3K9MC

Cathepsin b in complex with stefin a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
publication title Stefin A displaces the occluding loop of cathepsin B only by as much as required to bind to the active site cleft
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k9mC00
3PYJA 1R4CA 4N6MA 1LXEA 4ZM8A 1ROAA 1GD3A 1N9JA 5A0OB 1YVBI 2CH9A 3UL5A 1CYUA 1TIJA 3SVAA 3L0RA 1GD4A 1MNLA 1N5PA 4N6TA 1FA3A 3K9MC 1DVCA 1NB5I 4IT7A 4TX4A 5LC7A 2KXGA 1IV7A 1IV9A 4LZIA 1WNHA 3GAXA 4N6OB 4N6V0 5ELJA 1G96A 3KFQC 1NB3I 1MOLA 1STFI 4CCVA 4N6UA 1A67A 3UL6A 3S67A 1KWIA 1CYVA 5ELUA 4N6LA 4EYCA 1CEWI 3QRDA 2O9UX 4N6NB 3LH4A 5EQLA 3NX0A 3MWZA 3PS8A 2W9QA 3PXMA 1EQKA 1N5HA 1M9GA 1PFPA 1FUWA 3IMAB 5LC6A 1DVDA 3Q2PA 2W9PA 1RN7A 2OCTA 1A90A 2BO9B 3KSED
chains in the Genus database with same CATH superfamily
1V74A 1M904 4R1KA 3CCU3 1JZDA 4XDWA 1T3BA 3ZG5A 3MG2A 1BSCA 2FXTA 2XF3A 2XEPA 2ZL8A 4R9LA 3M8CA 4FMAA 3AGOA 1W2B2 2YFLB 3WOEB 1T5YA 1G02A 5IG4A 1BSAA 1ULIB 4JRFA 2YX9A 1N9JA 3UJMA 1B27A 4EV5A 1YVBI 3BNEA 3RDEA 5RNTA 1OHPA 1GMPA 3VSYA 4HM1B 5HGRA 5IW9A 5JPPA 2BT3A 1CYUA 5CXOA 4OK0A 5FW5A 1UUGB 3E99A 1TIJA 3PCRA 4CPKA 3ROBA 1DMQA 1RGCA 1UI8A 3CXC2 5CK6A 4R9KA 1E97A 4EBGA 1X1WA 1US1A 1LNHA 2W6JH 3HX8A 1YIJ3 3GZXB 1VQK3 3G713 4GB5A 2BU4A 1FA3A 2IYJA 3OX9A 1OPYA 1MWSA 3EF8A 3FF0A 3NV0A 2RFRA 2STDA 2M7OA 1K734 1NB5I 1RGFA 4TX4A 3CC23 1IQ8A 1GYBA 1W6YA 5CLKA 5AEUB 2SARA 5BXQA 1RHLA 4L8PA 1Q864 1BNJA 2F99A 3DGLA 4NREA 3DMCA 5D81A 4N6OB 4R4KA 2FNQA 3CC43 5IG5A 3CCM3 4L7KA 1R4YA 1OGXA 5GSPA 1IU7A 1VQP3 1MOLA 1W01A 3DZLA 3KIIA 3EX9A 1OHSA 2Z6BA 1A2VA 4N3VA 2YFJB 2BMOB 1BRHA 1O7MB 3I0YA 2HMLB 1QALA 2F56A 1FYSA 4N6UA 2UX0A 1ASKA 1VQ83 3CU3A 3DM8A 3MYTA 3X40A 2H0HA 4WFOA 1N8R4 1IT7A 3CCE3 4HM6B 4LGQA 1TTOA 3JUQA 4FMDA 2CW9A 3AHWA 2A15A 2KF4A 1TP6A 2GU1A 3EN8A 3MG3A 3ZFZA 2O9UX 4N6NB 4HM3B 3NX0A 4RNTA 3CPW2 3NUVA 4HM4B 3I553 2F98A 3PXMA 3ECFA 2RGQA 1ZGXA 2CC3A 1RNTA 3B4OA 1RGEA 4BL3A 4FCJA 1I8VA 4H3UA 5IG3A 2AAEA 5AIGA 2RCDA 1X1UA 2E2VA 3BB9A 4HZBB 3Q3FA 3OV4A 4I5QA 4JF8A 1TFKA 8CHOA 4XBYA 1YJ93 1BOXA 1SIIA 1K9M4 3ALAA 1O7PB 1BSEA 4RZMA 1GY5A 3K0ZA 1Q40B 1DVDA 2FGTA 2H0IA 1BNIA 7RNTA 2CIUA 3EC9A 1A2PA 1EUIC 3Q2PA 7STDA 2W9PA 2CFKA 3NQYA 1JV2B 1ZS7A 5BIRA 1VQN3 1UCKA 4HBRA 1VQ53 3IJEB 4NPBA 1YGEA 3D3LA 1B2ZA 2CWTA 3N9HA 1GOUA 1OF5B 1NU3A 1T2IA 1UCJA 1RCKA 1V57A 1Z1SA 3SXXA 6GSPA 1IYYA 3LT9A 1OUNA 1Q42A 1RGAA 3UNLA 1B21A 1VQ43 4N6MA 4Q53A 2CFLA 4EV2A 1IVXA 4CJNA 1WTHA 1UI7A 1I2FA 1WQLB 2W56B 3JVCA 3VGNA 1JJ22 2OTJ3 5M18A 1ROAA 3NQZA 3FGYA 3Q90A 3N8BA 1GD3A 3OWSA 1RCLA 1DMMA 2R4IA 2XR8B 1C54A 2CH9A 3UL5A 1SPUA 3NXJA 2XRXB 3BNBA 3U97A 2GXFA 3KN4A 1SARA 4OUQA 1BGSA 4RBNA 3EHCA 2ML5A 3L0RA 3TDGA 3CC73 1EEJA 1Q7HA 5AYSC 1ROVA 5IG0A 1GD4A 1RGKA 3CPOA 1MNLA 4WP5A 1BUQA 2XFSA 1KD14 1RGLA 1JBRA 1IVWA 3BLZA 3FH1A 2C11A 4EXRA 1O7GB 2YFIB 3CMA3 1UCIA 1UUVB 5IEOA 4AEQA 1VQO3 4I4KA 2C4BA 4R80A 3GZYB 3F7XA 3BIRA 2KXGA 3T0UA 1IV7A 5EEOA 1F8NA 1JB5A 1IV9A 3LTCA 2IA7A 3A76A 3PCSA 3EBYA 4HZ9B 2KRTA 3FKAA 1Q814 3CCV3 1LRAA 1W02A 3URPA 3STDA 5JPUA 2XSOB 2C10A 3UB1A 1BRIA 2P09A 3FCSB 2SBLA 3Q1CA 4N6V0 4HM8B 4O02B 1JKGA 3D5GA 3F9SA 4GL6A 1L5GB 4J5KA 1AY7A 2KF6A 3F7SA 4WYKA 1U5OA 3X41A 5EVHA 3MHEA 3LMLA 3NHXA 1B3SA 7GSPA 3EE1A 2D42A 3F40A 3K7CA 2IUJA 3EQQB 3UL6A 5AI1A 5AEWB 3FZWA 3BNCA 2OQEA 5I97A 1BRKA 1CYVA 2Z77A 1BU4A 2HMJB 4KFDA 4N6LA 3NM7A 4EW5A 4BU4A 4AKZA 3S27A 3MSOA 3AHSA 1BSDA 3G4S3 3PGBA 3WDGB 1PYLA 5FGOA 4BTYA 1MWUA 1IVVA 1T2HA 2H0GA 3GZRA 2RNTA 3K5TA 3OWYA 3BNDA 2W0QA 1BNRA 1FGTA 1I3IA 1TJDA 1SQWA 3SLUA 1GMQA 2K0MA 1LQGC 2MF7A 2CWUA 2I9WA 3CCS3 1VQL3 2QGUA 1NNVA 1NWWA 1SJWA 2BNGA 1W4NA 4H61A 5DREA 3LXUX 3B8LA 2WGQA 1JBTA 1QJGA 5G2GA 2F5WA 1TU5A 1NO3A 1AV4A 3CNMA 3D9RA 6STDA 3DGNA 1Q824 4STDA 1UCLA 1YGWA 1I70A 4PEJA 5AIIA 5G1LA 2OCTA 2OOVC 3VF1A 3KZTA 5KP3A 4MEIA 3OWUA 3G8ZA 1BNFA 1UGIA 1MGWA 2F4YA 2BO9B 4U13A 1AVKA 2L4VA 3HK4A 1RJOA 1IK3A 2INXA 3PYJA 1N8QA 2B24B 1WMPA 3AMOB 3G0KA 2CFGA 3QK9A 5BVBA 3I563 2CX0A 3MKIA 2O3OA 1LXEA 1S5AA 1UUWB 4GHOA 1M1XB 1V58A 3DGOA 1YI23 4BTWA 1JRQA 3EN1B 1JB4A 1JN5B 1LOVA 3WR2A 8RNTA 4K1VA 1O7NB 4G1MB 3J7Yd 2W03A 4K61A 2E2UA 5G1KA 1LQMB 1IDPA 3EJVA 1DE3A 1O7WB 1ULJB 4O3VA 3CD63 1FGMA 2W04A 1OGZA 3EBTA 1VQ63 4GSPA 1KC84 1QAFA 3GZBA 1W00A 3JUMA 3CCJ3 1LOXA 5KP1A 1VQ73 1QVG2 3WA3A 2PNCA 1WMOA 3LTDA 1W7CA 1UW1A 2CHCA 3D79A 4ORLA 1HYFA 2K3DA 4HKVB 3S29A 4FMCA 1W5ZA 1N5PA 2QIYA 5M19A 1E3RA 3WA2X 1DYUA 2KCDA 1QVF2 1A2KA 1JZOA 2CG0A 2GBXB 4NHFA 1CQSA 5KP4A 1WMNA 1JNQA 2Z76A 3K9MC 1RN1A 1DVCA 3G6E3 4HAAA 4IT7A 1CH0A 1GOVA 1YJN3 1BAOA 1I2GA 1RNBA 1AVLA 1W2ZA 5IF6A 4KFEA 2ML6A 4HM0B 1BNSA 1TRQA 3BU4A 3GSPA 2XGNA 2WO0A 3LTAA 1WNHA 5AIFA 3T8UA 1LOWA 2MC8A 1HZ1A 6RNTA 1EA2A 1X1YA 1SIHA 1ZO2A 3RNTA 3CNXA 2P0XA 1RRHA 2WOHA 1G0TA 1OACA 2Q07A 3CME3 2GBWB 4FCMA 1STFI 3V92A 4BL2A 1Q40A 3OXAA 1GOYA 4KFFA 1X1XA 1KSIA 3FSDA 3IPTA 1W6CA 1A67A 1D6UA 2JQ5A 1N9EA 2GEXA 2OWPA 1RTUA 1NJI4 3SOYA 1M1K4 2BMRB 2J8XB 3S67A 3RGAA 1RKYA 1J2BA 2UUGC 1U8CB 4FCZA 1AR0A 4CDLA 1CEWI 3NV0B 4J9AA 9RNTA 1GY6A 1OF5A 3QRDA 1FGRA 1IQYA 2KAAA 1RDSA 3WMDA 3DGYA 4FMBA 1QAKA 1TRPA 3MWZA 1GS3A 4K1UA 2V1LA 3MG1A 3ZG0A 2PZVA 1B2SA 2W56A 2E2TA 1RSNA 4IPBA 1BRGA 1GSPA 1EQKA 3EB8A 5D82A 5IERA 3GRDA 2D1WA 1PFPA 3JUNA 3SX1A 5M1AA 3AGNA 4K90B 1OH0A 1VZZA 1ZX2A 2LYXA 3X3ZA 1FUWA 4XBXA 3IMAB 1STDA 2HMMB 1BIRA 2AADA 3H3HA 4MMXB 5LC6A 2RSXA 1K41A 4WWUC 1FGQA 2P38A 3HIIA 4L8OA 3CCQ3 3NBBA 1HKXA 1KQS2 1BNEA 1MWTA 1TUHA 2CK3H 3DH2A 3CCR3 2HOHA 3RGRA 3JUPA 1A90A 4LYLB 4ILFA 1RGHA 1D6YA 3GWRA 4AKYA 2HMOB 4RNZA 3DUKA 1YIT3 4J8TA 5AIHA 1I0XA 2WGOA 1I2EA 4FR9A 1I3FA 5IEPA 3NBRA 4KVHA 1RGGA 1NDOB 4X2OA 4OVMA 1BRJA 3LT8A 2B1XB 1R4CA 2OQEC 1PY3A 3NBJA 2HMNB 2F86B 3D4AA 2XGLA 1VQ93 1YNVX 2KF3A 2BIRA 3WHOA 4ZM8A 2QA43 5BU4A 1C7HA 5IENA 3LYGA 3CCL3 5D83A 1IT8A 2Y73A 2CWVA 5A0OB 3OW22 3B4PA 1D6ZA 4HYZA 3G16A 5DRVA 3N54B 3WOFB 1BUJA 1BRNL 3V99A 2BMQB 3HIGA 1TFOA 2XFTA 2P0MA 5AYRB 4BIRA 2JDIH 3S28A 1JBSA 3B7CA 4IIAA 4RNYA 2CG1A 2Y74A 2Z7AA 2RBIA 5STDA 1BANA 3SVAA 2OOVA 3LZAA 3SEDA 1RLSA 1BNGA 1Q9EA 1VQM3 4N6TA 1B2UA 3HZPA 4EC6A 3FG3A 1K8A4 2CFWA 3H51A 1HU9A 1W6GA 2LQVA 1BVIA 1B2MA 1K28A 3KSED 1S723 4XBTA 4KT3B 3SOAA 3K63A 1B2XA 2CKFB 1BRSA 3F8XA 4HVNA 4XB5A 2BHMA 2K54A 1UDII 3HI7A 4MJDA 5LC7A 2XSHB 1BSBA 4HM5B 1JB2A 5TGNA 4KZ1A 1LVNA 4LZIA 1DETA 1GY7A 3KKGA 3F8HA 4J5GA 3GAXA 3T8NA 2ZA4A 4XM4A 1UGHI 5CF1A 1YJW3 1RRLA 3KE7A 3JUOA 1FW7A 3KSPA 2L1SA 1G96A 1DMNA 2CFDA 3FLJA 3KFQC 5ELJA 1ISKA 1NB3I 2GSPA 4LSOA 1O7HB 4LMIA 4CCVA 1FUTA 1FUSA 3LTBA 1RN4A 2GU3A 3O8YA 4QWTA 2WOFA 2HMKB 3U1WA 4BTXA 3HOHA 2ZDJA 5JBSA 1B20A 4HJLB 1KWIA 5CF2A 1OHOA 1EKMA 5ELUA 3FG1A 3DY5A 3S5CA 1I0VA 3FF2A 3FG4A 4EYCA 3D5IA 3ER7A 1EG9B 4HOHA 3WODG 4O2HA 3V98A 1FGOA 3LH4A 3KCHA 1IVUA 2KF5A 5EQLA 3AMOA 2XH9A 3PS8A 2UGIA 2W9QA 3NM2A 1MGRA 3LOYA 1MWRA 2ZHXB 1PU4A 2CX1A 3X3YA 1E3VA 1N5HA 3MPHA 1JN5A 1FZUA 1M9GA 2F5MA 3A5EA 2GEYA 1LNIA 3PZWA 4O8SA 4X2HA 4DKIA 2IY2A 1QMAA 2W2CA 1JKGB 4HM7B 2QEX3 3X42A 4MMZB 5HOHA 4WHAA 1VQQA 4WYKB 1IQXA 1OCVA 2IUKA 3X3XA 4HM2B 1RN7A 3SYUA 4MMYB 4XDVA 1YHQ3 3DXOA 2R41A 2IMJA 1LOYA 4LEHA 1RMSA 1GMRA 2P05A 3DGMA 3F14A 2OTL3 1YVSA 1Y4KA 1Q7Y4 1AQZA
chains in the Genus database with same CATH topology
1V74A 1M904 4R1KA 3CCU3 4XDWA 3MG2A 2XF3A 2FXTA 2XEPA 2ZL8A 4R9LA 3M8CA 4FMAA 1W2B2 2YFLB 3WOEB 1T5YA 5IG4A 1ULIB 4JRFA 2YX9A 1N9JA 3UJMA 4EV5A 1YVBI 3BNEA 3RDEA 1OHPA 3VSYA 4HM1B 5HGRA 5IW9A 5JPPA 2BT3A 1CYUA 5CXOA 4OK0A 5FW5A 3E99A 1TIJA 3PCRA 3ROBA 1DMQA 1UI8A 3CXC2 5CK6A 4R9KA 1E97A 4EBGA 3HX8A 1US1A 1LNHA 2W6JH 1YIJ3 3GZXB 1VQK3 3G713 4GB5A 1FA3A 3OX9A 1OPYA 3EF8A 3FF0A 3NV0A 2RFRA 2STDA 2M7OA 1K734 1NB5I 4TX4A 3CC23 1IQ8A 1GYBA 1W6YA 5CLKA 5AEUB 5BXQA 1Q864 4L8PA 2F99A 3DGLA 4NREA 3DMCA 5D81A 4N6OB 4R4KA 2FNQA 3CC43 5IG5A 3CCM3 4L7KA 1OGXA 1IU7A 1VQP3 1MOLA 1W01A 3DZLA 3KIIA 3EX9A 1OHSA 2Z6BA 1A2VA 4N3VA 2YFJB 2BMOB 1O7MB 3I0YA 2HMLB 1QALA 4N6UA 1VQ83 2UX0A 1ASKA 3CU3A 3DM8A 3MYTA 3X40A 4WFOA 1N8R4 1IT7A 3CCE3 4HM6B 4LGQA 3JUQA 4FMDA 2CW9A 2A15A 1TP6A 2GU1A 3EN8A 3MG3A 2O9UX 4N6NB 4HM3B 3NX0A 3CPW2 3NUVA 4HM4B 3I553 2F98A 3PXMA 3ECFA 2RGQA 2CC3A 3B4OA 4FCJA 4H3UA 5IG3A 5AIGA 2RCDA 2E2VA 3BB9A 4HZBB 3OV4A 4JF8A 1TFKA 8CHOA 4XBYA 1YJ93 1SIIA 1K9M4 3ALAA 1O7PB 4RZMA 1GY5A 3K0ZA 1Q40B 1DVDA 2FGTA 2CIUA 3EC9A 3Q2PA 7STDA 2W9PA 2CFKA 3NQYA 1JV2B 1VQN3 4HBRA 1VQ53 3IJEB 1YGEA 3D3LA 2CWTA 3N9HA 1OF5B 1NU3A 3SXXA 1Z1SA 3LT9A 1OUNA 1Q42A 3UNLA 1VQ43 4N6MA 4Q53A 2CFLA 4EV2A 1IVXA 1WTHA 1UI7A 1WQLB 2W56B 3JVCA 3VGNA 1JJ22 2OTJ3 1ROAA 3NQZA 3FGYA 3Q90A 3N8BA 1GD3A 3OWSA 2XR8B 1DMMA 2R4IA 2CH9A 3UL5A 1SPUA 3NXJA 2XRXB 3BNBA 3U97A 2GXFA 3KN4A 4OUQA 4RBNA 3EHCA 2ML5A 3L0RA 3TDGA 3CC73 5AYSC 1ROVA 5IG0A 1GD4A 3CPOA 1MNLA 4WP5A 1BUQA 2XFSA 1KD14 1IVWA 3BLZA 3FH1A 2C11A 4EXRA 1O7GB 2YFIB 3CMA3 1UUVB 5IEOA 4AEQA 1VQO3 4I4KA 4R80A 3GZYB 3F7XA 2KXGA 3T0UA 1IV7A 5EEOA 1F8NA 1JB5A 1IV9A 3LTCA 2IA7A 3A76A 3PCSA 3EBYA 4HZ9B 2KRTA 3FKAA 1Q814 3CCV3 1W02A 3STDA 5JPUA 2XSOB 2C10A 3UB1A 2P09A 3FCSB 2SBLA 3Q1CA 4N6V0 4HM8B 4O02B 1JKGA 3F9SA 4GL6A 1L5GB 3F7SA 4WYKA 1U5OA 3X41A 5EVHA 3MHEA 3LMLA 3NHXA 3EE1A 2D42A 3F40A 3K7CA 2IUJA 3EQQB 3UL6A 5AI1A 5AEWB 3FZWA 3BNCA 2OQEA 5I97A 1CYVA 2Z77A 2HMJB 4KFDA 4N6LA 3NM7A 4AKZA 3S27A 3MSOA 3G4S3 3PGBA 3WDGB 5FGOA 4BTYA 1IVVA 3GZRA 3K5TA 3OWYA 3BNDA 2W0QA 1FGTA 1SQWA 3SLUA 2K0MA 2MF7A 2CWUA 2I9WA 3CCS3 1VQL3 2QGUA 1NWWA 1SJWA 2BNGA 1W4NA 4H61A 5DREA 3LXUX 3B8LA 2WGQA 1QJGA 5G2GA 1TU5A 1NO3A 1AV4A 3CNMA 3D9RA 6STDA 3DGNA 1Q824 4STDA 4PEJA 5AIIA 3VF1A 2OCTA 2OOVC 3KZTA 5KP3A 4MEIA 3OWUA 3G8ZA 2BO9B 4U13A 1AVKA 2L4VA 3HK4A 1RJOA 1IK3A 2INXA 3PYJA 1N8QA 2B24B 1WMPA 3AMOB 3G0KA 2CFGA 3QK9A 5BVBA 3I563 3MKIA 2O3OA 1LXEA 1S5AA 1UUWB 1M1XB 3DGOA 1YI23 4BTWA 1JRQA 3EN1B 1JB4A 1JN5B 4K1VA 1O7NB 4G1MB 3J7Yd 2W03A 4K61A 2E2UA 1IDPA 3EJVA 1O7WB 1ULJB 4O3VA 3CD63 1FGMA 2W04A 1OGZA 3EBTA 1VQ63 1KC84 1QAFA 3GZBA 1W00A 3JUMA 3CCJ3 1LOXA 5KP1A 1VQ73 1QVG2 3WA3A 2PNCA 1WMOA 3LTDA 1W7CA 1UW1A 2CHCA 4ORLA 4HKVB 3S29A 4FMCA 1W5ZA 1N5PA 2QIYA 1E3RA 3WA2X 1DYUA 2KCDA 1QVF2 1A2KA 2CG0A 2GBXB 4NHFA 1CQSA 5KP4A 1WMNA 1JNQA 2Z76A 3K9MC 1DVCA 3G6E3 4IT7A 1YJN3 1AVLA 1W2ZA 5IF6A 4KFEA 2ML6A 4HM0B 2XGNA 3LTAA 1WNHA 5AIFA 3T8UA 2MC8A 1EA2A 1ZO2A 1SIHA 3CNXA 2P0XA 1RRHA 2WOHA 1OACA 2Q07A 3CME3 2GBWB 4FCMA 1STFI 3V92A 1Q40A 3OXAA 4KFFA 1KSIA 3FSDA 3IPTA 1W6CA 1A67A 1D6UA 2JQ5A 1N9EA 2GEXA 2OWPA 1NJI4 1M1K4 3SOYA 2BMRB 3S67A 3RGAA 1RKYA 1J2BA 1U8CB 4FCZA 1AR0A 4CDLA 1CEWI 3NV0B 4J9AA 1GY6A 1OF5A 3QRDA 1FGRA 1IQYA 3WMDA 4FMBA 1QAKA 3MWZA 1GS3A 4K1UA 2V1LA 3MG1A 2PZVA 2W56A 2E2TA 4IPBA 1EQKA 3EB8A 5D82A 5IERA 3GRDA 2D1WA 1PFPA 3JUNA 3SX1A 4K90B 1OH0A 1VZZA 1ZX2A 2LYXA 3X3ZA 1FUWA 4XBXA 3IMAB 1STDA 2HMMB 3H3HA 5LC6A 4MMXB 2RSXA 1K41A 4WWUC 1FGQA 2P38A 3HIIA 4L8OA 3CCQ3 3NBBA 1HKXA 1KQS2 2CK3H 3CCR3 1TUHA 3RGRA 3JUPA 1A90A 1D6YA 3GWRA 4AKYA 2HMOB 4RNZA 3DUKA 1YIT3 4J8TA 5AIHA 2WGOA 5IEPA 4FR9A 3NBRA 4KVHA 1NDOB 4X2OA 4OVMA 3LT8A 2B1XB 1R4CA 2OQEC 3NBJA 2HMNB 2F86B 2XGLA 1VQ93 4ZM8A 2QA43 5IENA 1C7HA 3LYGA 3CCL3 5D83A 1IT8A 2Y73A 2CWVA 5A0OB 3OW22 3B4PA 1D6ZA 4HYZA 3G16A 5DRVA 3N54B 3WOFB 3V99A 2BMQB 3HIGA 1TFOA 2XFTA 2P0MA 5AYRB 2JDIH 3S28A 3B7CA 4IIAA 4RNYA 2CG1A 2Y74A 2Z7AA 5STDA 3SVAA 2OOVA 3LZAA 3SEDA 1VQM3 4N6TA 3HZPA 4EC6A 3FG3A 1K8A4 2CFWA 3H51A 1HU9A 1W6GA 2LQVA 1K28A 3KSED 1S723 4XBTA 3SOAA 3K63A 2CKFB 3F8XA 4HVNA 4XB5A 2BHMA 2K54A 3HI7A 4MJDA 5LC7A 2XSHB 4HM5B 1JB2A 5TGNA 4KZ1A 1LVNA 4LZIA 1GY7A 3KKGA 3F8HA 3GAXA 3T8NA 4XM4A 5CF1A 1YJW3 1RRLA 3KE7A 3JUOA 3KSPA 3FLJA 1G96A 1DMNA 2CFDA 3KFQC 5ELJA 1ISKA 1NB3I 4LSOA 1O7HB 4LMIA 4CCVA 3LTBA 2GU3A 3O8YA 4QWTA 2WOFA 2HMKB 3U1WA 4BTXA 2ZDJA 5JBSA 4HJLB 1KWIA 5CF2A 1OHOA 1EKMA 5ELUA 3FG1A 3DY5A 3S5CA 4EYCA 3FF2A 3FG4A 3WODG 3ER7A 1EG9B 4O2HA 3V98A 1FGOA 3LH4A 5EQLA 1IVUA 3AMOA 2XH9A 3PS8A 2W9QA 3NM2A 3LOYA 1PU4A 3X3YA 1E3VA 1N5HA 3MPHA 1JN5A 1M9GA 2GEYA 3PZWA 4O8SA 4X2HA 1Y4KA 1QMAA 2W2CA 1JKGB 4HM7B 2QEX3 3X42A 4MMZB 4WHAA 4WYKB 1IQXA 1OCVA 2IUKA 3X3XA 4HM2B 1RN7A 4MMYB 4XDVA 1YHQ3 3DXOA 2IMJA 4LEHA 2P05A 3DGMA 3F14A 2OTL3 2WO0A 1Q7Y4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYJ A;  1R4C A;  4N6M A;  1LXE A;  4ZM8 A;  1ROA A;  1GD3 A;  1N9J A;  5A0O B;  1YVB I;  2CH9 A;  3UL5 A;  1CYU A;  1TIJ A;  3SVA A;  3L0R A;  1GD4 A;  1MNL A;  1N5P A;  4N6T A;  1FA3 A;  3K9M C;  1DVC A;  1NB5 I;  4IT7 A;  4TX4 A;  5LC7 A;  2KXG A;  1IV7 A;  1IV9 A;  4LZI A;  1WNH A;  3GAX A;  4N6O B;  4N6V 0;  5ELJ A;  1G96 A;  3KFQ C;  1NB3 I;  1MOL A;  1STF I;  4CCV A;  4N6U A;  1A67 A;  3UL6 A;  3S67 A;  1KWI A;  1CYV A;  5ELU A;  4N6L A;  4EYC A;  1CEW I;  3QRD A;  2O9U X;  4N6N B;  3LH4 A;  5EQL A;  3NX0 A;  3MWZ A;  3PS8 A;  2W9Q A;  3PXM A;  1EQK A;  1N5H A;  1M9G A;  1PFP A;  1FUW A;  3IMA B;  5LC6 A;  1DVD A;  3Q2P A;  2W9P A;  1RN7 A;  2OCT A;  1A90 A;  2BO9 B;  3KSE D; 
#chains in the Genus database with same CATH topology
 1V74 A;  1M90 4;  4R1K A;  3CCU 3;  1JZD A;  4XDW A;  1T3B A;  3ZG5 A;  3MG2 A;  1BSC A;  2FXT A;  2XF3 A;  2XEP A;  2ZL8 A;  4R9L A;  3M8C A;  4FMA A;  3AGO A;  1W2B 2;  2YFL B;  3WOE B;  1T5Y A;  1G02 A;  5IG4 A;  1BSA A;  1ULI B;  4JRF A;  2YX9 A;  1N9J A;  3UJM A;  1B27 A;  4EV5 A;  1YVB I;  3BNE A;  3RDE A;  5RNT A;  1OHP A;  1GMP A;  3VSY A;  4HM1 B;  5HGR A;  5IW9 A;  5JPP A;  2BT3 A;  1CYU A;  5CXO A;  4OK0 A;  5FW5 A;  1UUG B;  3E99 A;  1TIJ A;  3PCR A;  4CPK A;  3ROB A;  1DMQ A;  1RGC A;  1UI8 A;  3CXC 2;  5CK6 A;  4R9K A;  1E97 A;  4EBG A;  1X1W A;  1US1 A;  1LNH A;  2W6J H;  3HX8 A;  1YIJ 3;  3GZX B;  1VQK 3;  3G71 3;  4GB5 A;  2BU4 A;  1FA3 A;  2IYJ A;  3OX9 A;  1OPY A;  1MWS A;  3EF8 A;  3FF0 A;  3NV0 A;  2RFR A;  2STD A;  2M7O A;  1K73 4;  1NB5 I;  1RGF A;  4TX4 A;  3CC2 3;  1IQ8 A;  1GYB A;  1W6Y A;  5CLK A;  5AEU B;  2SAR A;  5BXQ A;  1RHL A;  4L8P A;  1Q86 4;  1BNJ A;  2F99 A;  3DGL A;  4NRE A;  3DMC A;  5D81 A;  4N6O B;  4R4K A;  2FNQ A;  3CC4 3;  5IG5 A;  3CCM 3;  4L7K A;  1R4Y A;  1OGX A;  5GSP A;  1IU7 A;  1VQP 3;  1MOL A;  1W01 A;  3DZL A;  3KII A;  3EX9 A;  1OHS A;  2Z6B A;  1A2V A;  4N3V A;  2YFJ B;  2BMO B;  1BRH A;  1O7M B;  3I0Y A;  2HML B;  1QAL A;  2F56 A;  1FYS A;  4N6U A;  2UX0 A;  1ASK A;  1VQ8 3;  3CU3 A;  3DM8 A;  3MYT A;  3X40 A;  2H0H A;  4WFO A;  1N8R 4;  1IT7 A;  3CCE 3;  4HM6 B;  4LGQ A;  1TTO A;  3JUQ A;  4FMD A;  2CW9 A;  3AHW A;  2A15 A;  2KF4 A;  1TP6 A;  2GU1 A;  3EN8 A;  3MG3 A;  3ZFZ A;  2O9U X;  4N6N B;  4HM3 B;  3NX0 A;  4RNT A;  3CPW 2;  3NUV A;  4HM4 B;  3I55 3;  2F98 A;  3PXM A;  3ECF A;  2RGQ A;  1ZGX A;  2CC3 A;  1RNT A;  3B4O A;  1RGE A;  4BL3 A;  4FCJ A;  1I8V A;  4H3U A;  5IG3 A;  2AAE A;  5AIG A;  2RCD A;  1X1U A;  2E2V A;  3BB9 A;  4HZB B;  3Q3F A;  3OV4 A;  4I5Q A;  4JF8 A;  1TFK A;  8CHO A;  4XBY A;  1YJ9 3;  1BOX A;  1SII A;  1K9M 4;  3ALA A;  1O7P B;  1BSE A;  4RZM A;  1GY5 A;  3K0Z A;  1Q40 B;  1DVD A;  2FGT A;  2H0I A;  1BNI A;  7RNT A;  2CIU A;  3EC9 A;  1A2P A;  1EUI C;  3Q2P A;  7STD A;  2W9P A;  2CFK A;  3NQY A;  1JV2 B;  1ZS7 A;  5BIR A;  1VQN 3;  1UCK A;  4HBR A;  1VQ5 3;  3IJE B;  4NPB A;  1YGE A;  3D3L A;  1B2Z A;  2CWT A;  3N9H A;  1GOU A;  1OF5 B;  1NU3 A;  1T2I A;  1UCJ A;  1RCK A;  1V57 A;  1Z1S A;  3SXX A;  6GSP A;  1IYY A;  3LT9 A;  1OUN A;  1Q42 A;  1RGA A;  3UNL A;  1B21 A;  1VQ4 3;  4N6M A;  4Q53 A;  2CFL A;  4EV2 A;  1IVX A;  4CJN A;  1WTH A;  1UI7 A;  1I2F A;  1WQL B;  2W56 B;  3JVC A;  3VGN A;  1JJ2 2;  2OTJ 3;  5M18 A;  1ROA A;  3NQZ A;  3FGY A;  3Q90 A;  3N8B A;  1GD3 A;  3OWS A;  1RCL A;  1DMM A;  2R4I A;  2XR8 B;  1C54 A;  2CH9 A;  3UL5 A;  1SPU A;  3NXJ A;  2XRX B;  3BNB A;  3U97 A;  2GXF A;  3KN4 A;  1SAR A;  4OUQ A;  1BGS A;  4RBN A;  3EHC A;  2ML5 A;  3L0R A;  3TDG A;  3CC7 3;  1EEJ A;  1Q7H A;  5AYS C;  1ROV A;  5IG0 A;  1GD4 A;  1RGK A;  3CPO A;  1MNL A;  4WP5 A;  1BUQ A;  2XFS A;  1KD1 4;  1RGL A;  1JBR A;  1IVW A;  3BLZ A;  3FH1 A;  2C11 A;  4EXR A;  1O7G B;  2YFI B;  3CMA 3;  1UCI A;  1UUV B;  5IEO A;  4AEQ A;  1VQO 3;  4I4K A;  2C4B A;  4R80 A;  3GZY B;  3F7X A;  3BIR A;  2KXG A;  3T0U A;  1IV7 A;  5EEO A;  1F8N A;  1JB5 A;  1IV9 A;  3LTC A;  2IA7 A;  3A76 A;  3PCS A;  3EBY A;  4HZ9 B;  2KRT A;  3FKA A;  1Q81 4;  3CCV 3;  1LRA A;  1W02 A;  3URP A;  3STD A;  5JPU A;  2XSO B;  2C10 A;  3UB1 A;  1BRI A;  2P09 A;  3FCS B;  2SBL A;  3Q1C A;  4N6V 0;  4HM8 B;  4O02 B;  1JKG A;  3D5G A;  3F9S A;  4GL6 A;  1L5G B;  4J5K A;  1AY7 A;  2KF6 A;  3F7S A;  4WYK A;  1U5O A;  3X41 A;  5EVH A;  3MHE A;  3LML A;  3NHX A;  1B3S A;  7GSP A;  3EE1 A;  2D42 A;  3F40 A;  3K7C A;  2IUJ A;  3EQQ B;  3UL6 A;  5AI1 A;  5AEW B;  3FZW A;  3BNC A;  2OQE A;  5I97 A;  1BRK A;  1CYV A;  2Z77 A;  1BU4 A;  2HMJ B;  4KFD A;  4N6L A;  3NM7 A;  4EW5 A;  4BU4 A;  4AKZ A;  3S27 A;  3MSO A;  3AHS A;  1BSD A;  3G4S 3;  3PGB A;  3WDG B;  1PYL A;  5FGO A;  4BTY A;  1MWU A;  1IVV A;  1T2H A;  2H0G A;  3GZR A;  2RNT A;  3K5T A;  3OWY A;  3BND A;  2W0Q A;  1BNR A;  1FGT A;  1I3I A;  1TJD A;  1SQW A;  3SLU A;  1GMQ A;  2K0M A;  1LQG C;  2MF7 A;  2CWU A;  2I9W A;  3CCS 3;  1VQL 3;  2QGU A;  1NNV A;  1NWW A;  1SJW A;  2BNG A;  1W4N A;  4H61 A;  5DRE A;  3LXU X;  3B8L A;  2WGQ A;  1JBT A;  1QJG A;  5G2G A;  2F5W A;  1TU5 A;  1NO3 A;  1AV4 A;  3CNM A;  3D9R A;  6STD A;  3DGN A;  1Q82 4;  4STD A;  1UCL A;  1YGW A;  1I70 A;  4PEJ A;  5AII A;  5G1L A;  2OCT A;  2OOV C;  3VF1 A;  3KZT A;  5KP3 A;  4MEI A;  3OWU A;  3G8Z A;  1BNF A;  1UGI A;  1MGW A;  2F4Y A;  2BO9 B;  4U13 A;  1AVK A;  2L4V A;  3HK4 A;  1RJO A;  1IK3 A;  2INX A;  3PYJ A;  1N8Q A;  2B24 B;  1WMP A;  3AMO B;  3G0K A;  2CFG A;  3QK9 A;  5BVB A;  3I56 3;  2CX0 A;  3MKI A;  2O3O A;  1LXE A;  1S5A A;  1UUW B;  4GHO A;  1M1X B;  1V58 A;  3DGO A;  1YI2 3;  4BTW A;  1JRQ A;  3EN1 B;  1JB4 A;  1JN5 B;  1LOV A;  3WR2 A;  8RNT A;  4K1V A;  1O7N B;  4G1M B;  3J7Y d;  2W03 A;  4K61 A;  2E2U A;  5G1K A;  1LQM B;  1IDP A;  3EJV A;  1DE3 A;  1O7W B;  1ULJ B;  4O3V A;  3CD6 3;  1FGM A;  2W04 A;  1OGZ A;  3EBT A;  1VQ6 3;  4GSP A;  1KC8 4;  1QAF A;  3GZB A;  1W00 A;  3JUM A;  3CCJ 3;  1LOX A;  5KP1 A;  1VQ7 3;  1QVG 2;  3WA3 A;  2PNC A;  1WMO A;  3LTD A;  1W7C A;  1UW1 A;  2CHC A;  3D79 A;  4ORL A;  1HYF A;  2K3D A;  4HKV B;  3S29 A;  4FMC A;  1W5Z A;  1N5P A;  2QIY A;  5M19 A;  1E3R A;  3WA2 X;  1DYU A;  2KCD A;  1QVF 2;  1A2K A;  1JZO A;  2CG0 A;  2GBX B;  4NHF A;  1CQS A;  5KP4 A;  1WMN A;  1JNQ A;  2Z76 A;  3K9M C;  1RN1 A;  1DVC A;  3G6E 3;  4HAA A;  4IT7 A;  1CH0 A;  1GOV A;  1YJN 3;  1BAO A;  1I2G A;  1RNB A;  1AVL A;  1W2Z A;  5IF6 A;  4KFE A;  2ML6 A;  4HM0 B;  1BNS A;  1TRQ A;  3BU4 A;  3GSP A;  2XGN A;  2WO0 A;  3LTA A;  1WNH A;  5AIF A;  3T8U A;  1LOW A;  2MC8 A;  1HZ1 A;  6RNT A;  1EA2 A;  1X1Y A;  1SIH A;  1ZO2 A;  3RNT A;  3CNX A;  2P0X A;  1RRH A;  2WOH A;  1G0T A;  1OAC A;  2Q07 A;  3CME 3;  2GBW B;  4FCM A;  1STF I;  3V92 A;  4BL2 A;  1Q40 A;  3OXA A;  1GOY A;  4KFF A;  1X1X A;  1KSI A;  3FSD A;  3IPT A;  1W6C A;  1A67 A;  1D6U A;  2JQ5 A;  1N9E A;  2GEX A;  2OWP A;  1RTU A;  1NJI 4;  3SOY A;  1M1K 4;  2BMR B;  2J8X B;  3S67 A;  3RGA A;  1RKY A;  1J2B A;  2UUG C;  1U8C B;  4FCZ A;  1AR0 A;  4CDL A;  1CEW I;  3NV0 B;  4J9A A;  9RNT A;  1GY6 A;  1OF5 A;  3QRD A;  1FGR A;  1IQY A;  2KAA A;  1RDS A;  3WMD A;  3DGY A;  4FMB A;  1QAK A;  1TRP A;  3MWZ A;  1GS3 A;  4K1U A;  2V1L A;  3MG1 A;  3ZG0 A;  2PZV A;  1B2S A;  2W56 A;  2E2T A;  1RSN A;  4IPB A;  1BRG A;  1GSP A;  1EQK A;  3EB8 A;  5D82 A;  5IER A;  3GRD A;  2D1W A;  1PFP A;  3JUN A;  3SX1 A;  5M1A A;  3AGN A;  4K90 B;  1OH0 A;  1VZZ A;  1ZX2 A;  2LYX A;  3X3Z A;  1FUW A;  4XBX A;  3IMA B;  1STD A;  2HMM B;  1BIR A;  2AAD A;  3H3H A;  4MMX B;  5LC6 A;  2RSX A;  1K41 A;  4WWU C;  1FGQ A;  2P38 A;  3HII A;  4L8O A;  3CCQ 3;  3NBB A;  1HKX A;  1KQS 2;  1BNE A;  1MWT A;  1TUH A;  2CK3 H;  3DH2 A;  3CCR 3;  2HOH A;  3RGR A;  3JUP A;  1A90 A;  4LYL B;  4ILF A;  1RGH A;  1D6Y A;  3GWR A;  4AKY A;  2HMO B;  4RNZ A;  3DUK A;  1YIT 3;  4J8T A;  5AIH A;  1I0X A;  2WGO A;  1I2E A;  4FR9 A;  1I3F A;  5IEP A;  3NBR A;  4KVH A;  1RGG A;  1NDO B;  4X2O A;  4OVM A;  1BRJ A;  3LT8 A;  2B1X B;  1R4C A;  2OQE C;  1PY3 A;  3NBJ A;  2HMN B;  2F86 B;  3D4A A;  2XGL A;  1VQ9 3;  1YNV X;  2KF3 A;  2BIR A;  3WHO A;  4ZM8 A;  2QA4 3;  5BU4 A;  1C7H A;  5IEN A;  3LYG A;  3CCL 3;  5D83 A;  1IT8 A;  2Y73 A;  2CWV A;  5A0O B;  3OW2 2;  3B4P A;  1D6Z A;  4HYZ A;  3G16 A;  5DRV A;  3N54 B;  3WOF B;  1BUJ A;  1BRN L;  3V99 A;  2BMQ B;  3HIG A;  1TFO A;  2XFT A;  2P0M A;  5AYR B;  4BIR A;  2JDI H;  3S28 A;  1JBS A;  3B7C A;  4IIA A;  4RNY A;  2CG1 A;  2Y74 A;  2Z7A A;  2RBI A;  5STD A;  1BAN A;  3SVA A;  2OOV A;  3LZA A;  3SED A;  1RLS A;  1BNG A;  1Q9E A;  1VQM 3;  4N6T A;  1B2U A;  3HZP A;  4EC6 A;  3FG3 A;  1K8A 4;  2CFW A;  3H51 A;  1HU9 A;  1W6G A;  2LQV A;  1BVI A;  1B2M A;  1K28 A;  3KSE D;  1S72 3;  4XBT A;  4KT3 B;  3SOA A;  3K63 A;  1B2X A;  2CKF B;  1BRS A;  3F8X A;  4HVN A;  4XB5 A;  2BHM A;  2K54 A;  1UDI I;  3HI7 A;  4MJD A;  5LC7 A;  2XSH B;  1BSB A;  4HM5 B;  1JB2 A;  5TGN A;  4KZ1 A;  1LVN A;  4LZI A;  1DET A;  1GY7 A;  3KKG A;  3F8H A;  4J5G A;  3GAX A;  3T8N A;  2ZA4 A;  4XM4 A;  1UGH I;  5CF1 A;  1YJW 3;  1RRL A;  3KE7 A;  3JUO A;  1FW7 A;  3KSP A;  2L1S A;  1G96 A;  1DMN A;  2CFD A;  3FLJ A;  3KFQ C;  5ELJ A;  1ISK A;  1NB3 I;  2GSP A;  4LSO A;  1O7H B;  4LMI A;  4CCV A;  1FUT A;  1FUS A;  3LTB A;  1RN4 A;  2GU3 A;  3O8Y A;  4QWT A;  2WOF A;  2HMK B;  3U1W A;  4BTX A;  3HOH A;  2ZDJ A;  5JBS A;  1B20 A;  4HJL B;  1KWI A;  5CF2 A;  1OHO A;  1EKM A;  5ELU A;  3FG1 A;  3DY5 A;  3S5C A;  1I0V A;  3FF2 A;  3FG4 A;  4EYC A;  3D5I A;  3ER7 A;  1EG9 B;  4HOH A;  3WOD G;  4O2H A;  3V98 A;  1FGO A;  3LH4 A;  3KCH A;  1IVU A;  2KF5 A;  5EQL A;  3AMO A;  2XH9 A;  3PS8 A;  2UGI A;  2W9Q A;  3NM2 A;  1MGR A;  3LOY A;  1MWR A;  2ZHX B;  1PU4 A;  2CX1 A;  3X3Y A;  1E3V A;  1N5H A;  3MPH A;  1JN5 A;  1FZU A;  1M9G A;  2F5M A;  3A5E A;  2GEY A;  1LNI A;  3PZW A;  4O8S A;  4X2H A;  4DKI A;  2IY2 A;  1QMA A;  2W2C A;  1JKG B;  4HM7 B;  2QEX 3;  3X42 A;  4MMZ B;  5HOH A;  4WHA A;  1VQQ A;  4WYK B;  1IQX A;  1OCV A;  2IUK A;  3X3X A;  4HM2 B;  1RN7 A;  3SYU A;  4MMY B;  4XDV A;  1YHQ 3;  3DXO A;  2R41 A;  2IMJ A;  1LOY A;  4LEH A;  1RMS A;  1GMR A;  2P05 A;  3DGM A;  3F14 A;  2OTL 3;  1YVS A;  1Y4K A;  1Q7Y 4;  1AQZ A; 
#chains in the Genus database with same CATH homology
 1V74 A;  1M90 4;  4R1K A;  3CCU 3;  4XDW A;  3MG2 A;  2XF3 A;  2FXT A;  2XEP A;  2ZL8 A;  4R9L A;  3M8C A;  4FMA A;  1W2B 2;  2YFL B;  3WOE B;  1T5Y A;  5IG4 A;  1ULI B;  4JRF A;  2YX9 A;  1N9J A;  3UJM A;  4EV5 A;  1YVB I;  3BNE A;  3RDE A;  1OHP A;  3VSY A;  4HM1 B;  5HGR A;  5IW9 A;  5JPP A;  2BT3 A;  1CYU A;  5CXO A;  4OK0 A;  5FW5 A;  3E99 A;  1TIJ A;  3PCR A;  3ROB A;  1DMQ A;  1UI8 A;  3CXC 2;  5CK6 A;  4R9K A;  1E97 A;  4EBG A;  3HX8 A;  1US1 A;  1LNH A;  2W6J H;  1YIJ 3;  3GZX B;  1VQK 3;  3G71 3;  4GB5 A;  1FA3 A;  3OX9 A;  1OPY A;  3EF8 A;  3FF0 A;  3NV0 A;  2RFR A;  2STD A;  2M7O A;  1K73 4;  1NB5 I;  4TX4 A;  3CC2 3;  1IQ8 A;  1GYB A;  1W6Y A;  5CLK A;  5AEU B;  5BXQ A;  1Q86 4;  4L8P A;  2F99 A;  3DGL A;  4NRE A;  3DMC A;  5D81 A;  4N6O B;  4R4K A;  2FNQ A;  3CC4 3;  5IG5 A;  3CCM 3;  4L7K A;  1OGX A;  1IU7 A;  1VQP 3;  1MOL A;  1W01 A;  3DZL A;  3KII A;  3EX9 A;  1OHS A;  2Z6B A;  1A2V A;  4N3V A;  2YFJ B;  2BMO B;  1O7M B;  3I0Y A;  2HML B;  1QAL A;  4N6U A;  1VQ8 3;  2UX0 A;  1ASK A;  3CU3 A;  3DM8 A;  3MYT A;  3X40 A;  4WFO A;  1N8R 4;  1IT7 A;  3CCE 3;  4HM6 B;  4LGQ A;  3JUQ A;  4FMD A;  2CW9 A;  2A15 A;  1TP6 A;  2GU1 A;  3EN8 A;  3MG3 A;  2O9U X;  4N6N B;  4HM3 B;  3NX0 A;  3CPW 2;  3NUV A;  4HM4 B;  3I55 3;  2F98 A;  3PXM A;  3ECF A;  2RGQ A;  2CC3 A;  3B4O A;  4FCJ A;  4H3U A;  5IG3 A;  5AIG A;  2RCD A;  2E2V A;  3BB9 A;  4HZB B;  3OV4 A;  4JF8 A;  1TFK A;  8CHO A;  4XBY A;  1YJ9 3;  1SII A;  1K9M 4;  3ALA A;  1O7P B;  4RZM A;  1GY5 A;  3K0Z A;  1Q40 B;  1DVD A;  2FGT A;  2CIU A;  3EC9 A;  3Q2P A;  7STD A;  2W9P A;  2CFK A;  3NQY A;  1JV2 B;  1VQN 3;  4HBR A;  1VQ5 3;  3IJE B;  1YGE A;  3D3L A;  2CWT A;  3N9H A;  1OF5 B;  1NU3 A;  3SXX A;  1Z1S A;  3LT9 A;  1OUN A;  1Q42 A;  3UNL A;  1VQ4 3;  4N6M A;  4Q53 A;  2CFL A;  4EV2 A;  1IVX A;  1WTH A;  1UI7 A;  1WQL B;  2W56 B;  3JVC A;  3VGN A;  1JJ2 2;  2OTJ 3;  1ROA A;  3NQZ A;  3FGY A;  3Q90 A;  3N8B A;  1GD3 A;  3OWS A;  2XR8 B;  1DMM A;  2R4I A;  2CH9 A;  3UL5 A;  1SPU A;  3NXJ A;  2XRX B;  3BNB A;  3U97 A;  2GXF A;  3KN4 A;  4OUQ A;  4RBN A;  3EHC A;  2ML5 A;  3L0R A;  3TDG A;  3CC7 3;  5AYS C;  1ROV A;  5IG0 A;  1GD4 A;  3CPO A;  1MNL A;  4WP5 A;  1BUQ A;  2XFS A;  1KD1 4;  1IVW A;  3BLZ A;  3FH1 A;  2C11 A;  4EXR A;  1O7G B;  2YFI B;  3CMA 3;  1UUV B;  5IEO A;  4AEQ A;  1VQO 3;  4I4K A;  4R80 A;  3GZY B;  3F7X A;  2KXG A;  3T0U A;  1IV7 A;  5EEO A;  1F8N A;  1JB5 A;  1IV9 A;  3LTC A;  2IA7 A;  3A76 A;  3PCS A;  3EBY A;  4HZ9 B;  2KRT A;  3FKA A;  1Q81 4;  3CCV 3;  1W02 A;  3STD A;  5JPU A;  2XSO B;  2C10 A;  3UB1 A;  2P09 A;  3FCS B;  2SBL A;  3Q1C A;  4N6V 0;  4HM8 B;  4O02 B;  1JKG A;  3F9S A;  4GL6 A;  1L5G B;  3F7S A;  4WYK A;  1U5O A;  3X41 A;  5EVH A;  3MHE A;  3LML A;  3NHX A;  3EE1 A;  2D42 A;  3F40 A;  3K7C A;  2IUJ A;  3EQQ B;  3UL6 A;  5AI1 A;  5AEW B;  3FZW A;  3BNC A;  2OQE A;  5I97 A;  1CYV A;  2Z77 A;  2HMJ B;  4KFD A;  4N6L A;  3NM7 A;  4AKZ A;  3S27 A;  3MSO A;  3G4S 3;  3PGB A;  3WDG B;  5FGO A;  4BTY A;  1IVV A;  3GZR A;  3K5T A;  3OWY A;  3BND A;  2W0Q A;  1FGT A;  1SQW A;  3SLU A;  2K0M A;  2MF7 A;  2CWU A;  2I9W A;  3CCS 3;  1VQL 3;  2QGU A;  1NWW A;  1SJW A;  2BNG A;  1W4N A;  4H61 A;  5DRE A;  3LXU X;  3B8L A;  2WGQ A;  1QJG A;  5G2G A;  1TU5 A;  1NO3 A;  1AV4 A;  3CNM A;  3D9R A;  6STD A;  3DGN A;  1Q82 4;  4STD A;  4PEJ A;  5AII A;  3VF1 A;  2OCT A;  2OOV C;  3KZT A;  5KP3 A;  4MEI A;  3OWU A;  3G8Z A;  2BO9 B;  4U13 A;  1AVK A;  2L4V A;  3HK4 A;  1RJO A;  1IK3 A;  2INX A;  3PYJ A;  1N8Q A;  2B24 B;  1WMP A;  3AMO B;  3G0K A;  2CFG A;  3QK9 A;  5BVB A;  3I56 3;  3MKI A;  2O3O A;  1LXE A;  1S5A A;  1UUW B;  1M1X B;  3DGO A;  1YI2 3;  4BTW A;  1JRQ A;  3EN1 B;  1JB4 A;  1JN5 B;  4K1V A;  1O7N B;  4G1M B;  3J7Y d;  2W03 A;  4K61 A;  2E2U A;  1IDP A;  3EJV A;  1O7W B;  1ULJ B;  4O3V A;  3CD6 3;  1FGM A;  2W04 A;  1OGZ A;  3EBT A;  1VQ6 3;  1KC8 4;  1QAF A;  3GZB A;  1W00 A;  3JUM A;  3CCJ 3;  1LOX A;  5KP1 A;  1VQ7 3;  1QVG 2;  3WA3 A;  2PNC A;  1WMO A;  3LTD A;  1W7C A;  1UW1 A;  2CHC A;  4ORL A;  4HKV B;  3S29 A;  4FMC A;  1W5Z A;  1N5P A;  2QIY A;  1E3R A;  3WA2 X;  1DYU A;  2KCD A;  1QVF 2;  1A2K A;  2CG0 A;  2GBX B;  4NHF A;  1CQS A;  5KP4 A;  1WMN A;  1JNQ A;  2Z76 A;  3K9M C;  1DVC A;  3G6E 3;  4IT7 A;  1YJN 3;  1AVL A;  1W2Z A;  5IF6 A;  4KFE A;  2ML6 A;  4HM0 B;  2XGN A;  3LTA A;  1WNH A;  5AIF A;  3T8U A;  2MC8 A;  1EA2 A;  1ZO2 A;  1SIH A;  3CNX A;  2P0X A;  1RRH A;  2WOH A;  1OAC A;  2Q07 A;  3CME 3;  2GBW B;  4FCM A;  1STF I;  3V92 A;  1Q40 A;  3OXA A;  4KFF A;  1KSI A;  3FSD A;  3IPT A;  1W6C A;  1A67 A;  1D6U A;  2JQ5 A;  1N9E A;  2GEX A;  2OWP A;  1NJI 4;  1M1K 4;  3SOY A;  2BMR B;  3S67 A;  3RGA A;  1RKY A;  1J2B A;  1U8C B;  4FCZ A;  1AR0 A;  4CDL A;  1CEW I;  3NV0 B;  4J9A A;  1GY6 A;  1OF5 A;  3QRD A;  1FGR A;  1IQY A;  3WMD A;  4FMB A;  1QAK A;  3MWZ A;  1GS3 A;  4K1U A;  2V1L A;  3MG1 A;  2PZV A;  2W56 A;  2E2T A;  4IPB A;  1EQK A;  3EB8 A;  5D82 A;  5IER A;  3GRD A;  2D1W A;  1PFP A;  3JUN A;  3SX1 A;  4K90 B;  1OH0 A;  1VZZ A;  1ZX2 A;  2LYX A;  3X3Z A;  1FUW A;  4XBX A;  3IMA B;  1STD A;  2HMM B;  3H3H A;  5LC6 A;  4MMX B;  2RSX A;  1K41 A;  4WWU C;  1FGQ A;  2P38 A;  3HII A;  4L8O A;  3CCQ 3;  3NBB A;  1HKX A;  1KQS 2;  2CK3 H;  3CCR 3;  1TUH A;  3RGR A;  3JUP A;  1A90 A;  1D6Y A;  3GWR A;  4AKY A;  2HMO B;  4RNZ A;  3DUK A;  1YIT 3;  4J8T A;  5AIH A;  2WGO A;  5IEP A;  4FR9 A;  3NBR A;  4KVH A;  1NDO B;  4X2O A;  4OVM A;  3LT8 A;  2B1X B;  1R4C A;  2OQE C;  3NBJ A;  2HMN B;  2F86 B;  2XGL A;  1VQ9 3;  4ZM8 A;  2QA4 3;  5IEN A;  1C7H A;  3LYG A;  3CCL 3;  5D83 A;  1IT8 A;  2Y73 A;  2CWV A;  5A0O B;  3OW2 2;  3B4P A;  1D6Z A;  4HYZ A;  3G16 A;  5DRV A;  3N54 B;  3WOF B;  3V99 A;  2BMQ B;  3HIG A;  1TFO A;  2XFT A;  2P0M A;  5AYR B;  2JDI H;  3S28 A;  3B7C A;  4IIA A;  4RNY A;  2CG1 A;  2Y74 A;  2Z7A A;  5STD A;  3SVA A;  2OOV A;  3LZA A;  3SED A;  1VQM 3;  4N6T A;  3HZP A;  4EC6 A;  3FG3 A;  1K8A 4;  2CFW A;  3H51 A;  1HU9 A;  1W6G A;  2LQV A;  1K28 A;  3KSE D;  1S72 3;  4XBT A;  3SOA A;  3K63 A;  2CKF B;  3F8X A;  4HVN A;  4XB5 A;  2BHM A;  2K54 A;  3HI7 A;  4MJD A;  5LC7 A;  2XSH B;  4HM5 B;  1JB2 A;  5TGN A;  4KZ1 A;  1LVN A;  4LZI A;  1GY7 A;  3KKG A;  3F8H A;  3GAX A;  3T8N A;  4XM4 A;  5CF1 A;  1YJW 3;  1RRL A;  3KE7 A;  3JUO A;  3KSP A;  3FLJ A;  1G96 A;  1DMN A;  2CFD A;  3KFQ C;  5ELJ A;  1ISK A;  1NB3 I;  4LSO A;  1O7H B;  4LMI A;  4CCV A;  3LTB A;  2GU3 A;  3O8Y A;  4QWT A;  2WOF A;  2HMK B;  3U1W A;  4BTX A;  2ZDJ A;  5JBS A;  4HJL B;  1KWI A;  5CF2 A;  1OHO A;  1EKM A;  5ELU A;  3FG1 A;  3DY5 A;  3S5C A;  4EYC A;  3FF2 A;  3FG4 A;  3WOD G;  3ER7 A;  1EG9 B;  4O2H A;  3V98 A;  1FGO A;  3LH4 A;  5EQL A;  1IVU A;  3AMO A;  2XH9 A;  3PS8 A;  2W9Q A;  3NM2 A;  3LOY A;  1PU4 A;  3X3Y A;  1E3V A;  1N5H A;  3MPH A;  1JN5 A;  1M9G A;  2GEY A;  3PZW A;  4O8S A;  4X2H A;  1Y4K A;  1QMA A;  2W2C A;  1JKG B;  4HM7 B;  2QEX 3;  3X42 A;  4MMZ B;  4WHA A;  4WYK B;  1IQX A;  1OCV A;  2IUK A;  3X3X A;  4HM2 B;  1RN7 A;  4MMY B;  4XDV A;  1YHQ 3;  3DXO A;  2IMJ A;  4LEH A;  2P05 A;  3DGM A;  3F14 A;  2OTL 3;  2WO0 A;  1Q7Y 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...