3K9MC

Cathepsin b in complex with stefin a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stefin A displaces the occluding loop of cathepsin B only by as much as required to bind to the active site cleft
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cathepsin B
total genus 16
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k9mC00
3K9MC 1STFI 1N5HA 5LC7A 1CYVA 5LC6A 5A0OB 1GD3A 4N6UA 3S67A 1KWIA 1MNLA 1GD4A 1FA3A 1RN7A 3LH4A 2W9QA 2W9PA 5ELUA 2O9UX 1WNHA 5EQLA 1G96A 4IT7A 1EQKA 1LXEA 4N6NB 1DVDA 4N6V0 1FUWA 3GAXA 3PXMA 1NB5I 4TX4A 3PS8A 3QRDA 1A67A 1A90A 4N6TA 2BO9B 1IV9A 3L0RA 3UL6A 1CYUA 1TIJA 1MOLA 1N5PA 2KXGA 1IV7A 1NB3I 3KFQC 1CEWI 1N9JA 4CCVA 4ZM8A 2OCTA 3IMAB 4LZIA 3KSED 4N6MA 5ELJA 3UL5A 3Q2PA 4N6LA 3PYJA 1PFPA 1YVBI 4EYCA 3SVAA 3MWZA 1DVCA 1M9GA 2CH9A 3NX0A 4N6OB 1ROAA 1R4CA
chains in the Genus database with same CATH superfamily
1TRQA 1UGIA 2IUKA 3AHWA 4RZMA 2UX0A 4XBYA 1I2EA 3SOYA 2CWVA 2INXA 1J2BA 4KZ1A 1RN7A 3F40A 1V58A 1KSIA 1GSPA 1G96A 1BAOA 1OPYA 1WMNA 4QWTA 4XDVA 4FMAA 1O7MB 5EVHA 2XRXB 1W2B2 3GRDA 4HOHA 4K61A 1NB5I 1OF5A 1VQ53 1A90A 2CHCA 1UUVB 3DMCA 4WFOA 3UL6A 1BRNL 1FGRA 1YJW3 3KSPA 1RCLA 1BRSA 1GY7A 4ZM8A 1C7HA 2C4BA 4O8SA 2YX9A 5I97A 3CCJ3 4G1MB 1T3BA 3CPW2 2IYJA 5TGNA 2CG0A 3MG2A 1RLSA 4MMYB 1W7CA 1AR0A 3DGMA 4HZ9B 1GOUA 5A0OB 1FGQA 3MHEA 4XBTA 1CH0A 2CX1A 3BNDA 3WODG 4OVMA 4N6V0 1OGXA 1B20A 1ZO2A 2CK3H 3NQYA 1IYYA 1IK3A 2YFIB 1HYFA 1T2HA 2W56A 1TJDA 2CFGA 1BU4A 1OACA 3LT8A 2GBWB 1UCKA 8CHOA 2UGIA 5JPPA 4CCVA 3LYGA 2OQEC 4BU4A 1RGHA 1VQQA 3MWZA 2F99A 4FMBA 2W2CA 4X2OA 1DE3A 1TRPA 1IQ8A 2ZDJA 8RNTA 4NPBA 1VQ63 1SIIA 3O8YA 3BLZA 4RNYA 4HM3B 3X41A 5IEPA 1FA3A 3MG1A 1S723 5HOHA 1B21A 3B4PA 3B7CA 5AI1A 5D83A 5ELUA 4L8PA 3FKAA 5STDA 1KC84 1GMRA 4WYKB 4EV2A 1KD14 3M8CA 5M18A 2WO0A 1OGZA 1EEJA 3VSYA 3MG3A 3URPA 3NQZA 3JUQA 4XBXA 1EUIC 2F5MA 2F5WA 2XF3A 4WP5A 4MEIA 2PZVA 2RBIA 1GY5A 1YGWA 4J9AA 1GMQA 4AKYA 2GEXA 1BANA 1RGFA 2HMLB 4ILFA 5AEUB 3EBTA 1TP6A 4RNZA 1FGOA 1O7WB 5AIGA 3CPOA 3I0YA 3KN4A 1TFKA 3KE7A 3NXJA 2K0MA 3GZBA 1I3IA 1V74A 1BRHA 2KF3A 2RNTA 3DUKA 1GD4A 3UB1A 1X1XA 1W00A 2E2UA 2RSXA 4N6NB 1BUJA 1UI7A 2R4IA 2KF5A 3JVCA 3WMDA 2XGLA 1GYBA 3FG1A 3PCRA 1JBTA 3S27A 4HM6B 2OTJ3 2PNCA 3B4OA 2W04A 3LTBA 4KT3B 2K54A 1GMPA 3SEDA 3IMAB 3BNEA 1YNVX 3VF1A 3RGRA 1OH0A 3CCQ3 1HU9A 1Q42A 5IF6A 3NUVA 4HM4B 5JBSA 1JZOA 3F7XA 3K63A 1T2IA 1N9EA 3OX9A 4TX4A 2Z6BA 2F98A 3SXXA 5AIHA 4EBGA 1CYVA 5LC6A 1IVVA 1MWUA 1YIT3 4MMZB 1JN5A 1AVLA 1UCJA 4R80A 1G0TA 1Q40A 4FMCA 3S5CA 3JUMA 3AGOA 5IG5A 1DYUA 1EQKA 1WNHA 3A5EA 1VZZA 5GSPA 5IENA 3WOFB 2WGOA 4AKZA 3PXMA 1BGSA 4FCJA 3EQQB 1RJOA 1ZX2A 2UUGC 2O3OA 1RCKA 3EBYA 4H61A 3G4S3 3HOHA 3ER7A 3GZYB 2WOFA 3HIGA 4NHFA 1PU4A 1DMQA 1ULJB 3KCHA 2ZL8A 2P05A 1VQN3 2JQ5A 3OXAA 4LYLB 3FLJA 5KP4A 3PYJA 4EYCA 2JDIH 3CCL3 3LTAA 1YJN3 5IEOA 1UUWB 2BHMA 1MGWA 3E99A 5CF1A 3EB8A 3CCE3 2FXTA 3FG4A 4GL6A 2MC8A 1ROVA 3AMOA 2QA43 1BUQA 2XFTA 1B2XA 4J5KA 1HZ1A 3HX8A 2QIYA 5G1KA 4O2HA 3IJEB 2XR8B 1I2FA 2GEYA 2D42A 3KZTA 1UUGB 1TIJA 3CD63 1EG9B 1W4NA 2D1WA 3S28A 2GSPA 4NREA 1CEWI 3I563 1FUTA 3DXOA 1QAFA 4N6MA 1GOVA 1NNVA 1IQXA 3FF0A 2IY2A 3Q2PA 1JNQA 3Q90A 4KFDA 1BSCA 3G713 1X1YA 1UDII 2GU3A 3OWYA 5HGRA 1VQ83 3GAXA 1IDPA 3EE1A 1PY3A 3NBRA 4GSPA 3F14A 4JRFA 1EKMA 5AIFA 5AYSC 4BL2A 1B2UA 1VQO3 1IVUA 1VQM3 1VQ73 4XB5A 3NM2A 3NV0A 1QJGA 4HM0B 3QK9A 2RCDA 4HM2B 5M19A 3SLUA 1RNBA 7STDA 4HM7B 5AEWB 1W02A 1LOWA 1VQ93 1T5YA 2BO9B 1AVKA 1IV9A 5KP3A 1DVDA 2LQVA 3G0KA 2H0HA 3DGLA 3WOEB 1VQ43 1N5PA 1Y4KA 3EC9A 3K7CA 1D6ZA 2M7OA 1GOYA 9RNTA 4LZIA 3CCU3 3HIIA 5AYRB 3UL5A 1SQWA 3T8NA 5IW9A 1M9GA 1S5AA 2CWUA 1YI23 1U5OA 2P38A 4I4KA 4FR9A 2E2VA 1RN1A 3D5GA 1BRJA 1UW1A 2XSOB 3STDA 4BIRA 1I0VA 6RNTA 1M904 1Q814 3NHXA 2KCDA 1JB4A 3K0ZA 3HI7A 3KKGA 1BSDA 1PYLA 3CC73 3MPHA 1BVIA 1LRAA 3F9SA 4N6TA 2XEPA 1MOLA 4CDLA 1Q9EA 3CU3A 1JKGA 2HMMB 3NV0B 3VGNA 2F86B 3FGYA 3IPTA 2CW9A 2HOHA 4EXRA 3G6E3 4K1VA 2KF4A 5FW5A 2OOVA 4RBNA 4J5GA 3EJVA 2ML6A 1R4CA 3X42A 3CCS3 1YJ93 1BNEA 2CFLA 2WOHA 1BNSA 1IT7A 4R9LA 5BU4A 2CKFB 1KWIA 5IERA 3T0UA 3CCM3 3ZG0A 1BRKA 5EEOA 1RSNA 1B27A 2HMKB 4LEHA 1ULIB 2Z7AA 2MF7A 4CPKA 3J7Yd 3CC43 3DH2A 1STDA 1US1A 1IVXA 3GSPA 3DGNA 2GU1A 1CYUA 1FUSA 3EHCA 1RGLA 3D79A 2BMOB 2R41A 1JB5A 2ZHXB 4BTYA 1I2GA 1LQGC 1RRLA 3AMOB 2W03A 4O3VA 4CJNA 1RNTA 1YVBI 2ZA4A 4BTXA 2KF6A 1B2SA 1OHPA 1BOXA 4OK0A 1D6UA 1K28A 3JUPA 2XSHB 4U13A 1BNIA 3K9MC 3X40A 1EA2A 3X3ZA 1SJWA 1RDSA 1GD3A 1YIJ3 7RNTA 1O7HB 2RGQA 2FNQA 2K3DA 3V98A 3CNXA 1LXEA 3D9RA 1FW7A 3SOAA 1JBSA 1AV4A 1BRIA 1W01A 3LT9A 1B2MA 1NO3A 1RGAA 2XFSA 1FZUA 2IA7A 3HZPA 3FG3A 1A2KA 2BU4A 4HM8B 1TU5A 1Z1SA 1SPUA 3GZXB 2KAAA 4HZBB 1RN4A 2OCTA 3ALAA 5ELJA 2STDA 2HMNB 4N6LA 2WGQA 3RDEA 3SVAA 3BNCA 1GS3A 1O7GB 1O7NB 1ROAA 2L4VA 4N3VA 1YVSA 2C10A 5IG4A 1STFI 3PGBA 2BMRB 1NJI4 1UGHI 1LOXA 3LOYA 4HAAA 1W5ZA 4HM1B 4EW5A 4PEJA 2OOVC 2FGTA 4FCMA 2W9PA 2KRTA 3CCR3 1BRGA 2O9UX 4AEQA 1QAKA 1FGTA 3FZWA 4ORLA 3CXC2 4KFEA 1E3RA 3PZWA 5DRVA 1TUHA 1OCVA 3WA2X 1LNIA 1W6YA 2IMJA 3FSDA 2BT3A 2H0GA 2I9WA 4K90B 1K8A4 1MWSA 3KSED 3ZFZA 1K9M4 2P09A 2QGUA 4XDWA 3CCV3 4R9KA 1W6CA 1PFPA 4WHAA 3A76A 5IG0A 1VQK3 2LYXA 1DETA 3F8XA 3ECFA 2KXGA 4N6OB 1M1K4 1LOVA 4J8TA 7GSPA 1WMOA 3OWSA 1V57A 1IU7A 4STDA 4X2HA 2B1XB 1FYSA 5G2GA 5RNTA 2SARA 1BNJA 3WDGB 3NBJA 3F7SA 1A2VA 3PS8A 4Q53A 1RGCA 5CLKA 1A67A 1VQP3 1O7PB 3H51A 1FGMA 3JUNA 3K5TA 1OUNA 1RGEA 1RTUA 4WYKA 2L1SA 1KQS2 5D82A 3V99A 1B2ZA 1IV7A 2OTL3 3KFQC 1B3SA 3WR2A 1Q7HA 4WWUC 1BSEA 1BSBA 2YFJB 3EF8A 2F56A 3CC23 3AGNA 2J8XB 2OWPA 2BNGA 4FCZA 3NBBA 2CG1A 1N5HA 1RGKA 4IIAA 4N6UA 3DM8A 3X3YA 1W2ZA 1VQL3 5IG3A 2W9QA 2CFDA 4BL3A 1ISKA 1JZDA 5FGOA 5AIIA 1E3VA 2CIUA 2Y73A 3DGOA 2GXFA 3U97A 1LNHA 1UCIA 3DY5A 5D81A 4MMXB 1LVNA 4IPBA 2BMQB 2W56B 2BIRA 4OUQA 5BIRA 3BNBA 1L5GB 3AHSA 1I3FA 3MKIA 1RHLA 6GSPA 1N9JA 3DGYA 1BNRA 3OWUA 1K41A 1IQYA 2SBLA 3BU4A 4HKVB 3H3HA 3LTCA 1IT8A 3ZG5A 3HK4A 5CF2A 3D3LA 1DVCA 2CH9A 3NX0A 2CX0A 1F8NA 3T8UA 2AADA 3UNLA 1ZGXA 1JRQA 4O02B 5LC7A 3NM7A 1CQSA 1WQLB 2CFWA 5DREA 1BIRA 1N8R4 1OHOA 1MNLA 4JF8A 3LXUX 1QVG2 2V1LA 3G16A 2E2TA 3OV4A 1LOYA 1DMMA 1I70A 1TTOA 2XGNA 2Q07A 4LSOA 1BNFA 1AQZA 3I553 1FUWA 2Y74A 1SIHA 1Q40B 2A15A 2HMJB 1JN5B 1MGRA 3X3XA 3EN1B 2P0XA 1WMPA 1BSAA 1R4YA 1OF5B 1HKXA 3FCSB 3KIIA 3L0RA 5BVBA 1NDOB 1RRHA 3N8BA 4L7KA 4LGQA 1WTHA 2W6JH 3DZLA 3N9HA 1JV2B 1UCLA 2Z76A 5KP1A 3Q1CA 4XM4A 3EN8A 1YHQ3 3LMLA 1D6YA 5M1AA 2AAEA 3WA3A 3S67A 3LTDA 1E97A 3G8ZA 4KFFA 1RKYA 1SARA 2IUJA 2YFLB 1Q864 4EV5A 1G02A 1NWWA 1M1XB 1LQMB 2H0IA 1JJ22 3ROBA 2HMOB 1MWTA 1ASKA 1X1UA 3SYUA 1A2PA 1OHSA 4HM5B 3S29A 4L8OA 3UJMA 1C54A 2RFRA 3PCSA 4FMDA 4KVHA 1UI8A 2CFKA 1GY6A 3V92A 1ZS7A 2ML5A 4HVNA 4RNTA 5BXQA 3CMA3 1TFOA 3B8LA 1JBRA 3BIRA 2P0MA 3TDGA 3GWRA 4BTWA 1Q7Y4 1K734 3BB9A 3EX9A 1IVWA 1NB3I 4HBRA 4LMIA 2W0QA 3D4AA 5CK6A 4I5QA 3RNTA 3SX1A 3Q3FA 3CNMA 4GHOA 4HJLB 1RMSA 2XH9A 4GB5A 4R1KA 3FF2A 1QMAA 1I8VA 1W6GA 3F8HA 3OW22 3RGAA 1NU3A 3GZRA 5CXOA 1I0XA 1QVF2 4DKIA 3D5IA 3JUOA 2OQEA 3U1WA 6STDA 3MYTA 3LH4A 1X1WA 1DMNA 5EQLA 4IT7A 4H3UA 1BNGA 2CWTA 3FH1A 4HYZA 1MWRA 3MSOA 3QRDA 4MJDA 1U8CB 2B24B 2C11A 2F4YA 1YGEA 3CME3 2QEX3 1N8QA 5JPUA 1Q824 1QALA 4EC6A 1RGGA 2CC3A 3LZAA 4K1UA 2Z77A 1JKGB 2GBXB 1AY7A 3WHOA 4R4KA 3N54B 1JB2A 5G1LA
chains in the Genus database with same CATH topology
2IUKA 4RZMA 2UX0A 4XBYA 3SOYA 2CWVA 2INXA 1J2BA 4KZ1A 1RN7A 3F40A 1KSIA 1WMNA 1G96A 2OOVA 1OPYA 4QWTA 1M1K4 4XDVA 4FMAA 1O7MB 5EVHA 2XRXB 1W2B2 3GRDA 4K61A 1NB5I 1OF5A 1VQ53 1A90A 2CHCA 1UUVB 3DMCA 4WFOA 3UL6A 1FGRA 1YJW3 3KSPA 1GY7A 4ZM8A 1C7HA 4O8SA 2YX9A 5I97A 3CCJ3 4G1MB 3CPW2 5TGNA 2CG0A 3MG2A 4MMYB 1W7CA 1AR0A 3DGMA 4HZ9B 5A0OB 1FGQA 3MHEA 4XBTA 3BNDA 3WODG 4OVMA 4N6V0 1OGXA 1ZO2A 2CK3H 3NQYA 1IK3A 2YFIB 2W56A 2CFGA 1OACA 3LT8A 2GBWB 8CHOA 5JPPA 4CCVA 3LYGA 2OQEC 3MWZA 2F99A 4FMBA 2W2CA 4X2OA 1IQ8A 2ZDJA 1VQ63 1SIIA 3O8YA 3BLZA 4RNYA 4HM3B 3X41A 5IEPA 1FA3A 3MG1A 1S723 3B4PA 3B7CA 5AI1A 5D83A 5ELUA 4L8PA 3FKAA 5STDA 1KC84 4WYKB 1KD14 4EV2A 3M8CA 2WO0A 1OGZA 3VSYA 3MG3A 3NQZA 3JUQA 4XBXA 2XF3A 4WP5A 4MEIA 2PZVA 1GY5A 4AKYA 4J9AA 2GEXA 2HMLB 5AEUB 3EBTA 1TP6A 4RNZA 1FGOA 1O7WB 5AIGA 3CPOA 3I0YA 3KN4A 1TFKA 3KE7A 3NXJA 2K0MA 3GZBA 1V74A 3DUKA 1GD4A 3UB1A 1W00A 2E2UA 2RSXA 4N6NB 1UI7A 2R4IA 3JVCA 3WMDA 2XGLA 1GYBA 3FG1A 3PCRA 3S27A 4HM6B 2OTJ3 2PNCA 3B4OA 2W04A 3LTBA 2K54A 3SEDA 3IMAB 3BNEA 3VF1A 3RGRA 1OH0A 3CCQ3 1HU9A 1Q42A 5IF6A 3NUVA 4HM4B 5JBSA 3F7XA 3K63A 1N9EA 3OX9A 4TX4A 2Z6BA 2F98A 3SXXA 5AIHA 4EBGA 1CYVA 5LC6A 1IVVA 1YIT3 4MMZB 1JN5A 1AVLA 4R80A 1Q40A 3S5CA 4FMCA 3JUMA 5IG5A 1DYUA 1EQKA 1WNHA 1VZZA 5IENA 3WOFB 2WGOA 4AKZA 3PXMA 4FCJA 3EQQB 1RJOA 1ZX2A 2O3OA 3EBYA 4H61A 3G4S3 3ER7A 3GZYB 2WOFA 3HIGA 4NHFA 1PU4A 1DMQA 1ULJB 2ZL8A 2P05A 1VQN3 2JQ5A 3OXAA 3FLJA 5KP4A 3PYJA 4EYCA 2JDIH 3CCL3 3LTAA 1YJN3 5IEOA 1UUWB 2BHMA 3E99A 5CF1A 3EB8A 3CCE3 2FXTA 3FG4A 4GL6A 2MC8A 1ROVA 3AMOA 2QA43 1BUQA 2XFTA 3HX8A 2QIYA 4O2HA 3IJEB 2XR8B 2GEYA 2D42A 3KZTA 1TIJA 3CD63 1EG9B 1W4NA 2D1WA 3S28A 4NREA 1CEWI 3I563 3DXOA 1QAFA 4N6MA 3FF0A 1IQXA 3G713 3Q2PA 1JNQA 3Q90A 4KFDA 2GU3A 3OWYA 5HGRA 1VQ83 3GAXA 1IDPA 3EE1A 5AIFA 3NBRA 5AYSC 3F14A 4JRFA 1EKMA 1VQO3 1IVUA 1VQM3 1VQ73 4XB5A 3NM2A 3NV0A 1QJGA 4HM0B 3QK9A 2RCDA 4HM2B 3SLUA 7STDA 4HM7B 5AEWB 1W02A 1VQ93 1T5YA 2BO9B 1AVKA 1IV9A 5KP3A 1DVDA 2LQVA 3G0KA 3DGLA 3WOEB 1VQ43 1N5PA 1Y4KA 3EC9A 3K7CA 1D6ZA 2M7OA 4LZIA 3CCU3 3HIIA 5AYRB 3UL5A 1SQWA 3T8NA 5IW9A 1M9GA 1S5AA 2CWUA 1YI23 1U5OA 2P38A 4I4KA 4FR9A 2E2VA 1UW1A 2XSOB 3STDA 1M904 1Q814 3NHXA 2KCDA 1JB4A 3K0ZA 3HI7A 3KKGA 3CC73 3MPHA 3F9SA 4N6TA 2XEPA 1MOLA 4CDLA 3CU3A 3VGNA 1JKGA 2HMMB 3NV0B 2F86B 3FGYA 3IPTA 2CW9A 4EXRA 3G6E3 4K1VA 5FW5A 4RBNA 3X42A 3EJVA 2ML6A 1R4CA 3CCS3 1YJ93 2CFLA 2WOHA 5IERA 1IT7A 4R9LA 3CCM3 2CKFB 1KWIA 3T0UA 5EEOA 2HMKB 4LEHA 1ULIB 2Z7AA 2MF7A 3J7Yd 3CC43 1STDA 1US1A 1IVXA 3DGNA 2GU1A 1CYUA 3EHCA 2BMOB 1JB5A 4BTYA 1RRLA 3AMOB 2W03A 4O3VA 1YVBI 4BTXA 1OHPA 4OK0A 1D6UA 1K28A 3JUPA 2XSHB 4U13A 3X40A 3K9MC 1EA2A 3X3ZA 1SJWA 1GD3A 1YIJ3 1O7HB 2RGQA 2FNQA 3V98A 3CNXA 1LXEA 3D9RA 3SOAA 1AV4A 1W01A 3LT9A 1NO3A 2XFSA 2IA7A 3HZPA 3FG3A 1A2KA 4HM8B 1TU5A 1Z1SA 1SPUA 3GZXB 4HZBB 2OCTA 3ALAA 5ELJA 2STDA 2HMNB 4N6LA 2WGQA 3RDEA 3SVAA 3BNCA 1GS3A 1O7GB 1O7NB 1ROAA 2L4VA 4N3VA 1NJI4 2C10A 5IG4A 1STFI 3PGBA 2BMRB 1LOXA 3LOYA 4HM1B 1W5ZA 4PEJA 2OOVC 2FGTA 4FCMA 2W9PA 2KRTA 3CCR3 2O9UX 4AEQA 1QAKA 1FGTA 3FZWA 4ORLA 3CXC2 4KFEA 1E3RA 3PZWA 5DRVA 1TUHA 1OCVA 3WA2X 1W6YA 2IMJA 3FSDA 2BT3A 2I9WA 4K90B 1K8A4 3KSED 1K9M4 2P09A 2QGUA 4XDWA 3CCV3 4R9KA 1W6CA 1PFPA 4WHAA 3A76A 5IG0A 1VQK3 2LYXA 3F8XA 3ECFA 2KXGA 4N6OB 4J8TA 1WMOA 3OWSA 1IU7A 4STDA 4X2HA 2B1XB 5G2GA 3WDGB 3NBJA 3F7SA 1A2VA 3PS8A 4Q53A 5CLKA 1A67A 1VQP3 1O7PB 3H51A 1FGMA 3JUNA 3K5TA 1OUNA 4WYKA 1KQS2 5D82A 3V99A 1IV7A 2OTL3 3KFQC 4WWUC 2YFJB 3EF8A 3CC23 4FCZA 2OWPA 2BNGA 3NBBA 2CG1A 1N5HA 4IIAA 4N6UA 3DM8A 3X3YA 1W2ZA 1VQL3 5IG3A 2W9QA 2CFDA 1ISKA 5FGOA 5AIIA 1E3VA 2CIUA 2Y73A 3DGOA 2GXFA 3U97A 1LNHA 3DY5A 5D81A 4MMXB 1LVNA 4IPBA 2BMQB 2W56B 4OUQA 3BNBA 1L5GB 3MKIA 1N9JA 3OWUA 1K41A 1IQYA 2SBLA 4HKVB 3H3HA 3LTCA 1IT8A 3HK4A 5CF2A 3D3LA 1DVCA 2CH9A 3NX0A 1F8NA 3T8UA 3UNLA 1JRQA 4O02B 5LC7A 3NM7A 1CQSA 1WQLB 2CFWA 5DREA 1N8R4 1OHOA 1MNLA 4JF8A 3LXUX 1QVG2 2V1LA 3G16A 2E2TA 3OV4A 1DMMA 2XGNA 2Q07A 4LSOA 3I553 1FUWA 2Y74A 1SIHA 1Q40B 2A15A 2HMJB 1JN5B 3X3XA 3EN1B 2P0XA 1WMPA 3FCSB 3KIIA 1OF5B 1HKXA 3L0RA 5BVBA 1NDOB 1RRHA 3N8BA 4L7KA 4LGQA 1WTHA 2W6JH 3DZLA 3N9HA 1JV2B 2Z76A 5KP1A 3Q1CA 4XM4A 3EN8A 1YHQ3 3LMLA 1D6YA 3WA3A 3S67A 3LTDA 1E97A 3G8ZA 4KFFA 1RKYA 2IUJA 2YFLB 1Q864 4EV5A 1NWWA 1M1XB 1JJ22 3ROBA 2HMOB 1ASKA 4HM5B 1OHSA 3S29A 4L8OA 3UJMA 2RFRA 3PCSA 4FMDA 4KVHA 1UI8A 2CFKA 1GY6A 3V92A 2ML5A 4HVNA 5BXQA 3CMA3 1TFOA 3B8LA 2P0MA 3TDGA 3GWRA 4BTWA 1Q7Y4 1K734 3BB9A 3EX9A 1IVWA 1NB3I 4HBRA 4LMIA 2W0QA 5CK6A 3SX1A 4R1KA 3CNMA 4HJLB 4GB5A 2XH9A 3FF2A 1QMAA 1W6GA 3F8HA 3OW22 3RGAA 1NU3A 3GZRA 5CXOA 1QVF2 6STDA 3JUOA 2OQEA 3U1WA 3MYTA 3LH4A 1DMNA 5EQLA 4IT7A 4H3UA 2CWTA 3FH1A 4HYZA 4MJDA 3MSOA 3QRDA 1U8CB 2B24B 2C11A 1YGEA 3CME3 2QEX3 1N8QA 5JPUA 1Q824 1QALA 4EC6A 2CC3A 3LZAA 4K1UA 2Z77A 1JKGB 2GBXB 4R4KA 3N54B 1JB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9M C;  1STF I;  1N5H A;  5LC7 A;  1CYV A;  5LC6 A;  5A0O B;  1GD3 A;  4N6U A;  3S67 A;  1KWI A;  1MNL A;  1GD4 A;  1FA3 A;  1RN7 A;  3LH4 A;  2W9Q A;  2W9P A;  5ELU A;  2O9U X;  1WNH A;  5EQL A;  1G96 A;  4IT7 A;  1EQK A;  1LXE A;  4N6N B;  1DVD A;  4N6V 0;  1FUW A;  3GAX A;  3PXM A;  1NB5 I;  4TX4 A;  3PS8 A;  3QRD A;  1A67 A;  1A90 A;  4N6T A;  2BO9 B;  1IV9 A;  3L0R A;  3UL6 A;  1CYU A;  1TIJ A;  1MOL A;  1N5P A;  2KXG A;  1IV7 A;  1NB3 I;  3KFQ C;  1CEW I;  1N9J A;  4CCV A;  4ZM8 A;  2OCT A;  3IMA B;  4LZI A;  3KSE D;  4N6M A;  5ELJ A;  3UL5 A;  3Q2P A;  4N6L A;  3PYJ A;  1PFP A;  1YVB I;  4EYC A;  3SVA A;  3MWZ A;  1DVC A;  1M9G A;  2CH9 A;  3NX0 A;  4N6O B;  1ROA A;  1R4C A; 
#chains in the Genus database with same CATH topology
 1TRQ A;  1UGI A;  2IUK A;  3AHW A;  4RZM A;  2UX0 A;  4XBY A;  1I2E A;  3SOY A;  2CWV A;  2INX A;  1J2B A;  4KZ1 A;  1RN7 A;  3F40 A;  1V58 A;  1KSI A;  1GSP A;  1G96 A;  1BAO A;  1OPY A;  1WMN A;  4QWT A;  4XDV A;  4FMA A;  1O7M B;  5EVH A;  2XRX B;  1W2B 2;  3GRD A;  4HOH A;  4K61 A;  1NB5 I;  1OF5 A;  1VQ5 3;  1A90 A;  2CHC A;  1UUV B;  3DMC A;  4WFO A;  3UL6 A;  1BRN L;  1FGR A;  1YJW 3;  3KSP A;  1RCL A;  1BRS A;  1GY7 A;  4ZM8 A;  1C7H A;  2C4B A;  4O8S A;  2YX9 A;  5I97 A;  3CCJ 3;  4G1M B;  1T3B A;  3CPW 2;  2IYJ A;  5TGN A;  2CG0 A;  3MG2 A;  1RLS A;  4MMY B;  1W7C A;  1AR0 A;  3DGM A;  4HZ9 B;  1GOU A;  5A0O B;  1FGQ A;  3MHE A;  4XBT A;  1CH0 A;  2CX1 A;  3BND A;  3WOD G;  4OVM A;  4N6V 0;  1OGX A;  1B20 A;  1ZO2 A;  2CK3 H;  3NQY A;  1IYY A;  1IK3 A;  2YFI B;  1HYF A;  1T2H A;  2W56 A;  1TJD A;  2CFG A;  1BU4 A;  1OAC A;  3LT8 A;  2GBW B;  1UCK A;  8CHO A;  2UGI A;  5JPP A;  4CCV A;  3LYG A;  2OQE C;  4BU4 A;  1RGH A;  1VQQ A;  3MWZ A;  2F99 A;  4FMB A;  2W2C A;  4X2O A;  1DE3 A;  1TRP A;  1IQ8 A;  2ZDJ A;  8RNT A;  4NPB A;  1VQ6 3;  1SII A;  3O8Y A;  3BLZ A;  4RNY A;  4HM3 B;  3X41 A;  5IEP A;  1FA3 A;  3MG1 A;  1S72 3;  5HOH A;  1B21 A;  3B4P A;  3B7C A;  5AI1 A;  5D83 A;  5ELU A;  4L8P A;  3FKA A;  5STD A;  1KC8 4;  1GMR A;  4WYK B;  4EV2 A;  1KD1 4;  3M8C A;  5M18 A;  2WO0 A;  1OGZ A;  1EEJ A;  3VSY A;  3MG3 A;  3URP A;  3NQZ A;  3JUQ A;  4XBX A;  1EUI C;  2F5M A;  2F5W A;  2XF3 A;  4WP5 A;  4MEI A;  2PZV A;  2RBI A;  1GY5 A;  1YGW A;  4J9A A;  1GMQ A;  4AKY A;  2GEX A;  1BAN A;  1RGF A;  2HML B;  4ILF A;  5AEU B;  3EBT A;  1TP6 A;  4RNZ A;  1FGO A;  1O7W B;  5AIG A;  3CPO A;  3I0Y A;  3KN4 A;  1TFK A;  3KE7 A;  3NXJ A;  2K0M A;  3GZB A;  1I3I A;  1V74 A;  1BRH A;  2KF3 A;  2RNT A;  3DUK A;  1GD4 A;  3UB1 A;  1X1X A;  1W00 A;  2E2U A;  2RSX A;  4N6N B;  1BUJ A;  1UI7 A;  2R4I A;  2KF5 A;  3JVC A;  3WMD A;  2XGL A;  1GYB A;  3FG1 A;  3PCR A;  1JBT A;  3S27 A;  4HM6 B;  2OTJ 3;  2PNC A;  3B4O A;  2W04 A;  3LTB A;  4KT3 B;  2K54 A;  1GMP A;  3SED A;  3IMA B;  3BNE A;  1YNV X;  3VF1 A;  3RGR A;  1OH0 A;  3CCQ 3;  1HU9 A;  1Q42 A;  5IF6 A;  3NUV A;  4HM4 B;  5JBS A;  1JZO A;  3F7X A;  3K63 A;  1T2I A;  1N9E A;  3OX9 A;  4TX4 A;  2Z6B A;  2F98 A;  3SXX A;  5AIH A;  4EBG A;  1CYV A;  5LC6 A;  1IVV A;  1MWU A;  1YIT 3;  4MMZ B;  1JN5 A;  1AVL A;  1UCJ A;  4R80 A;  1G0T A;  1Q40 A;  4FMC A;  3S5C A;  3JUM A;  3AGO A;  5IG5 A;  1DYU A;  1EQK A;  1WNH A;  3A5E A;  1VZZ A;  5GSP A;  5IEN A;  3WOF B;  2WGO A;  4AKZ A;  3PXM A;  1BGS A;  4FCJ A;  3EQQ B;  1RJO A;  1ZX2 A;  2UUG C;  2O3O A;  1RCK A;  3EBY A;  4H61 A;  3G4S 3;  3HOH A;  3ER7 A;  3GZY B;  2WOF A;  3HIG A;  4NHF A;  1PU4 A;  1DMQ A;  1ULJ B;  3KCH A;  2ZL8 A;  2P05 A;  1VQN 3;  2JQ5 A;  3OXA A;  4LYL B;  3FLJ A;  5KP4 A;  3PYJ A;  4EYC A;  2JDI H;  3CCL 3;  3LTA A;  1YJN 3;  5IEO A;  1UUW B;  2BHM A;  1MGW A;  3E99 A;  5CF1 A;  3EB8 A;  3CCE 3;  2FXT A;  3FG4 A;  4GL6 A;  2MC8 A;  1ROV A;  3AMO A;  2QA4 3;  1BUQ A;  2XFT A;  1B2X A;  4J5K A;  1HZ1 A;  3HX8 A;  2QIY A;  5G1K A;  4O2H A;  3IJE B;  2XR8 B;  1I2F A;  2GEY A;  2D42 A;  3KZT A;  1UUG B;  1TIJ A;  3CD6 3;  1EG9 B;  1W4N A;  2D1W A;  3S28 A;  2GSP A;  4NRE A;  1CEW I;  3I56 3;  1FUT A;  3DXO A;  1QAF A;  4N6M A;  1GOV A;  1NNV A;  1IQX A;  3FF0 A;  2IY2 A;  3Q2P A;  1JNQ A;  3Q90 A;  4KFD A;  1BSC A;  3G71 3;  1X1Y A;  1UDI I;  2GU3 A;  3OWY A;  5HGR A;  1VQ8 3;  3GAX A;  1IDP A;  3EE1 A;  1PY3 A;  3NBR A;  4GSP A;  3F14 A;  4JRF A;  1EKM A;  5AIF A;  5AYS C;  4BL2 A;  1B2U A;  1VQO 3;  1IVU A;  1VQM 3;  1VQ7 3;  4XB5 A;  3NM2 A;  3NV0 A;  1QJG A;  4HM0 B;  3QK9 A;  2RCD A;  4HM2 B;  5M19 A;  3SLU A;  1RNB A;  7STD A;  4HM7 B;  5AEW B;  1W02 A;  1LOW A;  1VQ9 3;  1T5Y A;  2BO9 B;  1AVK A;  1IV9 A;  5KP3 A;  1DVD A;  2LQV A;  3G0K A;  2H0H A;  3DGL A;  3WOE B;  1VQ4 3;  1N5P A;  1Y4K A;  3EC9 A;  3K7C A;  1D6Z A;  2M7O A;  1GOY A;  9RNT A;  4LZI A;  3CCU 3;  3HII A;  5AYR B;  3UL5 A;  1SQW A;  3T8N A;  5IW9 A;  1M9G A;  1S5A A;  2CWU A;  1YI2 3;  1U5O A;  2P38 A;  4I4K A;  4FR9 A;  2E2V A;  1RN1 A;  3D5G A;  1BRJ A;  1UW1 A;  2XSO B;  3STD A;  4BIR A;  1I0V A;  6RNT A;  1M90 4;  1Q81 4;  3NHX A;  2KCD A;  1JB4 A;  3K0Z A;  3HI7 A;  3KKG A;  1BSD A;  1PYL A;  3CC7 3;  3MPH A;  1BVI A;  1LRA A;  3F9S A;  4N6T A;  2XEP A;  1MOL A;  4CDL A;  1Q9E A;  3CU3 A;  1JKG A;  2HMM B;  3NV0 B;  3VGN A;  2F86 B;  3FGY A;  3IPT A;  2CW9 A;  2HOH A;  4EXR A;  3G6E 3;  4K1V A;  2KF4 A;  5FW5 A;  2OOV A;  4RBN A;  4J5G A;  3EJV A;  2ML6 A;  1R4C A;  3X42 A;  3CCS 3;  1YJ9 3;  1BNE A;  2CFL A;  2WOH A;  1BNS A;  1IT7 A;  4R9L A;  5BU4 A;  2CKF B;  1KWI A;  5IER A;  3T0U A;  3CCM 3;  3ZG0 A;  1BRK A;  5EEO A;  1RSN A;  1B27 A;  2HMK B;  4LEH A;  1ULI B;  2Z7A A;  2MF7 A;  4CPK A;  3J7Y d;  3CC4 3;  3DH2 A;  1STD A;  1US1 A;  1IVX A;  3GSP A;  3DGN A;  2GU1 A;  1CYU A;  1FUS A;  3EHC A;  1RGL A;  3D79 A;  2BMO B;  2R41 A;  1JB5 A;  2ZHX B;  4BTY A;  1I2G A;  1LQG C;  1RRL A;  3AMO B;  2W03 A;  4O3V A;  4CJN A;  1RNT A;  1YVB I;  2ZA4 A;  4BTX A;  2KF6 A;  1B2S A;  1OHP A;  1BOX A;  4OK0 A;  1D6U A;  1K28 A;  3JUP A;  2XSH B;  4U13 A;  1BNI A;  3K9M C;  3X40 A;  1EA2 A;  3X3Z A;  1SJW A;  1RDS A;  1GD3 A;  1YIJ 3;  7RNT A;  1O7H B;  2RGQ A;  2FNQ A;  2K3D A;  3V98 A;  3CNX A;  1LXE A;  3D9R A;  1FW7 A;  3SOA A;  1JBS A;  1AV4 A;  1BRI A;  1W01 A;  3LT9 A;  1B2M A;  1NO3 A;  1RGA A;  2XFS A;  1FZU A;  2IA7 A;  3HZP A;  3FG3 A;  1A2K A;  2BU4 A;  4HM8 B;  1TU5 A;  1Z1S A;  1SPU A;  3GZX B;  2KAA A;  4HZB B;  1RN4 A;  2OCT A;  3ALA A;  5ELJ A;  2STD A;  2HMN B;  4N6L A;  2WGQ A;  3RDE A;  3SVA A;  3BNC A;  1GS3 A;  1O7G B;  1O7N B;  1ROA A;  2L4V A;  4N3V A;  1YVS A;  2C10 A;  5IG4 A;  1STF I;  3PGB A;  2BMR B;  1NJI 4;  1UGH I;  1LOX A;  3LOY A;  4HAA A;  1W5Z A;  4HM1 B;  4EW5 A;  4PEJ A;  2OOV C;  2FGT A;  4FCM A;  2W9P A;  2KRT A;  3CCR 3;  1BRG A;  2O9U X;  4AEQ A;  1QAK A;  1FGT A;  3FZW A;  4ORL A;  3CXC 2;  4KFE A;  1E3R A;  3PZW A;  5DRV A;  1TUH A;  1OCV A;  3WA2 X;  1LNI A;  1W6Y A;  2IMJ A;  3FSD A;  2BT3 A;  2H0G A;  2I9W A;  4K90 B;  1K8A 4;  1MWS A;  3KSE D;  3ZFZ A;  1K9M 4;  2P09 A;  2QGU A;  4XDW A;  3CCV 3;  4R9K A;  1W6C A;  1PFP A;  4WHA A;  3A76 A;  5IG0 A;  1VQK 3;  2LYX A;  1DET A;  3F8X A;  3ECF A;  2KXG A;  4N6O B;  1M1K 4;  1LOV A;  4J8T A;  7GSP A;  1WMO A;  3OWS A;  1V57 A;  1IU7 A;  4STD A;  4X2H A;  2B1X B;  1FYS A;  5G2G A;  5RNT A;  2SAR A;  1BNJ A;  3WDG B;  3NBJ A;  3F7S A;  1A2V A;  3PS8 A;  4Q53 A;  1RGC A;  5CLK A;  1A67 A;  1VQP 3;  1O7P B;  3H51 A;  1FGM A;  3JUN A;  3K5T A;  1OUN A;  1RGE A;  1RTU A;  4WYK A;  2L1S A;  1KQS 2;  5D82 A;  3V99 A;  1B2Z A;  1IV7 A;  2OTL 3;  3KFQ C;  1B3S A;  3WR2 A;  1Q7H A;  4WWU C;  1BSE A;  1BSB A;  2YFJ B;  3EF8 A;  2F56 A;  3CC2 3;  3AGN A;  2J8X B;  2OWP A;  2BNG A;  4FCZ A;  3NBB A;  2CG1 A;  1N5H A;  1RGK A;  4IIA A;  4N6U A;  3DM8 A;  3X3Y A;  1W2Z A;  1VQL 3;  5IG3 A;  2W9Q A;  2CFD A;  4BL3 A;  1ISK A;  1JZD A;  5FGO A;  5AII A;  1E3V A;  2CIU A;  2Y73 A;  3DGO A;  2GXF A;  3U97 A;  1LNH A;  1UCI A;  3DY5 A;  5D81 A;  4MMX B;  1LVN A;  4IPB A;  2BMQ B;  2W56 B;  2BIR A;  4OUQ A;  5BIR A;  3BNB A;  1L5G B;  3AHS A;  1I3F A;  3MKI A;  1RHL A;  6GSP A;  1N9J A;  3DGY A;  1BNR A;  3OWU A;  1K41 A;  1IQY A;  2SBL A;  3BU4 A;  4HKV B;  3H3H A;  3LTC A;  1IT8 A;  3ZG5 A;  3HK4 A;  5CF2 A;  3D3L A;  1DVC A;  2CH9 A;  3NX0 A;  2CX0 A;  1F8N A;  3T8U A;  2AAD A;  3UNL A;  1ZGX A;  1JRQ A;  4O02 B;  5LC7 A;  3NM7 A;  1CQS A;  1WQL B;  2CFW A;  5DRE A;  1BIR A;  1N8R 4;  1OHO A;  1MNL A;  4JF8 A;  3LXU X;  1QVG 2;  2V1L A;  3G16 A;  2E2T A;  3OV4 A;  1LOY A;  1DMM A;  1I70 A;  1TTO A;  2XGN A;  2Q07 A;  4LSO A;  1BNF A;  1AQZ A;  3I55 3;  1FUW A;  2Y74 A;  1SIH A;  1Q40 B;  2A15 A;  2HMJ B;  1JN5 B;  1MGR A;  3X3X A;  3EN1 B;  2P0X A;  1WMP A;  1BSA A;  1R4Y A;  1OF5 B;  1HKX A;  3FCS B;  3KII A;  3L0R A;  5BVB A;  1NDO B;  1RRH A;  3N8B A;  4L7K A;  4LGQ A;  1WTH A;  2W6J H;  3DZL A;  3N9H A;  1JV2 B;  1UCL A;  2Z76 A;  5KP1 A;  3Q1C A;  4XM4 A;  3EN8 A;  1YHQ 3;  3LML A;  1D6Y A;  5M1A A;  2AAE A;  3WA3 A;  3S67 A;  3LTD A;  1E97 A;  3G8Z A;  4KFF A;  1RKY A;  1SAR A;  2IUJ A;  2YFL B;  1Q86 4;  4EV5 A;  1G02 A;  1NWW A;  1M1X B;  1LQM B;  2H0I A;  1JJ2 2;  3ROB A;  2HMO B;  1MWT A;  1ASK A;  1X1U A;  3SYU A;  1A2P A;  1OHS A;  4HM5 B;  3S29 A;  4L8O A;  3UJM A;  1C54 A;  2RFR A;  3PCS A;  4FMD A;  4KVH A;  1UI8 A;  2CFK A;  1GY6 A;  3V92 A;  1ZS7 A;  2ML5 A;  4HVN A;  4RNT A;  5BXQ A;  3CMA 3;  1TFO A;  3B8L A;  1JBR A;  3BIR A;  2P0M A;  3TDG A;  3GWR A;  4BTW A;  1Q7Y 4;  1K73 4;  3BB9 A;  3EX9 A;  1IVW A;  1NB3 I;  4HBR A;  4LMI A;  2W0Q A;  3D4A A;  5CK6 A;  4I5Q A;  3RNT A;  3SX1 A;  3Q3F A;  3CNM A;  4GHO A;  4HJL B;  1RMS A;  2XH9 A;  4GB5 A;  4R1K A;  3FF2 A;  1QMA A;  1I8V A;  1W6G A;  3F8H A;  3OW2 2;  3RGA A;  1NU3 A;  3GZR A;  5CXO A;  1I0X A;  1QVF 2;  4DKI A;  3D5I A;  3JUO A;  2OQE A;  3U1W A;  6STD A;  3MYT A;  3LH4 A;  1X1W A;  1DMN A;  5EQL A;  4IT7 A;  4H3U A;  1BNG A;  2CWT A;  3FH1 A;  4HYZ A;  1MWR A;  3MSO A;  3QRD A;  4MJD A;  1U8C B;  2B24 B;  2C11 A;  2F4Y A;  1YGE A;  3CME 3;  2QEX 3;  1N8Q A;  5JPU A;  1Q82 4;  1QAL A;  4EC6 A;  1RGG A;  2CC3 A;  3LZA A;  4K1U A;  2Z77 A;  1JKG B;  2GBX B;  1AY7 A;  3WHO A;  4R4K A;  3N54 B;  1JB2 A;  5G1L A; 
#chains in the Genus database with same CATH homology
 2IUK A;  4RZM A;  2UX0 A;  4XBY A;  3SOY A;  2CWV A;  2INX A;  1J2B A;  4KZ1 A;  1RN7 A;  3F40 A;  1KSI A;  1WMN A;  1G96 A;  2OOV A;  1OPY A;  4QWT A;  1M1K 4;  4XDV A;  4FMA A;  1O7M B;  5EVH A;  2XRX B;  1W2B 2;  3GRD A;  4K61 A;  1NB5 I;  1OF5 A;  1VQ5 3;  1A90 A;  2CHC A;  1UUV B;  3DMC A;  4WFO A;  3UL6 A;  1FGR A;  1YJW 3;  3KSP A;  1GY7 A;  4ZM8 A;  1C7H A;  4O8S A;  2YX9 A;  5I97 A;  3CCJ 3;  4G1M B;  3CPW 2;  5TGN A;  2CG0 A;  3MG2 A;  4MMY B;  1W7C A;  1AR0 A;  3DGM A;  4HZ9 B;  5A0O B;  1FGQ A;  3MHE A;  4XBT A;  3BND A;  3WOD G;  4OVM A;  4N6V 0;  1OGX A;  1ZO2 A;  2CK3 H;  3NQY A;  1IK3 A;  2YFI B;  2W56 A;  2CFG A;  1OAC A;  3LT8 A;  2GBW B;  8CHO A;  5JPP A;  4CCV A;  3LYG A;  2OQE C;  3MWZ A;  2F99 A;  4FMB A;  2W2C A;  4X2O A;  1IQ8 A;  2ZDJ A;  1VQ6 3;  1SII A;  3O8Y A;  3BLZ A;  4RNY A;  4HM3 B;  3X41 A;  5IEP A;  1FA3 A;  3MG1 A;  1S72 3;  3B4P A;  3B7C A;  5AI1 A;  5D83 A;  5ELU A;  4L8P A;  3FKA A;  5STD A;  1KC8 4;  4WYK B;  1KD1 4;  4EV2 A;  3M8C A;  2WO0 A;  1OGZ A;  3VSY A;  3MG3 A;  3NQZ A;  3JUQ A;  4XBX A;  2XF3 A;  4WP5 A;  4MEI A;  2PZV A;  1GY5 A;  4AKY A;  4J9A A;  2GEX A;  2HML B;  5AEU B;  3EBT A;  1TP6 A;  4RNZ A;  1FGO A;  1O7W B;  5AIG A;  3CPO A;  3I0Y A;  3KN4 A;  1TFK A;  3KE7 A;  3NXJ A;  2K0M A;  3GZB A;  1V74 A;  3DUK A;  1GD4 A;  3UB1 A;  1W00 A;  2E2U A;  2RSX A;  4N6N B;  1UI7 A;  2R4I A;  3JVC A;  3WMD A;  2XGL A;  1GYB A;  3FG1 A;  3PCR A;  3S27 A;  4HM6 B;  2OTJ 3;  2PNC A;  3B4O A;  2W04 A;  3LTB A;  2K54 A;  3SED A;  3IMA B;  3BNE A;  3VF1 A;  3RGR A;  1OH0 A;  3CCQ 3;  1HU9 A;  1Q42 A;  5IF6 A;  3NUV A;  4HM4 B;  5JBS A;  3F7X A;  3K63 A;  1N9E A;  3OX9 A;  4TX4 A;  2Z6B A;  2F98 A;  3SXX A;  5AIH A;  4EBG A;  1CYV A;  5LC6 A;  1IVV A;  1YIT 3;  4MMZ B;  1JN5 A;  1AVL A;  4R80 A;  1Q40 A;  3S5C A;  4FMC A;  3JUM A;  5IG5 A;  1DYU A;  1EQK A;  1WNH A;  1VZZ A;  5IEN A;  3WOF B;  2WGO A;  4AKZ A;  3PXM A;  4FCJ A;  3EQQ B;  1RJO A;  1ZX2 A;  2O3O A;  3EBY A;  4H61 A;  3G4S 3;  3ER7 A;  3GZY B;  2WOF A;  3HIG A;  4NHF A;  1PU4 A;  1DMQ A;  1ULJ B;  2ZL8 A;  2P05 A;  1VQN 3;  2JQ5 A;  3OXA A;  3FLJ A;  5KP4 A;  3PYJ A;  4EYC A;  2JDI H;  3CCL 3;  3LTA A;  1YJN 3;  5IEO A;  1UUW B;  2BHM A;  3E99 A;  5CF1 A;  3EB8 A;  3CCE 3;  2FXT A;  3FG4 A;  4GL6 A;  2MC8 A;  1ROV A;  3AMO A;  2QA4 3;  1BUQ A;  2XFT A;  3HX8 A;  2QIY A;  4O2H A;  3IJE B;  2XR8 B;  2GEY A;  2D42 A;  3KZT A;  1TIJ A;  3CD6 3;  1EG9 B;  1W4N A;  2D1W A;  3S28 A;  4NRE A;  1CEW I;  3I56 3;  3DXO A;  1QAF A;  4N6M A;  3FF0 A;  1IQX A;  3G71 3;  3Q2P A;  1JNQ A;  3Q90 A;  4KFD A;  2GU3 A;  3OWY A;  5HGR A;  1VQ8 3;  3GAX A;  1IDP A;  3EE1 A;  5AIF A;  3NBR A;  5AYS C;  3F14 A;  4JRF A;  1EKM A;  1VQO 3;  1IVU A;  1VQM 3;  1VQ7 3;  4XB5 A;  3NM2 A;  3NV0 A;  1QJG A;  4HM0 B;  3QK9 A;  2RCD A;  4HM2 B;  3SLU A;  7STD A;  4HM7 B;  5AEW B;  1W02 A;  1VQ9 3;  1T5Y A;  2BO9 B;  1AVK A;  1IV9 A;  5KP3 A;  1DVD A;  2LQV A;  3G0K A;  3DGL A;  3WOE B;  1VQ4 3;  1N5P A;  1Y4K A;  3EC9 A;  3K7C A;  1D6Z A;  2M7O A;  4LZI A;  3CCU 3;  3HII A;  5AYR B;  3UL5 A;  1SQW A;  3T8N A;  5IW9 A;  1M9G A;  1S5A A;  2CWU A;  1YI2 3;  1U5O A;  2P38 A;  4I4K A;  4FR9 A;  2E2V A;  1UW1 A;  2XSO B;  3STD A;  1M90 4;  1Q81 4;  3NHX A;  2KCD A;  1JB4 A;  3K0Z A;  3HI7 A;  3KKG A;  3CC7 3;  3MPH A;  3F9S A;  4N6T A;  2XEP A;  1MOL A;  4CDL A;  3CU3 A;  3VGN A;  1JKG A;  2HMM B;  3NV0 B;  2F86 B;  3FGY A;  3IPT A;  2CW9 A;  4EXR A;  3G6E 3;  4K1V A;  5FW5 A;  4RBN A;  3X42 A;  3EJV A;  2ML6 A;  1R4C A;  3CCS 3;  1YJ9 3;  2CFL A;  2WOH A;  5IER A;  1IT7 A;  4R9L A;  3CCM 3;  2CKF B;  1KWI A;  3T0U A;  5EEO A;  2HMK B;  4LEH A;  1ULI B;  2Z7A A;  2MF7 A;  3J7Y d;  3CC4 3;  1STD A;  1US1 A;  1IVX A;  3DGN A;  2GU1 A;  1CYU A;  3EHC A;  2BMO B;  1JB5 A;  4BTY A;  1RRL A;  3AMO B;  2W03 A;  4O3V A;  1YVB I;  4BTX A;  1OHP A;  4OK0 A;  1D6U A;  1K28 A;  3JUP A;  2XSH B;  4U13 A;  3X40 A;  3K9M C;  1EA2 A;  3X3Z A;  1SJW A;  1GD3 A;  1YIJ 3;  1O7H B;  2RGQ A;  2FNQ A;  3V98 A;  3CNX A;  1LXE A;  3D9R A;  3SOA A;  1AV4 A;  1W01 A;  3LT9 A;  1NO3 A;  2XFS A;  2IA7 A;  3HZP A;  3FG3 A;  1A2K A;  4HM8 B;  1TU5 A;  1Z1S A;  1SPU A;  3GZX B;  4HZB B;  2OCT A;  3ALA A;  5ELJ A;  2STD A;  2HMN B;  4N6L A;  2WGQ A;  3RDE A;  3SVA A;  3BNC A;  1GS3 A;  1O7G B;  1O7N B;  1ROA A;  2L4V A;  4N3V A;  1NJI 4;  2C10 A;  5IG4 A;  1STF I;  3PGB A;  2BMR B;  1LOX A;  3LOY A;  4HM1 B;  1W5Z A;  4PEJ A;  2OOV C;  2FGT A;  4FCM A;  2W9P A;  2KRT A;  3CCR 3;  2O9U X;  4AEQ A;  1QAK A;  1FGT A;  3FZW A;  4ORL A;  3CXC 2;  4KFE A;  1E3R A;  3PZW A;  5DRV A;  1TUH A;  1OCV A;  3WA2 X;  1W6Y A;  2IMJ A;  3FSD A;  2BT3 A;  2I9W A;  4K90 B;  1K8A 4;  3KSE D;  1K9M 4;  2P09 A;  2QGU A;  4XDW A;  3CCV 3;  4R9K A;  1W6C A;  1PFP A;  4WHA A;  3A76 A;  5IG0 A;  1VQK 3;  2LYX A;  3F8X A;  3ECF A;  2KXG A;  4N6O B;  4J8T A;  1WMO A;  3OWS A;  1IU7 A;  4STD A;  4X2H A;  2B1X B;  5G2G A;  3WDG B;  3NBJ A;  3F7S A;  1A2V A;  3PS8 A;  4Q53 A;  5CLK A;  1A67 A;  1VQP 3;  1O7P B;  3H51 A;  1FGM A;  3JUN A;  3K5T A;  1OUN A;  4WYK A;  1KQS 2;  5D82 A;  3V99 A;  1IV7 A;  2OTL 3;  3KFQ C;  4WWU C;  2YFJ B;  3EF8 A;  3CC2 3;  4FCZ A;  2OWP A;  2BNG A;  3NBB A;  2CG1 A;  1N5H A;  4IIA A;  4N6U A;  3DM8 A;  3X3Y A;  1W2Z A;  1VQL 3;  5IG3 A;  2W9Q A;  2CFD A;  1ISK A;  5FGO A;  5AII A;  1E3V A;  2CIU A;  2Y73 A;  3DGO A;  2GXF A;  3U97 A;  1LNH A;  3DY5 A;  5D81 A;  4MMX B;  1LVN A;  4IPB A;  2BMQ B;  2W56 B;  4OUQ A;  3BNB A;  1L5G B;  3MKI A;  1N9J A;  3OWU A;  1K41 A;  1IQY A;  2SBL A;  4HKV B;  3H3H A;  3LTC A;  1IT8 A;  3HK4 A;  5CF2 A;  3D3L A;  1DVC A;  2CH9 A;  3NX0 A;  1F8N A;  3T8U A;  3UNL A;  1JRQ A;  4O02 B;  5LC7 A;  3NM7 A;  1CQS A;  1WQL B;  2CFW A;  5DRE A;  1N8R 4;  1OHO A;  1MNL A;  4JF8 A;  3LXU X;  1QVG 2;  2V1L A;  3G16 A;  2E2T A;  3OV4 A;  1DMM A;  2XGN A;  2Q07 A;  4LSO A;  3I55 3;  1FUW A;  2Y74 A;  1SIH A;  1Q40 B;  2A15 A;  2HMJ B;  1JN5 B;  3X3X A;  3EN1 B;  2P0X A;  1WMP A;  3FCS B;  3KII A;  1OF5 B;  1HKX A;  3L0R A;  5BVB A;  1NDO B;  1RRH A;  3N8B A;  4L7K A;  4LGQ A;  1WTH A;  2W6J H;  3DZL A;  3N9H A;  1JV2 B;  2Z76 A;  5KP1 A;  3Q1C A;  4XM4 A;  3EN8 A;  1YHQ 3;  3LML A;  1D6Y A;  3WA3 A;  3S67 A;  3LTD A;  1E97 A;  3G8Z A;  4KFF A;  1RKY A;  2IUJ A;  2YFL B;  1Q86 4;  4EV5 A;  1NWW A;  1M1X B;  1JJ2 2;  3ROB A;  2HMO B;  1ASK A;  4HM5 B;  1OHS A;  3S29 A;  4L8O A;  3UJM A;  2RFR A;  3PCS A;  4FMD A;  4KVH A;  1UI8 A;  2CFK A;  1GY6 A;  3V92 A;  2ML5 A;  4HVN A;  5BXQ A;  3CMA 3;  1TFO A;  3B8L A;  2P0M A;  3TDG A;  3GWR A;  4BTW A;  1Q7Y 4;  1K73 4;  3BB9 A;  3EX9 A;  1IVW A;  1NB3 I;  4HBR A;  4LMI A;  2W0Q A;  5CK6 A;  3SX1 A;  4R1K A;  3CNM A;  4HJL B;  4GB5 A;  2XH9 A;  3FF2 A;  1QMA A;  1W6G A;  3F8H A;  3OW2 2;  3RGA A;  1NU3 A;  3GZR A;  5CXO A;  1QVF 2;  6STD A;  3JUO A;  2OQE A;  3U1W A;  3MYT A;  3LH4 A;  1DMN A;  5EQL A;  4IT7 A;  4H3U A;  2CWT A;  3FH1 A;  4HYZ A;  4MJD A;  3MSO A;  3QRD A;  1U8C B;  2B24 B;  2C11 A;  1YGE A;  3CME 3;  2QEX 3;  1N8Q A;  5JPU A;  1Q82 4;  1QAL A;  4EC6 A;  2CC3 A;  3LZA A;  4K1U A;  2Z77 A;  1JKG B;  2GBX B;  4R4K A;  3N54 B;  1JB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...