3K9MC

Cathepsin b in complex with stefin a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Stefin A displaces the occluding loop of cathepsin B only by as much as required to bind to the active site cleft
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k9mC00
1DVDA 1RN7A 1GD3A 3Q2PA 3PXMA 3UL6A 4N6MA 4N6OB 4TX4A 4CCVA 5EQLA 1IV9A 2W9QA 1N5HA 1A67A 1MNLA 1ROAA 1R4CA 5LC7A 1DVCA 1NB5I 1N9JA 1STFI 2BO9B 3KFQC 4ZM8A 3SVAA 3L0RA 1PFPA 3IMAB 2W9PA 1YVBI 1CEWI 1NB3I 2KXGA 1N5PA 3KSED 5ELJA 1FUWA 1LXEA 1M9GA 3NX0A 3PYJA 3S67A 1MOLA 1EQKA 1FA3A 1CYUA 1CYVA 3GAXA 5ELUA 4N6TA 5LC6A 4EYCA 4N6V0 4IT7A 3UL5A 1KWIA 2O9UX 3MWZA 4N6LA 3QRDA 4N6NB 3LH4A 1GD4A 2CH9A 2OCTA 3K9MC 1TIJA 5A0OB 4LZIA 1IV7A 1WNHA 1G96A 4N6UA 1A90A 3PS8A
chains in the Genus database with same CATH superfamily
1UGIA 1WMOA 1A2KA 4WWUC 1EKMA 1W6GA 2P0XA 1BRSA 2YFIB 1NNVA 3FKAA 4KVHA 3FH1A 4XBYA 4O3VA 3PXMA 4RNZA 1GOYA 1RNTA 4BTWA 3CCU3 1UI8A 4N6OB 4TX4A 4OUQA 1UUVB 3NQZA 5EQLA 3CCS3 5HGRA 3CC73 3UB1A 1UUGB 1RCLA 4HM3B 1TP6A 2OOVA 4AKZA 1NJI4 1Q9EA 1ZGXA 4MEIA 1LOYA 1A67A 1IYYA 1LQMB 1RRLA 1M1XB 2BMQB 4R4KA 3DH2A 1MWTA 2XRXB 1KSIA 1HYFA 4HM1B 1IQXA 4HYZA 3B8LA 1U5OA 4HJLB 3SOAA 4CJNA 2B24B 1T2HA 4XDVA 5LC7A 3DZLA 4STDA 5M1AA 1K8A4 1BNFA 1AVLA 2BNGA 2BO9B 3DGLA 3KFQC 4QWTA 2AADA 5G1LA 5AEUB 1Q7Y4 1KC84 1S5AA 2YX9A 3GWRA 3CD63 4HVNA 1W01A 3F14A 3NBBA 4J5KA 4ZM8A 5JPUA 1C7HA 1JJ22 3SVAA 3UJMA 3IMAB 2GBWB 1JKGA 4L8PA 3G4S3 3V98A 1X1UA 3HK4A 1AVKA 3RGAA 2HOHA 3WDGB 1TFKA 3VF1A 3MSOA 1X1WA 1FZUA 1OHOA 4I4KA 3CCJ3 2XFSA 3B4PA 4LSOA 4GL6A 3S29A 1I3IA 3X3XA 2KXGA 2PZVA 2W56A 1VQK3 1DE3A 1IU7A 3MG3A 1M9GA 4HM2B 4K1VA 4EC6A 2E2VA 3S67A 1EEJA 1QAFA 4GB5A 2F4YA 3GZBA 4AEQA 3ALAA 3G16A 1JKGB 3K7CA 4RNYA 3N9HA 1CYUA 1W6YA 5AIIA 4FMDA 2XGLA 5BXQA 5JPPA 1V74A 1BSCA 3CXC2 5CXOA 1JB4A 2XH9A 4MJDA 1QAKA 1JBTA 1RGCA 1TFOA 2UGIA 5M18A 3JUMA 1GOUA 3G713 1JZOA 1T3BA 3LMLA 2Z6BA 1ROVA 2W56B 4K1UA 2D42A 3JUQA 4R80A 2A15A 3U1WA 3UL5A 1Q864 1KWIA 1UUWB 2QGUA 1FGMA 4H3UA 1J2BA 3LOYA 3EQQB 3QRDA 1DMQA 1MGRA 3KE7A 1YGEA 3LH4A 1YJ93 1QVF2 2WGQA 4HKVB 2CG1A 3RDEA 2M7OA 1OHSA 3AHWA 4IIAA 1JN5A 1IVXA 1BRIA 1GD4A 2CH9A 2WOFA 2JDIH 1ULIB 3Q1CA 4R9LA 2HMOB 3FCSB 3ROBA 4EXRA 3HOHA 1JZDA 1K41A 2CFGA 3HIIA 3NV0B 1YVSA 3NM2A 3RNTA 1DETA 4ORLA 2W04A 5IW9A 3VSYA 1Q824 4KFDA 4RNTA 2XFTA 2ML5A 3CC43 3X40A 1BRNL 2QEX3 1RN1A 7RNTA 3OWYA 2IA7A 3CC23 1W02A 4HZBB 3LTCA 3CCE3 1JN5B 3FG3A 5G1KA 1VQ73 1Q40A 1MWSA 2CWUA 3F40A 2CKFB 3WOFB 5CF2A 4FCJA 1Q814 3G0KA 3LYGA 1DVDA 3OWSA 1BANA 3E99A 4HBRA 2QIYA 1HZ1A 3Q2PA 3NBRA 1IQYA 3X3ZA 1G02A 4N6MA 2R4IA 3K63A 2OTL3 2B1XB 3N8BA 1W6CA 1IV9A 3OV4A 3EX9A 3JUPA 2BMRB 4BTYA 1OGZA 2P0MA 3SYUA 4HZ9B 1Z1SA 2KF3A 1ROAA 2CFLA 4KFEA 1IDPA 1BNIA 5BVBA 1RGHA 5CF1A 3CPW2 1AQZA 1FYSA 1K9M4 1NB5I 1VQ93 4J9AA 3D79A 3LXUX 1VQM3 3BNEA 1RGGA 2GBXB 1QALA 5IG3A 4OK0A 3BLZA 3WR2A 3CNMA 3ZG0A 2SARA 1BSDA 1GMPA 1MWUA 1W4NA 3CCQ3 6GSPA 4BU4A 1BVIA 5STDA 3S28A 1VQL3 2CW9A 3EB8A 1PFPA 3GSPA 3ZFZA 3I553 2E2UA 2RBIA 3GZRA 3X41A 3CCL3 1EUIC 1QVG2 3LTBA 1PYLA 1E3RA 5KP3A 1O7NB 4ILFA 2BMOB 3A5EA 1W7CA 3BIRA 4LEHA 3V92A 1CEWI 4J5GA 5IERA 1O7PB 1RGKA 1NB3I 2Z76A 1N5PA 2HMJB 1FGRA 2GSPA 3CCR3 2K3DA 1I2GA 1FGTA 3PYJA 3DMCA 3OXAA 3FF0A 1EQKA 4H61A 1VZZA 2RGQA 2Z77A 2F86B 2WO0A 5EEOA 5M19A 5ELUA 1D6ZA 4BL3A 3ZG5A 1EG9B 2CX0A 3MPHA 3BNCA 1PY3A 3I563 5IENA 1FGQA 3DGYA 1N8R4 4IT7A 4N3VA 1IVUA 1BGSA 1I2FA 1O7HB 3CPOA 2OWPA 7GSPA 2O9UX 2CC3A 3D4AA 3MWZA 2GU1A 5AI1A 3J7Yd 1B21A 1LVNA 1BNSA 1IQ8A 2IMJA 2J8XB 2IUKA 2PNCA 1D6YA 2XEPA 4KZ1A 2L1SA 4EV2A 1JNQA 3Q90A 4XDWA 4DKIA 2P09A 4BTXA 1ISKA 1WQLB 2OCTA 4FMBA 5D83A 1DYUA 1BNGA 1Y4KA 3HIGA 3F8XA 1UDII 1IK3A 3HI7A 1Q7HA 4X2OA 1YI23 1GY5A 1UW1A 3I0YA 3KCHA 1V57A 1N9EA 1SQWA 3IJEB 4LZIA 1IV7A 3O8YA 1W00A 4HOHA 3NV0A 4XBXA 1UGHI 1ZO2A 3MG2A 1RTUA 4NPBA 3KN4A 4JF8A 1A90A 3HZPA 2KCDA 2LYXA 3VGNA 2GU3A 1RN7A 2HMNB 1OCVA 3RGRA 3LZAA 2H0GA 4WHAA 4JRFA 3F9SA 7STDA 2KF6A 1BNEA 1CH0A 1OF5B 1ASKA 2W03A 2ZA4A 3EJVA 3NHXA 1VQQA 2CG0A 2Z7AA 3BB9A 5CLKA 5EVHA 1YIJ3 2CIUA 2RNTA 3JUOA 4CCVA 2CHCA 5BIRA 2F56A 3B7CA 2YFJB 4LYLB 3KIIA 3NBJA 1K28A 1UCKA 3CME3 1MWRA 3STDA 3WMDA 1NO3A 1FUSA 3DGMA 3CCV3 3MKIA 2CK3H 3DY5A 3QK9A 1UCJA 1JBRA 1TUHA 5DRVA 2IY2A 1DVCA 3T0UA 1E97A 1JBSA 1WMNA 1RRHA 3K0ZA 3MYTA 1VQ43 3CMA3 5I97A 1RGEA 1UI7A 1L5GB 3SXXA 3WA2X 1KQS2 2IUJA 1K734 1BU4A 2P38A 3V99A 5JBSA 3HX8A 1GS3A 2GEXA 3BNDA 4FMCA 1BRJA 3A76A 2YFLB 3CU3A 2V1LA 1WTHA 1GMRA 2SBLA 1BIRA 3S5CA 1X1YA 1B2SA 2CFWA 3OX9A 1BNJA 1RDSA 2XF3A 1TTOA 3EN1B 3WODG 2W0QA 4IPBA 2Q07A 3MG1A 2W9PA 5AYSC 2KF5A 2FNQA 3DUKA 5AYRB 8CHOA 3FLJA 3K5TA 3PS8A 1SIHA 2HMMB 3LT8A 2H0IA 4R9KA 1G0TA 2FGTA 1RNBA 1SIIA 3BU4A 1LNIA 3D9RA 5ELJA 1LXEA 1VQ63 4AKYA 3NX0A 1FUWA 3FG1A 3ER7A 1AV4A 1BRHA 4HAAA 3SEDA 1OACA 3OWUA 3FSDA 1UCLA 3PCSA 1FA3A 1NWWA 2BT3A 1BSEA 5DREA 1JRQA 2UUGC 1FGOA 1I0VA 1LOWA 1CYVA 2XSOB 4OVMA 3SX1A 3DGOA 6RNTA 2STDA 1I8VA 4Q53A 1T2IA 1O7WB 3FG4A 4L7KA 4MMXB 5AIGA 1RHLA 1W2B2 1CQSA 2K54A 5HOHA 1DMMA 1IT8A 1C54A 1B3SA 1IVVA 3B4OA 2BHMA 2CWTA 3AGOA 1HU9A 4RZMA 1GY7A 1UCIA 1SPUA 2CX1A 4HM0B 4MMYB 4XBTA 1BRKA 5AIHA 2RFRA 5KP4A 3DXOA 4N6LA 4HM7B 1LOVA 3TDGA 1BAOA 2F5MA 2OOVC 3D5GA 1EA2A 4N6NB 5RNTA 4WP5A 2JQ5A 1RGAA 3LTDA 2C10A 1NU3A 1SJWA 3DGNA 1FW7A 4MMZB 1GMQA 4J8TA 1QMAA 3G6E3 4KT3B 1PU4A 2F98A 1RKYA 1F8NA 1RJOA 1TJDA 3EBYA 3K9MC 4GSPA 6STDA 1A2VA 2INXA 2WGOA 5G2GA 5IEOA 1R4YA 1JV2B 5A0OB 2ZHXB 1WNHA 1OHPA 2RSXA 1RGFA 3GZXB 1V58A 2GXFA 4FCZA 1G96A 4N6UA 3UNLA 1STDA 4EW5A 9RNTA 1X1XA 3D5IA 1GYBA 3EC9A 2Y74A 1E3VA 1ZS7A 4FMAA 3FZWA 2ZL8A 2AAEA 1RN4A 1GD3A 2WOHA 1YGWA 1WMPA 1LQGC 3KKGA 1BNRA 4EYCA 4RBNA 3NUVA 5LC6A 1ULJB 2BIRA 3UL6A 1ZX2A 3H51A 3WOEB 3BNBA 1N8QA 3X42A 1AY7A 1TRPA 4O2HA 1O7GB 2O3OA 3GZYB 2W9QA 5FW5A 1LOXA 2XSHB 3WA3A 1RMSA 2W2CA 2ML6A 1OF5A 2KRTA 1N5HA 1B2XA 1GY6A 5IG5A 1MNLA 1YIT3 3F7SA 2OQEC 2H0HA 3AMOA 3JUNA 1I70A 2R41A 1U8CB 4KFFA 1RSNA 5D81A 1YJW3 3NXJA 1R4CA 5FGOA 3EE1A 2E2TA 1STFI 1N9JA 1TRQA 2KF4A 4FR9A 2F99A 5BU4A 3SOYA 1YNVX 3KSPA 4HM4B 4GHOA 2KAAA 1Q42A 1S723 2MF7A 4X2HA 2OQEA 2P05A 4LMIA 1OGXA 2CWVA 4HM6B 1MGWA 4EBGA 3NM7A 1TU5A 4WYKA 1W2ZA 2UX0A 1IVWA 3L0RA 4K61A 2CFKA 4L8OA 1M1K4 2HMLB 2K0MA 3AMOB 2RCDA 4XB5A 1SARA 4WFOA 2LQVA 2I9WA 2F5WA 1M904 3PZWA 2MC8A 1YVBI 3CNXA 1YHQ3 2GEYA 2C4BA 3FGYA 3MHEA 1I0XA 1HKXA 2HMKB 4PEJA 5IF6A 1LNHA 3EBTA 4BIRA 1LRAA 1OUNA 3GRDA 3KSED 4WYKB 4O02B 5IEPA 2W6JH 2BU4A 3PGBA 3M8CA 4NHFA 1MOLA 5D82A 4EV5A 1VQ53 5TGNA 1AR0A 4XM4A 3LT9A 3URPA 5GSPA 5IG0A 4O8SA 2QA43 2OTJ3 3EHCA 1BRGA 1JB5A 4K90B 1I2EA 1A2PA 1QJGA 3AHSA 3ECFA 3GAXA 4HM8B 1VQN3 4NREA 5AIFA 1W5ZA 1BUQA 1VQP3 2L4VA 1IT7A 3D3LA 3EF8A 3T8UA 5AEWB 1D6UA 3WHOA 2FXTA 1VQ83 4N6TA 1YJN3 4N6V0 3Q3FA 1GSPA 4CDLA 3SLUA 1JB2A 1RGLA 1B2MA 3X3YA 1VQO3 3NQYA 4HM5B 3T8NA 2Y73A 3PCRA 5CK6A 4R1KA 3F8HA 4G1MB 3CCM3 2C11A 2XR8B 3H3HA 1KD14 3LTAA 2IYJA 3JVCA 3S27A 3OW22 1B2UA 1NDOB 4FCMA 1B27A 3DM8A 3AGNA 1O7MB 1TIJA 3N54B 1BSAA 1RLSA 1US1A 3EN8A 1OPYA 3IPTA 1Q40B 2D1WA 4LGQA 1FUTA 3F7XA 1DMNA 1I3FA 1T5YA 3U97A 1BOXA 1B2ZA 2CFDA 2XGNA 3G8ZA 1OH0A 8RNTA 1RCKA 4BL2A 4CPKA 1BUJA 5IG4A 1BSBA 3KZTA 2ZDJA 4I5QA 5KP1A 4U13A 1GOVA 1B20A 3FF2A
chains in the Genus database with same CATH topology
1WMOA 1A2KA 4WWUC 1EKMA 1W6GA 2P0XA 2YFIB 3FKAA 4KVHA 3FH1A 4XBYA 4O3VA 3PXMA 4RNZA 4BTWA 3CCU3 1UI8A 4N6OB 4TX4A 4OUQA 1UUVB 3NQZA 5EQLA 3CCS3 5HGRA 3UB1A 4HM3B 2OOVA 1TP6A 4AKZA 1NJI4 4MEIA 1A67A 1RRLA 2BMQB 1M1XB 4R4KA 2XRXB 1KSIA 4HM1B 1IQXA 4HYZA 3B8LA 1U5OA 4HJLB 3SOAA 2B24B 4XDVA 5LC7A 3DZLA 4STDA 1K8A4 2BNGA 1AVLA 2BO9B 3DGLA 3KFQC 4QWTA 5AEUB 1Q7Y4 1KC84 3CD63 1S5AA 2YX9A 3GWRA 4HVNA 1W01A 3F14A 3NBBA 4ZM8A 5JPUA 1C7HA 1JJ22 3SVAA 3UJMA 3IMAB 2GBWB 1JKGA 4L8PA 3G4S3 3V98A 3HK4A 1AVKA 3RGAA 3WDGB 1TFKA 3VF1A 3MSOA 1OHOA 4I4KA 3CCJ3 2XFSA 3B4PA 4LSOA 4GL6A 3S29A 3X3XA 2KXGA 2PZVA 2W56A 1VQK3 1IU7A 3MG3A 1M9GA 4HM2B 4K1VA 4EC6A 2E2VA 3S67A 1QAFA 4GB5A 4AEQA 3GZBA 3ALAA 3G16A 1JKGB 3K7CA 4RNYA 3N9HA 1CYUA 1W6YA 5AIIA 4FMDA 2XGLA 5BXQA 5JPPA 1V74A 3CXC2 5CXOA 1JB4A 2XH9A 4MJDA 1QAKA 1TFOA 3JUMA 3G713 3LMLA 2Z6BA 1ROVA 2W56B 4K1UA 2D42A 3JUQA 4R80A 2A15A 3U1WA 3UL5A 1Q864 1KWIA 1UUWB 2QGUA 1FGMA 4H3UA 1J2BA 3LOYA 3EQQB 3QRDA 1DMQA 3KE7A 1QVF2 1YGEA 3LH4A 1YJ93 2WGQA 4HKVB 2CG1A 3RDEA 2M7OA 1OHSA 4IIAA 1JN5A 1IVXA 1GD4A 2CH9A 3CC73 2WOFA 2JDIH 1ULIB 3Q1CA 4R9LA 2HMOB 3FCSB 3ROBA 4EXRA 1K41A 2CFGA 3HIIA 3NV0B 3NM2A 4ORLA 2W04A 5IW9A 3VSYA 1Q824 4KFDA 2XFTA 2ML5A 3CC43 3X40A 2QEX3 3OWYA 2IA7A 3CC23 1W02A 4HZBB 3LTCA 3CCE3 1JN5B 3FG3A 1VQ73 1Q40A 2CWUA 3F40A 2CKFB 3WOFB 5CF2A 4FCJA 1Q814 3G0KA 3LYGA 1DVDA 3OWSA 3E99A 4HBRA 2QIYA 3Q2PA 3NBRA 1IQYA 3X3ZA 4N6MA 2R4IA 3K63A 2OTL3 2B1XB 3N8BA 1W6CA 1IV9A 3OV4A 3EX9A 3JUPA 2BMRB 4BTYA 1OGZA 2P0MA 4HZ9B 1Z1SA 1ROAA 2CFLA 4KFEA 1IDPA 5BVBA 5CF1A 3CPW2 1K9M4 1NB5I 1VQ93 4J9AA 3LXUX 1VQM3 3BNEA 2GBXB 1QALA 5IG3A 4OK0A 3BLZA 3CNMA 1W4NA 3CCQ3 5STDA 3S28A 1VQL3 2CW9A 3EB8A 1PFPA 3I553 2E2UA 3GZRA 3X41A 3CCL3 1QVG2 3LTBA 1E3RA 5KP3A 1O7NB 2BMOB 1W7CA 4LEHA 3V92A 1CEWI 5IERA 1O7PB 1NB3I 2Z76A 1N5PA 2HMJB 1FGRA 3CCR3 1FGTA 3PYJA 3DMCA 3OXAA 3FF0A 1EQKA 4H61A 1VZZA 2RGQA 2Z77A 2F86B 2WO0A 5EEOA 5ELUA 1D6ZA 1EG9B 3MPHA 3BNCA 3I563 5IENA 1FGQA 1N8R4 4IT7A 4N3VA 1IVUA 1O7HB 3CPOA 2OWPA 2O9UX 2CC3A 3MWZA 2GU1A 5AI1A 3J7Yd 1LVNA 1IQ8A 2IMJA 2IUKA 2PNCA 1D6YA 2XEPA 4KZ1A 4EV2A 1JNQA 3Q90A 4XDWA 2P09A 4BTXA 1ISKA 1WQLB 2OCTA 4FMBA 5D83A 1DYUA 3HIGA 1Y4KA 3F8XA 1IK3A 3HI7A 4X2OA 1YI23 1GY5A 1UW1A 3I0YA 1N9EA 1SQWA 3IJEB 4LZIA 1IV7A 3O8YA 1W00A 3NV0A 4XBXA 1ZO2A 3MG2A 3KN4A 4JF8A 1A90A 3HZPA 2KCDA 2LYXA 3VGNA 2GU3A 1RN7A 2HMNB 1OCVA 3RGRA 3LZAA 4WHAA 4JRFA 3F9SA 7STDA 2W03A 1OF5B 1ASKA 3NHXA 3EJVA 5CLKA 5EVHA 2CG0A 3BB9A 1YIJ3 2CIUA 3JUOA 4CCVA 2CHCA 3B7CA 2YFJB 3KIIA 3NBJA 1K28A 3CME3 3STDA 3WMDA 1NO3A 3DGMA 3CCV3 3MKIA 2CK3H 3DY5A 3QK9A 1TUHA 5DRVA 1DVCA 3T0UA 1E97A 1WMNA 1RRHA 3K0ZA 3MYTA 1VQ43 3CMA3 5I97A 3SXXA 1UI7A 1L5GB 1KQS2 3WA2X 2IUJA 1K734 2P38A 3V99A 5JBSA 3HX8A 1GS3A 2GEXA 3BNDA 4FMCA 3A76A 3CU3A 2YFLB 2V1LA 1WTHA 2SBLA 3S5CA 2CFWA 3OX9A 2XF3A 3EN1B 3WODG 2W0QA 4IPBA 2Q07A 3MG1A 2W9PA 5AYSC 2FNQA 3DUKA 5AYRB 8CHOA 3FLJA 3K5TA 1SIHA 2HMMB 3LT8A 4R9KA 2FGTA 1SIIA 3D9RA 5ELJA 1LXEA 1VQ63 4AKYA 3NX0A 1FUWA 3FG1A 3ER7A 1AV4A 3SEDA 1OACA 3OWUA 3FSDA 3PCSA 1FA3A 1NWWA 2BT3A 5DREA 1JRQA 1FGOA 1CYVA 2XSOB 4OVMA 3SX1A 3DGOA 2STDA 4Q53A 1W2B2 4L7KA 1O7WB 3FG4A 4MMXB 5AIGA 1CQSA 2K54A 1DMMA 1IT8A 1IVVA 3B4OA 2BHMA 2CWTA 4RZMA 1HU9A 5LC6A 1GY7A 4HM0B 1SPUA 4MMYB 4XBTA 5AIHA 2RFRA 5KP4A 3DXOA 4N6LA 4HM7B 3TDGA 2OOVC 4N6NB 1EA2A 4WP5A 2JQ5A 3LTDA 2C10A 1NU3A 1SJWA 3DGNA 4MMZB 4J8TA 1QMAA 3G6E3 1PU4A 2F98A 1RKYA 1F8NA 1RJOA 3EBYA 3K9MC 6STDA 1A2VA 2INXA 2WGOA 5G2GA 5IEOA 1JV2B 5A0OB 1WNHA 1OHPA 2RSXA 3GZXB 3UNLA 2GXFA 4FCZA 1G96A 4N6UA 1STDA 1GYBA 3EC9A 2Y74A 1E3VA 4FMAA 3FZWA 2ZL8A 1GD3A 2WOHA 1WMPA 3KKGA 4EYCA 4RBNA 3NUVA 3UL6A 1ULJB 1ZX2A 3H51A 3WOEB 3BNBA 1N8QA 3X42A 4O2HA 1O7GB 2O3OA 3GZYB 2W9QA 5FW5A 1LOXA 2XSHB 3WA3A 2W2CA 2ML6A 1OF5A 2KRTA 1N5HA 1GY6A 5IG5A 1MNLA 1YIT3 3F7SA 2OQEC 3AMOA 3JUNA 1U8CB 4KFFA 5D81A 1YJW3 3NXJA 1R4CA 5FGOA 3EE1A 2E2TA 1STFI 1N9JA 4FR9A 2F99A 3SOYA 4HM4B 3KSPA 1Q42A 1S723 2MF7A 4X2HA 2OQEA 2P05A 4LMIA 1OGXA 2CWVA 4HM6B 4EBGA 3NM7A 1TU5A 4WYKA 1W2ZA 2UX0A 1IVWA 3L0RA 4K61A 2CFKA 4L8OA 1M1K4 2HMLB 2K0MA 3AMOB 2RCDA 4XB5A 4WFOA 2LQVA 2I9WA 1M904 3PZWA 2MC8A 1YVBI 3CNXA 1YHQ3 2GEYA 3FGYA 3MHEA 1HKXA 2HMKB 4PEJA 5IF6A 1LNHA 3EBTA 1OUNA 3GRDA 3KSED 4WYKB 4O02B 5IEPA 2W6JH 3PGBA 3M8CA 4NHFA 1MOLA 5D82A 4EV5A 1VQ53 5TGNA 1AR0A 4XM4A 3LT9A 2OTJ3 2QA43 5IG0A 4O8SA 3EHCA 4K90B 1JB5A 1QJGA 3ECFA 3GAXA 4HM8B 1VQN3 4NREA 5AIFA 1W5ZA 1BUQA 1VQP3 2L4VA 1IT7A 3D3LA 3EF8A 3T8UA 5AEWB 1D6UA 2FXTA 1VQ83 4N6TA 1YJN3 4N6V0 4CDLA 3SLUA 1JB2A 3X3YA 1VQO3 3NQYA 4HM5B 3T8NA 2Y73A 3PCRA 5CK6A 4R1KA 3F8HA 4G1MB 3CCM3 2C11A 2XR8B 3H3HA 1KD14 3LTAA 3S27A 3JVCA 3OW22 1NDOB 4FCMA 3DM8A 1O7MB 1TIJA 3N54B 1US1A 3EN8A 1OPYA 3IPTA 1Q40B 2D1WA 4LGQA 3F7XA 1DMNA 1T5YA 3U97A 2XGNA 2CFDA 3G8ZA 1OH0A 5IG4A 3KZTA 2ZDJA 5KP1A 4U13A 2Z7AA 3PS8A 3FF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVD A;  1RN7 A;  1GD3 A;  3Q2P A;  3PXM A;  3UL6 A;  4N6M A;  4N6O B;  4TX4 A;  4CCV A;  5EQL A;  1IV9 A;  2W9Q A;  1N5H A;  1A67 A;  1MNL A;  1ROA A;  1R4C A;  5LC7 A;  1DVC A;  1NB5 I;  1N9J A;  1STF I;  2BO9 B;  3KFQ C;  4ZM8 A;  3SVA A;  3L0R A;  1PFP A;  3IMA B;  2W9P A;  1YVB I;  1CEW I;  1NB3 I;  2KXG A;  1N5P A;  3KSE D;  5ELJ A;  1FUW A;  1LXE A;  1M9G A;  3NX0 A;  3PYJ A;  3S67 A;  1MOL A;  1EQK A;  1FA3 A;  1CYU A;  1CYV A;  3GAX A;  5ELU A;  4N6T A;  5LC6 A;  4EYC A;  4N6V 0;  4IT7 A;  3UL5 A;  1KWI A;  2O9U X;  3MWZ A;  4N6L A;  3QRD A;  4N6N B;  3LH4 A;  1GD4 A;  2CH9 A;  2OCT A;  3K9M C;  1TIJ A;  5A0O B;  4LZI A;  1IV7 A;  1WNH A;  1G96 A;  4N6U A;  1A90 A;  3PS8 A; 
#chains in the Genus database with same CATH topology
 1UGI A;  1WMO A;  1A2K A;  4WWU C;  1EKM A;  1W6G A;  2P0X A;  1BRS A;  2YFI B;  1NNV A;  3FKA A;  4KVH A;  3FH1 A;  4XBY A;  4O3V A;  3PXM A;  4RNZ A;  1GOY A;  1RNT A;  4BTW A;  3CCU 3;  1UI8 A;  4N6O B;  4TX4 A;  4OUQ A;  1UUV B;  3NQZ A;  5EQL A;  3CCS 3;  5HGR A;  3CC7 3;  3UB1 A;  1UUG B;  1RCL A;  4HM3 B;  1TP6 A;  2OOV A;  4AKZ A;  1NJI 4;  1Q9E A;  1ZGX A;  4MEI A;  1LOY A;  1A67 A;  1IYY A;  1LQM B;  1RRL A;  1M1X B;  2BMQ B;  4R4K A;  3DH2 A;  1MWT A;  2XRX B;  1KSI A;  1HYF A;  4HM1 B;  1IQX A;  4HYZ A;  3B8L A;  1U5O A;  4HJL B;  3SOA A;  4CJN A;  2B24 B;  1T2H A;  4XDV A;  5LC7 A;  3DZL A;  4STD A;  5M1A A;  1K8A 4;  1BNF A;  1AVL A;  2BNG A;  2BO9 B;  3DGL A;  3KFQ C;  4QWT A;  2AAD A;  5G1L A;  5AEU B;  1Q7Y 4;  1KC8 4;  1S5A A;  2YX9 A;  3GWR A;  3CD6 3;  4HVN A;  1W01 A;  3F14 A;  3NBB A;  4J5K A;  4ZM8 A;  5JPU A;  1C7H A;  1JJ2 2;  3SVA A;  3UJM A;  3IMA B;  2GBW B;  1JKG A;  4L8P A;  3G4S 3;  3V98 A;  1X1U A;  3HK4 A;  1AVK A;  3RGA A;  2HOH A;  3WDG B;  1TFK A;  3VF1 A;  3MSO A;  1X1W A;  1FZU A;  1OHO A;  4I4K A;  3CCJ 3;  2XFS A;  3B4P A;  4LSO A;  4GL6 A;  3S29 A;  1I3I A;  3X3X A;  2KXG A;  2PZV A;  2W56 A;  1VQK 3;  1DE3 A;  1IU7 A;  3MG3 A;  1M9G A;  4HM2 B;  4K1V A;  4EC6 A;  2E2V A;  3S67 A;  1EEJ A;  1QAF A;  4GB5 A;  2F4Y A;  3GZB A;  4AEQ A;  3ALA A;  3G16 A;  1JKG B;  3K7C A;  4RNY A;  3N9H A;  1CYU A;  1W6Y A;  5AII A;  4FMD A;  2XGL A;  5BXQ A;  5JPP A;  1V74 A;  1BSC A;  3CXC 2;  5CXO A;  1JB4 A;  2XH9 A;  4MJD A;  1QAK A;  1JBT A;  1RGC A;  1TFO A;  2UGI A;  5M18 A;  3JUM A;  1GOU A;  3G71 3;  1JZO A;  1T3B A;  3LML A;  2Z6B A;  1ROV A;  2W56 B;  4K1U A;  2D42 A;  3JUQ A;  4R80 A;  2A15 A;  3U1W A;  3UL5 A;  1Q86 4;  1KWI A;  1UUW B;  2QGU A;  1FGM A;  4H3U A;  1J2B A;  3LOY A;  3EQQ B;  3QRD A;  1DMQ A;  1MGR A;  3KE7 A;  1YGE A;  3LH4 A;  1YJ9 3;  1QVF 2;  2WGQ A;  4HKV B;  2CG1 A;  3RDE A;  2M7O A;  1OHS A;  3AHW A;  4IIA A;  1JN5 A;  1IVX A;  1BRI A;  1GD4 A;  2CH9 A;  2WOF A;  2JDI H;  1ULI B;  3Q1C A;  4R9L A;  2HMO B;  3FCS B;  3ROB A;  4EXR A;  3HOH A;  1JZD A;  1K41 A;  2CFG A;  3HII A;  3NV0 B;  1YVS A;  3NM2 A;  3RNT A;  1DET A;  4ORL A;  2W04 A;  5IW9 A;  3VSY A;  1Q82 4;  4KFD A;  4RNT A;  2XFT A;  2ML5 A;  3CC4 3;  3X40 A;  1BRN L;  2QEX 3;  1RN1 A;  7RNT A;  3OWY A;  2IA7 A;  3CC2 3;  1W02 A;  4HZB B;  3LTC A;  3CCE 3;  1JN5 B;  3FG3 A;  5G1K A;  1VQ7 3;  1Q40 A;  1MWS A;  2CWU A;  3F40 A;  2CKF B;  3WOF B;  5CF2 A;  4FCJ A;  1Q81 4;  3G0K A;  3LYG A;  1DVD A;  3OWS A;  1BAN A;  3E99 A;  4HBR A;  2QIY A;  1HZ1 A;  3Q2P A;  3NBR A;  1IQY A;  3X3Z A;  1G02 A;  4N6M A;  2R4I A;  3K63 A;  2OTL 3;  2B1X B;  3N8B A;  1W6C A;  1IV9 A;  3OV4 A;  3EX9 A;  3JUP A;  2BMR B;  4BTY A;  1OGZ A;  2P0M A;  3SYU A;  4HZ9 B;  1Z1S A;  2KF3 A;  1ROA A;  2CFL A;  4KFE A;  1IDP A;  1BNI A;  5BVB A;  1RGH A;  5CF1 A;  3CPW 2;  1AQZ A;  1FYS A;  1K9M 4;  1NB5 I;  1VQ9 3;  4J9A A;  3D79 A;  3LXU X;  1VQM 3;  3BNE A;  1RGG A;  2GBX B;  1QAL A;  5IG3 A;  4OK0 A;  3BLZ A;  3WR2 A;  3CNM A;  3ZG0 A;  2SAR A;  1BSD A;  1GMP A;  1MWU A;  1W4N A;  3CCQ 3;  6GSP A;  4BU4 A;  1BVI A;  5STD A;  3S28 A;  1VQL 3;  2CW9 A;  3EB8 A;  1PFP A;  3GSP A;  3ZFZ A;  3I55 3;  2E2U A;  2RBI A;  3GZR A;  3X41 A;  3CCL 3;  1EUI C;  1QVG 2;  3LTB A;  1PYL A;  1E3R A;  5KP3 A;  1O7N B;  4ILF A;  2BMO B;  3A5E A;  1W7C A;  3BIR A;  4LEH A;  3V92 A;  1CEW I;  4J5G A;  5IER A;  1O7P B;  1RGK A;  1NB3 I;  2Z76 A;  1N5P A;  2HMJ B;  1FGR A;  2GSP A;  3CCR 3;  2K3D A;  1I2G A;  1FGT A;  3PYJ A;  3DMC A;  3OXA A;  3FF0 A;  1EQK A;  4H61 A;  1VZZ A;  2RGQ A;  2Z77 A;  2F86 B;  2WO0 A;  5EEO A;  5M19 A;  5ELU A;  1D6Z A;  4BL3 A;  3ZG5 A;  1EG9 B;  2CX0 A;  3MPH A;  3BNC A;  1PY3 A;  3I56 3;  5IEN A;  1FGQ A;  3DGY A;  1N8R 4;  4IT7 A;  4N3V A;  1IVU A;  1BGS A;  1I2F A;  1O7H B;  3CPO A;  2OWP A;  7GSP A;  2O9U X;  2CC3 A;  3D4A A;  3MWZ A;  2GU1 A;  5AI1 A;  3J7Y d;  1B21 A;  1LVN A;  1BNS A;  1IQ8 A;  2IMJ A;  2J8X B;  2IUK A;  2PNC A;  1D6Y A;  2XEP A;  4KZ1 A;  2L1S A;  4EV2 A;  1JNQ A;  3Q90 A;  4XDW A;  4DKI A;  2P09 A;  4BTX A;  1ISK A;  1WQL B;  2OCT A;  4FMB A;  5D83 A;  1DYU A;  1BNG A;  1Y4K A;  3HIG A;  3F8X A;  1UDI I;  1IK3 A;  3HI7 A;  1Q7H A;  4X2O A;  1YI2 3;  1GY5 A;  1UW1 A;  3I0Y A;  3KCH A;  1V57 A;  1N9E A;  1SQW A;  3IJE B;  4LZI A;  1IV7 A;  3O8Y A;  1W00 A;  4HOH A;  3NV0 A;  4XBX A;  1UGH I;  1ZO2 A;  3MG2 A;  1RTU A;  4NPB A;  3KN4 A;  4JF8 A;  1A90 A;  3HZP A;  2KCD A;  2LYX A;  3VGN A;  2GU3 A;  1RN7 A;  2HMN B;  1OCV A;  3RGR A;  3LZA A;  2H0G A;  4WHA A;  4JRF A;  3F9S A;  7STD A;  2KF6 A;  1BNE A;  1CH0 A;  1OF5 B;  1ASK A;  2W03 A;  2ZA4 A;  3EJV A;  3NHX A;  1VQQ A;  2CG0 A;  2Z7A A;  3BB9 A;  5CLK A;  5EVH A;  1YIJ 3;  2CIU A;  2RNT A;  3JUO A;  4CCV A;  2CHC A;  5BIR A;  2F56 A;  3B7C A;  2YFJ B;  4LYL B;  3KII A;  3NBJ A;  1K28 A;  1UCK A;  3CME 3;  1MWR A;  3STD A;  3WMD A;  1NO3 A;  1FUS A;  3DGM A;  3CCV 3;  3MKI A;  2CK3 H;  3DY5 A;  3QK9 A;  1UCJ A;  1JBR A;  1TUH A;  5DRV A;  2IY2 A;  1DVC A;  3T0U A;  1E97 A;  1JBS A;  1WMN A;  1RRH A;  3K0Z A;  3MYT A;  1VQ4 3;  3CMA 3;  5I97 A;  1RGE A;  1UI7 A;  1L5G B;  3SXX A;  3WA2 X;  1KQS 2;  2IUJ A;  1K73 4;  1BU4 A;  2P38 A;  3V99 A;  5JBS A;  3HX8 A;  1GS3 A;  2GEX A;  3BND A;  4FMC A;  1BRJ A;  3A76 A;  2YFL B;  3CU3 A;  2V1L A;  1WTH A;  1GMR A;  2SBL A;  1BIR A;  3S5C A;  1X1Y A;  1B2S A;  2CFW A;  3OX9 A;  1BNJ A;  1RDS A;  2XF3 A;  1TTO A;  3EN1 B;  3WOD G;  2W0Q A;  4IPB A;  2Q07 A;  3MG1 A;  2W9P A;  5AYS C;  2KF5 A;  2FNQ A;  3DUK A;  5AYR B;  8CHO A;  3FLJ A;  3K5T A;  3PS8 A;  1SIH A;  2HMM B;  3LT8 A;  2H0I A;  4R9K A;  1G0T A;  2FGT A;  1RNB A;  1SII A;  3BU4 A;  1LNI A;  3D9R A;  5ELJ A;  1LXE A;  1VQ6 3;  4AKY A;  3NX0 A;  1FUW A;  3FG1 A;  3ER7 A;  1AV4 A;  1BRH A;  4HAA A;  3SED A;  1OAC A;  3OWU A;  3FSD A;  1UCL A;  3PCS A;  1FA3 A;  1NWW A;  2BT3 A;  1BSE A;  5DRE A;  1JRQ A;  2UUG C;  1FGO A;  1I0V A;  1LOW A;  1CYV A;  2XSO B;  4OVM A;  3SX1 A;  3DGO A;  6RNT A;  2STD A;  1I8V A;  4Q53 A;  1T2I A;  1O7W B;  3FG4 A;  4L7K A;  4MMX B;  5AIG A;  1RHL A;  1W2B 2;  1CQS A;  2K54 A;  5HOH A;  1DMM A;  1IT8 A;  1C54 A;  1B3S A;  1IVV A;  3B4O A;  2BHM A;  2CWT A;  3AGO A;  1HU9 A;  4RZM A;  1GY7 A;  1UCI A;  1SPU A;  2CX1 A;  4HM0 B;  4MMY B;  4XBT A;  1BRK A;  5AIH A;  2RFR A;  5KP4 A;  3DXO A;  4N6L A;  4HM7 B;  1LOV A;  3TDG A;  1BAO A;  2F5M A;  2OOV C;  3D5G A;  1EA2 A;  4N6N B;  5RNT A;  4WP5 A;  2JQ5 A;  1RGA A;  3LTD A;  2C10 A;  1NU3 A;  1SJW A;  3DGN A;  1FW7 A;  4MMZ B;  1GMQ A;  4J8T A;  1QMA A;  3G6E 3;  4KT3 B;  1PU4 A;  2F98 A;  1RKY A;  1F8N A;  1RJO A;  1TJD A;  3EBY A;  3K9M C;  4GSP A;  6STD A;  1A2V A;  2INX A;  2WGO A;  5G2G A;  5IEO A;  1R4Y A;  1JV2 B;  5A0O B;  2ZHX B;  1WNH A;  1OHP A;  2RSX A;  1RGF A;  3GZX B;  1V58 A;  2GXF A;  4FCZ A;  1G96 A;  4N6U A;  3UNL A;  1STD A;  4EW5 A;  9RNT A;  1X1X A;  3D5I A;  1GYB A;  3EC9 A;  2Y74 A;  1E3V A;  1ZS7 A;  4FMA A;  3FZW A;  2ZL8 A;  2AAE A;  1RN4 A;  1GD3 A;  2WOH A;  1YGW A;  1WMP A;  1LQG C;  3KKG A;  1BNR A;  4EYC A;  4RBN A;  3NUV A;  5LC6 A;  1ULJ B;  2BIR A;  3UL6 A;  1ZX2 A;  3H51 A;  3WOE B;  3BNB A;  1N8Q A;  3X42 A;  1AY7 A;  1TRP A;  4O2H A;  1O7G B;  2O3O A;  3GZY B;  2W9Q A;  5FW5 A;  1LOX A;  2XSH B;  3WA3 A;  1RMS A;  2W2C A;  2ML6 A;  1OF5 A;  2KRT A;  1N5H A;  1B2X A;  1GY6 A;  5IG5 A;  1MNL A;  1YIT 3;  3F7S A;  2OQE C;  2H0H A;  3AMO A;  3JUN A;  1I70 A;  2R41 A;  1U8C B;  4KFF A;  1RSN A;  5D81 A;  1YJW 3;  3NXJ A;  1R4C A;  5FGO A;  3EE1 A;  2E2T A;  1STF I;  1N9J A;  1TRQ A;  2KF4 A;  4FR9 A;  2F99 A;  5BU4 A;  3SOY A;  1YNV X;  3KSP A;  4HM4 B;  4GHO A;  2KAA A;  1Q42 A;  1S72 3;  2MF7 A;  4X2H A;  2OQE A;  2P05 A;  4LMI A;  1OGX A;  2CWV A;  4HM6 B;  1MGW A;  4EBG A;  3NM7 A;  1TU5 A;  4WYK A;  1W2Z A;  2UX0 A;  1IVW A;  3L0R A;  4K61 A;  2CFK A;  4L8O A;  1M1K 4;  2HML B;  2K0M A;  3AMO B;  2RCD A;  4XB5 A;  1SAR A;  4WFO A;  2LQV A;  2I9W A;  2F5W A;  1M90 4;  3PZW A;  2MC8 A;  1YVB I;  3CNX A;  1YHQ 3;  2GEY A;  2C4B A;  3FGY A;  3MHE A;  1I0X A;  1HKX A;  2HMK B;  4PEJ A;  5IF6 A;  1LNH A;  3EBT A;  4BIR A;  1LRA A;  1OUN A;  3GRD A;  3KSE D;  4WYK B;  4O02 B;  5IEP A;  2W6J H;  2BU4 A;  3PGB A;  3M8C A;  4NHF A;  1MOL A;  5D82 A;  4EV5 A;  1VQ5 3;  5TGN A;  1AR0 A;  4XM4 A;  3LT9 A;  3URP A;  5GSP A;  5IG0 A;  4O8S A;  2QA4 3;  2OTJ 3;  3EHC A;  1BRG A;  1JB5 A;  4K90 B;  1I2E A;  1A2P A;  1QJG A;  3AHS A;  3ECF A;  3GAX A;  4HM8 B;  1VQN 3;  4NRE A;  5AIF A;  1W5Z A;  1BUQ A;  1VQP 3;  2L4V A;  1IT7 A;  3D3L A;  3EF8 A;  3T8U A;  5AEW B;  1D6U A;  3WHO A;  2FXT A;  1VQ8 3;  4N6T A;  1YJN 3;  4N6V 0;  3Q3F A;  1GSP A;  4CDL A;  3SLU A;  1JB2 A;  1RGL A;  1B2M A;  3X3Y A;  1VQO 3;  3NQY A;  4HM5 B;  3T8N A;  2Y73 A;  3PCR A;  5CK6 A;  4R1K A;  3F8H A;  4G1M B;  3CCM 3;  2C11 A;  2XR8 B;  3H3H A;  1KD1 4;  3LTA A;  2IYJ A;  3JVC A;  3S27 A;  3OW2 2;  1B2U A;  1NDO B;  4FCM A;  1B27 A;  3DM8 A;  3AGN A;  1O7M B;  1TIJ A;  3N54 B;  1BSA A;  1RLS A;  1US1 A;  3EN8 A;  1OPY A;  3IPT A;  1Q40 B;  2D1W A;  4LGQ A;  1FUT A;  3F7X A;  1DMN A;  1I3F A;  1T5Y A;  3U97 A;  1BOX A;  1B2Z A;  2CFD A;  2XGN A;  3G8Z A;  1OH0 A;  8RNT A;  1RCK A;  4BL2 A;  4CPK A;  1BUJ A;  5IG4 A;  1BSB A;  3KZT A;  2ZDJ A;  4I5Q A;  5KP1 A;  4U13 A;  1GOV A;  1B20 A;  3FF2 A; 
#chains in the Genus database with same CATH homology
 1WMO A;  1A2K A;  4WWU C;  1EKM A;  1W6G A;  2P0X A;  2YFI B;  3FKA A;  4KVH A;  3FH1 A;  4XBY A;  4O3V A;  3PXM A;  4RNZ A;  4BTW A;  3CCU 3;  1UI8 A;  4N6O B;  4TX4 A;  4OUQ A;  1UUV B;  3NQZ A;  5EQL A;  3CCS 3;  5HGR A;  3UB1 A;  4HM3 B;  2OOV A;  1TP6 A;  4AKZ A;  1NJI 4;  4MEI A;  1A67 A;  1RRL A;  2BMQ B;  1M1X B;  4R4K A;  2XRX B;  1KSI A;  4HM1 B;  1IQX A;  4HYZ A;  3B8L A;  1U5O A;  4HJL B;  3SOA A;  2B24 B;  4XDV A;  5LC7 A;  3DZL A;  4STD A;  1K8A 4;  2BNG A;  1AVL A;  2BO9 B;  3DGL A;  3KFQ C;  4QWT A;  5AEU B;  1Q7Y 4;  1KC8 4;  3CD6 3;  1S5A A;  2YX9 A;  3GWR A;  4HVN A;  1W01 A;  3F14 A;  3NBB A;  4ZM8 A;  5JPU A;  1C7H A;  1JJ2 2;  3SVA A;  3UJM A;  3IMA B;  2GBW B;  1JKG A;  4L8P A;  3G4S 3;  3V98 A;  3HK4 A;  1AVK A;  3RGA A;  3WDG B;  1TFK A;  3VF1 A;  3MSO A;  1OHO A;  4I4K A;  3CCJ 3;  2XFS A;  3B4P A;  4LSO A;  4GL6 A;  3S29 A;  3X3X A;  2KXG A;  2PZV A;  2W56 A;  1VQK 3;  1IU7 A;  3MG3 A;  1M9G A;  4HM2 B;  4K1V A;  4EC6 A;  2E2V A;  3S67 A;  1QAF A;  4GB5 A;  4AEQ A;  3GZB A;  3ALA A;  3G16 A;  1JKG B;  3K7C A;  4RNY A;  3N9H A;  1CYU A;  1W6Y A;  5AII A;  4FMD A;  2XGL A;  5BXQ A;  5JPP A;  1V74 A;  3CXC 2;  5CXO A;  1JB4 A;  2XH9 A;  4MJD A;  1QAK A;  1TFO A;  3JUM A;  3G71 3;  3LML A;  2Z6B A;  1ROV A;  2W56 B;  4K1U A;  2D42 A;  3JUQ A;  4R80 A;  2A15 A;  3U1W A;  3UL5 A;  1Q86 4;  1KWI A;  1UUW B;  2QGU A;  1FGM A;  4H3U A;  1J2B A;  3LOY A;  3EQQ B;  3QRD A;  1DMQ A;  3KE7 A;  1QVF 2;  1YGE A;  3LH4 A;  1YJ9 3;  2WGQ A;  4HKV B;  2CG1 A;  3RDE A;  2M7O A;  1OHS A;  4IIA A;  1JN5 A;  1IVX A;  1GD4 A;  2CH9 A;  3CC7 3;  2WOF A;  2JDI H;  1ULI B;  3Q1C A;  4R9L A;  2HMO B;  3FCS B;  3ROB A;  4EXR A;  1K41 A;  2CFG A;  3HII A;  3NV0 B;  3NM2 A;  4ORL A;  2W04 A;  5IW9 A;  3VSY A;  1Q82 4;  4KFD A;  2XFT A;  2ML5 A;  3CC4 3;  3X40 A;  2QEX 3;  3OWY A;  2IA7 A;  3CC2 3;  1W02 A;  4HZB B;  3LTC A;  3CCE 3;  1JN5 B;  3FG3 A;  1VQ7 3;  1Q40 A;  2CWU A;  3F40 A;  2CKF B;  3WOF B;  5CF2 A;  4FCJ A;  1Q81 4;  3G0K A;  3LYG A;  1DVD A;  3OWS A;  3E99 A;  4HBR A;  2QIY A;  3Q2P A;  3NBR A;  1IQY A;  3X3Z A;  4N6M A;  2R4I A;  3K63 A;  2OTL 3;  2B1X B;  3N8B A;  1W6C A;  1IV9 A;  3OV4 A;  3EX9 A;  3JUP A;  2BMR B;  4BTY A;  1OGZ A;  2P0M A;  4HZ9 B;  1Z1S A;  1ROA A;  2CFL A;  4KFE A;  1IDP A;  5BVB A;  5CF1 A;  3CPW 2;  1K9M 4;  1NB5 I;  1VQ9 3;  4J9A A;  3LXU X;  1VQM 3;  3BNE A;  2GBX B;  1QAL A;  5IG3 A;  4OK0 A;  3BLZ A;  3CNM A;  1W4N A;  3CCQ 3;  5STD A;  3S28 A;  1VQL 3;  2CW9 A;  3EB8 A;  1PFP A;  3I55 3;  2E2U A;  3GZR A;  3X41 A;  3CCL 3;  1QVG 2;  3LTB A;  1E3R A;  5KP3 A;  1O7N B;  2BMO B;  1W7C A;  4LEH A;  3V92 A;  1CEW I;  5IER A;  1O7P B;  1NB3 I;  2Z76 A;  1N5P A;  2HMJ B;  1FGR A;  3CCR 3;  1FGT A;  3PYJ A;  3DMC A;  3OXA A;  3FF0 A;  1EQK A;  4H61 A;  1VZZ A;  2RGQ A;  2Z77 A;  2F86 B;  2WO0 A;  5EEO A;  5ELU A;  1D6Z A;  1EG9 B;  3MPH A;  3BNC A;  3I56 3;  5IEN A;  1FGQ A;  1N8R 4;  4IT7 A;  4N3V A;  1IVU A;  1O7H B;  3CPO A;  2OWP A;  2O9U X;  2CC3 A;  3MWZ A;  2GU1 A;  5AI1 A;  3J7Y d;  1LVN A;  1IQ8 A;  2IMJ A;  2IUK A;  2PNC A;  1D6Y A;  2XEP A;  4KZ1 A;  4EV2 A;  1JNQ A;  3Q90 A;  4XDW A;  2P09 A;  4BTX A;  1ISK A;  1WQL B;  2OCT A;  4FMB A;  5D83 A;  1DYU A;  3HIG A;  1Y4K A;  3F8X A;  1IK3 A;  3HI7 A;  4X2O A;  1YI2 3;  1GY5 A;  1UW1 A;  3I0Y A;  1N9E A;  1SQW A;  3IJE B;  4LZI A;  1IV7 A;  3O8Y A;  1W00 A;  3NV0 A;  4XBX A;  1ZO2 A;  3MG2 A;  3KN4 A;  4JF8 A;  1A90 A;  3HZP A;  2KCD A;  2LYX A;  3VGN A;  2GU3 A;  1RN7 A;  2HMN B;  1OCV A;  3RGR A;  3LZA A;  4WHA A;  4JRF A;  3F9S A;  7STD A;  2W03 A;  1OF5 B;  1ASK A;  3NHX A;  3EJV A;  5CLK A;  5EVH A;  2CG0 A;  3BB9 A;  1YIJ 3;  2CIU A;  3JUO A;  4CCV A;  2CHC A;  3B7C A;  2YFJ B;  3KII A;  3NBJ A;  1K28 A;  3CME 3;  3STD A;  3WMD A;  1NO3 A;  3DGM A;  3CCV 3;  3MKI A;  2CK3 H;  3DY5 A;  3QK9 A;  1TUH A;  5DRV A;  1DVC A;  3T0U A;  1E97 A;  1WMN A;  1RRH A;  3K0Z A;  3MYT A;  1VQ4 3;  3CMA 3;  5I97 A;  3SXX A;  1UI7 A;  1L5G B;  1KQS 2;  3WA2 X;  2IUJ A;  1K73 4;  2P38 A;  3V99 A;  5JBS A;  3HX8 A;  1GS3 A;  2GEX A;  3BND A;  4FMC A;  3A76 A;  3CU3 A;  2YFL B;  2V1L A;  1WTH A;  2SBL A;  3S5C A;  2CFW A;  3OX9 A;  2XF3 A;  3EN1 B;  3WOD G;  2W0Q A;  4IPB A;  2Q07 A;  3MG1 A;  2W9P A;  5AYS C;  2FNQ A;  3DUK A;  5AYR B;  8CHO A;  3FLJ A;  3K5T A;  1SIH A;  2HMM B;  3LT8 A;  4R9K A;  2FGT A;  1SII A;  3D9R A;  5ELJ A;  1LXE A;  1VQ6 3;  4AKY A;  3NX0 A;  1FUW A;  3FG1 A;  3ER7 A;  1AV4 A;  3SED A;  1OAC A;  3OWU A;  3FSD A;  3PCS A;  1FA3 A;  1NWW A;  2BT3 A;  5DRE A;  1JRQ A;  1FGO A;  1CYV A;  2XSO B;  4OVM A;  3SX1 A;  3DGO A;  2STD A;  4Q53 A;  1W2B 2;  4L7K A;  1O7W B;  3FG4 A;  4MMX B;  5AIG A;  1CQS A;  2K54 A;  1DMM A;  1IT8 A;  1IVV A;  3B4O A;  2BHM A;  2CWT A;  4RZM A;  1HU9 A;  5LC6 A;  1GY7 A;  4HM0 B;  1SPU A;  4MMY B;  4XBT A;  5AIH A;  2RFR A;  5KP4 A;  3DXO A;  4N6L A;  4HM7 B;  3TDG A;  2OOV C;  4N6N B;  1EA2 A;  4WP5 A;  2JQ5 A;  3LTD A;  2C10 A;  1NU3 A;  1SJW A;  3DGN A;  4MMZ B;  4J8T A;  1QMA A;  3G6E 3;  1PU4 A;  2F98 A;  1RKY A;  1F8N A;  1RJO A;  3EBY A;  3K9M C;  6STD A;  1A2V A;  2INX A;  2WGO A;  5G2G A;  5IEO A;  1JV2 B;  5A0O B;  1WNH A;  1OHP A;  2RSX A;  3GZX B;  3UNL A;  2GXF A;  4FCZ A;  1G96 A;  4N6U A;  1STD A;  1GYB A;  3EC9 A;  2Y74 A;  1E3V A;  4FMA A;  3FZW A;  2ZL8 A;  1GD3 A;  2WOH A;  1WMP A;  3KKG A;  4EYC A;  4RBN A;  3NUV A;  3UL6 A;  1ULJ B;  1ZX2 A;  3H51 A;  3WOE B;  3BNB A;  1N8Q A;  3X42 A;  4O2H A;  1O7G B;  2O3O A;  3GZY B;  2W9Q A;  5FW5 A;  1LOX A;  2XSH B;  3WA3 A;  2W2C A;  2ML6 A;  1OF5 A;  2KRT A;  1N5H A;  1GY6 A;  5IG5 A;  1MNL A;  1YIT 3;  3F7S A;  2OQE C;  3AMO A;  3JUN A;  1U8C B;  4KFF A;  5D81 A;  1YJW 3;  3NXJ A;  1R4C A;  5FGO A;  3EE1 A;  2E2T A;  1STF I;  1N9J A;  4FR9 A;  2F99 A;  3SOY A;  4HM4 B;  3KSP A;  1Q42 A;  1S72 3;  2MF7 A;  4X2H A;  2OQE A;  2P05 A;  4LMI A;  1OGX A;  2CWV A;  4HM6 B;  4EBG A;  3NM7 A;  1TU5 A;  4WYK A;  1W2Z A;  2UX0 A;  1IVW A;  3L0R A;  4K61 A;  2CFK A;  4L8O A;  1M1K 4;  2HML B;  2K0M A;  3AMO B;  2RCD A;  4XB5 A;  4WFO A;  2LQV A;  2I9W A;  1M90 4;  3PZW A;  2MC8 A;  1YVB I;  3CNX A;  1YHQ 3;  2GEY A;  3FGY A;  3MHE A;  1HKX A;  2HMK B;  4PEJ A;  5IF6 A;  1LNH A;  3EBT A;  1OUN A;  3GRD A;  3KSE D;  4WYK B;  4O02 B;  5IEP A;  2W6J H;  3PGB A;  3M8C A;  4NHF A;  1MOL A;  5D82 A;  4EV5 A;  1VQ5 3;  5TGN A;  1AR0 A;  4XM4 A;  3LT9 A;  2OTJ 3;  2QA4 3;  5IG0 A;  4O8S A;  3EHC A;  4K90 B;  1JB5 A;  1QJG A;  3ECF A;  3GAX A;  4HM8 B;  1VQN 3;  4NRE A;  5AIF A;  1W5Z A;  1BUQ A;  1VQP 3;  2L4V A;  1IT7 A;  3D3L A;  3EF8 A;  3T8U A;  5AEW B;  1D6U A;  2FXT A;  1VQ8 3;  4N6T A;  1YJN 3;  4N6V 0;  4CDL A;  3SLU A;  1JB2 A;  3X3Y A;  1VQO 3;  3NQY A;  4HM5 B;  3T8N A;  2Y73 A;  3PCR A;  5CK6 A;  4R1K A;  3F8H A;  4G1M B;  3CCM 3;  2C11 A;  2XR8 B;  3H3H A;  1KD1 4;  3LTA A;  3S27 A;  3JVC A;  3OW2 2;  1NDO B;  4FCM A;  3DM8 A;  1O7M B;  1TIJ A;  3N54 B;  1US1 A;  3EN8 A;  1OPY A;  3IPT A;  1Q40 B;  2D1W A;  4LGQ A;  3F7X A;  1DMN A;  1T5Y A;  3U97 A;  2XGN A;  2CFD A;  3G8Z A;  1OH0 A;  5IG4 A;  3KZT A;  2ZDJ A;  5KP1 A;  4U13 A;  2Z7A A;  3PS8 A;  3FF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...