3UJMA

Crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rasputin
publication title Crystal structure of the Rasputin NTF2-like domain from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ujmA00
4HM6B 3GZXB 4XDWA 5IF6A 2B1XB 3B4OA 5EVHA 2UX0A 5D81A 1O7MB 5TGNA 2HMMB 1VZZA 1UUVB 1BUQA 1OHSA 2CHCA 2B24B 5IEPA 1A2KA 3FGYA 3SOAA 4ORLA 1CQSA 1JN5A 3GRDA 5AIFA 3MG1A 3DUKA 1DMQA 3M8CA 3NM2A 3D9RA 1E97A 4J9AA 3K7CA 2BNGA 3GZBA 4R1KA 3SOYA 5AI1A 1STDA 2F99A 1JKGA 1TP6A 5D82A 3JUOA 3EBYA 4PEJA 1IDPA 1Z1SA 5AIGA 4HJLB 1NU3A 3KKGA 3CU3A 3OWSA 1K41A 2IMJA 2F98A 4XM4A 3JUMA 2Z76A 3HX8A 3VSYA 3F9SA 3B7CA 1O7NB 1UUWB 5KP3A 4FCJA 3B4PA 5AIIA 2RGQA 3UJMA 1Q40B 5FW5A 4HVNA 4L8OA 3NUVA 3NHXA 4HKVB 3BB9A 4FCMA 4STDA 1SJWA 2BMRB 2GBXB 2HMJB 3B8LA 1JB2A 5JPUA 2STDA 1GY7A 4OUQA 4HM2B 3F40A 3KE7A 5IENA 3BLZA 4Q53A 2I9WA 1ASKA 2XSOB 3HZPA 3FZWA 4LGQA 3DZLA 3DM8A 3EHCA 2JQ5A 1OUNA 5DREA 4WWUC 2GEYA 2QGUA 5KP4A 5D83A 1ZX2A 3KSPA 4OVMA 5G2GA 3H51A 3NV0A 5IERA 4HZ9B 1W00A 2HMOB 2QIYA 5HGRA 3ECFA 3CPOA 1QJGA 2RCDA 1JN5B 3FH1A 1GS3A 3JUNA 1DMNA 3GZYB 3JUQA 3G8ZA 1WQLB 5IEOA 1TUHA 4L7KA 5AIHA 4XB5A 4LEHA 3SEDA 4X2OA 1JKGB 4GB5A 3STDA 3EF8A 2CKFB 2PZVA 2HMNB 4LMIA 5KP1A 1JB4A 4L8PA 4MJDA 4J8TA 2A15A 2YFJB 2Z77A 3F14A 5IG5A 1ULIB 3FF2A 1GYBA 2YFIB 1EG9B 4HM3B 2W2CA 5CF2A 2HMLB 5BVBA 1OPYA 1W01A 3MYTA 2Z7AA 2R4IA 1O7WB 3H3HA 4HZBB 1Q42A 4U13A 3EQQB 3FF0A 4XBYA 4N3VA 1ULJB 3HK4A 3I0YA 4WYKA 1OF5A 3G16A 4K1UA 3JUPA 2RFRA 3DXOA 5IG4A 5DRVA 3A76A 3EN8A 2XRXB 4HM8B 3EX9A 3GZRA 3LZAA 1NDOB 1JB5A 1U5OA 5CLKA 3IPTA 3EBTA 3OXAA 5AEUB 2F86B 1QMAA 3G0KA 2BMOB 1OHOA 3F7SA 1GY5A 4H3UA 3RGRA 4HM7B 5STDA 1W6YA 1E3RA 1OCVA 3MSOA 4R9LA 3ROBA 2XR8B 3MG2A 7STDA 3UNLA 4KVHA 4RZMA 4HM4B 5BXQA 3NBRA 3MKIA 3RGAA 4IIAA 3F8HA 4R9KA 3FLJA 1O7HB 3F8XA 3LYGA 5IG3A 2OWPA 1S5AA 3OWUA 3ER7A 3DMCA 3MG3A 2INXA 2XSHB 5AEWB 3EJVA 1E3VA 1OGXA 1O7GB 4XBTA 2YFLB 3S5CA 4I4KA 3MHEA 2HMKB 5IG0A 8CHOA 1W02A 3CNXA 3F7XA 1OHPA 4K1VA 1AR0A 1GY6A 3T8UA 1OH0A 1HKXA 3WMDA 3FKAA 1EA2A 3VGNA 1ISKA 2GBWB 3NXJA 4HM5B 1Q40A 3FSDA 4WYKB 5CXOA 3K0ZA 3CNMA 3EN1B 5CK6A 1OF5B 3EC9A 3OWYA 3T8NA 3GWRA 6STDA 2BMQB 1ZO2A 4WP5A 1C7HA 1DMMA 3OV4A 3Q90A 3E99A 4HM1B 4CDLA 2K54A 5CF1A 1O7PB 4XBXA 4XDVA 1OGZA 3KZTA 4HM0B 2GXFA 3OX9A 2GEXA 1NWWA 3NV0B 5JPPA 4X2HA
chains in the Genus database with same CATH superfamily
1JBRA 4HM6B 4O2HA 1RN4A 1JZDA 1W5ZA 2IUKA 3GZXB 1HU9A 3Q3FA 4XDWA 5IF6A 6RNTA 3LTDA 1R4CA 4G1MB 1YIT3 1SPUA 2B1XB 3B4OA 5EVHA 4BIRA 3CCE3 3X42A 1UCKA 3IJEB 1T2HA 4JF8A 1BNJA 3VF1A 2XEPA 2UX0A 1W2ZA 1O7MB 5D81A 2HMMB 3LOYA 4KFEA 5TGNA 1VZZA 4H61A 1OACA 1UUVB 1BRJA 1OHSA 2CHCA 3FG4A 2B24B 3GSPA 3LTAA 5EEOA 5IEPA 1N8R4 1BRNL 1A2KA 1EUIC 1VQ53 2F56A 1BSDA 3FGYA 3SOAA 3UL5A 2RBIA 4ORLA 1CQSA 1JN5A 1RHLA 3GRDA 4ILFA 5AIFA 3MG1A 2O9UX 1VQO3 3DUKA 1DMQA 3KCHA 3M8CA 3NM2A 1EEJA 2E2TA 3D9RA 3CMA3 3X40A 1IU7A 1E97A 4J9AA 1MWTA 3L0RA 1LNHA 2BNGA 3K7CA 1A67A 1WMOA 3GZBA 4R1KA 1GOVA 3SOYA 5AI1A 1STDA 2F99A 3SXXA 1FUWA 1JKGA 1TP6A 5D82A 5FGOA 1RJOA 3JUOA 4NPBA 4K61A 1WMNA 4JRFA 2KF5A 3EBYA 3QRDA 1IDPA 4PEJA 1Z1SA 4WHAA 5AIGA 1VQ93 3A5EA 3K5TA 1W6CA 4HJLB 3CD63 3AMOA 1NU3A 3KKGA 4AKYA 1JJ22 1DVCA 1IVWA 3CU3A 3RNTA 3T0UA 3OWSA 4AKZA 1VQ63 4EW5A 1BIRA 1K41A 2IMJA 3UB1A 2F98A 3PS8A 4XM4A 3JUMA 2KF6A 3N54B 5JBSA 1KWIA 2Z76A 2BU4A 3JVCA 4N6TA 1AY7A 3HX8A 3VSYA 3F9SA 3CPW2 2QA43 1NJI4 3B7CA 1B20A 2IUJA 2ML6A 1RGLA 5AYSC 1O7NB 1VQQA 2P09A 1IQXA 1RGAA 1UUWB 5KP3A 3BNDA 1TJDA 1A2VA 4FCJA 1TFKA 1W7CA 3AGNA 1PY3A 1SIHA 1BRGA 1T5YA 1ROVA 2SARA 3B4PA 3CCQ3 5AIIA 2RGQA 1N9EA 3PGBA 3UJMA 3CC73 4GHOA 1BU4A 3DGNA 1Q40B 5FW5A 4HVNA 2LQVA 1BNSA 1IT8A 1DETA 3DH2A 4MMYB 1VQP3 1MNLA 1YJW3 1US1A 1M1K4 1D6YA 4EBGA 1MGWA 2CWTA 1MWUA 2YX9A 4N6NB 4L8OA 1I2GA 3NUVA 4EXRA 1M1XB 2D1WA 3OW22 1EQKA 2D42A 2BHMA 1S723 1IVUA 1IK3A 1W4NA 3CXC2 4BL3A 1LVNA 5AYRB 1EKMA 3NHXA 1RTUA 1X1YA 3AHWA 1QVF2 1JZOA 2CX1A 3BB9A 4FCMA 4HKVB 4STDA 1SJWA 1I0XA 1WMPA 2BMRB 2GBXB 2HMJB 3LXUX 2QEX3 1BUQA 4FMDA 2OQEC 3B8LA 1I70A 2HOHA 1QALA 1JB2A 1FA3A 3S28A 5JPUA 2STDA 1BRHA 1GY7A 1YVBI 3EE1A 3NX0A 3F40A 4HM2B 1LOVA 1JV2B 3KE7A 4LSOA 2F5WA 4OUQA 1CEWI 5IENA 1IVVA 1TRQA 1V74A 2Z6BA 1W6GA 3LTBA 3PXMA 4FMCA 3BLZA 1PU4A 1VQK3 1RSNA 3DGLA 3LTCA 4Q53A 4J5KA 1X1UA 2I9WA 1TU5A 4O02B 1ASKA 2W9QA 2ZDJA 3DY5A 1RMSA 2XSOB 3HZPA 3CCJ3 2OTJ3 3PZWA 1QAFA 3FZWA 1BUJA 1B2ZA 2PNCA 1PYLA 3QK9A 4LGQA 3DZLA 3DM8A 2XFTA 1VQ73 1Q7HA 3EHCA 1RN1A 1RN7A 1A90A 3WOFB 2JQ5A 1BGSA 1OUNA 5DREA 4WWUC 1AV4A 3WR2A 2GEYA 3I553 2QGUA 5KP4A 1LRAA 1BSEA 3Q1CA 2MF7A 1T3BA 3HOHA 1FUSA 2GU3A 3LH4A 5D83A 4RNYA 3J7Yd 1ZX2A 2AAEA 3PCRA 1GOYA 4J5GA 4O8SA 1G02A 1NNVA 3KSPA 4OVMA 1Q814 2OQEA 5G2GA 5M1AA 3H51A 3WA3A 3DGMA 2ZL8A 3NV0A 2CIUA 4FCZA 1B21A 5IERA 1GMPA 4HZ9B 2K0MA 4GL6A 1D6UA 1W00A 1DYUA 2HMOB 2UGIA 3N8BA 4MMZB 2QIYA 2L4VA 5HGRA 1CYVA 1FW7A 4R4KA 2P0MA 3ZG5A 2OTL3 3ECFA 3CPOA 4CPKA 1QJGA 1K28A 2RCDA 1RGEA 1YGEA 4EC6A 1HZ1A 2F4YA 1UCJA 1JN5B 3NQZA 3FG3A 4DKIA 1JRQA 5I97A 3FH1A 1YIJ3 1UGIA 1GS3A 1NB3I 3JUNA 1B3SA 1DMNA 2KAAA 3GZYB 3BIRA 3JUQA 3G8ZA 1WQLB 2W6JH 5IEOA 1TUHA 1YI23 2OOVC 3DGYA 4RBNA 5M19A 4L7KA 4GSPA 1FUTA 1GMRA 1I2EA 2CFGA 2SBLA 4KFDA 4XB5A 4LEHA 5AIHA 3SEDA 3WHOA 1FGOA 5IW9A 1B2XA 1BVIA 1JNQA 2GU1A 4X2OA 1Q7Y4 1JKGB 3HIIA 4GB5A 1W2B2 1KD14 3STDA 2IY2A 3EF8A 1K8A4 2V1LA 4RNTA 1X1WA 3D79A 5A0OB 3MPHA 3X41A 1L5GB 1SQWA 4RNZA 2CKFB 2PZVA 2HMNB 5RNTA 2M7OA 4LMIA 3AGOA 5KP1A 1JB4A 4L8PA 4MJDA 4KT3B 1TRPA 2H0HA 2WOFA 3G6E3 4K90B 3CCR3 3LT9A 1IT7A 1TFOA 4J8TA 2KXGA 1RDSA 2A15A 1FGTA 2YFJB 2Z77A 2CFDA 5LC7A 3F14A 1HYFA 4EV5A 1JBSA 1I2FA 5IG5A 3CC43 3BNCA 1ULIB 2H0GA 1U8CB 1RKYA 1RCKA 2OCTA 1BSCA 1T2IA 2KF4A 1GYBA 1LOYA 2E2VA 1BRKA 2XGNA 1LOXA 1EG9B 2YFIB 1M904 4HM3B 5G1KA 2W2CA 5CF2A 1F8NA 2HMLB 1TIJA 4LYLB 1OPYA 5BVBA 1B2UA 1W01A 1KC84 3MYTA 2Z7AA 1UI8A 3WODG 2R4IA 1O7WB 2UUGC 3D5GA 1BRIA 3H3HA 1BOXA 4HAAA 2F5MA 2GSPA 3GAXA 3X3ZA 4HZBB 1Q42A 4CCVA 2Y74A 2IYJA 3BNEA 1DE3A 1QAKA 4U13A 3IMAB 3EQQB 4FR9A 2K3DA 3FF0A 3FG1A 4XBYA 3KN4A 1ULJB 4N3VA 3HK4A 3I0YA 1NB5I 4O3VA 1NO3A 1BAOA 1IV9A 4WYKA 3AHSA 1OF5A 3G16A 4K1UA 4AEQA 3JUPA 1UI7A 3Q2PA 3NBJA 1RRHA 3U97A 2RFRA 1VQL3 1UW1A 3DXOA 3LMLA 1KQS2 4KFFA 4NREA 2KCDA 2RNTA 5IG4A 5DRVA 1FGMA 2ZA4A 2CFLA 1B2SA 3A76A 5HOHA 3EN8A 1GD4A 2WGQA 2XRXB 5BIRA 1Q9EA 2W04A 1I0VA 2CK3H 4HM8B 3K9MC 3EX9A 3GZRA 3LZAA 1NDOB 3CCS3 1JB5A 3CCU3 1I8VA 4BTWA 1U5OA 2CWVA 4WFOA 1LQMB 2W9PA 4MMXB 2LYXA 5CLKA 2XGLA 3IPTA 3EBTA 3OXAA 1G0TA 5AEUB 2F86B 3CME3 1QMAA 4FMBA 3G0KA 2BMOB 1OHOA 3F7SA 1RNBA 2CG0A 1GY5A 4H3UA 1LOWA 1AVKA 4EYCA 1LQGC 1J2BA 3DGOA 4N6OB 3RGRA 1IVXA 4HM7B 5STDA 1YJ93 1W6YA 1E3RA 1OCVA 2W56A 3V98A 4N6LA 2AADA 3MSOA 4R9LA 4R80A 5GSPA 3ROBA 1STFI 1DVDA 2BT3A 3D3LA 2XR8B 3MG2A 1BSBA 7STDA 1B2MA 2BIRA 3URPA 2KF3A 1IYYA 3UNLA 4KVHA 3O8YA 1B27A 4HM4B 4RZMA 5G1LA 1AQZA 2C11A 4BTYA 7GSPA 5BXQA 1YHQ3 1I3IA 1GD3A 2FGTA 4OK0A 3S27A 1BNGA 2KRTA 2Y73A 2WO0A 1RGGA 4HYZA 1RGCA 3SVAA 1UDII 1UCIA 1N5HA 1FZUA 1GSPA 2XH9A 3NBRA 3CCL3 3S29A 1M9GA 3MKIA 1V57A 3D5IA 3RGAA 2L1SA 5M18A 3N9HA 1UUGB 4IIAA 1VQ43 1VQN3 2W03A 3F8HA 4R9KA 3FLJA 1O7HB 2ZHXB 3F8XA 3LYGA 3PYJA 3X3YA 3UL6A 5IG3A 1TTOA 2OWPA 4HOHA 1D6ZA 1FGQA 1GMQA 1RGFA 1S5AA 3AMOB 4MEIA 3OWUA 2CW9A 3ER7A 1BNIA 3CCV3 2CH9A 1FGRA 2Q07A 4BL2A 2IA7A 3DMCA 1MWRA 4FMAA 3U1WA 3MG3A 5LC6A 2INXA 1MGRA 2XSHB 1MWSA 4HBRA 5AEWB 3EJVA 1E3VA 1OGXA 3PCSA 1PFPA 1O7GB 2R41A 3NM7A 4XBTA 4BU4A 2YFLB 1QVG2 2WGOA 4N6MA 5ELJA 4ZM8A 4KZ1A 9RNTA 1BRSA 1UCLA 3ALAA 3S5CA 2JDIH 1IQ8A 3MHEA 4I4KA 5EQLA 2WOHA 2OOVA 3G713 1IV7A 2CFKA 2FNQA 1YJN3 2MC8A 2HMKB 5IG0A 1ZS7A 5JPPA 8CHOA 1W02A 3CNXA 2CG1A 3F7XA 3I563 1K9M4 1OHPA 1LXEA 1RRLA 1SARA 1RLSA 4IT7A 1X1XA 4K1VA 1V58A 1AR0A 4I5QA 3WA2X 1C54A 1GY6A 3T8UA 3ZFZA 1OH0A 1HKXA 2P38A 3SYUA 6GSPA 1K734 3HIGA 3WMDA 1IQYA 4BTXA 2C4BA 3FKAA 1BNFA 3D4AA 1EA2A 3V99A 1I3FA 4N6V0 3X3XA 3SLUA 3VGNA 1Q864 2O3OA 3BNBA 3TDGA 7RNTA 1RCLA 4TX4A 1ISKA 2GBWB 3NXJA 1UGHI 3V92A 4HM5B 1Q40A 3MWZA 3FSDA 4WYKB 5CXOA 2FXTA 3K0ZA 3CNMA 3EN1B 5CK6A 1OF5B 3EC9A 3FCSB 1N8QA 3OWYA 4NHFA 3T8NA 2CFWA 2ML5A 1R4YA 3GWRA 3CCM3 2RSXA 1VQM3 6STDA 4QWTA 3NBBA 2BMQB 1FYSA 1N9JA 3K63A 1WNHA 3KFQC 2C10A 1ZO2A 3EB8A 2P05A 4WP5A 1JBTA 1BANA 4CJNA 1VQ83 3LT8A 2E2UA 1BSAA 5BU4A 1ZGXA 3WDGB 1G96A 1C7HA 1DMMA 3OV4A 1YNVX 3Q90A 3SX1A 3E99A 4HM1B 1ROAA 4LZIA 4CDLA 8RNTA 2K54A 1KSIA 3CC23 5CF1A 1A2PA 1RNTA 1O7PB 2CX0A 4XBXA 2H0IA 2P0XA 5ELUA 1RGHA 1MOLA 3FF2A 3BU4A 4XDVA 2XF3A 1YVSA 1OGZA 1Y4KA 2BO9B 3KSED 3KZTA 3KIIA 1AVLA 3WOEB 1YGWA 4IPBA 3S67A 4HM0B 1BNRA 1CYUA 3NQYA 1SIIA 2GXFA 3OX9A 1WTHA 1GOUA 4EV2A 3G4S3 2XFSA 2GEXA 1CH0A 2J8XB 1NWWA 1Q824 3HI7A 2CWUA 2CC3A 2W0QA 3NV0B 4N6UA 1BNEA 1LNIA 3RDEA 2W56B 1N5PA 3ZG0A 1RGKA 4X2HA
chains in the Genus database with same CATH topology
4HM6B 4O2HA 3GZXB 1W5ZA 2IUKA 1HU9A 4XDWA 5IF6A 3LTDA 1R4CA 4G1MB 1YIT3 1SPUA 2B1XB 3B4OA 5EVHA 3CCE3 3X42A 3IJEB 4JF8A 3VF1A 2XEPA 2UX0A 1W2ZA 1O7MB 5D81A 2HMMB 3LOYA 4KFEA 5TGNA 1VZZA 4H61A 1OACA 1UUVB 1BUQA 1OHSA 2CHCA 3FG4A 2B24B 3LTAA 5EEOA 5IEPA 1N8R4 1A2KA 1VQ53 3FGYA 3SOAA 3UL5A 4ORLA 1CQSA 1JN5A 3GRDA 5AIFA 3MG1A 2O9UX 1VQO3 3DUKA 1DMQA 3M8CA 3NM2A 2E2TA 3D9RA 3CMA3 3X40A 1IU7A 1E97A 4J9AA 3L0RA 1LNHA 2BNGA 3K7CA 1A67A 1WMOA 3GZBA 4R1KA 3SOYA 5AI1A 1STDA 2F99A 3SXXA 1FUWA 1JKGA 1TP6A 5D82A 5FGOA 1RJOA 3JUOA 4K61A 1WMNA 4JRFA 3EBYA 3QRDA 4PEJA 1IDPA 4WHAA 1Z1SA 5AIGA 1VQ93 3K5TA 1W6CA 4HJLB 3CD63 3AMOA 1NU3A 3KKGA 4AKYA 1JJ22 1DVCA 1IVWA 3CU3A 3T0UA 1VQ63 3OWSA 4AKZA 1K41A 2IMJA 3UB1A 2F98A 3PS8A 4XM4A 3JUMA 3N54B 5JBSA 1KWIA 2Z76A 3JVCA 4N6TA 3HX8A 3VSYA 3F9SA 3CPW2 2QA43 1NJI4 3B7CA 2IUJA 2ML6A 5AYSC 1O7NB 1IQXA 1UUWB 5KP3A 3BNDA 1A2VA 4FCJA 1TFKA 1W7CA 1SIHA 1T5YA 1ROVA 3B4PA 3CCQ3 5AIIA 2RGQA 1N9EA 3PGBA 3UJMA 3CC73 3DGNA 1Q40B 5FW5A 4HVNA 2LQVA 1IT8A 4MMYB 1VQP3 1MNLA 1YJW3 1US1A 1M1K4 1D6YA 4EBGA 2CWTA 4N6NB 2YX9A 4L8OA 3NUVA 4EXRA 1M1XB 2D1WA 3OW22 1EQKA 2D42A 2BHMA 1S723 1IVUA 1IK3A 1W4NA 3CXC2 1LVNA 5AYRB 1EKMA 3NHXA 1QVF2 3BB9A 4HKVB 4FCMA 4STDA 1SJWA 1WMPA 2BMRB 2GBXB 2HMJB 3LXUX 2QEX3 4FMDA 2OQEC 3B8LA 1QALA 1JB2A 1FA3A 3S28A 5JPUA 2STDA 1GY7A 1YVBI 3EE1A 3NX0A 3F40A 4HM2B 4LSOA 1JV2B 3KE7A 4OUQA 5IENA 1CEWI 1IVVA 3LTBA 1V74A 2Z6BA 1W6GA 4FMCA 3PXMA 3BLZA 1PU4A 1VQK3 3DGLA 3LTCA 4Q53A 1TU5A 2I9WA 4O02B 1ASKA 2W9QA 2ZDJA 3DY5A 2XSOB 3HZPA 3CCJ3 2OTJ3 3PZWA 1QAFA 3FZWA 2PNCA 3QK9A 4LGQA 3DZLA 3DM8A 2XFTA 1VQ73 3EHCA 1RN7A 1A90A 3WOFB 2JQ5A 1OUNA 5DREA 4WWUC 1AV4A 2GEYA 3I553 2QGUA 5KP4A 3Q1CA 2MF7A 2GU3A 5D83A 3LH4A 4RNYA 3J7Yd 1ZX2A 3PCRA 4O8SA 3KSPA 4OVMA 1Q814 2OQEA 5G2GA 3WA3A 3H51A 3DGMA 2ZL8A 3NV0A 2CIUA 4FCZA 5IERA 4HZ9B 2K0MA 4GL6A 1D6UA 1W00A 1DYUA 2HMOB 3N8BA 4MMZB 2QIYA 2L4VA 5HGRA 1CYVA 4R4KA 2P0MA 2OTL3 3ECFA 3CPOA 1QJGA 1K28A 2RCDA 1YGEA 4EC6A 1JN5B 3NQZA 3FG3A 1JRQA 5I97A 3FH1A 1YIJ3 1GS3A 1NB3I 3JUNA 1DMNA 3GZYB 3JUQA 3G8ZA 1WQLB 2W6JH 5IEOA 1TUHA 1YI23 2OOVC 4RBNA 4L7KA 4KFDA 4XB5A 5AIHA 2SBLA 2CFGA 4LEHA 3SEDA 1FGOA 5IW9A 1JNQA 2GU1A 4X2OA 1Q7Y4 1JKGB 3HIIA 4GB5A 1W2B2 1KD14 3STDA 1K8A4 3EF8A 2V1LA 5A0OB 3MPHA 3X41A 1L5GB 1SQWA 4RNZA 2CKFB 2PZVA 2HMNB 2M7OA 4LMIA 5KP1A 1JB4A 4L8PA 4MJDA 2WOFA 3CCR3 3G6E3 4K90B 3LT9A 1IT7A 1TFOA 4J8TA 2KXGA 2A15A 1FGTA 2YFJB 2Z77A 2CFDA 5LC7A 3F14A 4EV5A 5IG5A 3CC43 3BNCA 1ULIB 1U8CB 1RKYA 2OCTA 3FF2A 1GYBA 2E2VA 2YFIB 2XGNA 1M904 1LOXA 1EG9B 4HM3B 2W2CA 5CF2A 1F8NA 2HMLB 1TIJA 5BVBA 1OPYA 1W01A 1KC84 3MYTA 2Z7AA 1UI8A 3WODG 2R4IA 1O7WB 3H3HA 3GAXA 3X3ZA 4HZBB 1Q42A 4CCVA 2Y74A 3BNEA 1QAKA 4U13A 3IMAB 3EQQB 4FR9A 3FF0A 3FG1A 4XBYA 3KN4A 1ULJB 4N3VA 3HK4A 3I0YA 1NB5I 4O3VA 1NO3A 1IV9A 4WYKA 1OF5A 3G16A 4K1UA 4AEQA 3JUPA 1UI7A 3Q2PA 3NBJA 1RRHA 3U97A 2RFRA 1VQL3 1UW1A 3DXOA 3LMLA 1KQS2 4KFFA 4NREA 2KCDA 5IG4A 5DRVA 1FGMA 2CFLA 3A76A 3EN8A 1GD4A 2WGQA 2XRXB 2W04A 2CK3H 4HM8B 3K9MC 3EX9A 3GZRA 3LZAA 1NDOB 3CCS3 1JB5A 3CCU3 4BTWA 1U5OA 2CWVA 4WFOA 2W9PA 4MMXB 2LYXA 5CLKA 2XGLA 3IPTA 3EBTA 3OXAA 5AEUB 2F86B 3CME3 1QMAA 4FMBA 3G0KA 2BMOB 1OHOA 3F7SA 2CG0A 1GY5A 4H3UA 1AVKA 4EYCA 1J2BA 3DGOA 4N6OB 3RGRA 1IVXA 4HM7B 5STDA 1YJ93 1W6YA 1E3RA 1OCVA 2W56A 3V98A 4N6LA 3MSOA 4R80A 4R9LA 3ROBA 1STFI 1DVDA 2BT3A 3D3LA 2XR8B 3MG2A 7STDA 3UNLA 4KVHA 3O8YA 4RZMA 4HM4B 2C11A 4BTYA 1YHQ3 5BXQA 1GD3A 2FGTA 4OK0A 3S27A 2KRTA 2Y73A 2WO0A 4HYZA 3SVAA 1N5HA 2XH9A 3NBRA 3CCL3 3S29A 1M9GA 3MKIA 3RGAA 3N9HA 4IIAA 1VQ43 1N5PA 1VQN3 2W03A 3F8HA 4R9KA 3FLJA 1O7HB 3F8XA 3X3YA 3LYGA 3PYJA 3UL6A 5IG3A 2OWPA 1D6ZA 1FGQA 1S5AA 3AMOB 4MEIA 3OWUA 2CW9A 3ER7A 3CCV3 2CH9A 1FGRA 2Q07A 2IA7A 3DMCA 4FMAA 3U1WA 3MG3A 5LC6A 2INXA 2XSHB 4HBRA 5AEWB 3EJVA 1E3VA 1OGXA 3PCSA 1PFPA 1O7GB 4XBTA 3NM7A 1QVG2 2YFLB 2WGOA 4N6MA 5ELJA 4ZM8A 4KZ1A 3ALAA 3S5CA 2JDIH 1IQ8A 3MHEA 4I4KA 5EQLA 2WOHA 2OOVA 3G713 1IV7A 2CFKA 2FNQA 1YJN3 2MC8A 2HMKB 5IG0A 5JPPA 8CHOA 1W02A 3CNXA 2CG1A 3F7XA 3I563 1K9M4 1OHPA 1LXEA 1RRLA 4IT7A 4K1VA 1AR0A 3WA2X 1GY6A 3T8UA 1OH0A 1HKXA 2P38A 1K734 3HIGA 3WMDA 1IQYA 4BTXA 3FKAA 1EA2A 3V99A 4N6V0 3X3XA 3SLUA 3VGNA 1Q864 2O3OA 3BNBA 3TDGA 1ISKA 4TX4A 2GBWB 3NXJA 3V92A 4HM5B 1Q40A 3MWZA 3FSDA 4WYKB 5CXOA 2FXTA 3K0ZA 3CNMA 3EN1B 5CK6A 1OF5B 3EC9A 3FCSB 1N8QA 3OWYA 4NHFA 3T8NA 2CFWA 2ML5A 3GWRA 3CCM3 2RSXA 1VQM3 6STDA 4QWTA 3NBBA 2BMQB 1N9JA 3K63A 1WNHA 3KFQC 2C10A 1ZO2A 3EB8A 2P05A 4WP5A 1VQ83 3LT8A 2E2UA 3WDGB 1G96A 1C7HA 1DMMA 3OV4A 3Q90A 3SX1A 3E99A 4HM1B 1ROAA 4LZIA 4CDLA 2K54A 1KSIA 3CC23 5CF1A 1O7PB 4XBXA 5ELUA 2P0XA 1MOLA 4XDVA 2XF3A 1Y4KA 1OGZA 2BO9B 3KSED 3KZTA 3KIIA 1AVLA 3WOEB 1CYUA 4IPBA 3S67A 4HM0B 3NQYA 1SIIA 2GXFA 3OX9A 1WTHA 4EV2A 3G4S3 2XFSA 2GEXA 1NWWA 1Q824 3HI7A 2CWUA 2CC3A 2W0QA 3NV0B 4N6UA 3RDEA 2W56B 2P09A 4X2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM6 B;  3GZX B;  4XDW A;  5IF6 A;  2B1X B;  3B4O A;  5EVH A;  2UX0 A;  5D81 A;  1O7M B;  5TGN A;  2HMM B;  1VZZ A;  1UUV B;  1BUQ A;  1OHS A;  2CHC A;  2B24 B;  5IEP A;  1A2K A;  3FGY A;  3SOA A;  4ORL A;  1CQS A;  1JN5 A;  3GRD A;  5AIF A;  3MG1 A;  3DUK A;  1DMQ A;  3M8C A;  3NM2 A;  3D9R A;  1E97 A;  4J9A A;  3K7C A;  2BNG A;  3GZB A;  4R1K A;  3SOY A;  5AI1 A;  1STD A;  2F99 A;  1JKG A;  1TP6 A;  5D82 A;  3JUO A;  3EBY A;  4PEJ A;  1IDP A;  1Z1S A;  5AIG A;  4HJL B;  1NU3 A;  3KKG A;  3CU3 A;  3OWS A;  1K41 A;  2IMJ A;  2F98 A;  4XM4 A;  3JUM A;  2Z76 A;  3HX8 A;  3VSY A;  3F9S A;  3B7C A;  1O7N B;  1UUW B;  5KP3 A;  4FCJ A;  3B4P A;  5AII A;  2RGQ A;  3UJM A;  1Q40 B;  5FW5 A;  4HVN A;  4L8O A;  3NUV A;  3NHX A;  4HKV B;  3BB9 A;  4FCM A;  4STD A;  1SJW A;  2BMR B;  2GBX B;  2HMJ B;  3B8L A;  1JB2 A;  5JPU A;  2STD A;  1GY7 A;  4OUQ A;  4HM2 B;  3F40 A;  3KE7 A;  5IEN A;  3BLZ A;  4Q53 A;  2I9W A;  1ASK A;  2XSO B;  3HZP A;  3FZW A;  4LGQ A;  3DZL A;  3DM8 A;  3EHC A;  2JQ5 A;  1OUN A;  5DRE A;  4WWU C;  2GEY A;  2QGU A;  5KP4 A;  5D83 A;  1ZX2 A;  3KSP A;  4OVM A;  5G2G A;  3H51 A;  3NV0 A;  5IER A;  4HZ9 B;  1W00 A;  2HMO B;  2QIY A;  5HGR A;  3ECF A;  3CPO A;  1QJG A;  2RCD A;  1JN5 B;  3FH1 A;  1GS3 A;  3JUN A;  1DMN A;  3GZY B;  3JUQ A;  3G8Z A;  1WQL B;  5IEO A;  1TUH A;  4L7K A;  5AIH A;  4XB5 A;  4LEH A;  3SED A;  4X2O A;  1JKG B;  4GB5 A;  3STD A;  3EF8 A;  2CKF B;  2PZV A;  2HMN B;  4LMI A;  5KP1 A;  1JB4 A;  4L8P A;  4MJD A;  4J8T A;  2A15 A;  2YFJ B;  2Z77 A;  3F14 A;  5IG5 A;  1ULI B;  3FF2 A;  1GYB A;  2YFI B;  1EG9 B;  4HM3 B;  2W2C A;  5CF2 A;  2HML B;  5BVB A;  1OPY A;  1W01 A;  3MYT A;  2Z7A A;  2R4I A;  1O7W B;  3H3H A;  4HZB B;  1Q42 A;  4U13 A;  3EQQ B;  3FF0 A;  4XBY A;  4N3V A;  1ULJ B;  3HK4 A;  3I0Y A;  4WYK A;  1OF5 A;  3G16 A;  4K1U A;  3JUP A;  2RFR A;  3DXO A;  5IG4 A;  5DRV A;  3A76 A;  3EN8 A;  2XRX B;  4HM8 B;  3EX9 A;  3GZR A;  3LZA A;  1NDO B;  1JB5 A;  1U5O A;  5CLK A;  3IPT A;  3EBT A;  3OXA A;  5AEU B;  2F86 B;  1QMA A;  3G0K A;  2BMO B;  1OHO A;  3F7S A;  1GY5 A;  4H3U A;  3RGR A;  4HM7 B;  5STD A;  1W6Y A;  1E3R A;  1OCV A;  3MSO A;  4R9L A;  3ROB A;  2XR8 B;  3MG2 A;  7STD A;  3UNL A;  4KVH A;  4RZM A;  4HM4 B;  5BXQ A;  3NBR A;  3MKI A;  3RGA A;  4IIA A;  3F8H A;  4R9K A;  3FLJ A;  1O7H B;  3F8X A;  3LYG A;  5IG3 A;  2OWP A;  1S5A A;  3OWU A;  3ER7 A;  3DMC A;  3MG3 A;  2INX A;  2XSH B;  5AEW B;  3EJV A;  1E3V A;  1OGX A;  1O7G B;  4XBT A;  2YFL B;  3S5C A;  4I4K A;  3MHE A;  2HMK B;  5IG0 A;  8CHO A;  1W02 A;  3CNX A;  3F7X A;  1OHP A;  4K1V A;  1AR0 A;  1GY6 A;  3T8U A;  1OH0 A;  1HKX A;  3WMD A;  3FKA A;  1EA2 A;  3VGN A;  1ISK A;  2GBW B;  3NXJ A;  4HM5 B;  1Q40 A;  3FSD A;  4WYK B;  5CXO A;  3K0Z A;  3CNM A;  3EN1 B;  5CK6 A;  1OF5 B;  3EC9 A;  3OWY A;  3T8N A;  3GWR A;  6STD A;  2BMQ B;  1ZO2 A;  4WP5 A;  1C7H A;  1DMM A;  3OV4 A;  3Q90 A;  3E99 A;  4HM1 B;  4CDL A;  2K54 A;  5CF1 A;  1O7P B;  4XBX A;  4XDV A;  1OGZ A;  3KZT A;  4HM0 B;  2GXF A;  3OX9 A;  2GEX A;  1NWW A;  3NV0 B;  5JPP A;  4X2H A; 
#chains in the Genus database with same CATH topology
 1JBR A;  4HM6 B;  4O2H A;  1RN4 A;  1JZD A;  1W5Z A;  2IUK A;  3GZX B;  1HU9 A;  3Q3F A;  4XDW A;  5IF6 A;  6RNT A;  3LTD A;  1R4C A;  4G1M B;  1YIT 3;  1SPU A;  2B1X B;  3B4O A;  5EVH A;  4BIR A;  3CCE 3;  3X42 A;  1UCK A;  3IJE B;  1T2H A;  4JF8 A;  1BNJ A;  3VF1 A;  2XEP A;  2UX0 A;  1W2Z A;  1O7M B;  5D81 A;  2HMM B;  3LOY A;  4KFE A;  5TGN A;  1VZZ A;  4H61 A;  1OAC A;  1UUV B;  1BRJ A;  1OHS A;  2CHC A;  3FG4 A;  2B24 B;  3GSP A;  3LTA A;  5EEO A;  5IEP A;  1N8R 4;  1BRN L;  1A2K A;  1EUI C;  1VQ5 3;  2F56 A;  1BSD A;  3FGY A;  3SOA A;  3UL5 A;  2RBI A;  4ORL A;  1CQS A;  1JN5 A;  1RHL A;  3GRD A;  4ILF A;  5AIF A;  3MG1 A;  2O9U X;  1VQO 3;  3DUK A;  1DMQ A;  3KCH A;  3M8C A;  3NM2 A;  1EEJ A;  2E2T A;  3D9R A;  3CMA 3;  3X40 A;  1IU7 A;  1E97 A;  4J9A A;  1MWT A;  3L0R A;  1LNH A;  2BNG A;  3K7C A;  1A67 A;  1WMO A;  3GZB A;  4R1K A;  1GOV A;  3SOY A;  5AI1 A;  1STD A;  2F99 A;  3SXX A;  1FUW A;  1JKG A;  1TP6 A;  5D82 A;  5FGO A;  1RJO A;  3JUO A;  4NPB A;  4K61 A;  1WMN A;  4JRF A;  2KF5 A;  3EBY A;  3QRD A;  1IDP A;  4PEJ A;  1Z1S A;  4WHA A;  5AIG A;  1VQ9 3;  3A5E A;  3K5T A;  1W6C A;  4HJL B;  3CD6 3;  3AMO A;  1NU3 A;  3KKG A;  4AKY A;  1JJ2 2;  1DVC A;  1IVW A;  3CU3 A;  3RNT A;  3T0U A;  3OWS A;  4AKZ A;  1VQ6 3;  4EW5 A;  1BIR A;  1K41 A;  2IMJ A;  3UB1 A;  2F98 A;  3PS8 A;  4XM4 A;  3JUM A;  2KF6 A;  3N54 B;  5JBS A;  1KWI A;  2Z76 A;  2BU4 A;  3JVC A;  4N6T A;  1AY7 A;  3HX8 A;  3VSY A;  3F9S A;  3CPW 2;  2QA4 3;  1NJI 4;  3B7C A;  1B20 A;  2IUJ A;  2ML6 A;  1RGL A;  5AYS C;  1O7N B;  1VQQ A;  2P09 A;  1IQX A;  1RGA A;  1UUW B;  5KP3 A;  3BND A;  1TJD A;  1A2V A;  4FCJ A;  1TFK A;  1W7C A;  3AGN A;  1PY3 A;  1SIH A;  1BRG A;  1T5Y A;  1ROV A;  2SAR A;  3B4P A;  3CCQ 3;  5AII A;  2RGQ A;  1N9E A;  3PGB A;  3UJM A;  3CC7 3;  4GHO A;  1BU4 A;  3DGN A;  1Q40 B;  5FW5 A;  4HVN A;  2LQV A;  1BNS A;  1IT8 A;  1DET A;  3DH2 A;  4MMY B;  1VQP 3;  1MNL A;  1YJW 3;  1US1 A;  1M1K 4;  1D6Y A;  4EBG A;  1MGW A;  2CWT A;  1MWU A;  2YX9 A;  4N6N B;  4L8O A;  1I2G A;  3NUV A;  4EXR A;  1M1X B;  2D1W A;  3OW2 2;  1EQK A;  2D42 A;  2BHM A;  1S72 3;  1IVU A;  1IK3 A;  1W4N A;  3CXC 2;  4BL3 A;  1LVN A;  5AYR B;  1EKM A;  3NHX A;  1RTU A;  1X1Y A;  3AHW A;  1QVF 2;  1JZO A;  2CX1 A;  3BB9 A;  4FCM A;  4HKV B;  4STD A;  1SJW A;  1I0X A;  1WMP A;  2BMR B;  2GBX B;  2HMJ B;  3LXU X;  2QEX 3;  1BUQ A;  4FMD A;  2OQE C;  3B8L A;  1I70 A;  2HOH A;  1QAL A;  1JB2 A;  1FA3 A;  3S28 A;  5JPU A;  2STD A;  1BRH A;  1GY7 A;  1YVB I;  3EE1 A;  3NX0 A;  3F40 A;  4HM2 B;  1LOV A;  1JV2 B;  3KE7 A;  4LSO A;  2F5W A;  4OUQ A;  1CEW I;  5IEN A;  1IVV A;  1TRQ A;  1V74 A;  2Z6B A;  1W6G A;  3LTB A;  3PXM A;  4FMC A;  3BLZ A;  1PU4 A;  1VQK 3;  1RSN A;  3DGL A;  3LTC A;  4Q53 A;  4J5K A;  1X1U A;  2I9W A;  1TU5 A;  4O02 B;  1ASK A;  2W9Q A;  2ZDJ A;  3DY5 A;  1RMS A;  2XSO B;  3HZP A;  3CCJ 3;  2OTJ 3;  3PZW A;  1QAF A;  3FZW A;  1BUJ A;  1B2Z A;  2PNC A;  1PYL A;  3QK9 A;  4LGQ A;  3DZL A;  3DM8 A;  2XFT A;  1VQ7 3;  1Q7H A;  3EHC A;  1RN1 A;  1RN7 A;  1A90 A;  3WOF B;  2JQ5 A;  1BGS A;  1OUN A;  5DRE A;  4WWU C;  1AV4 A;  3WR2 A;  2GEY A;  3I55 3;  2QGU A;  5KP4 A;  1LRA A;  1BSE A;  3Q1C A;  2MF7 A;  1T3B A;  3HOH A;  1FUS A;  2GU3 A;  3LH4 A;  5D83 A;  4RNY A;  3J7Y d;  1ZX2 A;  2AAE A;  3PCR A;  1GOY A;  4J5G A;  4O8S A;  1G02 A;  1NNV A;  3KSP A;  4OVM A;  1Q81 4;  2OQE A;  5G2G A;  5M1A A;  3H51 A;  3WA3 A;  3DGM A;  2ZL8 A;  3NV0 A;  2CIU A;  4FCZ A;  1B21 A;  5IER A;  1GMP A;  4HZ9 B;  2K0M A;  4GL6 A;  1D6U A;  1W00 A;  1DYU A;  2HMO B;  2UGI A;  3N8B A;  4MMZ B;  2QIY A;  2L4V A;  5HGR A;  1CYV A;  1FW7 A;  4R4K A;  2P0M A;  3ZG5 A;  2OTL 3;  3ECF A;  3CPO A;  4CPK A;  1QJG A;  1K28 A;  2RCD A;  1RGE A;  1YGE A;  4EC6 A;  1HZ1 A;  2F4Y A;  1UCJ A;  1JN5 B;  3NQZ A;  3FG3 A;  4DKI A;  1JRQ A;  5I97 A;  3FH1 A;  1YIJ 3;  1UGI A;  1GS3 A;  1NB3 I;  3JUN A;  1B3S A;  1DMN A;  2KAA A;  3GZY B;  3BIR A;  3JUQ A;  3G8Z A;  1WQL B;  2W6J H;  5IEO A;  1TUH A;  1YI2 3;  2OOV C;  3DGY A;  4RBN A;  5M19 A;  4L7K A;  4GSP A;  1FUT A;  1GMR A;  1I2E A;  2CFG A;  2SBL A;  4KFD A;  4XB5 A;  4LEH A;  5AIH A;  3SED A;  3WHO A;  1FGO A;  5IW9 A;  1B2X A;  1BVI A;  1JNQ A;  2GU1 A;  4X2O A;  1Q7Y 4;  1JKG B;  3HII A;  4GB5 A;  1W2B 2;  1KD1 4;  3STD A;  2IY2 A;  3EF8 A;  1K8A 4;  2V1L A;  4RNT A;  1X1W A;  3D79 A;  5A0O B;  3MPH A;  3X41 A;  1L5G B;  1SQW A;  4RNZ A;  2CKF B;  2PZV A;  2HMN B;  5RNT A;  2M7O A;  4LMI A;  3AGO A;  5KP1 A;  1JB4 A;  4L8P A;  4MJD A;  4KT3 B;  1TRP A;  2H0H A;  2WOF A;  3G6E 3;  4K90 B;  3CCR 3;  3LT9 A;  1IT7 A;  1TFO A;  4J8T A;  2KXG A;  1RDS A;  2A15 A;  1FGT A;  2YFJ B;  2Z77 A;  2CFD A;  5LC7 A;  3F14 A;  1HYF A;  4EV5 A;  1JBS A;  1I2F A;  5IG5 A;  3CC4 3;  3BNC A;  1ULI B;  2H0G A;  1U8C B;  1RKY A;  1RCK A;  2OCT A;  1BSC A;  1T2I A;  2KF4 A;  1GYB A;  1LOY A;  2E2V A;  1BRK A;  2XGN A;  1LOX A;  1EG9 B;  2YFI B;  1M90 4;  4HM3 B;  5G1K A;  2W2C A;  5CF2 A;  1F8N A;  2HML B;  1TIJ A;  4LYL B;  1OPY A;  5BVB A;  1B2U A;  1W01 A;  1KC8 4;  3MYT A;  2Z7A A;  1UI8 A;  3WOD G;  2R4I A;  1O7W B;  2UUG C;  3D5G A;  1BRI A;  3H3H A;  1BOX A;  4HAA A;  2F5M A;  2GSP A;  3GAX A;  3X3Z A;  4HZB B;  1Q42 A;  4CCV A;  2Y74 A;  2IYJ A;  3BNE A;  1DE3 A;  1QAK A;  4U13 A;  3IMA B;  3EQQ B;  4FR9 A;  2K3D A;  3FF0 A;  3FG1 A;  4XBY A;  3KN4 A;  1ULJ B;  4N3V A;  3HK4 A;  3I0Y A;  1NB5 I;  4O3V A;  1NO3 A;  1BAO A;  1IV9 A;  4WYK A;  3AHS A;  1OF5 A;  3G16 A;  4K1U A;  4AEQ A;  3JUP A;  1UI7 A;  3Q2P A;  3NBJ A;  1RRH A;  3U97 A;  2RFR A;  1VQL 3;  1UW1 A;  3DXO A;  3LML A;  1KQS 2;  4KFF A;  4NRE A;  2KCD A;  2RNT A;  5IG4 A;  5DRV A;  1FGM A;  2ZA4 A;  2CFL A;  1B2S A;  3A76 A;  5HOH A;  3EN8 A;  1GD4 A;  2WGQ A;  2XRX B;  5BIR A;  1Q9E A;  2W04 A;  1I0V A;  2CK3 H;  4HM8 B;  3K9M C;  3EX9 A;  3GZR A;  3LZA A;  1NDO B;  3CCS 3;  1JB5 A;  3CCU 3;  1I8V A;  4BTW A;  1U5O A;  2CWV A;  4WFO A;  1LQM B;  2W9P A;  4MMX B;  2LYX A;  5CLK A;  2XGL A;  3IPT A;  3EBT A;  3OXA A;  1G0T A;  5AEU B;  2F86 B;  3CME 3;  1QMA A;  4FMB A;  3G0K A;  2BMO B;  1OHO A;  3F7S A;  1RNB A;  2CG0 A;  1GY5 A;  4H3U A;  1LOW A;  1AVK A;  4EYC A;  1LQG C;  1J2B A;  3DGO A;  4N6O B;  3RGR A;  1IVX A;  4HM7 B;  5STD A;  1YJ9 3;  1W6Y A;  1E3R A;  1OCV A;  2W56 A;  3V98 A;  4N6L A;  2AAD A;  3MSO A;  4R9L A;  4R80 A;  5GSP A;  3ROB A;  1STF I;  1DVD A;  2BT3 A;  3D3L A;  2XR8 B;  3MG2 A;  1BSB A;  7STD A;  1B2M A;  2BIR A;  3URP A;  2KF3 A;  1IYY A;  3UNL A;  4KVH A;  3O8Y A;  1B27 A;  4HM4 B;  4RZM A;  5G1L A;  1AQZ A;  2C11 A;  4BTY A;  7GSP A;  5BXQ A;  1YHQ 3;  1I3I A;  1GD3 A;  2FGT A;  4OK0 A;  3S27 A;  1BNG A;  2KRT A;  2Y73 A;  2WO0 A;  1RGG A;  4HYZ A;  1RGC A;  3SVA A;  1UDI I;  1UCI A;  1N5H A;  1FZU A;  1GSP A;  2XH9 A;  3NBR A;  3CCL 3;  3S29 A;  1M9G A;  3MKI A;  1V57 A;  3D5I A;  3RGA A;  2L1S A;  5M18 A;  3N9H A;  1UUG B;  4IIA A;  1VQ4 3;  1VQN 3;  2W03 A;  3F8H A;  4R9K A;  3FLJ A;  1O7H B;  2ZHX B;  3F8X A;  3LYG A;  3PYJ A;  3X3Y A;  3UL6 A;  5IG3 A;  1TTO A;  2OWP A;  4HOH A;  1D6Z A;  1FGQ A;  1GMQ A;  1RGF A;  1S5A A;  3AMO B;  4MEI A;  3OWU A;  2CW9 A;  3ER7 A;  1BNI A;  3CCV 3;  2CH9 A;  1FGR A;  2Q07 A;  4BL2 A;  2IA7 A;  3DMC A;  1MWR A;  4FMA A;  3U1W A;  3MG3 A;  5LC6 A;  2INX A;  1MGR A;  2XSH B;  1MWS A;  4HBR A;  5AEW B;  3EJV A;  1E3V A;  1OGX A;  3PCS A;  1PFP A;  1O7G B;  2R41 A;  3NM7 A;  4XBT A;  4BU4 A;  2YFL B;  1QVG 2;  2WGO A;  4N6M A;  5ELJ A;  4ZM8 A;  4KZ1 A;  9RNT A;  1BRS A;  1UCL A;  3ALA A;  3S5C A;  2JDI H;  1IQ8 A;  3MHE A;  4I4K A;  5EQL A;  2WOH A;  2OOV A;  3G71 3;  1IV7 A;  2CFK A;  2FNQ A;  1YJN 3;  2MC8 A;  2HMK B;  5IG0 A;  1ZS7 A;  5JPP A;  8CHO A;  1W02 A;  3CNX A;  2CG1 A;  3F7X A;  3I56 3;  1K9M 4;  1OHP A;  1LXE A;  1RRL A;  1SAR A;  1RLS A;  4IT7 A;  1X1X A;  4K1V A;  1V58 A;  1AR0 A;  4I5Q A;  3WA2 X;  1C54 A;  1GY6 A;  3T8U A;  3ZFZ A;  1OH0 A;  1HKX A;  2P38 A;  3SYU A;  6GSP A;  1K73 4;  3HIG A;  3WMD A;  1IQY A;  4BTX A;  2C4B A;  3FKA A;  1BNF A;  3D4A A;  1EA2 A;  3V99 A;  1I3F A;  4N6V 0;  3X3X A;  3SLU A;  3VGN A;  1Q86 4;  2O3O A;  3BNB A;  3TDG A;  7RNT A;  1RCL A;  4TX4 A;  1ISK A;  2GBW B;  3NXJ A;  1UGH I;  3V92 A;  4HM5 B;  1Q40 A;  3MWZ A;  3FSD A;  4WYK B;  5CXO A;  2FXT A;  3K0Z A;  3CNM A;  3EN1 B;  5CK6 A;  1OF5 B;  3EC9 A;  3FCS B;  1N8Q A;  3OWY A;  4NHF A;  3T8N A;  2CFW A;  2ML5 A;  1R4Y A;  3GWR A;  3CCM 3;  2RSX A;  1VQM 3;  6STD A;  4QWT A;  3NBB A;  2BMQ B;  1FYS A;  1N9J A;  3K63 A;  1WNH A;  3KFQ C;  2C10 A;  1ZO2 A;  3EB8 A;  2P05 A;  4WP5 A;  1JBT A;  1BAN A;  4CJN A;  1VQ8 3;  3LT8 A;  2E2U A;  1BSA A;  5BU4 A;  1ZGX A;  3WDG B;  1G96 A;  1C7H A;  1DMM A;  3OV4 A;  1YNV X;  3Q90 A;  3SX1 A;  3E99 A;  4HM1 B;  1ROA A;  4LZI A;  4CDL A;  8RNT A;  2K54 A;  1KSI A;  3CC2 3;  5CF1 A;  1A2P A;  1RNT A;  1O7P B;  2CX0 A;  4XBX A;  2H0I A;  2P0X A;  5ELU A;  1RGH A;  1MOL A;  3FF2 A;  3BU4 A;  4XDV A;  2XF3 A;  1YVS A;  1OGZ A;  1Y4K A;  2BO9 B;  3KSE D;  3KZT A;  3KII A;  1AVL A;  3WOE B;  1YGW A;  4IPB A;  3S67 A;  4HM0 B;  1BNR A;  1CYU A;  3NQY A;  1SII A;  2GXF A;  3OX9 A;  1WTH A;  1GOU A;  4EV2 A;  3G4S 3;  2XFS A;  2GEX A;  1CH0 A;  2J8X B;  1NWW A;  1Q82 4;  3HI7 A;  2CWU A;  2CC3 A;  2W0Q A;  3NV0 B;  4N6U A;  1BNE A;  1LNI A;  3RDE A;  2W56 B;  1N5P A;  3ZG0 A;  1RGK A;  4X2H A; 
#chains in the Genus database with same CATH homology
 4HM6 B;  4O2H A;  3GZX B;  1W5Z A;  2IUK A;  1HU9 A;  4XDW A;  5IF6 A;  3LTD A;  1R4C A;  4G1M B;  1YIT 3;  1SPU A;  2B1X B;  3B4O A;  5EVH A;  3CCE 3;  3X42 A;  3IJE B;  4JF8 A;  3VF1 A;  2XEP A;  2UX0 A;  1W2Z A;  1O7M B;  5D81 A;  2HMM B;  3LOY A;  4KFE A;  5TGN A;  1VZZ A;  4H61 A;  1OAC A;  1UUV B;  1BUQ A;  1OHS A;  2CHC A;  3FG4 A;  2B24 B;  3LTA A;  5EEO A;  5IEP A;  1N8R 4;  1A2K A;  1VQ5 3;  3FGY A;  3SOA A;  3UL5 A;  4ORL A;  1CQS A;  1JN5 A;  3GRD A;  5AIF A;  3MG1 A;  2O9U X;  1VQO 3;  3DUK A;  1DMQ A;  3M8C A;  3NM2 A;  2E2T A;  3D9R A;  3CMA 3;  3X40 A;  1IU7 A;  1E97 A;  4J9A A;  3L0R A;  1LNH A;  2BNG A;  3K7C A;  1A67 A;  1WMO A;  3GZB A;  4R1K A;  3SOY A;  5AI1 A;  1STD A;  2F99 A;  3SXX A;  1FUW A;  1JKG A;  1TP6 A;  5D82 A;  5FGO A;  1RJO A;  3JUO A;  4K61 A;  1WMN A;  4JRF A;  3EBY A;  3QRD A;  4PEJ A;  1IDP A;  4WHA A;  1Z1S A;  5AIG A;  1VQ9 3;  3K5T A;  1W6C A;  4HJL B;  3CD6 3;  3AMO A;  1NU3 A;  3KKG A;  4AKY A;  1JJ2 2;  1DVC A;  1IVW A;  3CU3 A;  3T0U A;  1VQ6 3;  3OWS A;  4AKZ A;  1K41 A;  2IMJ A;  3UB1 A;  2F98 A;  3PS8 A;  4XM4 A;  3JUM A;  3N54 B;  5JBS A;  1KWI A;  2Z76 A;  3JVC A;  4N6T A;  3HX8 A;  3VSY A;  3F9S A;  3CPW 2;  2QA4 3;  1NJI 4;  3B7C A;  2IUJ A;  2ML6 A;  5AYS C;  1O7N B;  1IQX A;  1UUW B;  5KP3 A;  3BND A;  1A2V A;  4FCJ A;  1TFK A;  1W7C A;  1SIH A;  1T5Y A;  1ROV A;  3B4P A;  3CCQ 3;  5AII A;  2RGQ A;  1N9E A;  3PGB A;  3UJM A;  3CC7 3;  3DGN A;  1Q40 B;  5FW5 A;  4HVN A;  2LQV A;  1IT8 A;  4MMY B;  1VQP 3;  1MNL A;  1YJW 3;  1US1 A;  1M1K 4;  1D6Y A;  4EBG A;  2CWT A;  4N6N B;  2YX9 A;  4L8O A;  3NUV A;  4EXR A;  1M1X B;  2D1W A;  3OW2 2;  1EQK A;  2D42 A;  2BHM A;  1S72 3;  1IVU A;  1IK3 A;  1W4N A;  3CXC 2;  1LVN A;  5AYR B;  1EKM A;  3NHX A;  1QVF 2;  3BB9 A;  4HKV B;  4FCM A;  4STD A;  1SJW A;  1WMP A;  2BMR B;  2GBX B;  2HMJ B;  3LXU X;  2QEX 3;  4FMD A;  2OQE C;  3B8L A;  1QAL A;  1JB2 A;  1FA3 A;  3S28 A;  5JPU A;  2STD A;  1GY7 A;  1YVB I;  3EE1 A;  3NX0 A;  3F40 A;  4HM2 B;  4LSO A;  1JV2 B;  3KE7 A;  4OUQ A;  5IEN A;  1CEW I;  1IVV A;  3LTB A;  1V74 A;  2Z6B A;  1W6G A;  4FMC A;  3PXM A;  3BLZ A;  1PU4 A;  1VQK 3;  3DGL A;  3LTC A;  4Q53 A;  1TU5 A;  2I9W A;  4O02 B;  1ASK A;  2W9Q A;  2ZDJ A;  3DY5 A;  2XSO B;  3HZP A;  3CCJ 3;  2OTJ 3;  3PZW A;  1QAF A;  3FZW A;  2PNC A;  3QK9 A;  4LGQ A;  3DZL A;  3DM8 A;  2XFT A;  1VQ7 3;  3EHC A;  1RN7 A;  1A90 A;  3WOF B;  2JQ5 A;  1OUN A;  5DRE A;  4WWU C;  1AV4 A;  2GEY A;  3I55 3;  2QGU A;  5KP4 A;  3Q1C A;  2MF7 A;  2GU3 A;  5D83 A;  3LH4 A;  4RNY A;  3J7Y d;  1ZX2 A;  3PCR A;  4O8S A;  3KSP A;  4OVM A;  1Q81 4;  2OQE A;  5G2G A;  3WA3 A;  3H51 A;  3DGM A;  2ZL8 A;  3NV0 A;  2CIU A;  4FCZ A;  5IER A;  4HZ9 B;  2K0M A;  4GL6 A;  1D6U A;  1W00 A;  1DYU A;  2HMO B;  3N8B A;  4MMZ B;  2QIY A;  2L4V A;  5HGR A;  1CYV A;  4R4K A;  2P0M A;  2OTL 3;  3ECF A;  3CPO A;  1QJG A;  1K28 A;  2RCD A;  1YGE A;  4EC6 A;  1JN5 B;  3NQZ A;  3FG3 A;  1JRQ A;  5I97 A;  3FH1 A;  1YIJ 3;  1GS3 A;  1NB3 I;  3JUN A;  1DMN A;  3GZY B;  3JUQ A;  3G8Z A;  1WQL B;  2W6J H;  5IEO A;  1TUH A;  1YI2 3;  2OOV C;  4RBN A;  4L7K A;  4KFD A;  4XB5 A;  5AIH A;  2SBL A;  2CFG A;  4LEH A;  3SED A;  1FGO A;  5IW9 A;  1JNQ A;  2GU1 A;  4X2O A;  1Q7Y 4;  1JKG B;  3HII A;  4GB5 A;  1W2B 2;  1KD1 4;  3STD A;  1K8A 4;  3EF8 A;  2V1L A;  5A0O B;  3MPH A;  3X41 A;  1L5G B;  1SQW A;  4RNZ A;  2CKF B;  2PZV A;  2HMN B;  2M7O A;  4LMI A;  5KP1 A;  1JB4 A;  4L8P A;  4MJD A;  2WOF A;  3CCR 3;  3G6E 3;  4K90 B;  3LT9 A;  1IT7 A;  1TFO A;  4J8T A;  2KXG A;  2A15 A;  1FGT A;  2YFJ B;  2Z77 A;  2CFD A;  5LC7 A;  3F14 A;  4EV5 A;  5IG5 A;  3CC4 3;  3BNC A;  1ULI B;  1U8C B;  1RKY A;  2OCT A;  3FF2 A;  1GYB A;  2E2V A;  2YFI B;  2XGN A;  1M90 4;  1LOX A;  1EG9 B;  4HM3 B;  2W2C A;  5CF2 A;  1F8N A;  2HML B;  1TIJ A;  5BVB A;  1OPY A;  1W01 A;  1KC8 4;  3MYT A;  2Z7A A;  1UI8 A;  3WOD G;  2R4I A;  1O7W B;  3H3H A;  3GAX A;  3X3Z A;  4HZB B;  1Q42 A;  4CCV A;  2Y74 A;  3BNE A;  1QAK A;  4U13 A;  3IMA B;  3EQQ B;  4FR9 A;  3FF0 A;  3FG1 A;  4XBY A;  3KN4 A;  1ULJ B;  4N3V A;  3HK4 A;  3I0Y A;  1NB5 I;  4O3V A;  1NO3 A;  1IV9 A;  4WYK A;  1OF5 A;  3G16 A;  4K1U A;  4AEQ A;  3JUP A;  1UI7 A;  3Q2P A;  3NBJ A;  1RRH A;  3U97 A;  2RFR A;  1VQL 3;  1UW1 A;  3DXO A;  3LML A;  1KQS 2;  4KFF A;  4NRE A;  2KCD A;  5IG4 A;  5DRV A;  1FGM A;  2CFL A;  3A76 A;  3EN8 A;  1GD4 A;  2WGQ A;  2XRX B;  2W04 A;  2CK3 H;  4HM8 B;  3K9M C;  3EX9 A;  3GZR A;  3LZA A;  1NDO B;  3CCS 3;  1JB5 A;  3CCU 3;  4BTW A;  1U5O A;  2CWV A;  4WFO A;  2W9P A;  4MMX B;  2LYX A;  5CLK A;  2XGL A;  3IPT A;  3EBT A;  3OXA A;  5AEU B;  2F86 B;  3CME 3;  1QMA A;  4FMB A;  3G0K A;  2BMO B;  1OHO A;  3F7S A;  2CG0 A;  1GY5 A;  4H3U A;  1AVK A;  4EYC A;  1J2B A;  3DGO A;  4N6O B;  3RGR A;  1IVX A;  4HM7 B;  5STD A;  1YJ9 3;  1W6Y A;  1E3R A;  1OCV A;  2W56 A;  3V98 A;  4N6L A;  3MSO A;  4R80 A;  4R9L A;  3ROB A;  1STF I;  1DVD A;  2BT3 A;  3D3L A;  2XR8 B;  3MG2 A;  7STD A;  3UNL A;  4KVH A;  3O8Y A;  4RZM A;  4HM4 B;  2C11 A;  4BTY A;  1YHQ 3;  5BXQ A;  1GD3 A;  2FGT A;  4OK0 A;  3S27 A;  2KRT A;  2Y73 A;  2WO0 A;  4HYZ A;  3SVA A;  1N5H A;  2XH9 A;  3NBR A;  3CCL 3;  3S29 A;  1M9G A;  3MKI A;  3RGA A;  3N9H A;  4IIA A;  1VQ4 3;  1N5P A;  1VQN 3;  2W03 A;  3F8H A;  4R9K A;  3FLJ A;  1O7H B;  3F8X A;  3X3Y A;  3LYG A;  3PYJ A;  3UL6 A;  5IG3 A;  2OWP A;  1D6Z A;  1FGQ A;  1S5A A;  3AMO B;  4MEI A;  3OWU A;  2CW9 A;  3ER7 A;  3CCV 3;  2CH9 A;  1FGR A;  2Q07 A;  2IA7 A;  3DMC A;  4FMA A;  3U1W A;  3MG3 A;  5LC6 A;  2INX A;  2XSH B;  4HBR A;  5AEW B;  3EJV A;  1E3V A;  1OGX A;  3PCS A;  1PFP A;  1O7G B;  4XBT A;  3NM7 A;  1QVG 2;  2YFL B;  2WGO A;  4N6M A;  5ELJ A;  4ZM8 A;  4KZ1 A;  3ALA A;  3S5C A;  2JDI H;  1IQ8 A;  3MHE A;  4I4K A;  5EQL A;  2WOH A;  2OOV A;  3G71 3;  1IV7 A;  2CFK A;  2FNQ A;  1YJN 3;  2MC8 A;  2HMK B;  5IG0 A;  5JPP A;  8CHO A;  1W02 A;  3CNX A;  2CG1 A;  3F7X A;  3I56 3;  1K9M 4;  1OHP A;  1LXE A;  1RRL A;  4IT7 A;  4K1V A;  1AR0 A;  3WA2 X;  1GY6 A;  3T8U A;  1OH0 A;  1HKX A;  2P38 A;  1K73 4;  3HIG A;  3WMD A;  1IQY A;  4BTX A;  3FKA A;  1EA2 A;  3V99 A;  4N6V 0;  3X3X A;  3SLU A;  3VGN A;  1Q86 4;  2O3O A;  3BNB A;  3TDG A;  1ISK A;  4TX4 A;  2GBW B;  3NXJ A;  3V92 A;  4HM5 B;  1Q40 A;  3MWZ A;  3FSD A;  4WYK B;  5CXO A;  2FXT A;  3K0Z A;  3CNM A;  3EN1 B;  5CK6 A;  1OF5 B;  3EC9 A;  3FCS B;  1N8Q A;  3OWY A;  4NHF A;  3T8N A;  2CFW A;  2ML5 A;  3GWR A;  3CCM 3;  2RSX A;  1VQM 3;  6STD A;  4QWT A;  3NBB A;  2BMQ B;  1N9J A;  3K63 A;  1WNH A;  3KFQ C;  2C10 A;  1ZO2 A;  3EB8 A;  2P05 A;  4WP5 A;  1VQ8 3;  3LT8 A;  2E2U A;  3WDG B;  1G96 A;  1C7H A;  1DMM A;  3OV4 A;  3Q90 A;  3SX1 A;  3E99 A;  4HM1 B;  1ROA A;  4LZI A;  4CDL A;  2K54 A;  1KSI A;  3CC2 3;  5CF1 A;  1O7P B;  4XBX A;  5ELU A;  2P0X A;  1MOL A;  4XDV A;  2XF3 A;  1Y4K A;  1OGZ A;  2BO9 B;  3KSE D;  3KZT A;  3KII A;  1AVL A;  3WOE B;  1CYU A;  4IPB A;  3S67 A;  4HM0 B;  3NQY A;  1SII A;  2GXF A;  3OX9 A;  1WTH A;  4EV2 A;  3G4S 3;  2XFS A;  2GEX A;  1NWW A;  1Q82 4;  3HI7 A;  2CWU A;  2CC3 A;  2W0Q A;  3NV0 B;  4N6U A;  3RDE A;  2W56 B;  2P09 A;  4X2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...