3K9MC

Cathepsin b in complex with stefin a
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cathepsin B
publication title Stefin A displaces the occluding loop of cathepsin B only by as much as required to bind to the active site cleft
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 98
sequence length 98
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3k9mC00
2BO9B 5ELJA 1KWIA 1FUWA 3KFQC 4N6OB 1ROAA 4N6MA 3QRDA 1A90A 1GD4A 2O9UX 4LZIA 2CH9A 1G96A 1YVBI 1IV9A 1WNHA 4EYCA 3IMAB 1MNLA 2KXGA 3S67A 1RN7A 5LC7A 1CYUA 1A67A 3GAXA 2W9PA 1M9GA 1DVCA 1CEWI 1LXEA 3MWZA 3Q2PA 1IV7A 2W9QA 4ZM8A 3K9MC 1N5HA 5ELUA 5LC6A 1FA3A 5EQLA 1MOLA 5A0OB 3LH4A 2OCTA 1EQKA 1TIJA 4N6LA 3L0RA 3SVAA 4N6NB 1NB5I 1PFPA 4N6UA 1GD3A 3PXMA 1CYVA 3PS8A 1R4CA 1DVDA 4N6TA 1STFI 4CCVA 3KSED 4N6V0 3NX0A 4TX4A 3PYJA 3UL5A 4IT7A 1NB3I 1N5PA 1N9JA 3UL6A
chains in the Genus database with same CATH superfamily
3HX8A 3WMDA 1T3BA 2P0XA 5ELJA 3J7Yd 1VQM3 1BRGA 4KFFA 3K63A 4MMZB 4HM3B 1I0XA 1UUWB 3KFQC 1RCLA 3CCJ3 8CHOA 2E2VA 7GSPA 4O02B 3DUKA 3QRDA 2UGIA 1QAFA 1W5ZA 1A90A 2D1WA 4WYKB 3AHSA 1BRJA 4MEIA 2MC8A 1DMNA 2YFLB 2KRTA 4QWTA 1VZZA 2CH9A 2CWUA 3A76A 1YVBI 3S29A 1YGWA 1IVUA 1IV9A 1W4NA 4XM4A 1X1WA 1X1YA 1WNHA 2KCDA 3X3XA 4EYCA 2Z77A 3CCS3 7RNTA 1VQL3 2YFJB 1GY5A 1RJOA 1W6YA 3S67A 2FXTA 3B7CA 1VQ53 5EEOA 4FCZA 2W2CA 3DH2A 1W02A 4NREA 1SQWA 1BGSA 4K1UA 1B2SA 1GYBA 2CG1A 4R1KA 2AADA 6STDA 1A67A 4BU4A 4HM2B 1I70A 2INXA 4X2OA 4KT3B 3OWUA 1NU3A 2CFWA 2F5MA 2HMLB 2HMMB 3HIIA 2PZVA 1OH0A 1SIIA 3NBBA 4STDA 4I4KA 3NBJA 4XBYA 1IT8A 3BLZA 1EKMA 3GZYB 1BRHA 3E99A 2Q07A 1IV7A 1N9EA 4LGQA 1E97A 4HBRA 1YIT3 2LYXA 1YGEA 5AYRB 5LC6A 3CCV3 5IW9A 2HOHA 4RNZA 1DMMA 1RHLA 1RGLA 1Q9EA 4J5GA 1FA3A 3IJEB 5EQLA 3AHWA 5IEOA 4XBTA 3EF8A 1Q7Y4 1JJ22 1BSCA 2CIUA 2F98A 1YI23 2KAAA 3CCR3 1GSPA 3VF1A 1Y4KA 1A2VA 5AEUB 1KC84 2IUJA 4EV5A 4HZ9B 3MHEA 4K61A 1KD14 1SIHA 5IG0A 1BNRA 1I2GA 2I9WA 1DMQA 5CXOA 1RDSA 3F9SA 1TU5A 3CCE3 4N6LA 1OHSA 1TRQA 1B3SA 1PY3A 4HM4B 3SOYA 1LQMB 2ZDJA 1FGMA 1OUNA 1U8CB 1JB4A 1DE3A 2ML6A 2KF3A 4X2HA 3DMCA 4HM1B 3EB8A 4JF8A 3EX9A 3PXMA 1BNSA 4K1VA 2C11A 3K5TA 2H0IA 1RTUA 4WHAA 1RGCA 3DZLA 3PGBA 2PNCA 3DGOA 1ISKA 5RNTA 1STFI 1MWUA 5CLKA 3CCU3 3X42A 3CME3 1BUQA 4WFOA 1TJDA 1LVNA 4BL3A 3A5EA 1RCKA 2XFSA 2BMRB 3U97A 2Z7AA 3NUVA 4LMIA 3LTAA 3NX0A 1B21A 1Z1SA 3PYJA 1UGIA 3WOEB 1OPYA 2XGLA 1VQ43 1EUIC 3ER7A 4IT7A 3G8ZA 5TGNA 2W04A 3FG4A 1O7GB 4RZMA 2ML5A 4J8TA 2F5WA 3LT8A 1Q814 1W2ZA 1LQGC 2BO9B 2XSHB 1TRPA 3LTCA 5IEPA 3EN8A 1LOWA 1RKYA 1BVIA 1FUWA 4EC6A 1GMPA 1JBSA 1BNGA 3CD63 2XGNA 3V98A 3BNDA 1IQ8A 3MYTA 2OTL3 3CC73 2D42A 4BL2A 1L5GB 6RNTA 2RSXA 3B4PA 3CNXA 1GD4A 3MKIA 1GMQA 2ZHXB 1JBTA 1G0TA 3NHXA 3PZWA 2BMOB 2WOFA 1I0VA 1JV2B 3CCM3 1C54A 2P0MA 3LT9A 4R4KA 1RMSA 1IT7A 3QK9A 1RN7A 1ZO2A 1N8R4 2Z6BA 3N54B 1W01A 1JRQA 3S28A 3ALAA 1RGHA 1JB5A 5JPUA 1M9GA 1RN1A 2WGQA 1Q824 2SARA 2IY2A 4HJLB 3WR2A 4AEQA 4OK0A 4RNYA 1W2B2 1UDII 2F99A 1FUTA 3BIRA 3DGLA 3JUQA 1RSNA 3CC23 2HMKB 4AKYA 1A2KA 1IVXA 2RNTA 3D3LA 2GBXB 3KE7A 1E3VA 1JBRA 1W6GA 2XRXB 3EHCA 4NPBA 2W03A 1FUSA 2IYJA 1BRNL 2B1XB 2OWPA 1US1A 3K9MC 3DXOA 3NQZA 1N5HA 5AIHA 3URPA 5ELUA 5D81A 4MJDA 3NBRA 3LTDA 1BANA 1MWSA 5D83A 2CWTA 4EW5A 2CFGA 1SARA 3F7XA 3OWSA 1QMAA 2C10A 3F8HA 1MOLA 1Q40A 3NQYA 1YJ93 3FG1A 4FMAA 3SEDA 3F7SA 1SJWA 3HI7A 3LH4A 1UI8A 2W0QA 3LTBA 4HVNA 4LYLB 1OF5A 4EXRA 3FZWA 5CK6A 5G2GA 5BIRA 3T8UA 1D6YA 4XDVA 4BTYA 3B8LA 4IIAA 1E3RA 1EQKA 2SBLA 1BRIA 1O7HB 5G1LA 1PU4A 4XB5A 3BNEA 3SVAA 2MF7A 2JDIH 5KP1A 9RNTA 5G1KA 1PFPA 1RN4A 3SYUA 4N6UA 1OF5B 2CG0A 1GOUA 2ZL8A 1AY7A 1BNFA 3CU3A 2CK3H 1R4CA 1IVWA 3FGYA 1ULJB 3GZBA 3PCRA 4BTWA 1DVDA 3F14A 1IQYA 2CX1A 3MG3A 4HZBB 2K54A 1IYYA 2P05A 4WWUC 4XBXA 1VQ63 1EG9B 1I2FA 5IENA 3OXAA 2BHMA 1YVSA 1VQ73 2P38A 1UCKA 4OVMA 5AEWB 3G4S3 4N6V0 3WDGB 4FR9A 3F8XA 3O8YA 3MG1A 3STDA 2OQEC 3KSPA 4BTXA 4I5QA 3OWYA 3LMLA 3UL5A 3FCSB 2CFKA 4MMXB 3PCSA 1HYFA 4HM6B 1I3FA 3Q90A 2IMJA 3WA3A 5IERA 1N5PA 3HIGA 2BNGA 3UL6A 3X40A 4HM7B 3N9HA 2XFTA 4J9AA 1I3IA 1T2IA 1V58A 3G713 3T0UA 3KCHA 1M1K4 1BIRA 3RNTA 4FMCA 1RGAA 2B24B 1ROAA 1RNTA 4N6MA 7STDA 1M904 1NO3A 2F4YA 1MWRA 3EJVA 2XH9A 2Y74A 1W00A 3D4AA 3MPHA 2OTJ3 1T5YA 3DY5A 2O9UX 3DGYA 3LXUX 4LZIA 1VQP3 1A2PA 4KVHA 5KP3A 1BNEA 1G96A 1QJGA 2BU4A 3JUMA 3RDEA 3EBTA 3CXC2 1K9M4 4Q53A 3DGMA 3IMAB 1VQN3 1MNLA 1GY6A 1JKGA 2KXGA 3TDGA 2H0GA 3AGNA 3G6E3 2GXFA 1B2XA 2WO0A 1BU4A 2JQ5A 5LC7A 3UNLA 5M18A 1JN5A 4GSPA 3LOYA 3GAXA 4H61A 2W9PA 2WGOA 3DGNA 4ILFA 1NJI4 5STDA 1DVCA 5BVBA 2YX9A 4WP5A 2WOHA 1CEWI 1STDA 1LXEA 2V1LA 3Q2PA 3VSYA 8RNTA 1Q864 1BNJA 2CFDA 2IA7A 2GEXA 1UCIA 1JKGB 5AIGA 1O7NB 4EBGA 5CF2A 3WA2X 1IVVA 3CC43 1QVF2 4U13A 3EBYA 3GWRA 2GU1A 4HOHA 2OOVC 1B2ZA 2W9QA 1K8A4 1JN5B 4ZM8A 3LYGA 3CCL3 1BSEA 2QIYA 3LZAA 1MWTA 1GS3A 4FCMA 2CWVA 4FMBA 4L8PA 1OGZA 1AVLA 5FGOA 3UJMA 5FW5A 1ASKA 3SX1A 1JB2A 1YIJ3 3EE1A 2FNQA 3JUPA 4CDLA 3GZXB 1RGKA 4HM5B 1AR0A 1AQZA 2BMQB 2K0MA 4EV2A 1WTHA 1JZDA 1B2MA 1UCLA 1S723 1JNQA 2KF5A 1HZ1A 3ECFA 1GMRA 1J2BA 2XF3A 3FLJA 1NNVA 1K734 1WMPA 4N6NB 4H3UA 2GBWB 1LRAA 4G1MB 3T8NA 2CFLA 1YNVX 4FMDA 3JVCA 3MSOA 1NB5I 4J5KA 2OQEA 1FZUA 4GL6A 1ROVA 2BT3A 3H51A 1CYVA 2HMJB 1I2EA 1MGWA 3PS8A 5M19A 2KF4A 2Z76A 1WQLB 1WMNA 1SPUA 3I563 2J8XB 3V92A 5IG3A 1TFKA 1IU7A 3GRDA 3HZPA 1LOYA 4N6TA 2GEYA 1OHPA 2HMOB 3FH1A 1VQQA 3D9RA 3G0KA 2O3OA 4CCVA 3KZTA 3KSED 1FGTA 3CPOA 3I553 1FGRA 4HM0B 1YJN3 1S5AA 6GSPA 2ZA4A 3FSDA 5JPPA 1LOVA 1NDOB 5CF1A 1BOXA 1QALA 3D5GA 3CCQ3 1C7HA 1EEJA 1OGXA 3D5IA 3OV4A 1TUHA 1QVG2 1FGOA 2E2UA 2YFIB 4R80A 2F56A 1Q40B 2A15A 2XEPA 3BU4A 1DYUA 3NM2A 1UUVB 2CW9A 2RGQA 1BUJA 1NB3I 1NWWA 1K28A 5HOHA 2FGTA 3V99A 1BSAA 1CQSA 1O7WB 1RGFA 4LEHA 4O2HA 3AMOA 1KWIA 3Q3FA 1M1XB 3IPTA 2IUKA 1IDPA 2R4IA 5AIIA 5D82A 1AVKA 3S5CA 3ZFZA 2CX0A 3GSPA 1KQS2 4RNTA 2QEX3 1AV4A 1RLSA 1WMOA 1RGGA 4N6OB 5IF6A 2LQVA 3CNMA 1CH0A 3EQQB 3Q1CA 4XDWA 1MGRA 4GHOA 4OUQA 1UUGB 2L4VA 4O3VA 5M1AA 3KKGA 3WHOA 4KZ1A 3WODG 3AGOA 3KIIA 3MG2A 5I97A 3B4OA 2QA43 3F40A 1FW7A 4K90B 2CHCA 1BRSA 3AMOB 3S27A 4BIRA 4AKZA 1BAOA 3ROBA 2UUGC 2OOVA 1VQ83 3N8BA 5KP4A 2KF6A 1GY7A 1UCJA 3JUOA 4HYZA 1X1XA 3H3HA 3DM8A 5AIFA 2XR8B 3M8CA 3SXXA 3WOFB 1K41A 3CPW2 1LNHA 1CYUA 5JBSA 1HKXA 4GB5A 4IPBA 2RFRA 2XSOB 2L1SA 3I0YA 1GOYA 3K7CA 2E2TA 1U5OA 1V57A 2CC3A 3MWZA 3NM7A 1YJW3 1TP6A 4L7KA 5DREA 1VQO3 1D6ZA 3OX9A 3EC9A 1GOVA 4L8OA 4CPKA 1BNIA 3RGRA 1ZS7A 4FCJA 1KSIA 4NHFA 2RCDA 2STDA 2GSPA 3BNCA 2H0HA 3JUNA 2C4BA 3BNBA 1W6CA 3FF0A 1IK3A 1LNIA 5EVHA 1JZOA 2R41A 4RBNA 5A0OB 1ZGXA 5AI1A 2W56A 2AAEA 2OCTA 5IG5A 1UW1A 5HGRA 1LOXA 1PYLA 1OACA 1B2UA 3RGAA 1V74A 1VQ93 3NXJA 3ZG0A 1RRHA 4O8SA 2F86B 3NV0A 1FYSA 1TFOA 1TIJA 1B27A 3BB9A 3UB1A 4KFDA 2K3DA 3G16A 3L0RA 3VGNA 1I8VA 1X1UA 1TTOA 1VQK3 1BRKA 4PEJA 2W56B 4CJNA 1GD3A 1Q7HA 2QGUA 2RBIA 3OW22 1YHQ3 1R4YA 1F8NA 5BU4A 4JRFA 3EN1B 5BXQA 5IG4A 2CKFB 3HOHA 2GU3A 1EA2A 1RRLA 2Y73A 1B20A 3D79A 3KN4A 1RGEA 3NV0B 1DETA 2BIRA 4N3VA 1O7PB 5GSPA 3ZG5A 3X3ZA 3CMA3 2UX0A 1ZX2A 1D6UA 1N8QA 2M7OA 4HKVB 2W6JH 3HK4A 4HM8B 1OHOA 3FF2A 4DKIA 2P09A 4LSOA 3FG3A 1FGQA 1UGHI 1ULIB 1BSDA 5DRVA 4ORLA 3SLUA 3U1WA 3FKAA 4KFEA 3K0ZA 1Q42A 4R9LA 4TX4A 1QAKA 3X3YA 1HU9A 1BSBA 4MMYB 1G02A 1W7CA 4HAAA 1UI7A 4R9KA 4WYKA 1RNBA 1O7MB 1IQXA 1OCVA 3GZRA 3SOAA 2HMNB 5AYSC 1T2HA 1N9JA 3X41A
chains in the Genus database with same CATH topology
3HX8A 3WMDA 2P0XA 5ELJA 3J7Yd 1VQM3 4KFFA 3K63A 4MMZB 4HM3B 1UUWB 3KFQC 3CCJ3 8CHOA 2E2VA 4O02B 3DUKA 3QRDA 1QAFA 1W5ZA 1A90A 2D1WA 4WYKB 4MEIA 2MC8A 1DMNA 2YFLB 2KRTA 4QWTA 1VZZA 2CH9A 2CWUA 3A76A 1YVBI 3S29A 1IVUA 1IV9A 1W4NA 4XM4A 1WNHA 2KCDA 3X3XA 4EYCA 2Z77A 3CCS3 1VQL3 2YFJB 1GY5A 1RJOA 1W6YA 3S67A 2FXTA 3B7CA 1VQ53 5EEOA 4FCZA 2W2CA 2CG1A 1W02A 4NREA 1SQWA 4K1UA 1GYBA 4R1KA 6STDA 1A67A 4HM2B 2INXA 4X2OA 3OWUA 1NU3A 2CFWA 2HMLB 2HMMB 3HIIA 2PZVA 1OH0A 1SIIA 3NBBA 4STDA 4I4KA 3NBJA 4XBYA 1IT8A 3BLZA 1EKMA 3GZYB 3E99A 2Q07A 1IV7A 1N9EA 4LGQA 1E97A 4HBRA 1YIT3 2LYXA 1YGEA 5AYRB 5LC6A 3CCV3 5IW9A 4RNZA 1DMMA 1FA3A 3IJEB 5EQLA 1Q7Y4 5IEOA 4XBTA 3EF8A 1JJ22 2CIUA 2F98A 1YI23 3CCR3 3VF1A 1Y4KA 1A2VA 5AEUB 1KC84 2IUJA 4EV5A 4HZ9B 3MHEA 4K61A 1KD14 1SIHA 5IG0A 2I9WA 1DMQA 5CXOA 3F9SA 1TU5A 3CCE3 4N6LA 1OHSA 4HM4B 3SOYA 2ZDJA 1FGMA 1OUNA 1U8CB 1JB4A 2ML6A 4X2HA 3DMCA 4HM1B 3EB8A 4JF8A 3EX9A 3PXMA 4K1VA 2C11A 3K5TA 4WHAA 3DZLA 1ISKA 3PGBA 2PNCA 3DGOA 1STFI 5CLKA 3CCU3 3X42A 3CME3 4WFOA 1LVNA 2XFSA 3U97A 2BMRB 2Z7AA 3NUVA 4LMIA 3LTAA 3NX0A 1Z1SA 3PYJA 3WOEB 1OPYA 2XGLA 1VQ43 3ER7A 4IT7A 3G8ZA 5TGNA 2W04A 3FG4A 1O7GB 4RZMA 2ML5A 4J8TA 1Q814 3LT8A 1W2ZA 2BO9B 2XSHB 3LTCA 5IEPA 3EN8A 1RKYA 1FUWA 4EC6A 3CD63 2XGNA 3V98A 3BNDA 1IQ8A 3MYTA 2OTL3 3CC73 2D42A 1L5GB 2RSXA 3B4PA 3CNXA 1GD4A 3MKIA 3NHXA 3PZWA 2BMOB 2WOFA 1JV2B 3CCM3 2P0MA 3LT9A 4R4KA 1IT7A 3QK9A 1RN7A 1ZO2A 1N8R4 2Z6BA 3N54B 1W01A 1JRQA 3S28A 3ALAA 1JB5A 5JPUA 1M9GA 2WGQA 1Q824 4HJLB 4AEQA 1W2B2 4OK0A 4RNYA 2F99A 3DGLA 3JUQA 3CC23 2HMKB 4AKYA 1A2KA 1IVXA 3D3LA 2GBXB 3KE7A 1E3VA 1W6GA 2XRXB 3EHCA 2W03A 2B1XB 2OWPA 1US1A 3K9MC 3DXOA 3NQZA 1N5HA 5AIHA 5ELUA 5D81A 4MJDA 3NBRA 3LTDA 5D83A 2CWTA 2CFGA 3F7XA 3OWSA 1QMAA 2C10A 3F8HA 1MOLA 1Q40A 3NQYA 1YJ93 3FG1A 4FMAA 3SEDA 3F7SA 1SJWA 3HI7A 3LH4A 1UI8A 2W0QA 3LTBA 4HVNA 1OF5A 4EXRA 3FZWA 5CK6A 5G2GA 3T8UA 1D6YA 4XDVA 4BTYA 3B8LA 4IIAA 1E3RA 1EQKA 2SBLA 1O7HB 1PU4A 4XB5A 3BNEA 3SVAA 2MF7A 2JDIH 5KP1A 1PFPA 4N6UA 1OF5B 2CG0A 2ZL8A 3CU3A 2CK3H 1R4CA 1IVWA 3FGYA 1ULJB 3GZBA 3PCRA 4BTWA 1DVDA 3F14A 1IQYA 3MG3A 4HZBB 2K54A 2P05A 4WWUC 4XBXA 1VQ63 1EG9B 5IENA 3OXAA 2BHMA 1VQ73 2P38A 5AEWB 4OVMA 3G4S3 4N6V0 3WDGB 4FR9A 3F8XA 3O8YA 3MG1A 3STDA 2OQEC 3KSPA 4BTXA 3OWYA 3LMLA 3UL5A 3FCSB 2CFKA 4MMXB 3PCSA 4HM6B 3Q90A 2IMJA 3WA3A 5IERA 1N5PA 3HIGA 2BNGA 3UL6A 3X40A 4HM7B 3N9HA 2XFTA 4J9AA 3G713 3T0UA 1M1K4 4FMCA 2B24B 1ROAA 4N6MA 1M904 7STDA 1NO3A 3EJVA 2XH9A 2Y74A 1W00A 3MPHA 2OTJ3 1T5YA 3DY5A 2O9UX 3LXUX 4LZIA 1VQP3 4KVHA 5KP3A 1G96A 1QJGA 3JUMA 3RDEA 3EBTA 3CXC2 1K9M4 4Q53A 3DGMA 3IMAB 1VQN3 1MNLA 1GY6A 1JKGA 2KXGA 3TDGA 3G6E3 2GXFA 2WO0A 2JQ5A 5LC7A 3UNLA 1JN5A 3LOYA 3GAXA 4H61A 2W9PA 2WGOA 3DGNA 1NJI4 5STDA 1DVCA 5BVBA 2YX9A 4WP5A 2WOHA 1CEWI 1STDA 1LXEA 2V1LA 3Q2PA 3VSYA 1Q864 2CFDA 2IA7A 2GEXA 5AIGA 1JKGB 4EBGA 1O7NB 5CF2A 3CC43 3WA2X 1IVVA 1QVF2 4U13A 3EBYA 3GWRA 2GU1A 2OOVC 1K8A4 2W9QA 1JN5B 4ZM8A 3LYGA 3CCL3 2QIYA 3LZAA 4FCMA 1GS3A 4FMBA 2CWVA 4L8PA 1OGZA 1AVLA 5FGOA 3UJMA 5FW5A 1ASKA 3SX1A 1JB2A 1YIJ3 3EE1A 2FNQA 3JUPA 4CDLA 3GZXB 4HM5B 1AR0A 2BMQB 2K0MA 4EV2A 1WTHA 1J2BA 1BUQA 1S723 1JNQA 3ECFA 2XF3A 3FLJA 1K734 1WMPA 4N6NB 4H3UA 2GBWB 4G1MB 3T8NA 2CFLA 4FMDA 3JVCA 3MSOA 1NB5I 2OQEA 4GL6A 1ROVA 2BT3A 3H51A 1CYVA 2HMJB 3PS8A 2Z76A 1WQLB 1WMNA 1SPUA 3I563 3V92A 5IG3A 1TFKA 1IU7A 3GRDA 3HZPA 4N6TA 2GEYA 1OHPA 2HMOB 3FH1A 3D9RA 3G0KA 2O3OA 4CCVA 3KZTA 3KSED 1FGTA 3CPOA 3I553 1FGRA 4HM0B 1YJN3 1S5AA 3FSDA 5JPPA 5CF1A 1NDOB 1QALA 3CCQ3 1C7HA 1OGXA 3OV4A 1TUHA 1QVG2 1FGOA 2E2UA 2YFIB 4R80A 1Q40B 2A15A 2XEPA 1DYUA 3NM2A 1UUVB 2CW9A 2RGQA 1NB3I 1NWWA 1K28A 2FGTA 3V99A 1CQSA 1O7WB 4O2HA 4LEHA 3AMOA 1KWIA 1M1XB 3IPTA 2IUKA 1IDPA 2R4IA 5AIIA 5D82A 1AVKA 3S5CA 1KQS2 2QEX3 1AV4A 1WMOA 4N6OB 5IF6A 2LQVA 3CNMA 3Q1CA 3EQQB 4XDWA 4OUQA 2L4VA 4O3VA 3KKGA 3WODG 4KZ1A 3KIIA 3MG2A 5I97A 3B4OA 2QA43 3F40A 4K90B 2CHCA 3AMOB 3S27A 4AKZA 3ROBA 2OOVA 1VQ83 3N8BA 5KP4A 1GY7A 3JUOA 4HYZA 3H3HA 3DM8A 5AIFA 2XR8B 3M8CA 3SXXA 3WOFB 1K41A 3CPW2 1LNHA 1CYUA 5JBSA 1HKXA 4GB5A 4IPBA 2RFRA 2XSOB 3I0YA 3K7CA 2E2TA 1U5OA 3MWZA 2CC3A 1YJW3 3NM7A 1TP6A 4L7KA 5DREA 1VQO3 1D6ZA 3OX9A 3EC9A 4L8OA 3RGRA 4FCJA 1KSIA 4NHFA 2RCDA 2STDA 3BNCA 3JUNA 3FF0A 3BNBA 1W6CA 1IK3A 5EVHA 4RBNA 5A0OB 5AI1A 2W56A 2OCTA 5IG5A 1UW1A 5HGRA 1LOXA 3RGAA 1OACA 1V74A 1VQ93 3NXJA 1RRHA 4O8SA 2F86B 3NV0A 1TFOA 1TIJA 3BB9A 3UB1A 4KFDA 3G16A 3L0RA 3VGNA 1VQK3 4PEJA 2W56B 1GD3A 2QGUA 3OW22 1YHQ3 1F8NA 5BXQA 4JRFA 3EN1B 5IG4A 2CKFB 2GU3A 1EA2A 1RRLA 2Y73A 4N3VA 3NV0B 3KN4A 1O7PB 3X3ZA 3CMA3 2UX0A 1ZX2A 1D6UA 1N8QA 2M7OA 4HKVB 2W6JH 3HK4A 4HM8B 1OHOA 3FF2A 2P09A 4LSOA 3FG3A 1FGQA 1ULIB 5DRVA 4ORLA 3SLUA 3U1WA 3FKAA 4KFEA 3K0ZA 1Q42A 4R9LA 4TX4A 1QAKA 3X3YA 1HU9A 4MMYB 1W7CA 1UI7A 4R9KA 4WYKA 1O7MB 1IQXA 1OCVA 3GZRA 3SOAA 2HMNB 5AYSC 1N9JA 3X41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BO9 B;  5ELJ A;  1KWI A;  1FUW A;  3KFQ C;  4N6O B;  1ROA A;  4N6M A;  3QRD A;  1A90 A;  1GD4 A;  2O9U X;  4LZI A;  2CH9 A;  1G96 A;  1YVB I;  1IV9 A;  1WNH A;  4EYC A;  3IMA B;  1MNL A;  2KXG A;  3S67 A;  1RN7 A;  5LC7 A;  1CYU A;  1A67 A;  3GAX A;  2W9P A;  1M9G A;  1DVC A;  1CEW I;  1LXE A;  3MWZ A;  3Q2P A;  1IV7 A;  2W9Q A;  4ZM8 A;  3K9M C;  1N5H A;  5ELU A;  5LC6 A;  1FA3 A;  5EQL A;  1MOL A;  5A0O B;  3LH4 A;  2OCT A;  1EQK A;  1TIJ A;  4N6L A;  3L0R A;  3SVA A;  4N6N B;  1NB5 I;  1PFP A;  4N6U A;  1GD3 A;  3PXM A;  1CYV A;  3PS8 A;  1R4C A;  1DVD A;  4N6T A;  1STF I;  4CCV A;  3KSE D;  4N6V 0;  3NX0 A;  4TX4 A;  3PYJ A;  3UL5 A;  4IT7 A;  1NB3 I;  1N5P A;  1N9J A;  3UL6 A; 
#chains in the Genus database with same CATH topology
 3HX8 A;  3WMD A;  1T3B A;  2P0X A;  5ELJ A;  3J7Y d;  1VQM 3;  1BRG A;  4KFF A;  3K63 A;  4MMZ B;  4HM3 B;  1I0X A;  1UUW B;  3KFQ C;  1RCL A;  3CCJ 3;  8CHO A;  2E2V A;  7GSP A;  4O02 B;  3DUK A;  3QRD A;  2UGI A;  1QAF A;  1W5Z A;  1A90 A;  2D1W A;  4WYK B;  3AHS A;  1BRJ A;  4MEI A;  2MC8 A;  1DMN A;  2YFL B;  2KRT A;  4QWT A;  1VZZ A;  2CH9 A;  2CWU A;  3A76 A;  1YVB I;  3S29 A;  1YGW A;  1IVU A;  1IV9 A;  1W4N A;  4XM4 A;  1X1W A;  1X1Y A;  1WNH A;  2KCD A;  3X3X A;  4EYC A;  2Z77 A;  3CCS 3;  7RNT A;  1VQL 3;  2YFJ B;  1GY5 A;  1RJO A;  1W6Y A;  3S67 A;  2FXT A;  3B7C A;  1VQ5 3;  5EEO A;  4FCZ A;  2W2C A;  3DH2 A;  1W02 A;  4NRE A;  1SQW A;  1BGS A;  4K1U A;  1B2S A;  1GYB A;  2CG1 A;  4R1K A;  2AAD A;  6STD A;  1A67 A;  4BU4 A;  4HM2 B;  1I70 A;  2INX A;  4X2O A;  4KT3 B;  3OWU A;  1NU3 A;  2CFW A;  2F5M A;  2HML B;  2HMM B;  3HII A;  2PZV A;  1OH0 A;  1SII A;  3NBB A;  4STD A;  4I4K A;  3NBJ A;  4XBY A;  1IT8 A;  3BLZ A;  1EKM A;  3GZY B;  1BRH A;  3E99 A;  2Q07 A;  1IV7 A;  1N9E A;  4LGQ A;  1E97 A;  4HBR A;  1YIT 3;  2LYX A;  1YGE A;  5AYR B;  5LC6 A;  3CCV 3;  5IW9 A;  2HOH A;  4RNZ A;  1DMM A;  1RHL A;  1RGL A;  1Q9E A;  4J5G A;  1FA3 A;  3IJE B;  5EQL A;  3AHW A;  5IEO A;  4XBT A;  3EF8 A;  1Q7Y 4;  1JJ2 2;  1BSC A;  2CIU A;  2F98 A;  1YI2 3;  2KAA A;  3CCR 3;  1GSP A;  3VF1 A;  1Y4K A;  1A2V A;  5AEU B;  1KC8 4;  2IUJ A;  4EV5 A;  4HZ9 B;  3MHE A;  4K61 A;  1KD1 4;  1SIH A;  5IG0 A;  1BNR A;  1I2G A;  2I9W A;  1DMQ A;  5CXO A;  1RDS A;  3F9S A;  1TU5 A;  3CCE 3;  4N6L A;  1OHS A;  1TRQ A;  1B3S A;  1PY3 A;  4HM4 B;  3SOY A;  1LQM B;  2ZDJ A;  1FGM A;  1OUN A;  1U8C B;  1JB4 A;  1DE3 A;  2ML6 A;  2KF3 A;  4X2H A;  3DMC A;  4HM1 B;  3EB8 A;  4JF8 A;  3EX9 A;  3PXM A;  1BNS A;  4K1V A;  2C11 A;  3K5T A;  2H0I A;  1RTU A;  4WHA A;  1RGC A;  3DZL A;  3PGB A;  2PNC A;  3DGO A;  1ISK A;  5RNT A;  1STF I;  1MWU A;  5CLK A;  3CCU 3;  3X42 A;  3CME 3;  1BUQ A;  4WFO A;  1TJD A;  1LVN A;  4BL3 A;  3A5E A;  1RCK A;  2XFS A;  2BMR B;  3U97 A;  2Z7A A;  3NUV A;  4LMI A;  3LTA A;  3NX0 A;  1B21 A;  1Z1S A;  3PYJ A;  1UGI A;  3WOE B;  1OPY A;  2XGL A;  1VQ4 3;  1EUI C;  3ER7 A;  4IT7 A;  3G8Z A;  5TGN A;  2W04 A;  3FG4 A;  1O7G B;  4RZM A;  2ML5 A;  4J8T A;  2F5W A;  3LT8 A;  1Q81 4;  1W2Z A;  1LQG C;  2BO9 B;  2XSH B;  1TRP A;  3LTC A;  5IEP A;  3EN8 A;  1LOW A;  1RKY A;  1BVI A;  1FUW A;  4EC6 A;  1GMP A;  1JBS A;  1BNG A;  3CD6 3;  2XGN A;  3V98 A;  3BND A;  1IQ8 A;  3MYT A;  2OTL 3;  3CC7 3;  2D42 A;  4BL2 A;  1L5G B;  6RNT A;  2RSX A;  3B4P A;  3CNX A;  1GD4 A;  3MKI A;  1GMQ A;  2ZHX B;  1JBT A;  1G0T A;  3NHX A;  3PZW A;  2BMO B;  2WOF A;  1I0V A;  1JV2 B;  3CCM 3;  1C54 A;  2P0M A;  3LT9 A;  4R4K A;  1RMS A;  1IT7 A;  3QK9 A;  1RN7 A;  1ZO2 A;  1N8R 4;  2Z6B A;  3N54 B;  1W01 A;  1JRQ A;  3S28 A;  3ALA A;  1RGH A;  1JB5 A;  5JPU A;  1M9G A;  1RN1 A;  2WGQ A;  1Q82 4;  2SAR A;  2IY2 A;  4HJL B;  3WR2 A;  4AEQ A;  4OK0 A;  4RNY A;  1W2B 2;  1UDI I;  2F99 A;  1FUT A;  3BIR A;  3DGL A;  3JUQ A;  1RSN A;  3CC2 3;  2HMK B;  4AKY A;  1A2K A;  1IVX A;  2RNT A;  3D3L A;  2GBX B;  3KE7 A;  1E3V A;  1JBR A;  1W6G A;  2XRX B;  3EHC A;  4NPB A;  2W03 A;  1FUS A;  2IYJ A;  1BRN L;  2B1X B;  2OWP A;  1US1 A;  3K9M C;  3DXO A;  3NQZ A;  1N5H A;  5AIH A;  3URP A;  5ELU A;  5D81 A;  4MJD A;  3NBR A;  3LTD A;  1BAN A;  1MWS A;  5D83 A;  2CWT A;  4EW5 A;  2CFG A;  1SAR A;  3F7X A;  3OWS A;  1QMA A;  2C10 A;  3F8H A;  1MOL A;  1Q40 A;  3NQY A;  1YJ9 3;  3FG1 A;  4FMA A;  3SED A;  3F7S A;  1SJW A;  3HI7 A;  3LH4 A;  1UI8 A;  2W0Q A;  3LTB A;  4HVN A;  4LYL B;  1OF5 A;  4EXR A;  3FZW A;  5CK6 A;  5G2G A;  5BIR A;  3T8U A;  1D6Y A;  4XDV A;  4BTY A;  3B8L A;  4IIA A;  1E3R A;  1EQK A;  2SBL A;  1BRI A;  1O7H B;  5G1L A;  1PU4 A;  4XB5 A;  3BNE A;  3SVA A;  2MF7 A;  2JDI H;  5KP1 A;  9RNT A;  5G1K A;  1PFP A;  1RN4 A;  3SYU A;  4N6U A;  1OF5 B;  2CG0 A;  1GOU A;  2ZL8 A;  1AY7 A;  1BNF A;  3CU3 A;  2CK3 H;  1R4C A;  1IVW A;  3FGY A;  1ULJ B;  3GZB A;  3PCR A;  4BTW A;  1DVD A;  3F14 A;  1IQY A;  2CX1 A;  3MG3 A;  4HZB B;  2K54 A;  1IYY A;  2P05 A;  4WWU C;  4XBX A;  1VQ6 3;  1EG9 B;  1I2F A;  5IEN A;  3OXA A;  2BHM A;  1YVS A;  1VQ7 3;  2P38 A;  1UCK A;  4OVM A;  5AEW B;  3G4S 3;  4N6V 0;  3WDG B;  4FR9 A;  3F8X A;  3O8Y A;  3MG1 A;  3STD A;  2OQE C;  3KSP A;  4BTX A;  4I5Q A;  3OWY A;  3LML A;  3UL5 A;  3FCS B;  2CFK A;  4MMX B;  3PCS A;  1HYF A;  4HM6 B;  1I3F A;  3Q90 A;  2IMJ A;  3WA3 A;  5IER A;  1N5P A;  3HIG A;  2BNG A;  3UL6 A;  3X40 A;  4HM7 B;  3N9H A;  2XFT A;  4J9A A;  1I3I A;  1T2I A;  1V58 A;  3G71 3;  3T0U A;  3KCH A;  1M1K 4;  1BIR A;  3RNT A;  4FMC A;  1RGA A;  2B24 B;  1ROA A;  1RNT A;  4N6M A;  7STD A;  1M90 4;  1NO3 A;  2F4Y A;  1MWR A;  3EJV A;  2XH9 A;  2Y74 A;  1W00 A;  3D4A A;  3MPH A;  2OTJ 3;  1T5Y A;  3DY5 A;  2O9U X;  3DGY A;  3LXU X;  4LZI A;  1VQP 3;  1A2P A;  4KVH A;  5KP3 A;  1BNE A;  1G96 A;  1QJG A;  2BU4 A;  3JUM A;  3RDE A;  3EBT A;  3CXC 2;  1K9M 4;  4Q53 A;  3DGM A;  3IMA B;  1VQN 3;  1MNL A;  1GY6 A;  1JKG A;  2KXG A;  3TDG A;  2H0G A;  3AGN A;  3G6E 3;  2GXF A;  1B2X A;  2WO0 A;  1BU4 A;  2JQ5 A;  5LC7 A;  3UNL A;  5M18 A;  1JN5 A;  4GSP A;  3LOY A;  3GAX A;  4H61 A;  2W9P A;  2WGO A;  3DGN A;  4ILF A;  1NJI 4;  5STD A;  1DVC A;  5BVB A;  2YX9 A;  4WP5 A;  2WOH A;  1CEW I;  1STD A;  1LXE A;  2V1L A;  3Q2P A;  3VSY A;  8RNT A;  1Q86 4;  1BNJ A;  2CFD A;  2IA7 A;  2GEX A;  1UCI A;  1JKG B;  5AIG A;  1O7N B;  4EBG A;  5CF2 A;  3WA2 X;  1IVV A;  3CC4 3;  1QVF 2;  4U13 A;  3EBY A;  3GWR A;  2GU1 A;  4HOH A;  2OOV C;  1B2Z A;  2W9Q A;  1K8A 4;  1JN5 B;  4ZM8 A;  3LYG A;  3CCL 3;  1BSE A;  2QIY A;  3LZA A;  1MWT A;  1GS3 A;  4FCM A;  2CWV A;  4FMB A;  4L8P A;  1OGZ A;  1AVL A;  5FGO A;  3UJM A;  5FW5 A;  1ASK A;  3SX1 A;  1JB2 A;  1YIJ 3;  3EE1 A;  2FNQ A;  3JUP A;  4CDL A;  3GZX B;  1RGK A;  4HM5 B;  1AR0 A;  1AQZ A;  2BMQ B;  2K0M A;  4EV2 A;  1WTH A;  1JZD A;  1B2M A;  1UCL A;  1S72 3;  1JNQ A;  2KF5 A;  1HZ1 A;  3ECF A;  1GMR A;  1J2B A;  2XF3 A;  3FLJ A;  1NNV A;  1K73 4;  1WMP A;  4N6N B;  4H3U A;  2GBW B;  1LRA A;  4G1M B;  3T8N A;  2CFL A;  1YNV X;  4FMD A;  3JVC A;  3MSO A;  1NB5 I;  4J5K A;  2OQE A;  1FZU A;  4GL6 A;  1ROV A;  2BT3 A;  3H51 A;  1CYV A;  2HMJ B;  1I2E A;  1MGW A;  3PS8 A;  5M19 A;  2KF4 A;  2Z76 A;  1WQL B;  1WMN A;  1SPU A;  3I56 3;  2J8X B;  3V92 A;  5IG3 A;  1TFK A;  1IU7 A;  3GRD A;  3HZP A;  1LOY A;  4N6T A;  2GEY A;  1OHP A;  2HMO B;  3FH1 A;  1VQQ A;  3D9R A;  3G0K A;  2O3O A;  4CCV A;  3KZT A;  3KSE D;  1FGT A;  3CPO A;  3I55 3;  1FGR A;  4HM0 B;  1YJN 3;  1S5A A;  6GSP A;  2ZA4 A;  3FSD A;  5JPP A;  1LOV A;  1NDO B;  5CF1 A;  1BOX A;  1QAL A;  3D5G A;  3CCQ 3;  1C7H A;  1EEJ A;  1OGX A;  3D5I A;  3OV4 A;  1TUH A;  1QVG 2;  1FGO A;  2E2U A;  2YFI B;  4R80 A;  2F56 A;  1Q40 B;  2A15 A;  2XEP A;  3BU4 A;  1DYU A;  3NM2 A;  1UUV B;  2CW9 A;  2RGQ A;  1BUJ A;  1NB3 I;  1NWW A;  1K28 A;  5HOH A;  2FGT A;  3V99 A;  1BSA A;  1CQS A;  1O7W B;  1RGF A;  4LEH A;  4O2H A;  3AMO A;  1KWI A;  3Q3F A;  1M1X B;  3IPT A;  2IUK A;  1IDP A;  2R4I A;  5AII A;  5D82 A;  1AVK A;  3S5C A;  3ZFZ A;  2CX0 A;  3GSP A;  1KQS 2;  4RNT A;  2QEX 3;  1AV4 A;  1RLS A;  1WMO A;  1RGG A;  4N6O B;  5IF6 A;  2LQV A;  3CNM A;  1CH0 A;  3EQQ B;  3Q1C A;  4XDW A;  1MGR A;  4GHO A;  4OUQ A;  1UUG B;  2L4V A;  4O3V A;  5M1A A;  3KKG A;  3WHO A;  4KZ1 A;  3WOD G;  3AGO A;  3KII A;  3MG2 A;  5I97 A;  3B4O A;  2QA4 3;  3F40 A;  1FW7 A;  4K90 B;  2CHC A;  1BRS A;  3AMO B;  3S27 A;  4BIR A;  4AKZ A;  1BAO A;  3ROB A;  2UUG C;  2OOV A;  1VQ8 3;  3N8B A;  5KP4 A;  2KF6 A;  1GY7 A;  1UCJ A;  3JUO A;  4HYZ A;  1X1X A;  3H3H A;  3DM8 A;  5AIF A;  2XR8 B;  3M8C A;  3SXX A;  3WOF B;  1K41 A;  3CPW 2;  1LNH A;  1CYU A;  5JBS A;  1HKX A;  4GB5 A;  4IPB A;  2RFR A;  2XSO B;  2L1S A;  3I0Y A;  1GOY A;  3K7C A;  2E2T A;  1U5O A;  1V57 A;  2CC3 A;  3MWZ A;  3NM7 A;  1YJW 3;  1TP6 A;  4L7K A;  5DRE A;  1VQO 3;  1D6Z A;  3OX9 A;  3EC9 A;  1GOV A;  4L8O A;  4CPK A;  1BNI A;  3RGR A;  1ZS7 A;  4FCJ A;  1KSI A;  4NHF A;  2RCD A;  2STD A;  2GSP A;  3BNC A;  2H0H A;  3JUN A;  2C4B A;  3BNB A;  1W6C A;  3FF0 A;  1IK3 A;  1LNI A;  5EVH A;  1JZO A;  2R41 A;  4RBN A;  5A0O B;  1ZGX A;  5AI1 A;  2W56 A;  2AAE A;  2OCT A;  5IG5 A;  1UW1 A;  5HGR A;  1LOX A;  1PYL A;  1OAC A;  1B2U A;  3RGA A;  1V74 A;  1VQ9 3;  3NXJ A;  3ZG0 A;  1RRH A;  4O8S A;  2F86 B;  3NV0 A;  1FYS A;  1TFO A;  1TIJ A;  1B27 A;  3BB9 A;  3UB1 A;  4KFD A;  2K3D A;  3G16 A;  3L0R A;  3VGN A;  1I8V A;  1X1U A;  1TTO A;  1VQK 3;  1BRK A;  4PEJ A;  2W56 B;  4CJN A;  1GD3 A;  1Q7H A;  2QGU A;  2RBI A;  3OW2 2;  1YHQ 3;  1R4Y A;  1F8N A;  5BU4 A;  4JRF A;  3EN1 B;  5BXQ A;  5IG4 A;  2CKF B;  3HOH A;  2GU3 A;  1EA2 A;  1RRL A;  2Y73 A;  1B20 A;  3D79 A;  3KN4 A;  1RGE A;  3NV0 B;  1DET A;  2BIR A;  4N3V A;  1O7P B;  5GSP A;  3ZG5 A;  3X3Z A;  3CMA 3;  2UX0 A;  1ZX2 A;  1D6U A;  1N8Q A;  2M7O A;  4HKV B;  2W6J H;  3HK4 A;  4HM8 B;  1OHO A;  3FF2 A;  4DKI A;  2P09 A;  4LSO A;  3FG3 A;  1FGQ A;  1UGH I;  1ULI B;  1BSD A;  5DRV A;  4ORL A;  3SLU A;  3U1W A;  3FKA A;  4KFE A;  3K0Z A;  1Q42 A;  4R9L A;  4TX4 A;  1QAK A;  3X3Y A;  1HU9 A;  1BSB A;  4MMY B;  1G02 A;  1W7C A;  4HAA A;  1UI7 A;  4R9K A;  4WYK A;  1RNB A;  1O7M B;  1IQX A;  1OCV A;  3GZR A;  3SOA A;  2HMN B;  5AYS C;  1T2H A;  1N9J A;  3X41 A; 
#chains in the Genus database with same CATH homology
 3HX8 A;  3WMD A;  2P0X A;  5ELJ A;  3J7Y d;  1VQM 3;  4KFF A;  3K63 A;  4MMZ B;  4HM3 B;  1UUW B;  3KFQ C;  3CCJ 3;  8CHO A;  2E2V A;  4O02 B;  3DUK A;  3QRD A;  1QAF A;  1W5Z A;  1A90 A;  2D1W A;  4WYK B;  4MEI A;  2MC8 A;  1DMN A;  2YFL B;  2KRT A;  4QWT A;  1VZZ A;  2CH9 A;  2CWU A;  3A76 A;  1YVB I;  3S29 A;  1IVU A;  1IV9 A;  1W4N A;  4XM4 A;  1WNH A;  2KCD A;  3X3X A;  4EYC A;  2Z77 A;  3CCS 3;  1VQL 3;  2YFJ B;  1GY5 A;  1RJO A;  1W6Y A;  3S67 A;  2FXT A;  3B7C A;  1VQ5 3;  5EEO A;  4FCZ A;  2W2C A;  2CG1 A;  1W02 A;  4NRE A;  1SQW A;  4K1U A;  1GYB A;  4R1K A;  6STD A;  1A67 A;  4HM2 B;  2INX A;  4X2O A;  3OWU A;  1NU3 A;  2CFW A;  2HML B;  2HMM B;  3HII A;  2PZV A;  1OH0 A;  1SII A;  3NBB A;  4STD A;  4I4K A;  3NBJ A;  4XBY A;  1IT8 A;  3BLZ A;  1EKM A;  3GZY B;  3E99 A;  2Q07 A;  1IV7 A;  1N9E A;  4LGQ A;  1E97 A;  4HBR A;  1YIT 3;  2LYX A;  1YGE A;  5AYR B;  5LC6 A;  3CCV 3;  5IW9 A;  4RNZ A;  1DMM A;  1FA3 A;  3IJE B;  5EQL A;  1Q7Y 4;  5IEO A;  4XBT A;  3EF8 A;  1JJ2 2;  2CIU A;  2F98 A;  1YI2 3;  3CCR 3;  3VF1 A;  1Y4K A;  1A2V A;  5AEU B;  1KC8 4;  2IUJ A;  4EV5 A;  4HZ9 B;  3MHE A;  4K61 A;  1KD1 4;  1SIH A;  5IG0 A;  2I9W A;  1DMQ A;  5CXO A;  3F9S A;  1TU5 A;  3CCE 3;  4N6L A;  1OHS A;  4HM4 B;  3SOY A;  2ZDJ A;  1FGM A;  1OUN A;  1U8C B;  1JB4 A;  2ML6 A;  4X2H A;  3DMC A;  4HM1 B;  3EB8 A;  4JF8 A;  3EX9 A;  3PXM A;  4K1V A;  2C11 A;  3K5T A;  4WHA A;  3DZL A;  1ISK A;  3PGB A;  2PNC A;  3DGO A;  1STF I;  5CLK A;  3CCU 3;  3X42 A;  3CME 3;  4WFO A;  1LVN A;  2XFS A;  3U97 A;  2BMR B;  2Z7A A;  3NUV A;  4LMI A;  3LTA A;  3NX0 A;  1Z1S A;  3PYJ A;  3WOE B;  1OPY A;  2XGL A;  1VQ4 3;  3ER7 A;  4IT7 A;  3G8Z A;  5TGN A;  2W04 A;  3FG4 A;  1O7G B;  4RZM A;  2ML5 A;  4J8T A;  1Q81 4;  3LT8 A;  1W2Z A;  2BO9 B;  2XSH B;  3LTC A;  5IEP A;  3EN8 A;  1RKY A;  1FUW A;  4EC6 A;  3CD6 3;  2XGN A;  3V98 A;  3BND A;  1IQ8 A;  3MYT A;  2OTL 3;  3CC7 3;  2D42 A;  1L5G B;  2RSX A;  3B4P A;  3CNX A;  1GD4 A;  3MKI A;  3NHX A;  3PZW A;  2BMO B;  2WOF A;  1JV2 B;  3CCM 3;  2P0M A;  3LT9 A;  4R4K A;  1IT7 A;  3QK9 A;  1RN7 A;  1ZO2 A;  1N8R 4;  2Z6B A;  3N54 B;  1W01 A;  1JRQ A;  3S28 A;  3ALA A;  1JB5 A;  5JPU A;  1M9G A;  2WGQ A;  1Q82 4;  4HJL B;  4AEQ A;  1W2B 2;  4OK0 A;  4RNY A;  2F99 A;  3DGL A;  3JUQ A;  3CC2 3;  2HMK B;  4AKY A;  1A2K A;  1IVX A;  3D3L A;  2GBX B;  3KE7 A;  1E3V A;  1W6G A;  2XRX B;  3EHC A;  2W03 A;  2B1X B;  2OWP A;  1US1 A;  3K9M C;  3DXO A;  3NQZ A;  1N5H A;  5AIH A;  5ELU A;  5D81 A;  4MJD A;  3NBR A;  3LTD A;  5D83 A;  2CWT A;  2CFG A;  3F7X A;  3OWS A;  1QMA A;  2C10 A;  3F8H A;  1MOL A;  1Q40 A;  3NQY A;  1YJ9 3;  3FG1 A;  4FMA A;  3SED A;  3F7S A;  1SJW A;  3HI7 A;  3LH4 A;  1UI8 A;  2W0Q A;  3LTB A;  4HVN A;  1OF5 A;  4EXR A;  3FZW A;  5CK6 A;  5G2G A;  3T8U A;  1D6Y A;  4XDV A;  4BTY A;  3B8L A;  4IIA A;  1E3R A;  1EQK A;  2SBL A;  1O7H B;  1PU4 A;  4XB5 A;  3BNE A;  3SVA A;  2MF7 A;  2JDI H;  5KP1 A;  1PFP A;  4N6U A;  1OF5 B;  2CG0 A;  2ZL8 A;  3CU3 A;  2CK3 H;  1R4C A;  1IVW A;  3FGY A;  1ULJ B;  3GZB A;  3PCR A;  4BTW A;  1DVD A;  3F14 A;  1IQY A;  3MG3 A;  4HZB B;  2K54 A;  2P05 A;  4WWU C;  4XBX A;  1VQ6 3;  1EG9 B;  5IEN A;  3OXA A;  2BHM A;  1VQ7 3;  2P38 A;  5AEW B;  4OVM A;  3G4S 3;  4N6V 0;  3WDG B;  4FR9 A;  3F8X A;  3O8Y A;  3MG1 A;  3STD A;  2OQE C;  3KSP A;  4BTX A;  3OWY A;  3LML A;  3UL5 A;  3FCS B;  2CFK A;  4MMX B;  3PCS A;  4HM6 B;  3Q90 A;  2IMJ A;  3WA3 A;  5IER A;  1N5P A;  3HIG A;  2BNG A;  3UL6 A;  3X40 A;  4HM7 B;  3N9H A;  2XFT A;  4J9A A;  3G71 3;  3T0U A;  1M1K 4;  4FMC A;  2B24 B;  1ROA A;  4N6M A;  1M90 4;  7STD A;  1NO3 A;  3EJV A;  2XH9 A;  2Y74 A;  1W00 A;  3MPH A;  2OTJ 3;  1T5Y A;  3DY5 A;  2O9U X;  3LXU X;  4LZI A;  1VQP 3;  4KVH A;  5KP3 A;  1G96 A;  1QJG A;  3JUM A;  3RDE A;  3EBT A;  3CXC 2;  1K9M 4;  4Q53 A;  3DGM A;  3IMA B;  1VQN 3;  1MNL A;  1GY6 A;  1JKG A;  2KXG A;  3TDG A;  3G6E 3;  2GXF A;  2WO0 A;  2JQ5 A;  5LC7 A;  3UNL A;  1JN5 A;  3LOY A;  3GAX A;  4H61 A;  2W9P A;  2WGO A;  3DGN A;  1NJI 4;  5STD A;  1DVC A;  5BVB A;  2YX9 A;  4WP5 A;  2WOH A;  1CEW I;  1STD A;  1LXE A;  2V1L A;  3Q2P A;  3VSY A;  1Q86 4;  2CFD A;  2IA7 A;  2GEX A;  5AIG A;  1JKG B;  4EBG A;  1O7N B;  5CF2 A;  3CC4 3;  3WA2 X;  1IVV A;  1QVF 2;  4U13 A;  3EBY A;  3GWR A;  2GU1 A;  2OOV C;  1K8A 4;  2W9Q A;  1JN5 B;  4ZM8 A;  3LYG A;  3CCL 3;  2QIY A;  3LZA A;  4FCM A;  1GS3 A;  4FMB A;  2CWV A;  4L8P A;  1OGZ A;  1AVL A;  5FGO A;  3UJM A;  5FW5 A;  1ASK A;  3SX1 A;  1JB2 A;  1YIJ 3;  3EE1 A;  2FNQ A;  3JUP A;  4CDL A;  3GZX B;  4HM5 B;  1AR0 A;  2BMQ B;  2K0M A;  4EV2 A;  1WTH A;  1J2B A;  1BUQ A;  1S72 3;  1JNQ A;  3ECF A;  2XF3 A;  3FLJ A;  1K73 4;  1WMP A;  4N6N B;  4H3U A;  2GBW B;  4G1M B;  3T8N A;  2CFL A;  4FMD A;  3JVC A;  3MSO A;  1NB5 I;  2OQE A;  4GL6 A;  1ROV A;  2BT3 A;  3H51 A;  1CYV A;  2HMJ B;  3PS8 A;  2Z76 A;  1WQL B;  1WMN A;  1SPU A;  3I56 3;  3V92 A;  5IG3 A;  1TFK A;  1IU7 A;  3GRD A;  3HZP A;  4N6T A;  2GEY A;  1OHP A;  2HMO B;  3FH1 A;  3D9R A;  3G0K A;  2O3O A;  4CCV A;  3KZT A;  3KSE D;  1FGT A;  3CPO A;  3I55 3;  1FGR A;  4HM0 B;  1YJN 3;  1S5A A;  3FSD A;  5JPP A;  5CF1 A;  1NDO B;  1QAL A;  3CCQ 3;  1C7H A;  1OGX A;  3OV4 A;  1TUH A;  1QVG 2;  1FGO A;  2E2U A;  2YFI B;  4R80 A;  1Q40 B;  2A15 A;  2XEP A;  1DYU A;  3NM2 A;  1UUV B;  2CW9 A;  2RGQ A;  1NB3 I;  1NWW A;  1K28 A;  2FGT A;  3V99 A;  1CQS A;  1O7W B;  4O2H A;  4LEH A;  3AMO A;  1KWI A;  1M1X B;  3IPT A;  2IUK A;  1IDP A;  2R4I A;  5AII A;  5D82 A;  1AVK A;  3S5C A;  1KQS 2;  2QEX 3;  1AV4 A;  1WMO A;  4N6O B;  5IF6 A;  2LQV A;  3CNM A;  3Q1C A;  3EQQ B;  4XDW A;  4OUQ A;  2L4V A;  4O3V A;  3KKG A;  3WOD G;  4KZ1 A;  3KII A;  3MG2 A;  5I97 A;  3B4O A;  2QA4 3;  3F40 A;  4K90 B;  2CHC A;  3AMO B;  3S27 A;  4AKZ A;  3ROB A;  2OOV A;  1VQ8 3;  3N8B A;  5KP4 A;  1GY7 A;  3JUO A;  4HYZ A;  3H3H A;  3DM8 A;  5AIF A;  2XR8 B;  3M8C A;  3SXX A;  3WOF B;  1K41 A;  3CPW 2;  1LNH A;  1CYU A;  5JBS A;  1HKX A;  4GB5 A;  4IPB A;  2RFR A;  2XSO B;  3I0Y A;  3K7C A;  2E2T A;  1U5O A;  3MWZ A;  2CC3 A;  1YJW 3;  3NM7 A;  1TP6 A;  4L7K A;  5DRE A;  1VQO 3;  1D6Z A;  3OX9 A;  3EC9 A;  4L8O A;  3RGR A;  4FCJ A;  1KSI A;  4NHF A;  2RCD A;  2STD A;  3BNC A;  3JUN A;  3FF0 A;  3BNB A;  1W6C A;  1IK3 A;  5EVH A;  4RBN A;  5A0O B;  5AI1 A;  2W56 A;  2OCT A;  5IG5 A;  1UW1 A;  5HGR A;  1LOX A;  3RGA A;  1OAC A;  1V74 A;  1VQ9 3;  3NXJ A;  1RRH A;  4O8S A;  2F86 B;  3NV0 A;  1TFO A;  1TIJ A;  3BB9 A;  3UB1 A;  4KFD A;  3G16 A;  3L0R A;  3VGN A;  1VQK 3;  4PEJ A;  2W56 B;  1GD3 A;  2QGU A;  3OW2 2;  1YHQ 3;  1F8N A;  5BXQ A;  4JRF A;  3EN1 B;  5IG4 A;  2CKF B;  2GU3 A;  1EA2 A;  1RRL A;  2Y73 A;  4N3V A;  3NV0 B;  3KN4 A;  1O7P B;  3X3Z A;  3CMA 3;  2UX0 A;  1ZX2 A;  1D6U A;  1N8Q A;  2M7O A;  4HKV B;  2W6J H;  3HK4 A;  4HM8 B;  1OHO A;  3FF2 A;  2P09 A;  4LSO A;  3FG3 A;  1FGQ A;  1ULI B;  5DRV A;  4ORL A;  3SLU A;  3U1W A;  3FKA A;  4KFE A;  3K0Z A;  1Q42 A;  4R9L A;  4TX4 A;  1QAK A;  3X3Y A;  1HU9 A;  4MMY B;  1W7C A;  1UI7 A;  4R9K A;  4WYK A;  1O7M B;  1IQX A;  1OCV A;  3GZR A;  3SOA A;  2HMN B;  5AYS C;  1N9J A;  3X41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...