1OCVA

The f116w mutant structure of ketosteroid isomerase from comamonas testosteroni
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALWGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Origin of the Different Ph Activity Profile in Two Homologous Ketosteroid Isomerases
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Ketosteroid isomerase
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ocvA00
4X2OA 1DMNA 2XSHB 1W6YA 3F7SA 3CNXA 3MHEA 4XDVA 1W02A 3VGNA 5AIGA 1JKGA 1ASKA 3NBRA 2F98A 1TUHA 1ULJB 5AEUB 5D81A 1OF5A 4HM0B 4J9AA 4K1VA 2CHCA 5JPPA 4KVHA 2XRXB 5KP1A 3M8CA 3SOYA 3JUNA 5IF6A 3I0YA 1EG9B 2INXA 1JB2A 2F86B 3LYGA 1Q40B 3FLJA 4R9KA 1JN5B 1OCVA 4HM5B 5AEWB 4X2HA 3FZWA 4RZMA 3KSPA 1GYBA 1W00A 4HM6B 1NDOB 3FF2A 1STDA 4HJLB 4LMIA 6STDA 3G16A 3KZTA 4HM7B 4HZ9B 2K54A 5TGNA 7STDA 1JN5A 3F14A 5CF1A 4LGQA 4HM8B 2XR8B 1E97A 4HM3B 8CHOA 1SJWA 3NM2A 3ECFA 4I4KA 5IG4A 3OX9A 3MG2A 1QJGA 2RFRA 3MYTA 1ZO2A 2HMLB 2XSOB 3ROBA 1O7WB 3CPOA 5DREA 3UNLA 2YFJB 1E3RA 3MG1A 5IENA 1GY6A 3RGAA 1OH0A 5IG5A 2Z77A 3OWSA 1EA2A 3S5CA 1GS3A 1UUWB 1E3VA 1OHPA 1BUQA 4XB5A 1W01A 5AIHA 2HMJB 3EN8A 3GZBA 3BLZA 4GB5A 4OUQA 5CF2A 2A15A 5KP3A 2I9WA 3JUQA 3K0ZA 1TP6A 3G0KA 5JPUA 3MG3A 4WWUC 3VSYA 5CLKA 2B1XB 3FKAA 2F99A 1DMMA 3BB9A 5KP4A 3B8LA 1ZX2A 1CQSA 2YFLB 3FSDA 1OGZA 3EBYA 3UJMA 3OXAA 5CXOA 3LZAA 4XM4A 3GZYB 4STDA 4WP5A 3EN1B 4HM2B 1DMQA 2Z76A 4XBYA 1OHOA 3DMCA 2PZVA 3GZRA 4K1UA 3MSOA 2UX0A 4L8OA 1C7HA 1S5AA 1U5OA 3NXJA 3HX8A 4J8TA 5FW5A 4HM4B 5AIFA 1OHSA 2GBWB 3K7CA 3DM8A 1NU3A 1O7GB 3KKGA 1Q40A 3CU3A 4XDWA 1GY5A 5IG3A 3F8XA 2GEYA 3B7CA 5D82A 2B24B 4WYKB 3EC9A 1A2KA 3GZXB 5IG0A 1GY7A 4PEJA 5IERA 1O7PB 3IPTA 3FF0A 2GXFA 1Z1SA 4L7KA 3WMDA 2HMMB 3OWUA 1JKGB 4N3VA 3ER7A 2IMJA 2STDA 5HGRA 3NV0B 3FGYA 2BMRB 1OF5B 4XBXA 5D83A 2HMKB 2QGUA 4HKVB 2QIYA 3FH1A 5EVHA 4WYKA 4U13A 3KE7A 1ISKA 3EX9A 1NWWA 3T8UA 2GEXA 1IDPA 2BMQB 3CNMA 5DRVA 5G2GA 2CKFB 4MJDA 3EHCA 1O7HB 3G8ZA 1OPYA 4R9LA 3NV0A 4LEHA 3H3HA 3GRDA 3F40A 1WQLB 3DXOA 4R1KA 3EJVA 2BNGA 1OGXA 2W2CA 5AIIA 2YFIB 1AR0A 3F9SA 4FCMA 3JUPA 5AI1A 2Z7AA 4IIAA 3DUKA 4HZBB 3RGRA 5BXQA 2OWPA 5BVBA 4L8PA 2GBXB 1OUNA 3OV4A 4FCJA 3D9RA 3JUOA 1JB5A 3B4OA 1K41A 4OVMA 3HZPA 3OWYA 5CK6A 3HK4A 3NHXA 4CDLA 5STDA 2JQ5A 1QMAA 1UUVB 2RCDA 2R4IA 1O7NB 3EQQB 5IEPA 2HMNB 4Q53A 1ULIB 3B4PA 4XBTA 3EF8A 3MKIA 3JUMA 2HMOB 4HM1B 4ORLA 4HVNA 4H3UA 3STDA 3SEDA 3T8NA 3SOAA 3F8HA 2RGQA 1HKXA 1JB4A 1O7MB 3A76A 3F7XA 3GWRA 2BMOB 3DZLA 5IEOA 1Q42A 3H51A 3EBTA 3Q90A 1VZZA 3NUVA 3E99A
chains in the Genus database with same CATH superfamily
4X2OA 3L0RA 1DMNA 1NO3A 1W6YA 2XSHB 3F7SA 2C4BA 3CNXA 5I97A 1Q814 1N9EA 1SIHA 3MHEA 4XDVA 3URPA 1W02A 1LQMB 4DKIA 2AAEA 3PZWA 3VGNA 5AIGA 1JKGA 4BTYA 3LH4A 1UW1A 2W9PA 1A90A 1ASKA 1GMRA 3WR2A 3NBRA 1B2XA 1YGEA 1US1A 2F98A 2W56A 1TUHA 4JF8A 1IK3A 1ULJB 2CIUA 5AEUB 1BRJA 2FGTA 3CCU3 5D81A 2O3OA 1LQGC 2C11A 3EB8A 3FG1A 3X3YA 1VQ93 1OF5A 4LSOA 3KFQC 1JZDA 1RCLA 8RNTA 4HM0B 4BL2A 4J9AA 4EXRA 4K1VA 2CHCA 5JPPA 4KVHA 5CF1A 3N9HA 2XRXB 5KP1A 3M8CA 3PGBA 1FGTA 1BNRA 2J8XB 4MMXB 2RNTA 1Q864 3SOYA 5BIRA 3JUNA 5IF6A 3I0YA 1EG9B 1V74A 5M18A 4G1MB 1D6UA 1EEJA 1PYLA 1T5YA 1KSIA 2INXA 3SLUA 1JB2A 4N6OB 3WOEB 4KFDA 1YGWA 1N5PA 2PNCA 2F86B 2P05A 1R4YA 5ELJA 3LYGA 1GSPA 1Q40B 2XF3A 3N54B 1D6ZA 3FLJA 1LVNA 1W2B2 4R9KA 5EEOA 3AMOA 4EBGA 1JN5B 2HOHA 3KCHA 4NHFA 2H0GA 1OCVA 3SVAA 1LOWA 1X1UA 4IT7A 1GOUA 1UI7A 4IPBA 1CEWI 3BU4A 4HM5B 3Q2PA 1DYUA 2K3DA 1DVCA 3BIRA 3CCR3 5AEWB 1RN1A 2WGOA 1RN4A 4EW5A 1M1XB 4X2HA 1OACA 3CCS3 1JBSA 1TIJA 3FZWA 1BNEA 4ZM8A 3KIIA 2XFSA 4RZMA 3KSPA 4HYZA 4FCZA 2KCDA 3OW22 2AADA 1MWRA 1GYBA 2W0QA 1W00A 4GL6A 4HM6B 3TDGA 2KF6A 1BRHA 2GSPA 1NDOB 2R41A 1RGGA 2SBLA 4EV5A 1RJOA 3FF2A 2E2TA 4OK0A 1KQS2 1STDA 1RGKA 1BGSA 1MOLA 3BNEA 4HJLB 2SARA 1NNVA 3S67A 5RNTA 1AV4A 1YIT3 1RGAA 1X1XA 4RNYA 5G1LA 4LMIA 2L1SA 6STDA 3G16A 1EUIC 3KZTA 4HM7B 4HZ9B 2K54A 5TGNA 6RNTA 1YIJ3 1FA3A 1UCJA 2O9UX 5LC7A 7STDA 1JN5A 2GU3A 1Y4KA 1GD3A 3F14A 1AVLA 2UGIA 4HM8B 4LGQA 4MEIA 4RBNA 2XR8B 3WA2X 3HIGA 1E97A 5A0OB 4HM3B 1JNQA 8CHOA 3ZG0A 7GSPA 1SJWA 1RDSA 2BT3A 3EE1A 3NM2A 2W6JH 1K734 3CCV3 1TFKA 3ECFA 4I4KA 4BU4A 5IG4A 3LTCA 3PXMA 2W04A 5G1KA 3OX9A 1LOXA 1YJN3 3UB1A 3MG2A 2ZDJA 1QJGA 1R4CA 2LQVA 1QVF2 2RFRA 3N8BA 4O3VA 3MYTA 2CFKA 4BTWA 3I563 1ZO2A 2HMLB 1KD14 2XSOB 4MMZB 3G6E3 1V57A 3ROBA 1NB5I 1O7WB 3CPOA 4HAAA 1RRLA 4LZIA 3CC73 3AHWA 1RGCA 5DREA 1Q7Y4 4O8SA 3UNLA 3V99A 1BOXA 4K61A 1N5HA 1IVUA 2YFJB 4N6UA 1DE3A 1E3RA 3MG1A 5IENA 2CWUA 1GY6A 2OCTA 3X41A 3RGAA 3LTAA 1GD4A 4FMDA 1VQ73 1OH0A 1I3IA 1IVVA 5AYRB 1N9JA 1UGIA 5IG5A 1IQ8A 1BRKA 3DGNA 3K63A 4N6V0 2Y73A 1YJW3 2Z77A 3OWSA 4AKZA 3CD63 1RGLA 2CG0A 4HOHA 1BNIA 1EA2A 2WO0A 3WHOA 1RNBA 1FGOA 1WTHA 2IUKA 2QEX3 3S5CA 1F8NA 3LT9A 3MWZA 1GS3A 3DH2A 1UUWB 1E3VA 1OHPA 1BUQA 4RNZA 2GU1A 1UGHI 1LXEA 1W5ZA 4XB5A 2CK3H 1RSNA 3CME3 1W01A 1BSCA 5AIHA 2HMJB 2Y74A 3EN8A 3GZBA 1DETA 2LYXA 1FYSA 1M904 1BU4A 3BLZA 4GB5A 4OUQA 5CF2A 2A15A 5KP3A 2I9WA 3JUQA 3K0ZA 4MMYB 1TP6A 2OQEA 3G0KA 2CFGA 5JPUA 1VQ43 3MG3A 4WWUC 3VSYA 5CLKA 4JRFA 1LNHA 2B1XB 3FCSB 3FKAA 2F99A 1DMMA 1BNJA 1B21A 3BB9A 1GMQA 3UL6A 2JDIH 9RNTA 2OTJ3 1T2HA 2L4VA 1JRQA 4ILFA 5KP4A 3B8LA 1ZX2A 1CQSA 1RTUA 2YFLB 3JVCA 1GOVA 3FSDA 1YHQ3 1TTOA 1G96A 1OGZA 1J2BA 3D79A 3EBYA 4R80A 4WHAA 1VQO3 3GSPA 3NBBA 1IQXA 3CCL3 1BSEA 1QAKA 2P0MA 3UJMA 1BAOA 3OXAA 4GSPA 1BRNL 5CXOA 2CFWA 3LZAA 1MNLA 1BSDA 1HYFA 3AGNA 1ZGXA 2CX0A 2Q07A 3LMLA 4XM4A 1GOYA 3GZYB 3NQZA 4TX4A 1FW7A 4STDA 4EYCA 4WP5A 1KWIA 1U8CB 1VQ63 3EN1B 3WDGB 4HM2B 1DMQA 2Z76A 2F5WA 4XBYA 2M7OA 1SQWA 1WMNA 2ML5A 1OHOA 1CYVA 3DMCA 3HOHA 1W7CA 2PZVA 5IW9A 1UDII 1W6CA 3GZRA 2H0HA 4K1UA 3MSOA 2UX0A 4L8OA 1C7HA 3CCM3 1S5AA 1U5OA 1BIRA 3NXJA 1RGEA 3HX8A 4J8TA 5FW5A 4HM4B 4CPKA 5AIFA 1C54A 1OHSA 3IMAB 2GBWB 3K7CA 3DM8A 1D6YA 2V1LA 1VQ83 1MWSA 3HI7A 1LOVA 4O02B 1NU3A 1B2ZA 1O7GB 3NM7A 3KKGA 1VQP3 1Q40A 1ZS7A 2CFLA 4BIRA 1A2PA 4FMAA 3CU3A 3SX1A 1I2EA 4XDWA 1MGRA 2YX9A 3IJEB 1I0VA 1M9GA 1GY5A 2OQEC 5IG3A 3F8XA 2CC3A 2E2UA 3GAXA 1IVWA 2GEYA 1IU7A 2KF5A 1BRGA 1BNSA 3B7CA 3S27A 1RGHA 1T3BA 3Q1CA 5D82A 2B24B 4RNTA 1Q7HA 1N8R4 1K8A4 2CWTA 3EC9A 1A2KA 3GZXB 4WYKB 5IG0A 6GSPA 1GY7A 4PEJA 1B20A 1UCIA 1VQ53 2KF3A 5IERA 2UUGC 3WA3A 1TFOA 1FUTA 1O7PB 3S29A 1RCKA 2F5MA 3FF0A 3DGLA 2GXFA 3IPTA 3K5TA 3CPW2 1JBTA 1Z1SA 3A5EA 4L7KA 2WGQA 4KZ1A 4BL3A 1IVXA 3WMDA 1SIIA 4NPBA 2HMMB 3ZG5A 3LTBA 2BIRA 3MPHA 4FR9A 4GHOA 3HIIA 1RN7A 1IT8A 3OWUA 1JKGB 4N3VA 3ER7A 4AKYA 1HZ1A 1AVKA 1BANA 1LRAA 2IMJA 4QWTA 5GSPA 1PY3A 2STDA 2ML6A 1K9M4 1FZUA 4H61A 5AYSC 5HGRA 3NV0B 2FNQA 1STFI 1Q9EA 2BMRB 3FGYA 2F4YA 4BTXA 3LXUX 3DGYA 3G713 2OTL3 1BVIA 1OF5B 3FG3A 4O2HA 1IT7A 1QALA 4XBXA 1UI8A 5D83A 2QA43 2IA7A 4CJNA 5BU4A 1VQN3 3PYJA 1YJ93 1CH0A 2HMKB 2QGUA 4HKVB 1X1YA 2QIYA 3FH1A 5EVHA 2ZHXB 4LYLB 1NB3I 4WYKA 3V98A 3D5IA 1JBRA 4U13A 3KE7A 1ISKA 1YVSA 1BRIA 3LT8A 4HBRA 3CC23 3EX9A 2ZL8A 1NWWA 1IV9A 2E2VA 1RRHA 1K28A 2F56A 3T8UA 2GEXA 1EQKA 1HU9A 1JZOA 2K0MA 1VQK3 2ZA4A 1RLSA 1IDPA 5M19A 3K9MC 3CXC2 1VQL3 2KRTA 2BMQB 2W03A 1BSBA 3AMOB 1FGRA 3CNMA 5DRVA 1G02A 1TJDA 3V92A 1CYUA 1W2ZA 5G2GA 2CKFB 1B2UA 2IYJA 1RHLA 4MJDA 1I2FA 3EHCA 3RNTA 1YI23 1O7HB 1RGFA 3G4S3 1W6GA 2KAAA 1MGWA 3G8ZA 1IQYA 5FGOA 1OPYA 2WOFA 4R9LA 3WODG 4NREA 3D3LA 3CMA3 3NV0A 4LEHA 2BHMA 3H3HA 3GRDA 3F40A 3I553 1WQLB 1UUGB 3DXOA 3O8YA 4R1KA 3X42A 1B27A 3EJVA 2BNGA 1FUWA 1OGXA 1YVBI 2W2CA 2CG1A 3DY5A 1I70A 5AIIA 2XGNA 4KFFA 4N6NB 3S28A 2YFIB 3DGMA 2IY2A 3AHSA 3QK9A 1AR0A 2RBIA 3F9SA 1W4NA 1FGQA 4FCMA 3JUPA 5AI1A 2Z7AA 2D42A 3FG4A 4IIAA 1G0TA 3DUKA 4HZBB 2C10A 1ROAA 1FUSA 3RGRA 5BXQA 3AGOA 2OWPA 1JV2B 1YNVX 5BVBA 4L8PA 2GBXB 1LOYA 1OUNA 3OV4A 2FXTA 4FCJA 2BU4A 1AQZA 3ALAA 3BNDA 3D9RA 3JUOA 1JB5A 2P38A 3B4OA 1K41A 3VF1A 4OVMA 3HZPA 3OWYA 3CCE3 3KN4A 5CK6A 1EKMA 4KT3B 1TRQA 3HK4A 1N8QA 3NHXA 2OOVA 2XFTA 3DGOA 1I2GA 2W9QA 3BNCA 4CCVA 5STDA 4CDLA 1RKYA 1UCLA 5JBSA 2JQ5A 3LOYA 3WOFB 1QMAA 1UUVB 1QAFA 1RMSA 4J5GA 2MC8A 2IUJA 2RCDA 2WOHA 2R4IA 4R4KA 5ELUA 1O7NB 3EQQB 1PU4A 1M1K4 2KF4A 1QVG2 4FMCA 5IEPA 1MWTA 1I3FA 2HMNB 4Q53A 1I8VA 1BNGA 3T0UA 3NBJA 3NQYA 1ULIB 5M1AA 3B4PA 3X3XA 3KSED 4WFOA 4EC6A 3SYUA 1A67A 5EQLA 2CWVA 4XBTA 2Z6BA 3EF8A 3X40A 3MKIA 3JUMA 2HMOB 4HM1B 1FGMA 1BSAA 4I5QA 1AY7A 2CW9A 4KFEA 1WMPA 1IV7A 1IYYA 1B3SA 1T2IA 2BO9B 4ORLA 3CC43 4HVNA 4H3UA 3STDA 1Q824 1JJ22 1TRPA 3NX0A 2XGLA 1SPUA 2CH9A 1BRSA 1MWUA 1X1WA 2XH9A 1VQM3 3D4AA 1GMPA 1I0XA 1B2MA 1UCKA 3SEDA 7RNTA 1DVDA 1WMOA 3LTDA 3QRDA 3RDEA 3T8NA 4J5KA 5LC6A 2W56B 4K90B 3PS8A 1L5GB 3SXXA 1ROVA 3SOAA 1LNIA 1B2SA 1SARA 2RSXA 3UL5A 1V58A 3F8HA 2RGQA 4AEQA 1HKXA 1JB4A 3BNBA 1O7MB 1PFPA 3A76A 1TU5A 2OOVC 3F7XA 3U1WA 4EV2A 3GWRA 3X3ZA 1NJI4 5HOHA 3CCJ3 4N6LA 2MF7A 3J7Yd 3ZFZA 4N6MA 2BMOB 1BNFA 2P09A 3DZLA 3Q3FA 5IEOA 2CX1A 3D5GA 4N6TA 1Q42A 1KC84 1BUJA 1A2VA 1S723 1WNHA 3H51A 3CCQ3 1RNTA 2KXGA 3PCSA 3U97A 3EBTA 2D1WA 2XEPA 3Q90A 2H0IA 2P0XA 1VZZA 3PCRA 4FMBA 3NUVA 1VQQA 3E99A 2CFDA
chains in the Genus database with same CATH topology
4X2OA 3L0RA 1DMNA 1NO3A 1W6YA 2XSHB 3F7SA 3CNXA 5I97A 1Q814 1N9EA 1SIHA 3MHEA 4XDVA 1W02A 3PZWA 3VGNA 5AIGA 1JKGA 4BTYA 3LH4A 1UW1A 2W9PA 1A90A 1ASKA 3NBRA 1YGEA 1US1A 2F98A 2W56A 1TUHA 4JF8A 1IK3A 1ULJB 2CIUA 5AEUB 2FGTA 3CCU3 5D81A 2O3OA 2C11A 3EB8A 3FG1A 3X3YA 1VQ93 1OF5A 4LSOA 3KFQC 4HM0B 4EXRA 4J9AA 4K1VA 2CHCA 5JPPA 4KVHA 3N9HA 2XRXB 5KP1A 3M8CA 3PGBA 1FGTA 4MMXB 3SOYA 3JUNA 5IF6A 3I0YA 1EG9B 1V74A 4G1MB 1D6UA 2INXA 3WOEB 1T5YA 1KSIA 3SLUA 1JB2A 4N6OB 4KFDA 1N5PA 2PNCA 2F86B 2P05A 5ELJA 3LYGA 1Q40B 2XF3A 3N54B 1D6ZA 3FLJA 1LVNA 1W2B2 4R9KA 5EEOA 3AMOA 4EBGA 1JN5B 4NHFA 1OCVA 3SVAA 4IT7A 1UI7A 4IPBA 1CEWI 4HM5B 3Q2PA 1DYUA 1DVCA 3CCR3 5AEWB 2WGOA 1M1XB 4X2HA 1OACA 3CCS3 1TIJA 3FZWA 4ZM8A 3KIIA 2XFSA 4RZMA 3KSPA 4HYZA 4FCZA 2KCDA 3OW22 1GYBA 2W0QA 1W00A 4GL6A 4HM6B 3TDGA 1NDOB 2SBLA 4EV5A 1RJOA 3FF2A 2E2TA 4OK0A 1KQS2 1STDA 1MOLA 3BNEA 4HJLB 3S67A 1AV4A 1YIT3 4RNYA 4LMIA 6STDA 3G16A 3KZTA 4HM7B 4HZ9B 2K54A 5TGNA 1YIJ3 1FA3A 2O9UX 5LC7A 7STDA 1JN5A 2GU3A 1Y4KA 1GD3A 3F14A 1AVLA 4HM8B 4LGQA 4MEIA 4RBNA 3WA2X 2XR8B 5CF1A 3HIGA 1E97A 5A0OB 4HM3B 1JNQA 8CHOA 1SJWA 2BT3A 3EE1A 3NM2A 2W6JH 1K734 3CCV3 1TFKA 3ECFA 4I4KA 5IG4A 3LTCA 3PXMA 2W04A 3OX9A 1LOXA 1YJN3 3UB1A 3MG2A 2ZDJA 1QJGA 1R4CA 2LQVA 1QVF2 2RFRA 3N8BA 4O3VA 3MYTA 2CFKA 4BTWA 3I563 1ZO2A 2HMLB 1KD14 2XSOB 4MMZB 3G6E3 3ROBA 1NB5I 1O7WB 3CPOA 4LZIA 1RRLA 3CC73 5DREA 1Q7Y4 4O8SA 3UNLA 3V99A 4K61A 1N5HA 1IVUA 2YFJB 4N6UA 1E3RA 3MG1A 5IENA 2CWUA 1GY6A 2OCTA 3X41A 3RGAA 3LTAA 1GD4A 4FMDA 1VQ73 1OH0A 1IVVA 5AYRB 1N9JA 5IG5A 1IQ8A 3DGNA 3K63A 4N6V0 2Y73A 1YJW3 2Z77A 3OWSA 4AKZA 3CD63 2CG0A 1EA2A 2WO0A 1FGOA 1WTHA 2IUKA 2QEX3 3S5CA 1F8NA 3LT9A 3MWZA 1GS3A 1UUWB 1E3VA 1OHPA 1BUQA 4RNZA 2GU1A 1LXEA 1W5ZA 4XB5A 2CK3H 3CME3 1W01A 5AIHA 2HMJB 2Y74A 3EN8A 3GZBA 2LYXA 1M904 3BLZA 4GB5A 4OUQA 5CF2A 2A15A 5KP3A 2I9WA 3JUQA 3K0ZA 4MMYB 1TP6A 2OQEA 3G0KA 2CFGA 5JPUA 1VQ43 3MG3A 4WWUC 3VSYA 5CLKA 4JRFA 1LNHA 2B1XB 3FCSB 3FKAA 2F99A 1DMMA 2OTJ3 3BB9A 1CYUA 3UL6A 2JDIH 2L4VA 1JRQA 5KP4A 3B8LA 1ZX2A 1CQSA 2YFLB 3JVCA 3FSDA 1YHQ3 1G96A 1OGZA 1J2BA 3EBYA 4R80A 4WHAA 1VQO3 3NBBA 1IQXA 3CCL3 1QAKA 2P0MA 3UJMA 3OXAA 5CXOA 2CFWA 3LZAA 1MNLA 3LMLA 2Q07A 4XM4A 3GZYB 3NQZA 4TX4A 4STDA 4EYCA 4WP5A 1KWIA 1U8CB 1VQ63 3EN1B 3WDGB 4HM2B 1DMQA 2Z76A 4XBYA 2M7OA 1SQWA 1WMNA 2ML5A 1OHOA 1CYVA 3DMCA 1W7CA 2PZVA 5IW9A 1W6CA 3GZRA 4K1UA 3MSOA 2UX0A 4L8OA 1C7HA 3CCM3 1S5AA 1U5OA 3NXJA 3HX8A 4J8TA 5FW5A 4HM4B 5AIFA 1OHSA 3IMAB 2GBWB 3K7CA 3DM8A 1D6YA 2V1LA 1VQ83 3HI7A 4O02B 1NU3A 1O7GB 3NM7A 3KKGA 1VQP3 1Q40A 2CFLA 4FMAA 3CU3A 3SX1A 4XDWA 2YX9A 3IJEB 1M9GA 1GY5A 2OQEC 5IG3A 3F8XA 2CC3A 2E2UA 3GAXA 1IVWA 2GEYA 1IU7A 3B7CA 3S27A 3Q1CA 5D82A 2B24B 1K8A4 1N8R4 2CWTA 3EC9A 1A2KA 3GZXB 4WYKB 5IG0A 1GY7A 4PEJA 1VQ53 5IERA 3WA3A 1TFOA 1O7PB 3S29A 3IPTA 3FF0A 3K5TA 3DGLA 2GXFA 3CPW2 1Z1SA 4L7KA 2WGQA 4KZ1A 1IVXA 3WMDA 1SIIA 2HMMB 3LTBA 3MPHA 4FR9A 3HIIA 1RN7A 1IT8A 3OWUA 1JKGB 4N3VA 3ER7A 4AKYA 1AVKA 2IMJA 4QWTA 2STDA 2ML6A 1K9M4 4H61A 5AYSC 5HGRA 3NV0B 2FNQA 1STFI 2BMRB 3FGYA 4BTXA 3G713 3LXUX 2OTL3 1OF5B 3FG3A 4O2HA 1IT7A 1QALA 4XBXA 1UI8A 5D83A 2QA43 2IA7A 1VQN3 3PYJA 1YJ93 2HMKB 2QGUA 4HKVB 2QIYA 3FH1A 5EVHA 1NB3I 4WYKA 3V98A 4U13A 3KE7A 1ISKA 3LT8A 4HBRA 3CC23 3EX9A 2ZL8A 1NWWA 1IV9A 2E2VA 1RRHA 1K28A 3T8UA 2GEXA 1EQKA 1HU9A 2K0MA 1VQK3 3CXC2 1IDPA 1VQL3 3K9MC 2KRTA 2BMQB 2W03A 3AMOB 1FGRA 3CNMA 5DRVA 3V92A 1W2ZA 5G2GA 2CKFB 4MJDA 3EHCA 1YI23 1O7HB 3G4S3 1W6GA 3G8ZA 3WODG 1IQYA 5FGOA 1OPYA 2WOFA 4R9LA 3CMA3 4NREA 3D3LA 3NV0A 4LEHA 2BHMA 3H3HA 3GRDA 3F40A 3I553 1WQLB 3DXOA 3O8YA 4R1KA 3X42A 3EJVA 2BNGA 1FUWA 1OGXA 2W2CA 1YVBI 2CG1A 3DY5A 5AIIA 2XGNA 4KFFA 4N6NB 3S28A 2YFIB 3DGMA 3QK9A 1AR0A 3F9SA 1Q864 1W4NA 1FGQA 4FCMA 3JUPA 5AI1A 2Z7AA 2D42A 3FG4A 4IIAA 3DUKA 4HZBB 2C10A 1ROAA 3RGRA 5BXQA 2OWPA 1JV2B 5BVBA 4L8PA 2GBXB 1OUNA 3OV4A 2FXTA 4FCJA 3D9RA 3ALAA 3BNDA 3JUOA 1JB5A 2P38A 3B4OA 1K41A 3VF1A 4OVMA 3HZPA 3OWYA 3CCE3 3KN4A 5CK6A 1EKMA 3HK4A 1N8QA 3NHXA 2OOVA 2XFTA 3DGOA 2W9QA 4CCVA 3BNCA 4CDLA 5STDA 1RKYA 5JBSA 2JQ5A 3LOYA 3WOFB 1QMAA 1UUVB 1QAFA 2MC8A 2IUJA 2RCDA 2WOHA 2R4IA 4R4KA 5ELUA 1O7NB 3EQQB 1PU4A 1M1K4 1QVG2 4FMCA 5IEPA 2HMNB 4Q53A 3T0UA 3NBJA 3NQYA 1ULIB 3B4PA 3X3XA 3KSED 4WFOA 4EC6A 1A67A 5EQLA 2CWVA 4XBTA 2Z6BA 3EF8A 3X40A 3MKIA 3JUMA 2HMOB 4HM1B 1FGMA 2CW9A 4KFEA 1WMPA 1IV7A 4ORLA 2BO9B 3CC43 4HVNA 4H3UA 3STDA 1Q824 1JJ22 3NX0A 2XGLA 1SPUA 2CH9A 2XH9A 1VQM3 3SEDA 1DVDA 1WMOA 3LTDA 3QRDA 3RDEA 3T8NA 5LC6A 2W56B 4K90B 3PS8A 1L5GB 3SXXA 1ROVA 3SOAA 2RSXA 3UL5A 3F8HA 2RGQA 4AEQA 1HKXA 1JB4A 3BNBA 1O7MB 1PFPA 3A76A 1TU5A 2OOVC 3F7XA 3U1WA 4EV2A 3GWRA 3X3ZA 1NJI4 3CCJ3 4N6LA 2MF7A 3J7Yd 4N6MA 2BMOB 3DZLA 2P09A 5IEOA 4N6TA 1Q42A 1KC84 1A2VA 1S723 1WNHA 3H51A 3CCQ3 2KXGA 3PCSA 3U97A 3EBTA 2D1WA 2XEPA 3Q90A 2P0XA 3PCRA 1VZZA 4FMBA 3NUVA 3E99A 2CFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2O A;  1DMN A;  2XSH B;  1W6Y A;  3F7S A;  3CNX A;  3MHE A;  4XDV A;  1W02 A;  3VGN A;  5AIG A;  1JKG A;  1ASK A;  3NBR A;  2F98 A;  1TUH A;  1ULJ B;  5AEU B;  5D81 A;  1OF5 A;  4HM0 B;  4J9A A;  4K1V A;  2CHC A;  5JPP A;  4KVH A;  2XRX B;  5KP1 A;  3M8C A;  3SOY A;  3JUN A;  5IF6 A;  3I0Y A;  1EG9 B;  2INX A;  1JB2 A;  2F86 B;  3LYG A;  1Q40 B;  3FLJ A;  4R9K A;  1JN5 B;  1OCV A;  4HM5 B;  5AEW B;  4X2H A;  3FZW A;  4RZM A;  3KSP A;  1GYB A;  1W00 A;  4HM6 B;  1NDO B;  3FF2 A;  1STD A;  4HJL B;  4LMI A;  6STD A;  3G16 A;  3KZT A;  4HM7 B;  4HZ9 B;  2K54 A;  5TGN A;  7STD A;  1JN5 A;  3F14 A;  5CF1 A;  4LGQ A;  4HM8 B;  2XR8 B;  1E97 A;  4HM3 B;  8CHO A;  1SJW A;  3NM2 A;  3ECF A;  4I4K A;  5IG4 A;  3OX9 A;  3MG2 A;  1QJG A;  2RFR A;  3MYT A;  1ZO2 A;  2HML B;  2XSO B;  3ROB A;  1O7W B;  3CPO A;  5DRE A;  3UNL A;  2YFJ B;  1E3R A;  3MG1 A;  5IEN A;  1GY6 A;  3RGA A;  1OH0 A;  5IG5 A;  2Z77 A;  3OWS A;  1EA2 A;  3S5C A;  1GS3 A;  1UUW B;  1E3V A;  1OHP A;  1BUQ A;  4XB5 A;  1W01 A;  5AIH A;  2HMJ B;  3EN8 A;  3GZB A;  3BLZ A;  4GB5 A;  4OUQ A;  5CF2 A;  2A15 A;  5KP3 A;  2I9W A;  3JUQ A;  3K0Z A;  1TP6 A;  3G0K A;  5JPU A;  3MG3 A;  4WWU C;  3VSY A;  5CLK A;  2B1X B;  3FKA A;  2F99 A;  1DMM A;  3BB9 A;  5KP4 A;  3B8L A;  1ZX2 A;  1CQS A;  2YFL B;  3FSD A;  1OGZ A;  3EBY A;  3UJM A;  3OXA A;  5CXO A;  3LZA A;  4XM4 A;  3GZY B;  4STD A;  4WP5 A;  3EN1 B;  4HM2 B;  1DMQ A;  2Z76 A;  4XBY A;  1OHO A;  3DMC A;  2PZV A;  3GZR A;  4K1U A;  3MSO A;  2UX0 A;  4L8O A;  1C7H A;  1S5A A;  1U5O A;  3NXJ A;  3HX8 A;  4J8T A;  5FW5 A;  4HM4 B;  5AIF A;  1OHS A;  2GBW B;  3K7C A;  3DM8 A;  1NU3 A;  1O7G B;  3KKG A;  1Q40 A;  3CU3 A;  4XDW A;  1GY5 A;  5IG3 A;  3F8X A;  2GEY A;  3B7C A;  5D82 A;  2B24 B;  4WYK B;  3EC9 A;  1A2K A;  3GZX B;  5IG0 A;  1GY7 A;  4PEJ A;  5IER A;  1O7P B;  3IPT A;  3FF0 A;  2GXF A;  1Z1S A;  4L7K A;  3WMD A;  2HMM B;  3OWU A;  1JKG B;  4N3V A;  3ER7 A;  2IMJ A;  2STD A;  5HGR A;  3NV0 B;  3FGY A;  2BMR B;  1OF5 B;  4XBX A;  5D83 A;  2HMK B;  2QGU A;  4HKV B;  2QIY A;  3FH1 A;  5EVH A;  4WYK A;  4U13 A;  3KE7 A;  1ISK A;  3EX9 A;  1NWW A;  3T8U A;  2GEX A;  1IDP A;  2BMQ B;  3CNM A;  5DRV A;  5G2G A;  2CKF B;  4MJD A;  3EHC A;  1O7H B;  3G8Z A;  1OPY A;  4R9L A;  3NV0 A;  4LEH A;  3H3H A;  3GRD A;  3F40 A;  1WQL B;  3DXO A;  4R1K A;  3EJV A;  2BNG A;  1OGX A;  2W2C A;  5AII A;  2YFI B;  1AR0 A;  3F9S A;  4FCM A;  3JUP A;  5AI1 A;  2Z7A A;  4IIA A;  3DUK A;  4HZB B;  3RGR A;  5BXQ A;  2OWP A;  5BVB A;  4L8P A;  2GBX B;  1OUN A;  3OV4 A;  4FCJ A;  3D9R A;  3JUO A;  1JB5 A;  3B4O A;  1K41 A;  4OVM A;  3HZP A;  3OWY A;  5CK6 A;  3HK4 A;  3NHX A;  4CDL A;  5STD A;  2JQ5 A;  1QMA A;  1UUV B;  2RCD A;  2R4I A;  1O7N B;  3EQQ B;  5IEP A;  2HMN B;  4Q53 A;  1ULI B;  3B4P A;  4XBT A;  3EF8 A;  3MKI A;  3JUM A;  2HMO B;  4HM1 B;  4ORL A;  4HVN A;  4H3U A;  3STD A;  3SED A;  3T8N A;  3SOA A;  3F8H A;  2RGQ A;  1HKX A;  1JB4 A;  1O7M B;  3A76 A;  3F7X A;  3GWR A;  2BMO B;  3DZL A;  5IEO A;  1Q42 A;  3H51 A;  3EBT A;  3Q90 A;  1VZZ A;  3NUV A;  3E99 A; 
#chains in the Genus database with same CATH topology
 4X2O A;  3L0R A;  1DMN A;  1NO3 A;  1W6Y A;  2XSH B;  3F7S A;  2C4B A;  3CNX A;  5I97 A;  1Q81 4;  1N9E A;  1SIH A;  3MHE A;  4XDV A;  3URP A;  1W02 A;  1LQM B;  4DKI A;  2AAE A;  3PZW A;  3VGN A;  5AIG A;  1JKG A;  4BTY A;  3LH4 A;  1UW1 A;  2W9P A;  1A90 A;  1ASK A;  1GMR A;  3WR2 A;  3NBR A;  1B2X A;  1YGE A;  1US1 A;  2F98 A;  2W56 A;  1TUH A;  4JF8 A;  1IK3 A;  1ULJ B;  2CIU A;  5AEU B;  1BRJ A;  2FGT A;  3CCU 3;  5D81 A;  2O3O A;  1LQG C;  2C11 A;  3EB8 A;  3FG1 A;  3X3Y A;  1VQ9 3;  1OF5 A;  4LSO A;  3KFQ C;  1JZD A;  1RCL A;  8RNT A;  4HM0 B;  4BL2 A;  4J9A A;  4EXR A;  4K1V A;  2CHC A;  5JPP A;  4KVH A;  5CF1 A;  3N9H A;  2XRX B;  5KP1 A;  3M8C A;  3PGB A;  1FGT A;  1BNR A;  2J8X B;  4MMX B;  2RNT A;  1Q86 4;  3SOY A;  5BIR A;  3JUN A;  5IF6 A;  3I0Y A;  1EG9 B;  1V74 A;  5M18 A;  4G1M B;  1D6U A;  1EEJ A;  1PYL A;  1T5Y A;  1KSI A;  2INX A;  3SLU A;  1JB2 A;  4N6O B;  3WOE B;  4KFD A;  1YGW A;  1N5P A;  2PNC A;  2F86 B;  2P05 A;  1R4Y A;  5ELJ A;  3LYG A;  1GSP A;  1Q40 B;  2XF3 A;  3N54 B;  1D6Z A;  3FLJ A;  1LVN A;  1W2B 2;  4R9K A;  5EEO A;  3AMO A;  4EBG A;  1JN5 B;  2HOH A;  3KCH A;  4NHF A;  2H0G A;  1OCV A;  3SVA A;  1LOW A;  1X1U A;  4IT7 A;  1GOU A;  1UI7 A;  4IPB A;  1CEW I;  3BU4 A;  4HM5 B;  3Q2P A;  1DYU A;  2K3D A;  1DVC A;  3BIR A;  3CCR 3;  5AEW B;  1RN1 A;  2WGO A;  1RN4 A;  4EW5 A;  1M1X B;  4X2H A;  1OAC A;  3CCS 3;  1JBS A;  1TIJ A;  3FZW A;  1BNE A;  4ZM8 A;  3KII A;  2XFS A;  4RZM A;  3KSP A;  4HYZ A;  4FCZ A;  2KCD A;  3OW2 2;  2AAD A;  1MWR A;  1GYB A;  2W0Q A;  1W00 A;  4GL6 A;  4HM6 B;  3TDG A;  2KF6 A;  1BRH A;  2GSP A;  1NDO B;  2R41 A;  1RGG A;  2SBL A;  4EV5 A;  1RJO A;  3FF2 A;  2E2T A;  4OK0 A;  1KQS 2;  1STD A;  1RGK A;  1BGS A;  1MOL A;  3BNE A;  4HJL B;  2SAR A;  1NNV A;  3S67 A;  5RNT A;  1AV4 A;  1YIT 3;  1RGA A;  1X1X A;  4RNY A;  5G1L A;  4LMI A;  2L1S A;  6STD A;  3G16 A;  1EUI C;  3KZT A;  4HM7 B;  4HZ9 B;  2K54 A;  5TGN A;  6RNT A;  1YIJ 3;  1FA3 A;  1UCJ A;  2O9U X;  5LC7 A;  7STD A;  1JN5 A;  2GU3 A;  1Y4K A;  1GD3 A;  3F14 A;  1AVL A;  2UGI A;  4HM8 B;  4LGQ A;  4MEI A;  4RBN A;  2XR8 B;  3WA2 X;  3HIG A;  1E97 A;  5A0O B;  4HM3 B;  1JNQ A;  8CHO A;  3ZG0 A;  7GSP A;  1SJW A;  1RDS A;  2BT3 A;  3EE1 A;  3NM2 A;  2W6J H;  1K73 4;  3CCV 3;  1TFK A;  3ECF A;  4I4K A;  4BU4 A;  5IG4 A;  3LTC A;  3PXM A;  2W04 A;  5G1K A;  3OX9 A;  1LOX A;  1YJN 3;  3UB1 A;  3MG2 A;  2ZDJ A;  1QJG A;  1R4C A;  2LQV A;  1QVF 2;  2RFR A;  3N8B A;  4O3V A;  3MYT A;  2CFK A;  4BTW A;  3I56 3;  1ZO2 A;  2HML B;  1KD1 4;  2XSO B;  4MMZ B;  3G6E 3;  1V57 A;  3ROB A;  1NB5 I;  1O7W B;  3CPO A;  4HAA A;  1RRL A;  4LZI A;  3CC7 3;  3AHW A;  1RGC A;  5DRE A;  1Q7Y 4;  4O8S A;  3UNL A;  3V99 A;  1BOX A;  4K61 A;  1N5H A;  1IVU A;  2YFJ B;  4N6U A;  1DE3 A;  1E3R A;  3MG1 A;  5IEN A;  2CWU A;  1GY6 A;  2OCT A;  3X41 A;  3RGA A;  3LTA A;  1GD4 A;  4FMD A;  1VQ7 3;  1OH0 A;  1I3I A;  1IVV A;  5AYR B;  1N9J A;  1UGI A;  5IG5 A;  1IQ8 A;  1BRK A;  3DGN A;  3K63 A;  4N6V 0;  2Y73 A;  1YJW 3;  2Z77 A;  3OWS A;  4AKZ A;  3CD6 3;  1RGL A;  2CG0 A;  4HOH A;  1BNI A;  1EA2 A;  2WO0 A;  3WHO A;  1RNB A;  1FGO A;  1WTH A;  2IUK A;  2QEX 3;  3S5C A;  1F8N A;  3LT9 A;  3MWZ A;  1GS3 A;  3DH2 A;  1UUW B;  1E3V A;  1OHP A;  1BUQ A;  4RNZ A;  2GU1 A;  1UGH I;  1LXE A;  1W5Z A;  4XB5 A;  2CK3 H;  1RSN A;  3CME 3;  1W01 A;  1BSC A;  5AIH A;  2HMJ B;  2Y74 A;  3EN8 A;  3GZB A;  1DET A;  2LYX A;  1FYS A;  1M90 4;  1BU4 A;  3BLZ A;  4GB5 A;  4OUQ A;  5CF2 A;  2A15 A;  5KP3 A;  2I9W A;  3JUQ A;  3K0Z A;  4MMY B;  1TP6 A;  2OQE A;  3G0K A;  2CFG A;  5JPU A;  1VQ4 3;  3MG3 A;  4WWU C;  3VSY A;  5CLK A;  4JRF A;  1LNH A;  2B1X B;  3FCS B;  3FKA A;  2F99 A;  1DMM A;  1BNJ A;  1B21 A;  3BB9 A;  1GMQ A;  3UL6 A;  2JDI H;  9RNT A;  2OTJ 3;  1T2H A;  2L4V A;  1JRQ A;  4ILF A;  5KP4 A;  3B8L A;  1ZX2 A;  1CQS A;  1RTU A;  2YFL B;  3JVC A;  1GOV A;  3FSD A;  1YHQ 3;  1TTO A;  1G96 A;  1OGZ A;  1J2B A;  3D79 A;  3EBY A;  4R80 A;  4WHA A;  1VQO 3;  3GSP A;  3NBB A;  1IQX A;  3CCL 3;  1BSE A;  1QAK A;  2P0M A;  3UJM A;  1BAO A;  3OXA A;  4GSP A;  1BRN L;  5CXO A;  2CFW A;  3LZA A;  1MNL A;  1BSD A;  1HYF A;  3AGN A;  1ZGX A;  2CX0 A;  2Q07 A;  3LML A;  4XM4 A;  1GOY A;  3GZY B;  3NQZ A;  4TX4 A;  1FW7 A;  4STD A;  4EYC A;  4WP5 A;  1KWI A;  1U8C B;  1VQ6 3;  3EN1 B;  3WDG B;  4HM2 B;  1DMQ A;  2Z76 A;  2F5W A;  4XBY A;  2M7O A;  1SQW A;  1WMN A;  2ML5 A;  1OHO A;  1CYV A;  3DMC A;  3HOH A;  1W7C A;  2PZV A;  5IW9 A;  1UDI I;  1W6C A;  3GZR A;  2H0H A;  4K1U A;  3MSO A;  2UX0 A;  4L8O A;  1C7H A;  3CCM 3;  1S5A A;  1U5O A;  1BIR A;  3NXJ A;  1RGE A;  3HX8 A;  4J8T A;  5FW5 A;  4HM4 B;  4CPK A;  5AIF A;  1C54 A;  1OHS A;  3IMA B;  2GBW B;  3K7C A;  3DM8 A;  1D6Y A;  2V1L A;  1VQ8 3;  1MWS A;  3HI7 A;  1LOV A;  4O02 B;  1NU3 A;  1B2Z A;  1O7G B;  3NM7 A;  3KKG A;  1VQP 3;  1Q40 A;  1ZS7 A;  2CFL A;  4BIR A;  1A2P A;  4FMA A;  3CU3 A;  3SX1 A;  1I2E A;  4XDW A;  1MGR A;  2YX9 A;  3IJE B;  1I0V A;  1M9G A;  1GY5 A;  2OQE C;  5IG3 A;  3F8X A;  2CC3 A;  2E2U A;  3GAX A;  1IVW A;  2GEY A;  1IU7 A;  2KF5 A;  1BRG A;  1BNS A;  3B7C A;  3S27 A;  1RGH A;  1T3B A;  3Q1C A;  5D82 A;  2B24 B;  4RNT A;  1Q7H A;  1N8R 4;  1K8A 4;  2CWT A;  3EC9 A;  1A2K A;  3GZX B;  4WYK B;  5IG0 A;  6GSP A;  1GY7 A;  4PEJ A;  1B20 A;  1UCI A;  1VQ5 3;  2KF3 A;  5IER A;  2UUG C;  3WA3 A;  1TFO A;  1FUT A;  1O7P B;  3S29 A;  1RCK A;  2F5M A;  3FF0 A;  3DGL A;  2GXF A;  3IPT A;  3K5T A;  3CPW 2;  1JBT A;  1Z1S A;  3A5E A;  4L7K A;  2WGQ A;  4KZ1 A;  4BL3 A;  1IVX A;  3WMD A;  1SII A;  4NPB A;  2HMM B;  3ZG5 A;  3LTB A;  2BIR A;  3MPH A;  4FR9 A;  4GHO A;  3HII A;  1RN7 A;  1IT8 A;  3OWU A;  1JKG B;  4N3V A;  3ER7 A;  4AKY A;  1HZ1 A;  1AVK A;  1BAN A;  1LRA A;  2IMJ A;  4QWT A;  5GSP A;  1PY3 A;  2STD A;  2ML6 A;  1K9M 4;  1FZU A;  4H61 A;  5AYS C;  5HGR A;  3NV0 B;  2FNQ A;  1STF I;  1Q9E A;  2BMR B;  3FGY A;  2F4Y A;  4BTX A;  3LXU X;  3DGY A;  3G71 3;  2OTL 3;  1BVI A;  1OF5 B;  3FG3 A;  4O2H A;  1IT7 A;  1QAL A;  4XBX A;  1UI8 A;  5D83 A;  2QA4 3;  2IA7 A;  4CJN A;  5BU4 A;  1VQN 3;  3PYJ A;  1YJ9 3;  1CH0 A;  2HMK B;  2QGU A;  4HKV B;  1X1Y A;  2QIY A;  3FH1 A;  5EVH A;  2ZHX B;  4LYL B;  1NB3 I;  4WYK A;  3V98 A;  3D5I A;  1JBR A;  4U13 A;  3KE7 A;  1ISK A;  1YVS A;  1BRI A;  3LT8 A;  4HBR A;  3CC2 3;  3EX9 A;  2ZL8 A;  1NWW A;  1IV9 A;  2E2V A;  1RRH A;  1K28 A;  2F56 A;  3T8U A;  2GEX A;  1EQK A;  1HU9 A;  1JZO A;  2K0M A;  1VQK 3;  2ZA4 A;  1RLS A;  1IDP A;  5M19 A;  3K9M C;  3CXC 2;  1VQL 3;  2KRT A;  2BMQ B;  2W03 A;  1BSB A;  3AMO B;  1FGR A;  3CNM A;  5DRV A;  1G02 A;  1TJD A;  3V92 A;  1CYU A;  1W2Z A;  5G2G A;  2CKF B;  1B2U A;  2IYJ A;  1RHL A;  4MJD A;  1I2F A;  3EHC A;  3RNT A;  1YI2 3;  1O7H B;  1RGF A;  3G4S 3;  1W6G A;  2KAA A;  1MGW A;  3G8Z A;  1IQY A;  5FGO A;  1OPY A;  2WOF A;  4R9L A;  3WOD G;  4NRE A;  3D3L A;  3CMA 3;  3NV0 A;  4LEH A;  2BHM A;  3H3H A;  3GRD A;  3F40 A;  3I55 3;  1WQL B;  1UUG B;  3DXO A;  3O8Y A;  4R1K A;  3X42 A;  1B27 A;  3EJV A;  2BNG A;  1FUW A;  1OGX A;  1YVB I;  2W2C A;  2CG1 A;  3DY5 A;  1I70 A;  5AII A;  2XGN A;  4KFF A;  4N6N B;  3S28 A;  2YFI B;  3DGM A;  2IY2 A;  3AHS A;  3QK9 A;  1AR0 A;  2RBI A;  3F9S A;  1W4N A;  1FGQ A;  4FCM A;  3JUP A;  5AI1 A;  2Z7A A;  2D42 A;  3FG4 A;  4IIA A;  1G0T A;  3DUK A;  4HZB B;  2C10 A;  1ROA A;  1FUS A;  3RGR A;  5BXQ A;  3AGO A;  2OWP A;  1JV2 B;  1YNV X;  5BVB A;  4L8P A;  2GBX B;  1LOY A;  1OUN A;  3OV4 A;  2FXT A;  4FCJ A;  2BU4 A;  1AQZ A;  3ALA A;  3BND A;  3D9R A;  3JUO A;  1JB5 A;  2P38 A;  3B4O A;  1K41 A;  3VF1 A;  4OVM A;  3HZP A;  3OWY A;  3CCE 3;  3KN4 A;  5CK6 A;  1EKM A;  4KT3 B;  1TRQ A;  3HK4 A;  1N8Q A;  3NHX A;  2OOV A;  2XFT A;  3DGO A;  1I2G A;  2W9Q A;  3BNC A;  4CCV A;  5STD A;  4CDL A;  1RKY A;  1UCL A;  5JBS A;  2JQ5 A;  3LOY A;  3WOF B;  1QMA A;  1UUV B;  1QAF A;  1RMS A;  4J5G A;  2MC8 A;  2IUJ A;  2RCD A;  2WOH A;  2R4I A;  4R4K A;  5ELU A;  1O7N B;  3EQQ B;  1PU4 A;  1M1K 4;  2KF4 A;  1QVG 2;  4FMC A;  5IEP A;  1MWT A;  1I3F A;  2HMN B;  4Q53 A;  1I8V A;  1BNG A;  3T0U A;  3NBJ A;  3NQY A;  1ULI B;  5M1A A;  3B4P A;  3X3X A;  3KSE D;  4WFO A;  4EC6 A;  3SYU A;  1A67 A;  5EQL A;  2CWV A;  4XBT A;  2Z6B A;  3EF8 A;  3X40 A;  3MKI A;  3JUM A;  2HMO B;  4HM1 B;  1FGM A;  1BSA A;  4I5Q A;  1AY7 A;  2CW9 A;  4KFE A;  1WMP A;  1IV7 A;  1IYY A;  1B3S A;  1T2I A;  2BO9 B;  4ORL A;  3CC4 3;  4HVN A;  4H3U A;  3STD A;  1Q82 4;  1JJ2 2;  1TRP A;  3NX0 A;  2XGL A;  1SPU A;  2CH9 A;  1BRS A;  1MWU A;  1X1W A;  2XH9 A;  1VQM 3;  3D4A A;  1GMP A;  1I0X A;  1B2M A;  1UCK A;  3SED A;  7RNT A;  1DVD A;  1WMO A;  3LTD A;  3QRD A;  3RDE A;  3T8N A;  4J5K A;  5LC6 A;  2W56 B;  4K90 B;  3PS8 A;  1L5G B;  3SXX A;  1ROV A;  3SOA A;  1LNI A;  1B2S A;  1SAR A;  2RSX A;  3UL5 A;  1V58 A;  3F8H A;  2RGQ A;  4AEQ A;  1HKX A;  1JB4 A;  3BNB A;  1O7M B;  1PFP A;  3A76 A;  1TU5 A;  2OOV C;  3F7X A;  3U1W A;  4EV2 A;  3GWR A;  3X3Z A;  1NJI 4;  5HOH A;  3CCJ 3;  4N6L A;  2MF7 A;  3J7Y d;  3ZFZ A;  4N6M A;  2BMO B;  1BNF A;  2P09 A;  3DZL A;  3Q3F A;  5IEO A;  2CX1 A;  3D5G A;  4N6T A;  1Q42 A;  1KC8 4;  1BUJ A;  1A2V A;  1S72 3;  1WNH A;  3H51 A;  3CCQ 3;  1RNT A;  2KXG A;  3PCS A;  3U97 A;  3EBT A;  2D1W A;  2XEP A;  3Q90 A;  2H0I A;  2P0X A;  1VZZ A;  3PCR A;  4FMB A;  3NUV A;  1VQQ A;  3E99 A;  2CFD A; 
#chains in the Genus database with same CATH homology
 4X2O A;  3L0R A;  1DMN A;  1NO3 A;  1W6Y A;  2XSH B;  3F7S A;  3CNX A;  5I97 A;  1Q81 4;  1N9E A;  1SIH A;  3MHE A;  4XDV A;  1W02 A;  3PZW A;  3VGN A;  5AIG A;  1JKG A;  4BTY A;  3LH4 A;  1UW1 A;  2W9P A;  1A90 A;  1ASK A;  3NBR A;  1YGE A;  1US1 A;  2F98 A;  2W56 A;  1TUH A;  4JF8 A;  1IK3 A;  1ULJ B;  2CIU A;  5AEU B;  2FGT A;  3CCU 3;  5D81 A;  2O3O A;  2C11 A;  3EB8 A;  3FG1 A;  3X3Y A;  1VQ9 3;  1OF5 A;  4LSO A;  3KFQ C;  4HM0 B;  4EXR A;  4J9A A;  4K1V A;  2CHC A;  5JPP A;  4KVH A;  3N9H A;  2XRX B;  5KP1 A;  3M8C A;  3PGB A;  1FGT A;  4MMX B;  3SOY A;  3JUN A;  5IF6 A;  3I0Y A;  1EG9 B;  1V74 A;  4G1M B;  1D6U A;  2INX A;  3WOE B;  1T5Y A;  1KSI A;  3SLU A;  1JB2 A;  4N6O B;  4KFD A;  1N5P A;  2PNC A;  2F86 B;  2P05 A;  5ELJ A;  3LYG A;  1Q40 B;  2XF3 A;  3N54 B;  1D6Z A;  3FLJ A;  1LVN A;  1W2B 2;  4R9K A;  5EEO A;  3AMO A;  4EBG A;  1JN5 B;  4NHF A;  1OCV A;  3SVA A;  4IT7 A;  1UI7 A;  4IPB A;  1CEW I;  4HM5 B;  3Q2P A;  1DYU A;  1DVC A;  3CCR 3;  5AEW B;  2WGO A;  1M1X B;  4X2H A;  1OAC A;  3CCS 3;  1TIJ A;  3FZW A;  4ZM8 A;  3KII A;  2XFS A;  4RZM A;  3KSP A;  4HYZ A;  4FCZ A;  2KCD A;  3OW2 2;  1GYB A;  2W0Q A;  1W00 A;  4GL6 A;  4HM6 B;  3TDG A;  1NDO B;  2SBL A;  4EV5 A;  1RJO A;  3FF2 A;  2E2T A;  4OK0 A;  1KQS 2;  1STD A;  1MOL A;  3BNE A;  4HJL B;  3S67 A;  1AV4 A;  1YIT 3;  4RNY A;  4LMI A;  6STD A;  3G16 A;  3KZT A;  4HM7 B;  4HZ9 B;  2K54 A;  5TGN A;  1YIJ 3;  1FA3 A;  2O9U X;  5LC7 A;  7STD A;  1JN5 A;  2GU3 A;  1Y4K A;  1GD3 A;  3F14 A;  1AVL A;  4HM8 B;  4LGQ A;  4MEI A;  4RBN A;  3WA2 X;  2XR8 B;  5CF1 A;  3HIG A;  1E97 A;  5A0O B;  4HM3 B;  1JNQ A;  8CHO A;  1SJW A;  2BT3 A;  3EE1 A;  3NM2 A;  2W6J H;  1K73 4;  3CCV 3;  1TFK A;  3ECF A;  4I4K A;  5IG4 A;  3LTC A;  3PXM A;  2W04 A;  3OX9 A;  1LOX A;  1YJN 3;  3UB1 A;  3MG2 A;  2ZDJ A;  1QJG A;  1R4C A;  2LQV A;  1QVF 2;  2RFR A;  3N8B A;  4O3V A;  3MYT A;  2CFK A;  4BTW A;  3I56 3;  1ZO2 A;  2HML B;  1KD1 4;  2XSO B;  4MMZ B;  3G6E 3;  3ROB A;  1NB5 I;  1O7W B;  3CPO A;  4LZI A;  1RRL A;  3CC7 3;  5DRE A;  1Q7Y 4;  4O8S A;  3UNL A;  3V99 A;  4K61 A;  1N5H A;  1IVU A;  2YFJ B;  4N6U A;  1E3R A;  3MG1 A;  5IEN A;  2CWU A;  1GY6 A;  2OCT A;  3X41 A;  3RGA A;  3LTA A;  1GD4 A;  4FMD A;  1VQ7 3;  1OH0 A;  1IVV A;  5AYR B;  1N9J A;  5IG5 A;  1IQ8 A;  3DGN A;  3K63 A;  4N6V 0;  2Y73 A;  1YJW 3;  2Z77 A;  3OWS A;  4AKZ A;  3CD6 3;  2CG0 A;  1EA2 A;  2WO0 A;  1FGO A;  1WTH A;  2IUK A;  2QEX 3;  3S5C A;  1F8N A;  3LT9 A;  3MWZ A;  1GS3 A;  1UUW B;  1E3V A;  1OHP A;  1BUQ A;  4RNZ A;  2GU1 A;  1LXE A;  1W5Z A;  4XB5 A;  2CK3 H;  3CME 3;  1W01 A;  5AIH A;  2HMJ B;  2Y74 A;  3EN8 A;  3GZB A;  2LYX A;  1M90 4;  3BLZ A;  4GB5 A;  4OUQ A;  5CF2 A;  2A15 A;  5KP3 A;  2I9W A;  3JUQ A;  3K0Z A;  4MMY B;  1TP6 A;  2OQE A;  3G0K A;  2CFG A;  5JPU A;  1VQ4 3;  3MG3 A;  4WWU C;  3VSY A;  5CLK A;  4JRF A;  1LNH A;  2B1X B;  3FCS B;  3FKA A;  2F99 A;  1DMM A;  2OTJ 3;  3BB9 A;  1CYU A;  3UL6 A;  2JDI H;  2L4V A;  1JRQ A;  5KP4 A;  3B8L A;  1ZX2 A;  1CQS A;  2YFL B;  3JVC A;  3FSD A;  1YHQ 3;  1G96 A;  1OGZ A;  1J2B A;  3EBY A;  4R80 A;  4WHA A;  1VQO 3;  3NBB A;  1IQX A;  3CCL 3;  1QAK A;  2P0M A;  3UJM A;  3OXA A;  5CXO A;  2CFW A;  3LZA A;  1MNL A;  3LML A;  2Q07 A;  4XM4 A;  3GZY B;  3NQZ A;  4TX4 A;  4STD A;  4EYC A;  4WP5 A;  1KWI A;  1U8C B;  1VQ6 3;  3EN1 B;  3WDG B;  4HM2 B;  1DMQ A;  2Z76 A;  4XBY A;  2M7O A;  1SQW A;  1WMN A;  2ML5 A;  1OHO A;  1CYV A;  3DMC A;  1W7C A;  2PZV A;  5IW9 A;  1W6C A;  3GZR A;  4K1U A;  3MSO A;  2UX0 A;  4L8O A;  1C7H A;  3CCM 3;  1S5A A;  1U5O A;  3NXJ A;  3HX8 A;  4J8T A;  5FW5 A;  4HM4 B;  5AIF A;  1OHS A;  3IMA B;  2GBW B;  3K7C A;  3DM8 A;  1D6Y A;  2V1L A;  1VQ8 3;  3HI7 A;  4O02 B;  1NU3 A;  1O7G B;  3NM7 A;  3KKG A;  1VQP 3;  1Q40 A;  2CFL A;  4FMA A;  3CU3 A;  3SX1 A;  4XDW A;  2YX9 A;  3IJE B;  1M9G A;  1GY5 A;  2OQE C;  5IG3 A;  3F8X A;  2CC3 A;  2E2U A;  3GAX A;  1IVW A;  2GEY A;  1IU7 A;  3B7C A;  3S27 A;  3Q1C A;  5D82 A;  2B24 B;  1K8A 4;  1N8R 4;  2CWT A;  3EC9 A;  1A2K A;  3GZX B;  4WYK B;  5IG0 A;  1GY7 A;  4PEJ A;  1VQ5 3;  5IER A;  3WA3 A;  1TFO A;  1O7P B;  3S29 A;  3IPT A;  3FF0 A;  3K5T A;  3DGL A;  2GXF A;  3CPW 2;  1Z1S A;  4L7K A;  2WGQ A;  4KZ1 A;  1IVX A;  3WMD A;  1SII A;  2HMM B;  3LTB A;  3MPH A;  4FR9 A;  3HII A;  1RN7 A;  1IT8 A;  3OWU A;  1JKG B;  4N3V A;  3ER7 A;  4AKY A;  1AVK A;  2IMJ A;  4QWT A;  2STD A;  2ML6 A;  1K9M 4;  4H61 A;  5AYS C;  5HGR A;  3NV0 B;  2FNQ A;  1STF I;  2BMR B;  3FGY A;  4BTX A;  3G71 3;  3LXU X;  2OTL 3;  1OF5 B;  3FG3 A;  4O2H A;  1IT7 A;  1QAL A;  4XBX A;  1UI8 A;  5D83 A;  2QA4 3;  2IA7 A;  1VQN 3;  3PYJ A;  1YJ9 3;  2HMK B;  2QGU A;  4HKV B;  2QIY A;  3FH1 A;  5EVH A;  1NB3 I;  4WYK A;  3V98 A;  4U13 A;  3KE7 A;  1ISK A;  3LT8 A;  4HBR A;  3CC2 3;  3EX9 A;  2ZL8 A;  1NWW A;  1IV9 A;  2E2V A;  1RRH A;  1K28 A;  3T8U A;  2GEX A;  1EQK A;  1HU9 A;  2K0M A;  1VQK 3;  3CXC 2;  1IDP A;  1VQL 3;  3K9M C;  2KRT A;  2BMQ B;  2W03 A;  3AMO B;  1FGR A;  3CNM A;  5DRV A;  3V92 A;  1W2Z A;  5G2G A;  2CKF B;  4MJD A;  3EHC A;  1YI2 3;  1O7H B;  3G4S 3;  1W6G A;  3G8Z A;  3WOD G;  1IQY A;  5FGO A;  1OPY A;  2WOF A;  4R9L A;  3CMA 3;  4NRE A;  3D3L A;  3NV0 A;  4LEH A;  2BHM A;  3H3H A;  3GRD A;  3F40 A;  3I55 3;  1WQL B;  3DXO A;  3O8Y A;  4R1K A;  3X42 A;  3EJV A;  2BNG A;  1FUW A;  1OGX A;  2W2C A;  1YVB I;  2CG1 A;  3DY5 A;  5AII A;  2XGN A;  4KFF A;  4N6N B;  3S28 A;  2YFI B;  3DGM A;  3QK9 A;  1AR0 A;  3F9S A;  1Q86 4;  1W4N A;  1FGQ A;  4FCM A;  3JUP A;  5AI1 A;  2Z7A A;  2D42 A;  3FG4 A;  4IIA A;  3DUK A;  4HZB B;  2C10 A;  1ROA A;  3RGR A;  5BXQ A;  2OWP A;  1JV2 B;  5BVB A;  4L8P A;  2GBX B;  1OUN A;  3OV4 A;  2FXT A;  4FCJ A;  3D9R A;  3ALA A;  3BND A;  3JUO A;  1JB5 A;  2P38 A;  3B4O A;  1K41 A;  3VF1 A;  4OVM A;  3HZP A;  3OWY A;  3CCE 3;  3KN4 A;  5CK6 A;  1EKM A;  3HK4 A;  1N8Q A;  3NHX A;  2OOV A;  2XFT A;  3DGO A;  2W9Q A;  4CCV A;  3BNC A;  4CDL A;  5STD A;  1RKY A;  5JBS A;  2JQ5 A;  3LOY A;  3WOF B;  1QMA A;  1UUV B;  1QAF A;  2MC8 A;  2IUJ A;  2RCD A;  2WOH A;  2R4I A;  4R4K A;  5ELU A;  1O7N B;  3EQQ B;  1PU4 A;  1M1K 4;  1QVG 2;  4FMC A;  5IEP A;  2HMN B;  4Q53 A;  3T0U A;  3NBJ A;  3NQY A;  1ULI B;  3B4P A;  3X3X A;  3KSE D;  4WFO A;  4EC6 A;  1A67 A;  5EQL A;  2CWV A;  4XBT A;  2Z6B A;  3EF8 A;  3X40 A;  3MKI A;  3JUM A;  2HMO B;  4HM1 B;  1FGM A;  2CW9 A;  4KFE A;  1WMP A;  1IV7 A;  4ORL A;  2BO9 B;  3CC4 3;  4HVN A;  4H3U A;  3STD A;  1Q82 4;  1JJ2 2;  3NX0 A;  2XGL A;  1SPU A;  2CH9 A;  2XH9 A;  1VQM 3;  3SED A;  1DVD A;  1WMO A;  3LTD A;  3QRD A;  3RDE A;  3T8N A;  5LC6 A;  2W56 B;  4K90 B;  3PS8 A;  1L5G B;  3SXX A;  1ROV A;  3SOA A;  2RSX A;  3UL5 A;  3F8H A;  2RGQ A;  4AEQ A;  1HKX A;  1JB4 A;  3BNB A;  1O7M B;  1PFP A;  3A76 A;  1TU5 A;  2OOV C;  3F7X A;  3U1W A;  4EV2 A;  3GWR A;  3X3Z A;  1NJI 4;  3CCJ 3;  4N6L A;  2MF7 A;  3J7Y d;  4N6M A;  2BMO B;  3DZL A;  2P09 A;  5IEO A;  4N6T A;  1Q42 A;  1KC8 4;  1A2V A;  1S72 3;  1WNH A;  3H51 A;  3CCQ 3;  2KXG A;  3PCS A;  3U97 A;  3EBT A;  2D1W A;  2XEP A;  3Q90 A;  2P0X A;  3PCR A;  1VZZ A;  4FMB A;  3NUV A;  3E99 A;  2CFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...