QVF2 2P05A 1Q7Y4 3EN8A 3OWYA 1W2ZA 1BRIA 1W6CA 2MF7A 4K61A 2YX9A 4OVMA 1BRHA 1BOXA 2O9UX 5EEOA 4N6UA 1LNIA 2OOVA 4K1UA 4BL2A 1RHLA 2E2TA 2C4BA 1TFKA 1TRPA 5AIGA 5BIRA 3N8BA 3MWZA 1JN5A 4J8TA 2XFSA 1OF5A 2R4IA 3JUQA 1G0TA 2CFDA 4RNZA 1PY3A 1J2BA 2WGQA 1LVNA 2ZL8A 1T5YA 4WHAA 2KF6A 1T3BA 5AI1A 1PYLA 1JV2B 1ROAA 2RGQA 3K63A 4FMAA 1LXEA 2P38A 1NU3A 3WDGB 3BIRA 3F7SA 2OQEA 3LH4A 3BNCA 3LTBA 4LGQA 5FGOA 3UB1A 1BRNL 1B21A 3F14A 4N6NB 4N3VA 3DGYA 1DETA 1TJDA 1KWIA 4O02B 2E2VA 3CXC2 1UW1A 1RJOA 2IUKA 4G1MB 2XGNA 3PXMA 1RGCA 1TUHA 2IA7A 1UCKA 1Q7HA 2F56A 3HX8A 1BSAA 5M1AA 3CPW2 1IYYA 1B2UA 3CCQ3 1OHOA 4CDLA 3PGBA 4L8PA 4N6V0 1BNRA 5AEWB 1SIIA 1O7HB 3NUVA 4EXRA 1C7HA 3CNMA 3NXJA 3HIGA 5CLKA 2HMOB 1LNHA 1SJWA 1TU5A 3HI7A 1S723 3J7Yd 1Q864 4EBGA 4N6MA 3NBRA 3EX9A 1BIRA 1RCLA 1WMPA 4EC6A 1VQ63 2FNQA 2JQ5A 3U1WA 3H3HA 2Y73A 1JN5B 2KXGA 2LYXA 3AGNA 1LQGC 2CK3H 4EW5A 1TTOA 3CD63 3EN1B 3F40A 1K9M4 2P0XA 1ZO2A 4HKVB 3G0KA 5I97A 2WGOA 1I0VA 3LZAA 4XM4A 5CF1A 1ULIB 2V1LA 2LQVA 4DKIA 1O7WB 3NV0A 4EYCA 4KT3B 3WOEB 4PEJA 2CWTA 1A2PA 3S29A 1KQS2 1AV4A 1TFOA 2W04A 3QRDA 1LRAA 2BMOB 3I553 1QAKA 3HOHA 3LT9A 3DGMA 2JDIH 4WP5A 1N9JA 3S28A 3BNBA 1KC84 1X1UA 1LOYA 2F98A 1K41A 3FF2A 1Y4KA 1RNBA 1E3VA 3OWUA 3RDEA 4XB5A 3F8XA 2Q07A 1MGWA 1EG9B 2HOHA 3EJVA 3IPTA 3S27A 3AMOA 3KN4A 4WYKB 3MG1A 1RMSA 3AGOA 3Q90A 5G2GA 5CF2A 1IT8A 3UJMA 2XSHB 4RNTA 4LYLB 2L1SA 3S67A 2CC3A 3M8CA 1AVLA 4LSOA 3WHOA 2CIUA 3B7CA 3EQQB 2AADA 3I0YA 3ECFA 1RGLA 1IV9A 3FG1A 3NHXA 1IU7A 3NQZA 3X3YA 3LMLA 6STDA 1D6YA 2PZVA 4HM4B 1N8QA 5IG0A 3ZG0A 3SOYA 1RGAA 2XF3A 3K5TA 3OWSA 4WWUC 2YFJB 5G1LA 3B4PA 1EEJA 5IF6A 2ML5A 3CCS3 3QK9A 3ROBA 3DGOA 2H0IA 3D5IA 1JB5A 3GZRA 1EA2A 5HGRA 4BTXA 5JPUA 1GSPA 2R41A 2UUGC 3EF8A 3HZPA 3ZG5A 4MEIA 1GOYA 4FMDA 1IVWA 3DUKA 5ELJA 1GY7A 3NX0A 2OOVC 2AAEA 4I5QA 2W56B 1HZ1A 1KSIA 1D6ZA 3A5EA 1O7MB 4JRFA 1A90A 1YVBI 2KF5A 2M7OA 1YNVX 2CHCA 3CME3 1EUIC 1HKXA 1RGFA 2CG1A 1RGHA 1BSEA 2BMQB 3PYJA 2QEX3 1YJ93 1Q814 3CC23 3CCR3 1I3IA 2P09A 1NDOB 3UL6A 1BANA 4MMYB 1F8NA 3GZYB 2RNTA 2IY2A 3AMOB 1W2B2 3D79A 2Z6BA 4I4KA 5LC6A 1LOVA 4H3UA 1JB4A 1QVG2 3F9SA 5AYSC 1MNLA 3UNLA 5LC7A 3N9HA 4XDVA 1NB3I 1U5OA 3IMAB 2B24B 4FCMA 2A15A 3DMCA 2CFWA 4LMIA 2GEYA 3MSOA 7GSPA 4Q53A 1N5PA 5IERA 4HM5B 2INXA 2D1WA 1K734 5KP1A 3WA3A 2KAAA 1JKGA 5STDA 2CFKA 2XGLA 3ZFZA 4ORLA 3SXXA 1IQXA 2QIYA 1BRSA 5IG3A 3IJEB 3LTAA 4HYZA 3GZBA 2H0HA 1BNFA 3CPOA 3H51A 3MHEA 1CH0A 1VQP3 1W01A 3X40A 5AIIA 2GU3A 2SBLA 3EC9A 4LZIA 2GXFA 1LQMB 1R4CA 1NO3A 3F7XA 1OGZA 4IPBA 4AKYA 3CCJ3 1OH0A 5FW5A 1YJN3 1YVSA 3LT8A 2F4YA 1UUGB 1GMRA 2QA43 2OCTA 2STDA 4R9KA 1UUWB 4GSPA 3PCRA 4CPKA 2XR8B 1MWUA 2F86B 1DE3A 3CC43 3OW22 2C11A 1VQ43 4L7KA 1JBTA 3VSYA 1FGQA 1STDA 1TRQA 3DY5A 1AY7A 3X41A 1QALA 3KSPA 1YIT3 3FLJA 2FXTA 3EB8A 1V57A 1MWSA 2CWUA 2KF3A 3AHWA 2Z76A 1OCVA 1W4NA 5HOHA 1T2IA 1M904 2H0GA 2K3DA 1ASKA 3E99A 4X2HA 4CJNA 1OF5B 2J8XB 4EV5A 1O7NB 1MOLA 3EHCA 1VQL3 1DVCA 1UGIA 3L0RA 1W6GA 4STDA 3CCU3 1GYBA 3KIIA 1SIHA 4HM8B 2O3OA 3NQYA 1BVIA 1GS3A 1JKGB 1R4YA 1SPUA 4BTYA 4J5GA 3LXUX 3JUNA 3JUPA 3B8LA 4GB5A 4O3VA 2F5MA 2WOHA 4XDWA 1BNSA 1V58A 2ZHXB 2WO0A 3V99A 3T8NA 1WTHA 2BT3A 3B4OA 1YI23 2IUJA 1SARA 3F8HA 3T8UA 1GMPA 3KSED 1FGTA 1I2EA 8RNTA 4BL3A 1W5ZA 2IYJA 2QGUA 1GD4A 3CCM3 1UDII 3SYUA 2OWPA 9RNTA 3NBBA 4FCZA 6RNTA 1UUVB 2HMLB 4EV2A 1B20A 5IG4A 1I70A 1GOUA 3MKIA 5EQLA 1FGMA 4IIAA 4ILFA 4N6OB 5IEPA 4HZ9B 4KFEA 3DGLA 2HMJB 1QMAA 2KRTA 2D42A 1UGHI 1ZGXA 5D82A 5EVHA 1OHSA 1RLSA 3X3XA 1RGEA 2WOFA 3EBTA 1IT7A 1CYVA 1OHPA 2GBWB 1QJGA 1I2FA 2KF4A 4RNYA 4ZM8A 5M19A 1IV7A 1BNJA 2GU1A 1RKYA 1N9EA 4FMCA 3VF1A
chains in the Genus database with same CATH topology
1E97A 1WMNA 4XBXA 3SX1A 1CEWI 3X3ZA 2XRXB 5CXOA 1US1A 3EE1A 3VGNA 2B1XB 3MYTA 2HMNB 4KZ1A 3RGRA 1TIJA 4WFOA 2FGTA 3OV4A 3K7CA 4J9AA 3FG4A 4HVNA 3D3LA 1HU9A 2W6JH 3NV0B 4TX4A 4HM7B 2BMRB 2GEXA 4KFDA 7STDA 4R9LA 1SQWA 2K54A 4HBRA 1EKMA 2BO9B 3S5CA 3GAXA 5IW9A 1ROVA 4MMXB 1D6UA 1BUQA 1IVUA 3STDA 3MPHA 3CU3A 1VQM3 5KP4A 3WODG 5AEUB 3A76A 1RRHA 3FF0A 1VQ83 3GZXB 4RBNA 2I9WA 3G6E3 2IMJA 4U13A 1GY6A 1S5AA 2OQEC 5D81A 5BXQA 3FGYA 1DMNA 3U97A 3GRDA 3HK4A 2CKFB 1W00A 1KD14 2CH9A 1A2KA 4O8SA 1OACA 3CC73 1GD3A 1PFPA 1L5GB 5TGNA 1VZZA 2HMKB 4NREA 3V92A 1YJW3 2ML6A 2W2CA 3BLZA 4XBTA 2XH9A 3LYGA 4X2OA 1IQ8A 2CWVA 5IG5A 1G96A 1Q40A 1O7GB 3DM8A 3UL5A 1NB5I 2W9QA 1STFI 3DGNA 2E2UA 1A67A 1U8CB 1Q42A 1FGOA 1ZX2A 1CYUA 1M1XB 3LTDA 2XFTA 4NHFA 3CCV3 1VQN3 4FMBA 4HZBB 1V74A 3CCL3 4KVHA 4O2HA 3WA2X 2XEPA 1YIJ3 2K0MA 3Q2PA 3JUOA 1DVDA 1K28A 1QAFA 1N5HA 1CQSA 5AYRB 4CCVA 3KKGA 2W03A 3BNDA 1NWWA 2L4VA 3NM7A 3DZLA 3O8YA 1LOXA 4H61A 1IQYA 1JRQA 3K9MC 5CK6A 4WYKA 3JVCA 1IVXA 3ALAA 3SLUA 1WQLB 3KE7A 5ELUA 3WMDA 2YFIB 3N54B 3D9RA 1Z1SA 4AKZA 5JBSA 1YHQ3 1DMQA 2Y74A 4HM1B 3CMA3 8CHOA 3PCSA 3SVAA 3FZWA 5KP3A 3CNXA 1FGRA 2CG0A 1W02A 4HM0B 1Q40B 3MG3A 1M1K4 3FH1A 4AEQA 1W7CA 3OX9A 2PNCA 4XBYA 3NBJA 4LEHA 1VQO3 3DXOA 3TDGA 3MG2A 3I563 4RZMA 1NJI4 4HJLB 4R1KA 3FKAA 2W56A 2W9PA 4K90B 5DREA 1OGXA 2CFGA 2P0MA 3T0UA 2KCDA 3WOFB 1O7PB 3EBYA 2UX0A 1JNQA 5JPPA 1IK3A 1ISKA 1DMMA 2RCDA 3SOAA 3NM2A 4OK0A 1GY5A 1AVKA 2CW9A 2Z7AA 3V98A 1UI7A 3PZWA 4L8OA 1RRLA 1PU4A 1E3RA 3ER7A 4N6TA 3HIIA 2GBXB 3JUMA 4QWTA 1N9EA 2MC8A 3LTCA 3G8ZA 1VQK3 1EQKA 1RN7A 4N6LA 4MJDA 5IEOA 3FSDA 4K1VA 1M9GA 5AIHA 3SEDA 3Q1CA 3KFQC 1OPYA 2HMMB 1JJ22 1FA3A 1TP6A 4HM2B 2C10A 5A0OB 1WNHA 2BHMA 1VQ93 2Z77A 1WMOA 4BTWA 5DRVA 1FUWA 4OUQA 2W0QA 1UI8A 2CFLA 3FCSB 1W6YA 4HM3B 2BNGA 2RFRA 5BVBA 1IDPA 4MMZB 3K0ZA 1N8R4 5AIFA 4HM6B 4R4KA 5IENA 1DYUA 3BB9A 2OTL3 2XSOB 3BNEA 3LOYA 1VQ73 1AR0A 2ZDJA 1JB2A 4FCJA 4KFFA 1VQ53 4IT7A 1IVVA 2OTJ3 1ULJB 4FR9A 4R80A 2RSXA 3KZTA 3CCE3 3FG3A 1Q824 3OXAA 3X42A 3G713 4JF8A 2YFLB 3PS8A 3GWRA 4GL6A 1OUNA 3G4S3 1A2VA 1YGEA 3G16A 5D83A 2F99A 3RGAA 1QVF2 2P05A 1Q7Y4 3EN8A 3OWYA 1W2ZA 1W6CA 2MF7A 4K61A 2YX9A 4OVMA 5EEOA 2OOVA 2O9UX 4N6UA 4K1UA 2E2TA 1TFKA 5AIGA 3N8BA 3MWZA 1JN5A 4J8TA 2XFSA 1OF5A 2R4IA 3JUQA 2CFDA 4RNZA 1J2BA 2WGQA 1LVNA 2ZL8A 1T5YA 4WHAA 5AI1A 1JV2B 1ROAA 2RGQA 3K63A 4FMAA 1LXEA 2P38A 1NU3A 3WDGB 3F7SA 2OQEA 3LH4A 3BNCA 3LTBA 4LGQA 5FGOA 3UB1A 3F14A 4N6NB 4N3VA 4O02B 1KWIA 2E2VA 3CXC2 1UW1A 1RJOA 4G1MB 2XGNA 3PXMA 1TUHA 2IA7A 3HX8A 3CPW2 3CCQ3 1OHOA 4CDLA 3PGBA 4L8PA 4N6V0 5AEWB 1SIIA 1O7HB 3NUVA 4EXRA 1C7HA 3CNMA 3NXJA 3HIGA 5CLKA 2HMOB 1LNHA 1SJWA 1TU5A 3HI7A 1S723 3J7Yd 1Q864 4EBGA 4N6MA 3NBRA 3EX9A 1WMPA 4EC6A 1VQ63 2FNQA 2JQ5A 3U1WA 3H3HA 2Y73A 1JN5B 2KXGA 2LYXA 2CK3H 3CD63 3EN1B 3F40A 1K9M4 2P0XA 1ZO2A 4HKVB 3G0KA 5I97A 2WGOA 4XM4A 3LZAA 5CF1A 1ULIB 2V1LA 2LQVA 1O7WB 3NV0A 4EYCA 3WOEB 4PEJA 2CWTA 3S29A 1KQS2 1AV4A 1TFOA 2W04A 3QRDA 2BMOB 3I553 1QAKA 3LT9A 3DGMA 2JDIH 4WP5A 1N9JA 3S28A 3BNBA 1KC84 2F98A 3FF2A 1K41A 1Y4KA 1E3VA 3OWUA 3RDEA 4XB5A 3F8XA 2Q07A 3EJVA 1EG9B 3IPTA 3S27A 3AMOA 3KN4A 4WYKB 3MG1A 3Q90A 5G2GA 5CF2A 1IT8A 3UJMA 2XSHB 3S67A 2CC3A 3M8CA 1AVLA 4LSOA 2CIUA 3B7CA 3EQQB 3I0YA 3ECFA 3FG1A 1IV9A 3NHXA 3NQZA 1IU7A 3X3YA 6STDA 3LMLA 1D6YA 2PZVA 4HM4B 1N8QA 5IG0A 3SOYA 2XF3A 3K5TA 3OWSA 4WWUC 2YFJB 3B4PA 5IF6A 2ML5A 3CCS3 3QK9A 3ROBA 3DGOA 1JB5A 3GZRA 1EA2A 5HGRA 4BTXA 5JPUA 3EF8A 3HZPA 4MEIA 4FMDA 1IVWA 3DUKA 5ELJA 1GY7A 3NX0A 2OOVC 2W56B 1KSIA 1D6ZA 4JRFA 1O7MB 1A90A 1YVBI 2M7OA 2CHCA 3CME3 1HKXA 2CG1A 2BMQB 3PYJA 2QEX3 1YJ93 1Q814 3CC23 3CCR3 2P09A 3UL6A 1NDOB 4MMYB 1F8NA 3GZYB 3AMOB 1W2B2 5LC6A 2Z6BA 4I4KA 4H3UA 1JB4A 1QVG2 3F9SA 5AYSC 1MNLA 3UNLA 5LC7A 3N9HA 4XDVA 1NB3I 1U5OA 3IMAB 2B24B 4FCMA 2A15A 3DMCA 2CFWA 4LMIA 2GEYA 3MSOA 4Q53A 1N5PA 5IERA 4HM5B 2INXA 2D1WA 1K734 5KP1A 3WA3A 1JKGA 5STDA 2CFKA 2XGLA 4ORLA 3SXXA 1IQXA 2QIYA 5IG3A 3IJEB 3LTAA 4HYZA 3GZBA 3CPOA 3H51A 3MHEA 1VQP3 1W01A 3X40A 5AIIA 2GU3A 2SBLA 3EC9A 4LZIA 2GXFA 1R4CA 1NO3A 3F7XA 1OGZA 4IPBA 4AKYA 3CCJ3 1OH0A 5FW5A 1YJN3 3LT8A 2QA43 2OCTA 2STDA 4R9KA 1UUWB 3PCRA 2XR8B 2F86B 3CC43 3OW22 2C11A 1VQ43 4L7KA 3VSYA 1FGQA 1STDA 3DY5A 3X41A 1QALA 3KSPA 1YIT3 3FLJA 2FXTA 3EB8A 2CWUA 2Z76A 1OCVA 1W4NA 1M904 1ASKA 3E99A 4X2HA 1OF5B 4EV5A 1O7NB 1MOLA 3EHCA 1VQL3 1DVCA 3L0RA 1W6GA 4STDA 3CCU3 1GYBA 3KIIA 1SIHA 4HM8B 2O3OA 3NQYA 1GS3A 1JKGB 1SPUA 4BTYA 3LXUX 3JUNA 3JUPA 3B8LA 4GB5A 4O3VA 2WOHA 4XDWA 3V99A 1K8A4 2WO0A 3T8NA 1WTHA 2BT3A 3B4OA 1YI23 2IUJA 3F8HA 3T8UA 3KSED 1FGTA 1W5ZA 2QGUA 1GD4A 3CCM3 2OWPA 3NBBA 4FCZA 1UUVB 2HMLB 4EV2A 5IG4A 3MKIA 5EQLA 1FGMA 4IIAA 4N6OB 5IEPA 4HZ9B 4KFEA 3DGLA 2HMJB 1QMAA 2KRTA 2D42A 5D82A 5EVHA 1OHSA 3X3XA 3EBTA 2WOFA 1IT7A 1CYVA 1OHPA 2GBWB 1QJGA 4RNYA 4ZM8A 1IV7A 2GU1A 1RKYA 2IUKA 4FMCA 3VF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E97 A;  4XBX A;  2XRX B;  5CXO A;  3VGN A;  2B1X B;  3MYT A;  2HMN B;  3RGR A;  3OV4 A;  3K7C A;  4J9A A;  4HVN A;  3NV0 B;  4HM7 B;  2BMR B;  2GEX A;  7STD A;  4R9L A;  2K54 A;  3S5C A;  1BUQ A;  3STD A;  3CU3 A;  5KP4 A;  5AEU B;  3A76 A;  3FF0 A;  3GZX B;  2I9W A;  2IMJ A;  4U13 A;  1GY6 A;  1S5A A;  5D81 A;  5BXQ A;  3FGY A;  1DMN A;  3GRD A;  3HK4 A;  2CKF B;  1W00 A;  1A2K A;  5TGN A;  1VZZ A;  2HMK B;  2W2C A;  3BLZ A;  4XBT A;  3LYG A;  4X2O A;  5IG5 A;  1Q40 A;  1O7G B;  3DM8 A;  1Q42 A;  1ZX2 A;  4HZB B;  4KVH A;  3JUO A;  1CQS A;  3KKG A;  1NWW A;  3DZL A;  5CK6 A;  4WYK A;  1WQL B;  3KE7 A;  3WMD A;  2YFI B;  3D9R A;  1Z1S A;  1DMQ A;  4HM1 B;  8CHO A;  3FZW A;  5KP3 A;  3CNX A;  1W02 A;  4HM0 B;  1Q40 B;  3MG3 A;  3FH1 A;  3OX9 A;  4XBY A;  4LEH A;  3DXO A;  3MG2 A;  4RZM A;  4HJL B;  4R1K A;  3FKA A;  5DRE A;  1OGX A;  1O7P B;  3EBY A;  2UX0 A;  5JPP A;  1ISK A;  1DMM A;  2RCD A;  3SOA A;  3NM2 A;  1GY5 A;  2Z7A A;  4L8O A;  1E3R A;  3ER7 A;  2GBX B;  3JUM A;  3G8Z A;  5IEO A;  4MJD A;  3FSD A;  4K1V A;  5AIH A;  3SED A;  1OPY A;  2HMM B;  1TP6 A;  4HM2 B;  2Z77 A;  5DRV A;  4OUQ A;  1W6Y A;  4HM3 B;  2BNG A;  2RFR A;  5BVB A;  1IDP A;  3K0Z A;  5AIF A;  4HM6 B;  5IEN A;  3BB9 A;  2XSO B;  1AR0 A;  1JB2 A;  4FCJ A;  1ULJ B;  3KZT A;  3OXA A;  2YFL B;  3GWR A;  1OUN A;  3G16 A;  5D83 A;  2F99 A;  3RGA A;  3EN8 A;  3OWY A;  4OVM A;  4K1U A;  5AIG A;  1JN5 A;  4J8T A;  1OF5 A;  2R4I A;  3JUQ A;  5AI1 A;  2RGQ A;  1NU3 A;  3F7S A;  4LGQ A;  3F14 A;  4N3V A;  1TUH A;  3HX8 A;  1OHO A;  4CDL A;  4L8P A;  5AEW B;  1O7H B;  3NUV A;  1C7H A;  3CNM A;  3NXJ A;  5CLK A;  2HMO B;  1SJW A;  3NBR A;  3EX9 A;  2JQ5 A;  3H3H A;  1JN5 B;  3EN1 B;  3F40 A;  1ZO2 A;  4HKV B;  3G0K A;  4XM4 A;  3LZA A;  5CF1 A;  1ULI B;  1O7W B;  3NV0 A;  4PEJ A;  2BMO B;  4WP5 A;  2F98 A;  3FF2 A;  1K41 A;  1E3V A;  3OWU A;  4XB5 A;  3F8X A;  3EJV A;  1EG9 B;  3IPT A;  4WYK B;  3MG1 A;  3Q90 A;  5G2G A;  5CF2 A;  3UJM A;  2XSH B;  3M8C A;  3B7C A;  3EQQ B;  3I0Y A;  3ECF A;  3NHX A;  6STD A;  2PZV A;  4HM4 B;  5IG0 A;  3SOY A;  4WWU C;  3OWS A;  2YFJ B;  3B4P A;  5IF6 A;  3ROB A;  1JB5 A;  3GZR A;  1EA2 A;  5HGR A;  5JPU A;  3EF8 A;  3HZP A;  3DUK A;  1GY7 A;  1O7M B;  2CHC A;  1HKX A;  2BMQ B;  1NDO B;  3GZY B;  4I4K A;  4H3U A;  1JB4 A;  3F9S A;  3UNL A;  4XDV A;  1U5O A;  2B24 B;  4FCM A;  2A15 A;  3DMC A;  4LMI A;  2GEY A;  3MSO A;  4Q53 A;  5IER A;  4HM5 B;  2INX A;  5KP1 A;  1JKG A;  5STD A;  4ORL A;  2QIY A;  5IG3 A;  3GZB A;  3CPO A;  3H51 A;  3MHE A;  1W01 A;  5AII A;  3EC9 A;  2GXF A;  3F7X A;  1OGZ A;  1OH0 A;  5FW5 A;  4R9K A;  2STD A;  1UUW B;  2XR8 B;  2F86 B;  4L7K A;  3VSY A;  1STD A;  3KSP A;  3FLJ A;  2Z76 A;  1OCV A;  1ASK A;  3E99 A;  4X2H A;  1OF5 B;  1O7N B;  3EHC A;  4STD A;  1GYB A;  4HM8 B;  1GS3 A;  1JKG B;  3JUN A;  3JUP A;  3B8L A;  4GB5 A;  4XDW A;  3T8N A;  3B4O A;  3F8H A;  3T8U A;  2QGU A;  2OWP A;  1UUV B;  2HML B;  5IG4 A;  3MKI A;  4IIA A;  5IEP A;  4HZ9 B;  2HMJ B;  1QMA A;  5D82 A;  5EVH A;  1OHS A;  3EBT A;  1OHP A;  2GBW B;  1QJG A; 
#chains in the Genus database with same CATH topology
 1E97 A;  1WMN A;  1ZS7 A;  4XBX A;  3SX1 A;  1CEW I;  3D4A A;  3X3Z A;  2XRX B;  1LOW A;  5CXO A;  1BRJ A;  1US1 A;  3EE1 A;  1BSD A;  2B1X B;  3VGN A;  3MYT A;  2HMN B;  4KZ1 A;  3RGR A;  1TIJ A;  1UCI A;  4WFO A;  2FGT A;  3OV4 A;  1I2G A;  1BNG A;  3K7C A;  4J9A A;  3FG4 A;  4HVN A;  3D3L A;  1HU9 A;  1X1X A;  2W6J H;  3NV0 B;  4TX4 A;  4HM7 B;  2BMR B;  2GEX A;  4KFD A;  4BU4 A;  7STD A;  2RBI A;  1SQW A;  2K54 A;  4HBR A;  4R9L A;  1EKM A;  2BO9 B;  2GSP A;  3GAX A;  3S5C A;  5IW9 A;  1ROV A;  4MMX B;  1D6U A;  1BUQ A;  1IVU A;  3STD A;  3MPH A;  3CU3 A;  1VQM 3;  2CX1 A;  5KP4 A;  1FZU A;  3WOD G;  5AEU B;  3A76 A;  1RRH A;  3FF0 A;  1VQ8 3;  3GZX B;  5RNT A;  4RBN A;  1RCK A;  2I9W A;  3G6E 3;  2IMJ A;  4U13 A;  1FUS A;  1GY6 A;  1RDS A;  1S5A A;  2OQE C;  5D81 A;  3FGY A;  1RNT A;  5BXQ A;  1JZO A;  7RNT A;  1BUJ A;  1DMN A;  1FW7 A;  3U97 A;  3GRD A;  3HK4 A;  2CKF B;  1JBS A;  1W00 A;  1KD1 4;  2CH9 A;  1A2K A;  4O8S A;  1OAC A;  3CC7 3;  1GD3 A;  1JBR A;  1PFP A;  1FUT A;  1I3F A;  1L5G B;  5TGN A;  1G02 A;  1UCL A;  1VZZ A;  2HMK B;  4NRE A;  3V92 A;  1YJW 3;  2ML6 A;  2W2C A;  3BLZ A;  4XBT A;  1BNE A;  2XH9 A;  3LYG A;  1BSC A;  4X2O A;  1IQ8 A;  2CWV A;  2OTJ 3;  5IG5 A;  1G96 A;  3D5G A;  1Q40 A;  4BIR A;  1X1Y A;  1O7G B;  1GMQ A;  3DM8 A;  3UL5 A;  1NB5 I;  2W9Q A;  1STF I;  3DGN A;  2E2U A;  1A67 A;  1U8C B;  1Q42 A;  1FGO A;  1ZX2 A;  1CYU A;  1M1X B;  3LTD A;  1MWR A;  2XFT A;  1BGS A;  4NHF A;  3CCV 3;  1VQN 3;  4J5K A;  4FMB A;  4HZB B;  1V74 A;  3CCL 3;  4KVH A;  4O2H A;  3WA2 X;  3BU4 A;  2XEP A;  1RN4 A;  1YIJ 3;  2K0M A;  3Q2P A;  3JUO A;  1DVD A;  1K28 A;  1RGG A;  1QAF A;  3KCH A;  1N5H A;  1K8A 4;  1CQS A;  5AYR B;  4CCV A;  3KKG A;  1BRK A;  2W03 A;  3BND A;  1MGR A;  1NWW A;  2L4V A;  3NM7 A;  3DZL A;  3O8Y A;  1RTU A;  1LOX A;  4H61 A;  1IQY A;  4GHO A;  1JRQ A;  3K9M C;  5CK6 A;  5BU4 A;  4WYK A;  3JVC A;  1IVX A;  3ALA A;  3SLU A;  1B2S A;  1BNI A;  1WQL B;  3KE7 A;  5ELU A;  1BSB A;  3WMD A;  2YFI B;  3N54 B;  3D9R A;  1Z1S A;  4AKZ A;  5JBS A;  1YHQ 3;  1DMQ A;  2Y74 A;  4HM1 B;  3CMA 3;  8CHO A;  3PCS A;  3SVA A;  1BU4 A;  3FZW A;  5KP3 A;  3CNX A;  1FGR A;  2CG0 A;  4HAA A;  1W02 A;  4HM0 B;  1Q40 B;  3MG3 A;  1M1K 4;  1I8V A;  3FH1 A;  4AEQ A;  1W7C A;  3OX9 A;  2PNC A;  4XBY A;  2UGI A;  3NBJ A;  4LEH A;  5G1K A;  1T2H A;  1VQO 3;  3DXO A;  3GSP A;  3TDG A;  5GSP A;  3MG2 A;  1Q9E A;  3I56 3;  4RZM A;  1NJI 4;  1C54 A;  4HJL B;  4R1K A;  3FKA A;  3WR2 A;  2W56 A;  2W9P A;  4K90 B;  5DRE A;  1OGX A;  2CFG A;  2P0M A;  3T0U A;  2KCD A;  3WOF B;  1O7P B;  3EBY A;  2UX0 A;  1JNQ A;  5JPP A;  1IK3 A;  1ISK A;  1DMM A;  2RCD A;  2ZA4 A;  1X1W A;  3URP A;  3SOA A;  1RN1 A;  3NM2 A;  4OK0 A;  1GY5 A;  1AVK A;  2CW9 A;  2CX0 A;  2Z7A A;  3V98 A;  1UI7 A;  3PZW A;  4L8O A;  1RRL A;  1PU4 A;  1E3R A;  1AQZ A;  3Q3F A;  3ER7 A;  4N6T A;  3HII A;  4NPB A;  1FYS A;  2GBX B;  2BU4 A;  3JUM A;  1VQQ A;  4QWT A;  2MC8 A;  1RSN A;  6GSP A;  3LTC A;  3G8Z A;  1VQK 3;  2SAR A;  1RN7 A;  4N6L A;  4MJD A;  5IEO A;  1EQK A;  3FSD A;  4K1V A;  1M9G A;  1NNV A;  3DH2 A;  5AIH A;  1B27 A;  3Q1C A;  3SED A;  3KFQ C;  1OPY A;  2HMM B;  1JJ2 2;  1FA3 A;  1TP6 A;  4HM2 B;  2C10 A;  5A0O B;  1WNH A;  2BHM A;  1B2X A;  1VQ9 3;  1UCJ A;  1BAO A;  1WMO A;  1BRG A;  1GOV A;  1YGW A;  2Z77 A;  5DRV A;  4BTW A;  4OUQ A;  2W0Q A;  1UI8 A;  2CFL A;  1FUW A;  3FCS B;  1W6Y A;  4HM3 B;  2BNG A;  2RFR A;  5BVB A;  1IDP A;  4MMZ B;  3K0Z A;  1N8R 4;  1B3S A;  5AIF A;  4HM6 B;  1MWT A;  4R4K A;  2BIR A;  5IEN A;  1DYU A;  3BB9 A;  2OTL 3;  1RGK A;  2XSO B;  3BNE A;  1B2Z A;  3LOY A;  1VQ7 3;  1AR0 A;  2ZDJ A;  1JB2 A;  1JZD A;  4FCJ A;  4KFF A;  1VQ5 3;  4HOH A;  1IVV A;  4IT7 A;  1ULJ B;  4FR9 A;  4R80 A;  2RSX A;  3KZT A;  3CCE 3;  3FG3 A;  1Q82 4;  3OXA A;  3X42 A;  3G71 3;  4JF8 A;  1I0X A;  2YFL B;  1B2M A;  3PS8 A;  5M18 A;  3GWR A;  4GL6 A;  1OUN A;  3G4S 3;  1HYF A;  1A2V A;  1YGE A;  2F5W A;  3AHS A;  3G16 A;  5D83 A;  2F99 A;  3RNT A;  3RGA A;  1QVF 2;  2P05 A;  1Q7Y 4;  3EN8 A;  3OWY A;  1W2Z A;  1BRI A;  1W6C A;  2MF7 A;  4K61 A;  2YX9 A;  4OVM A;  1BRH A;  1BOX A;  2O9U X;  5EEO A;  4N6U A;  1LNI A;  2OOV A;  4K1U A;  4BL2 A;  1RHL A;  2E2T A;  2C4B A;  1TFK A;  1TRP A;  5AIG A;  5BIR A;  3N8B A;  3MWZ A;  1JN5 A;  4J8T A;  2XFS A;  1OF5 A;  2R4I A;  3JUQ A;  1G0T A;  2CFD A;  4RNZ A;  1PY3 A;  1J2B A;  2WGQ A;  1LVN A;  2ZL8 A;  1T5Y A;  4WHA A;  2KF6 A;  1T3B A;  5AI1 A;  1PYL A;  1JV2 B;  1ROA A;  2RGQ A;  3K63 A;  4FMA A;  1LXE A;  2P38 A;  1NU3 A;  3WDG B;  3BIR A;  3F7S A;  2OQE A;  3LH4 A;  3BNC A;  3LTB A;  4LGQ A;  5FGO A;  3UB1 A;  1BRN L;  1B21 A;  3F14 A;  4N6N B;  4N3V A;  3DGY A;  1DET A;  1TJD A;  1KWI A;  4O02 B;  2E2V A;  3CXC 2;  1UW1 A;  1RJO A;  2IUK A;  4G1M B;  2XGN A;  3PXM A;  1RGC A;  1TUH A;  2IA7 A;  1UCK A;  1Q7H A;  2F56 A;  3HX8 A;  1BSA A;  5M1A A;  3CPW 2;  1IYY A;  1B2U A;  3CCQ 3;  1OHO A;  4CDL A;  3PGB A;  4L8P A;  4N6V 0;  1BNR A;  5AEW B;  1SII A;  1O7H B;  3NUV A;  4EXR A;  1C7H A;  3CNM A;  3NXJ A;  3HIG A;  5CLK A;  2HMO B;  1LNH A;  1SJW A;  1TU5 A;  3HI7 A;  1S72 3;  3J7Y d;  1Q86 4;  4EBG A;  4N6M A;  3NBR A;  3EX9 A;  1BIR A;  1RCL A;  1WMP A;  4EC6 A;  1VQ6 3;  2FNQ A;  2JQ5 A;  3U1W A;  3H3H A;  2Y73 A;  1JN5 B;  2KXG A;  2LYX A;  3AGN A;  1LQG C;  2CK3 H;  4EW5 A;  1TTO A;  3CD6 3;  3EN1 B;  3F40 A;  1K9M 4;  2P0X A;  1ZO2 A;  4HKV B;  3G0K A;  5I97 A;  2WGO A;  1I0V A;  3LZA A;  4XM4 A;  5CF1 A;  1ULI B;  2V1L A;  2LQV A;  4DKI A;  1O7W B;  3NV0 A;  4EYC A;  4KT3 B;  3WOE B;  4PEJ A;  2CWT A;  1A2P A;  3S29 A;  1KQS 2;  1AV4 A;  1TFO A;  2W04 A;  3QRD A;  1LRA A;  2BMO B;  3I55 3;  1QAK A;  3HOH A;  3LT9 A;  3DGM A;  2JDI H;  4WP5 A;  1N9J A;  3S28 A;  3BNB A;  1KC8 4;  1X1U A;  1LOY A;  2F98 A;  1K41 A;  3FF2 A;  1Y4K A;  1RNB A;  1E3V A;  3OWU A;  3RDE A;  4XB5 A;  3F8X A;  2Q07 A;  1MGW A;  1EG9 B;  2HOH A;  3EJV A;  3IPT A;  3S27 A;  3AMO A;  3KN4 A;  4WYK B;  3MG1 A;  1RMS A;  3AGO A;  3Q90 A;  5G2G A;  5CF2 A;  1IT8 A;  3UJM A;  2XSH B;  4RNT A;  4LYL B;  2L1S A;  3S67 A;  2CC3 A;  3M8C A;  1AVL A;  4LSO A;  3WHO A;  2CIU A;  3B7C A;  3EQQ B;  2AAD A;  3I0Y A;  3ECF A;  1RGL A;  1IV9 A;  3FG1 A;  3NHX A;  1IU7 A;  3NQZ A;  3X3Y A;  3LML A;  6STD A;  1D6Y A;  2PZV A;  4HM4 B;  1N8Q A;  5IG0 A;  3ZG0 A;  3SOY A;  1RGA A;  2XF3 A;  3K5T A;  3OWS A;  4WWU C;  2YFJ B;  5G1L A;  3B4P A;  1EEJ A;  5IF6 A;  2ML5 A;  3CCS 3;  3QK9 A;  3ROB A;  3DGO A;  2H0I A;  3D5I A;  1JB5 A;  3GZR A;  1EA2 A;  5HGR A;  4BTX A;  5JPU A;  1GSP A;  2R41 A;  2UUG C;  3EF8 A;  3HZP A;  3ZG5 A;  4MEI A;  1GOY A;  4FMD A;  1IVW A;  3DUK A;  5ELJ A;  1GY7 A;  3NX0 A;  2OOV C;  2AAE A;  4I5Q A;  2W56 B;  1HZ1 A;  1KSI A;  1D6Z A;  3A5E A;  1O7M B;  4JRF A;  1A90 A;  1YVB I;  2KF5 A;  2M7O A;  1YNV X;  2CHC A;  3CME 3;  1EUI C;  1HKX A;  1RGF A;  2CG1 A;  1RGH A;  1BSE A;  2BMQ B;  3PYJ A;  2QEX 3;  1YJ9 3;  1Q81 4;  3CC2 3;  3CCR 3;  1I3I A;  2P09 A;  1NDO B;  3UL6 A;  1BAN A;  4MMY B;  1F8N A;  3GZY B;  2RNT A;  2IY2 A;  3AMO B;  1W2B 2;  3D79 A;  2Z6B A;  4I4K A;  5LC6 A;  1LOV A;  4H3U A;  1JB4 A;  1QVG 2;  3F9S A;  5AYS C;  1MNL A;  3UNL A;  5LC7 A;  3N9H A;  4XDV A;  1NB3 I;  1U5O A;  3IMA B;  2B24 B;  4FCM A;  2A15 A;  3DMC A;  2CFW A;  4LMI A;  2GEY A;  3MSO A;  7GSP A;  4Q53 A;  1N5P A;  5IER A;  4HM5 B;  2INX A;  2D1W A;  1K73 4;  5KP1 A;  3WA3 A;  2KAA A;  1JKG A;  5STD A;  2CFK A;  2XGL A;  3ZFZ A;  4ORL A;  3SXX A;  1IQX A;  2QIY A;  1BRS A;  5IG3 A;  3IJE B;  3LTA A;  4HYZ A;  3GZB A;  2H0H A;  1BNF A;  3CPO A;  3H51 A;  3MHE A;  1CH0 A;  1VQP 3;  1W01 A;  3X40 A;  5AII A;  2GU3 A;  2SBL A;  3EC9 A;  4LZI A;  2GXF A;  1LQM B;  1R4C A;  1NO3 A;  3F7X A;  1OGZ A;  4IPB A;  4AKY A;  3CCJ 3;  1OH0 A;  5FW5 A;  1YJN 3;  1YVS A;  3LT8 A;  2F4Y A;  1UUG B;  1GMR A;  2QA4 3;  2OCT A;  2STD A;  4R9K A;  1UUW B;  4GSP A;  3PCR A;  4CPK A;  2XR8 B;  1MWU A;  2F86 B;  1DE3 A;  3CC4 3;  3OW2 2;  2C11 A;  1VQ4 3;  4L7K A;  1JBT A;  3VSY A;  1FGQ A;  1STD A;  1TRQ A;  3DY5 A;  1AY7 A;  3X41 A;  1QAL A;  3KSP A;  1YIT 3;  3FLJ A;  2FXT A;  3EB8 A;  1V57 A;  1MWS A;  2CWU A;  2KF3 A;  3AHW A;  2Z76 A;  1OCV A;  1W4N A;  5HOH A;  1T2I A;  1M90 4;  2H0G A;  2K3D A;  1ASK A;  3E99 A;  4X2H A;  4CJN A;  1OF5 B;  2J8X B;  4EV5 A;  1O7N B;  1MOL A;  3EHC A;  1VQL 3;  1DVC A;  1UGI A;  3L0R A;  1W6G A;  4STD A;  3CCU 3;  1GYB A;  3KII A;  1SIH A;  4HM8 B;  2O3O A;  3NQY A;  1BVI A;  1GS3 A;  1JKG B;  1R4Y A;  1SPU A;  4BTY A;  4J5G A;  3LXU X;  3JUN A;  3JUP A;  3B8L A;  4GB5 A;  4O3V A;  2F5M A;  2WOH A;  4XDW A;  1BNS A;  1V58 A;  2ZHX B;  2WO0 A;  3V99 A;  3T8N A;  1WTH A;  2BT3 A;  3B4O A;  1YI2 3;  2IUJ A;  1SAR A;  3F8H A;  3T8U A;  1GMP A;  3KSE D;  1FGT A;  1I2E A;  8RNT A;  4BL3 A;  1W5Z A;  2IYJ A;  2QGU A;  1GD4 A;  3CCM 3;  1UDI I;  3SYU A;  2OWP A;  9RNT A;  3NBB A;  4FCZ A;  6RNT A;  1UUV B;  2HML B;  4EV2 A;  1B20 A;  5IG4 A;  1I70 A;  1GOU A;  3MKI A;  5EQL A;  1FGM A;  4IIA A;  4ILF A;  4N6O B;  5IEP A;  4HZ9 B;  4KFE A;  3DGL A;  2HMJ B;  1QMA A;  2KRT A;  2D42 A;  1UGH I;  1ZGX A;  5D82 A;  5EVH A;  1OHS A;  1RLS A;  3X3X A;  1RGE A;  2WOF A;  3EBT A;  1IT7 A;  1CYV A;  1OHP A;  2GBW B;  1QJG A;  1I2F A;  2KF4 A;  4RNY A;  4ZM8 A;  5M19 A;  1IV7 A;  1BNJ A;  2GU1 A;  1RKY A;  1N9E A;  4FMC A;  3VF1 A; 
#chains in the Genus database with same CATH homology
 1E97 A;  1WMN A;  4XBX A;  3SX1 A;  1CEW I;  3X3Z A;  2XRX B;  5CXO A;  1US1 A;  3EE1 A;  3VGN A;  2B1X B;  3MYT A;  2HMN B;  4KZ1 A;  3RGR A;  1TIJ A;  4WFO A;  2FGT A;  3OV4 A;  3K7C A;  4J9A A;  3FG4 A;  4HVN A;  3D3L A;  1HU9 A;  2W6J H;  3NV0 B;  4TX4 A;  4HM7 B;  2BMR B;  2GEX A;  4KFD A;  7STD A;  4R9L A;  1SQW A;  2K54 A;  4HBR A;  1EKM A;  2BO9 B;  3S5C A;  3GAX A;  5IW9 A;  1ROV A;  4MMX B;  1D6U A;  1BUQ A;  1IVU A;  3STD A;  3MPH A;  3CU3 A;  1VQM 3;  5KP4 A;  3WOD G;  5AEU B;  3A76 A;  1RRH A;  3FF0 A;  1VQ8 3;  3GZX B;  4RBN A;  2I9W A;  3G6E 3;  2IMJ A;  4U13 A;  1GY6 A;  1S5A A;  2OQE C;  5D81 A;  5BXQ A;  3FGY A;  1DMN A;  3U97 A;  3GRD A;  3HK4 A;  2CKF B;  1W00 A;  1KD1 4;  2CH9 A;  1A2K A;  4O8S A;  1OAC A;  3CC7 3;  1GD3 A;  1PFP A;  1L5G B;  5TGN A;  1VZZ A;  2HMK B;  4NRE A;  3V92 A;  1YJW 3;  2ML6 A;  2W2C A;  3BLZ A;  4XBT A;  2XH9 A;  3LYG A;  4X2O A;  1IQ8 A;  2CWV A;  5IG5 A;  1G96 A;  1Q40 A;  1O7G B;  3DM8 A;  3UL5 A;  1NB5 I;  2W9Q A;  1STF I;  3DGN A;  2E2U A;  1A67 A;  1U8C B;  1Q42 A;  1FGO A;  1ZX2 A;  1CYU A;  1M1X B;  3LTD A;  2XFT A;  4NHF A;  3CCV 3;  1VQN 3;  4FMB A;  4HZB B;  1V74 A;  3CCL 3;  4KVH A;  4O2H A;  3WA2 X;  2XEP A;  1YIJ 3;  2K0M A;  3Q2P A;  3JUO A;  1DVD A;  1K28 A;  1QAF A;  1N5H A;  1CQS A;  5AYR B;  4CCV A;  3KKG A;  2W03 A;  3BND A;  1NWW A;  2L4V A;  3NM7 A;  3DZL A;  3O8Y A;  1LOX A;  4H61 A;  1IQY A;  1JRQ A;  3K9M C;  5CK6 A;  4WYK A;  3JVC A;  1IVX A;  3ALA A;  3SLU A;  1WQL B;  3KE7 A;  5ELU A;  3WMD A;  2YFI B;  3N54 B;  3D9R A;  1Z1S A;  4AKZ A;  5JBS A;  1YHQ 3;  1DMQ A;  2Y74 A;  4HM1 B;  3CMA 3;  8CHO A;  3PCS A;  3SVA A;  3FZW A;  5KP3 A;  3CNX A;  1FGR A;  2CG0 A;  1W02 A;  4HM0 B;  1Q40 B;  3MG3 A;  1M1K 4;  3FH1 A;  4AEQ A;  1W7C A;  3OX9 A;  2PNC A;  4XBY A;  3NBJ A;  4LEH A;  1VQO 3;  3DXO A;  3TDG A;  3MG2 A;  3I56 3;  4RZM A;  1NJI 4;  4HJL B;  4R1K A;  3FKA A;  2W56 A;  2W9P A;  4K90 B;  5DRE A;  1OGX A;  2CFG A;  2P0M A;  3T0U A;  2KCD A;  3WOF B;  1O7P B;  3EBY A;  2UX0 A;  1JNQ A;  5JPP A;  1IK3 A;  1ISK A;  1DMM A;  2RCD A;  3SOA A;  3NM2 A;  4OK0 A;  1GY5 A;  1AVK A;  2CW9 A;  2Z7A A;  3V98 A;  1UI7 A;  3PZW A;  4L8O A;  1RRL A;  1PU4 A;  1E3R A;  3ER7 A;  4N6T A;  3HII A;  2GBX B;  3JUM A;  4QWT A;  1N9E A;  2MC8 A;  3LTC A;  3G8Z A;  1VQK 3;  1EQK A;  1RN7 A;  4N6L A;  4MJD A;  5IEO A;  3FSD A;  4K1V A;  1M9G A;  5AIH A;  3SED A;  3Q1C A;  3KFQ C;  1OPY A;  2HMM B;  1JJ2 2;  1FA3 A;  1TP6 A;  4HM2 B;  2C10 A;  5A0O B;  1WNH A;  2BHM A;  1VQ9 3;  2Z77 A;  1WMO A;  4BTW A;  5DRV A;  1FUW A;  4OUQ A;  2W0Q A;  1UI8 A;  2CFL A;  3FCS B;  1W6Y A;  4HM3 B;  2BNG A;  2RFR A;  5BVB A;  1IDP A;  4MMZ B;  3K0Z A;  1N8R 4;  5AIF A;  4HM6 B;  4R4K A;  5IEN A;  1DYU A;  3BB9 A;  2OTL 3;  2XSO B;  3BNE A;  3LOY A;  1VQ7 3;  1AR0 A;  2ZDJ A;  1JB2 A;  4FCJ A;  4KFF A;  1VQ5 3;  4IT7 A;  1IVV A;  2OTJ 3;  1ULJ B;  4FR9 A;  4R80 A;  2RSX A;  3KZT A;  3CCE 3;  3FG3 A;  1Q82 4;  3OXA A;  3X42 A;  3G71 3;  4JF8 A;  2YFL B;  3PS8 A;  3GWR A;  4GL6 A;  1OUN A;  3G4S 3;  1A2V A;  1YGE A;  3G16 A;  5D83 A;  2F99 A;  3RGA A;  1QVF 2;  2P05 A;  1Q7Y 4;  3EN8 A;  3OWY A;  1W2Z A;  1W6C A;  2MF7 A;  4K61 A;  2YX9 A;  4OVM A;  5EEO A;  2OOV A;  2O9U X;  4N6U A;  4K1U A;  2E2T A;  1TFK A;  5AIG A;  3N8B A;  3MWZ A;  1JN5 A;  4J8T A;  2XFS A;  1OF5 A;  2R4I A;  3JUQ A;  2CFD A;  4RNZ A;  1J2B A;  2WGQ A;  1LVN A;  2ZL8 A;  1T5Y A;  4WHA A;  5AI1 A;  1JV2 B;  1ROA A;  2RGQ A;  3K63 A;  4FMA A;  1LXE A;  2P38 A;  1NU3 A;  3WDG B;  3F7S A;  2OQE A;  3LH4 A;  3BNC A;  3LTB A;  4LGQ A;  5FGO A;  3UB1 A;  3F14 A;  4N6N B;  4N3V A;  4O02 B;  1KWI A;  2E2V A;  3CXC 2;  1UW1 A;  1RJO A;  4G1M B;  2XGN A;  3PXM A;  1TUH A;  2IA7 A;  3HX8 A;  3CPW 2;  3CCQ 3;  1OHO A;  4CDL A;  3PGB A;  4L8P A;  4N6V 0;  5AEW B;  1SII A;  1O7H B;  3NUV A;  4EXR A;  1C7H A;  3CNM A;  3NXJ A;  3HIG A;  5CLK A;  2HMO B;  1LNH A;  1SJW A;  1TU5 A;  3HI7 A;  1S72 3;  3J7Y d;  1Q86 4;  4EBG A;  4N6M A;  3NBR A;  3EX9 A;  1WMP A;  4EC6 A;  1VQ6 3;  2FNQ A;  2JQ5 A;  3U1W A;  3H3H A;  2Y73 A;  1JN5 B;  2KXG A;  2LYX A;  2CK3 H;  3CD6 3;  3EN1 B;  3F40 A;  1K9M 4;  2P0X A;  1ZO2 A;  4HKV B;  3G0K A;  5I97 A;  2WGO A;  4XM4 A;  3LZA A;  5CF1 A;  1ULI B;  2V1L A;  2LQV A;  1O7W B;  3NV0 A;  4EYC A;  3WOE B;  4PEJ A;  2CWT A;  3S29 A;  1KQS 2;  1AV4 A;  1TFO A;  2W04 A;  3QRD A;  2BMO B;  3I55 3;  1QAK A;  3LT9 A;  3DGM A;  2JDI H;  4WP5 A;  1N9J A;  3S28 A;  3BNB A;  1KC8 4;  2F98 A;  3FF2 A;  1K41 A;  1Y4K A;  1E3V A;  3OWU A;  3RDE A;  4XB5 A;  3F8X A;  2Q07 A;  3EJV A;  1EG9 B;  3IPT A;  3S27 A;  3AMO A;  3KN4 A;  4WYK B;  3MG1 A;  3Q90 A;  5G2G A;  5CF2 A;  1IT8 A;  3UJM A;  2XSH B;  3S67 A;  2CC3 A;  3M8C A;  1AVL A;  4LSO A;  2CIU A;  3B7C A;  3EQQ B;  3I0Y A;  3ECF A;  3FG1 A;  1IV9 A;  3NHX A;  3NQZ A;  1IU7 A;  3X3Y A;  6STD A;  3LML A;  1D6Y A;  2PZV A;  4HM4 B;  1N8Q A;  5IG0 A;  3SOY A;  2XF3 A;  3K5T A;  3OWS A;  4WWU C;  2YFJ B;  3B4P A;  5IF6 A;  2ML5 A;  3CCS 3;  3QK9 A;  3ROB A;  3DGO A;  1JB5 A;  3GZR A;  1EA2 A;  5HGR A;  4BTX A;  5JPU A;  3EF8 A;  3HZP A;  4MEI A;  4FMD A;  1IVW A;  3DUK A;  5ELJ A;  1GY7 A;  3NX0 A;  2OOV C;  2W56 B;  1KSI A;  1D6Z A;  4JRF A;  1O7M B;  1A90 A;  1YVB I;  2M7O A;  2CHC A;  3CME 3;  1HKX A;  2CG1 A;  2BMQ B;  3PYJ A;  2QEX 3;  1YJ9 3;  1Q81 4;  3CC2 3;  3CCR 3;  2P09 A;  3UL6 A;  1NDO B;  4MMY B;  1F8N A;  3GZY B;  3AMO B;  1W2B 2;  5LC6 A;  2Z6B A;  4I4K A;  4H3U A;  1JB4 A;  1QVG 2;  3F9S A;  5AYS C;  1MNL A;  3UNL A;  5LC7 A;  3N9H A;  4XDV A;  1NB3 I;  1U5O A;  3IMA B;  2B24 B;  4FCM A;  2A15 A;  3DMC A;  2CFW A;  4LMI A;  2GEY A;  3MSO A;  4Q53 A;  1N5P A;  5IER A;  4HM5 B;  2INX A;  2D1W A;  1K73 4;  5KP1 A;  3WA3 A;  1JKG A;  5STD A;  2CFK A;  2XGL A;  4ORL A;  3SXX A;  1IQX A;  2QIY A;  5IG3 A;  3IJE B;  3LTA A;  4HYZ A;  3GZB A;  3CPO A;  3H51 A;  3MHE A;  1VQP 3;  1W01 A;  3X40 A;  5AII A;  2GU3 A;  2SBL A;  3EC9 A;  4LZI A;  2GXF A;  1R4C A;  1NO3 A;  3F7X A;  1OGZ A;  4IPB A;  4AKY A;  3CCJ 3;  1OH0 A;  5FW5 A;  1YJN 3;  3LT8 A;  2QA4 3;  2OCT A;  2STD A;  4R9K A;  1UUW B;  3PCR A;  2XR8 B;  2F86 B;  3CC4 3;  3OW2 2;  2C11 A;  1VQ4 3;  4L7K A;  3VSY A;  1FGQ A;  1STD A;  3DY5 A;  3X41 A;  1QAL A;  3KSP A;  1YIT 3;  3FLJ A;  2FXT A;  3EB8 A;  2CWU A;  2Z76 A;  1OCV A;  1W4N A;  1M90 4;  1ASK A;  3E99 A;  4X2H A;  1OF5 B;  4EV5 A;  1O7N B;  1MOL A;  3EHC A;  1VQL 3;  1DVC A;  3L0R A;  1W6G A;  4STD A;  3CCU 3;  1GYB A;  3KII A;  1SIH A;  4HM8 B;  2O3O A;  3NQY A;  1GS3 A;  1JKG B;  1SPU A;  4BTY A;  3LXU X;  3JUN A;  3JUP A;  3B8L A;  4GB5 A;  4O3V A;  2WOH A;  4XDW A;  3V99 A;  1K8A 4;  2WO0 A;  3T8N A;  1WTH A;  2BT3 A;  3B4O A;  1YI2 3;  2IUJ A;  3F8H A;  3T8U A;  3KSE D;  1FGT A;  1W5Z A;  2QGU A;  1GD4 A;  3CCM 3;  2OWP A;  3NBB A;  4FCZ A;  1UUV B;  2HML B;  4EV2 A;  5IG4 A;  3MKI A;  5EQL A;  1FGM A;  4IIA A;  4N6O B;  5IEP A;  4HZ9 B;  4KFE A;  3DGL A;  2HMJ B;  1QMA A;  2KRT A;  2D42 A;  5D82 A;  5EVH A;  1OHS A;  3X3X A;  3EBT A;  2WOF A;  1IT7 A;  1CYV A;  1OHP A;  2GBW B;  1QJG A;  4RNY A;  4ZM8 A;  1IV7 A;  2GU1 A;  1RKY A;  2IUK A;  4FMC A;  3VF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...