3UJMA

Crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rasputin
publication title Crystal structure of the Rasputin NTF2-like domain from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ujmA00
4H3UA 3SOYA 3DMCA 3B4PA 1OCVA 3NV0B 4GB5A 5G2GA 3F9SA 5BVBA 1E3VA 4STDA 1JKGB 3EX9A 4HZ9B 2XSHB 2HMKB 3JUNA 3OV4A 4HZBB 2INXA 5CLKA 4OUQA 5IG3A 4R9LA 4L8PA 1UUVB 2GBXB 1JB4A 3FLJA 3F14A 3DUKA 2XRXB 3KZTA 2GBWB 4XDVA 3T8NA 4HM5B 2GXFA 3D9RA 3MG1A 3UJMA 1GY7A 4R1KA 1OHPA 3ECFA 3F40A 3Q90A 1O7GB 1OHOA 3GRDA 1ZO2A 3SEDA 3FH1A 4MJDA 4Q53A 2I9WA 2F86B 1BUQA 1OH0A 1UUWB 3ROBA 4XBXA 1Z1SA 3H3HA 3STDA 2B24B 4I4KA 1GYBA 1K41A 3BB9A 3E99A 1HKXA 3F8XA 1A2KA 2W2CA 3BLZA 3FF2A 3A76A 3DXOA 4HM0B 2BNGA 3MKIA 1NU3A 2R4IA 4WP5A 4XDWA 4LGQA 3JUOA 3M8CA 1AR0A 3KKGA 3EQQB 4R9KA 2OWPA 3GZXB 2STDA 3RGAA 2PZVA 4K1VA 4L7KA 5IG5A 3JUMA 1OPYA 4WWUC 4PEJA 5DRVA 1O7PB 1JN5B 1OF5B 2BMQB 2F99A 1ISKA 5AIGA 2K54A 4RZMA 1S5AA 4J9AA 4XBYA 5IERA 3IPTA 1WQLB 5JPPA 1W00A 4X2HA 4LMIA 5AI1A 3VGNA 3NM2A 1JB5A 1Q42A 3WMDA 3FF0A 2YFIB 3GWRA 4HM8B 2IMJA 2RFRA 2B1XB 1DMMA 4HM4B 2HMMB 3FSDA 5IENA 1DMNA 7STDA 3B4OA 5STDA 5AIHA 2GEXA 3CU3A 4ORLA 3VSYA 3NV0A 1DMQA 1GS3A 1JN5A 3GZBA 1JKGA 4U13A 1OF5A 1OGXA 3B8LA 3UNLA 5D81A 1IDPA 1U5OA 5IG0A 5KP4A 5CF1A 3MHEA 4HKVB 3EHCA 2RCDA 4HVNA 4KVHA 1TP6A 2QGUA 1W6YA 5D82A 3CNMA 3F7XA 3DM8A 3NUVA 1OHSA 2A15A 1W02A 3G0KA 1C7HA 2GEYA 3MG2A 3EJVA 3MYTA 4WYKB 2XSOB 3LZAA 5FW5A 3CNXA 2Z7AA 3S5CA 3JUPA 3NBRA 5IF6A 1Q40B 3OWUA 4HM1B 5EVHA 1O7NB 2RGQA 3H51A 3OWYA 3RGRA 5IEPA 3T8UA 1E97A 1ULIB 2HMOB 3JUQA 3SOAA 1E3RA 3EC9A 3G16A 1EA2A 3FKAA 5BXQA 3HK4A 3OWSA 3F8HA 1QJGA 3KSPA 1NDOB 5CXOA 5JPUA 2CHCA 2YFJB 2HMLB 5KP3A 3K0ZA 5IEOA 3OX9A 4LEHA 2CKFB 1QMAA 1O7MB 2BMRB 3K7CA 2JQ5A 4FCMA 5TGNA 2Z76A 3CPOA 4XM4A 3GZRA 1NWWA 2XR8B 1GY5A 1ASKA 5CF2A 5AIFA 4WYKA 1STDA 2BMOB 1TUHA 5AIIA 5DREA 4FCJA 3HX8A 4L8OA 3KE7A 3I0YA 1Q40A 4XBTA 1JB2A 5AEWB 3DZLA 4IIAA 5AEUB 4CDLA 3GZYB 3EBTA 3G8ZA 3EN8A 1ZX2A 2YFLB 1EG9B 4HJLB 3NHXA 1W01A 4HM6B 4HM2B 5IG4A 4OVMA 5KP1A 2HMJB 3F7SA 3NXJA 2UX0A 3FZWA 3EN1B 1CQSA 3FGYA 1ULJB 1VZZA 3EBYA 2QIYA 8CHOA 4HM7B 1SJWA 4K1UA 4X2OA 1O7HB 3LYGA 4J8TA 3OXAA 3ER7A 2Z77A 3HZPA 4HM3B 5D83A 4N3VA 2HMNB 3MG3A 1GY6A 1OUNA 1O7WB 3EF8A 3MSOA 5CK6A 6STDA 5HGRA 4XB5A 1OGZA 2F98A 3B7CA
chains in the Genus database with same CATH superfamily
3HIIA 1TTOA 3J7Yd 4H3UA 1CYUA 3SOYA 3DMCA 3LOYA 3ZG0A 2XEPA 3B4PA 3IJEB 3Q1CA 2OQEC 1FZUA 2BT3A 1BNFA 1B27A 1OCVA 1N8R4 2UGIA 3URPA 3D79A 3NV0B 4MMZB 2XH9A 4GB5A 5G2GA 3F9SA 5BVBA 5HOHA 1EUIC 1E3VA 1MNLA 4R80A 4STDA 3N9HA 1JKGB 1I2FA 3I553 3EX9A 4J5GA 4RNTA 1BRJA 3ALAA 4HZ9B 3CCU3 1BSCA 1U8CB 4NREA 2XF3A 3AGOA 1LOYA 2KF3A 3UL5A 3CPW2 2XSHB 5G1LA 3UB1A 1GMRA 1BRGA 1RCKA 2HMKB 3JUNA 3OV4A 2ZHXB 1K28A 1JRQA 3CC73 3BNEA 1RDSA 4FMCA 4K61A 3K63A 4HZBB 1YIJ3 1I3IA 1FGRA 1YGWA 3EB8A 3LTCA 1YGEA 2ZL8A 2C10A 4BL3A 2F5WA 2FGTA 2INXA 2OOVC 4MMYB 1VQ73 5CLKA 1NO3A 1D6YA 4OUQA 4EXRA 1A90A 1IV7A 1IQXA 2RSXA 5IG3A 4KZ1A 4R9LA 4L8PA 1UUVB 3X3ZA 2Q07A 4ILFA 7GSPA 3G6E3 1A2VA 1US1A 2KF5A 2GBXB 1JB4A 3LTAA 1UW1A 3FLJA 3F14A 1IV9A 2BU4A 3DUKA 3LTBA 2XRXB 3KZTA 1NB5I 2GBWB 1RGGA 1LOWA 1DETA 1BANA 4XDVA 1ZGXA 3T8NA 3WR2A 4HM5B 1JBTA 2D1WA 1TJDA 2GXFA 2SBLA 3D9RA 3MG1A 4FCZA 4N6MA 2L4VA 4GSPA 1B2MA 3KN4A 4H61A 1MWUA 3O8YA 3QRDA 5BU4A 2IUKA 1A67A 1B20A 3RDEA 3UJMA 3V92A 1I2EA 1GY7A 4R1KA 1OHPA 1I2GA 2Z6BA 2IYJA 1MGWA 1RHLA 3CCE3 4O02B 4CCVA 2W9QA 1IVUA 1RGFA 3ECFA 1Y4KA 2C4BA 3F40A 4KT3B 3U97A 3N54B 3VF1A 1IK3A 4CPKA 3Q90A 1O7GB 1OHOA 2HOHA 1ZO2A 2CFLA 2CX1A 3GRDA 3SEDA 3Q3FA 3FH1A 4MJDA 4Q53A 1UGHI 1W2ZA 2F86B 2BIRA 1LOVA 1OH0A 2I9WA 2KCDA 3HIGA 1BUQA 1IVWA 3S27A 1DVDA 1UUWB 1JV2B 3ROBA 1HYFA 4XBXA 1UCJA 2K0MA 1Z1SA 3H3HA 1FUWA 2W6JH 3STDA 2E2UA 2B24B 2XGNA 9RNTA 2ZA4A 4O8SA 3AHSA 4N6OB 1K9M4 3FG3A 2FNQA 1JBSA 1FW7A 1BNEA 1DYUA 1GYBA 3HOHA 4I4KA 4AEQA 1EQKA 1V74A 5G1KA 3CC23 1K41A 1FUSA 3BB9A 1T3BA 1BAOA 1TFOA 2CX0A 1PU4A 3E99A 1HKXA 5LC7A 1WMNA 4AKZA 3F8XA 1QVG2 1A2KA 2W2CA 3BLZA 4JF8A 5JBSA 1QAFA 3FF2A 1RRLA 1RGAA 3A76A 3DGMA 1FUTA 1MOLA 3DXOA 1BVIA 1BSDA 4HM0B 3PCSA 2BNGA 3MKIA 3CCL3 1RMSA 5M18A 1RJOA 1M1XB 1K8A4 1BSAA 8RNTA 2W03A 1NU3A 2R4IA 4WP5A 4XDWA 1RGHA 2IA7A 2WOHA 2SARA 2OTL3 2WGQA 4LGQA 1Q9EA 4CJNA 2H0IA 5GSPA 1AV4A 1M9GA 3CXC2 1IT7A 3JUOA 1YIT3 3FG1A 1NNVA 3M8CA 1VQ43 1AR0A 3KKGA 3SX1A 1TFKA 3KIIA 3EQQB 4R9KA 1RTUA 1GMPA 1WMPA 5I97A 1LRAA 3LH4A 2OWPA 1DVCA 1VQ83 2ML5A 2CWUA 2Y74A 4BL2A 3GZXB 1B2SA 2STDA 3RGAA 1GOYA 2PZVA 4K1VA 4N6TA 4L7KA 2LQVA 4KFDA 1TU5A 1C54A 5IG5A 1TRQA 3JUMA 1OPYA 4WWUC 3S29A 4PEJA 5DRVA 1OACA 1O7PB 1SARA 1JN5B 2WO0A 3CCS3 3S28A 1BGSA 3D5IA 4BU4A 4RNZA 3A5EA 1OF5B 2BMQB 4DKIA 2F99A 1ISKA 1F8NA 4K90B 5AIGA 2K54A 4RZMA 1S5AA 4J9AA 3PCRA 1UCIA 2P0MA 4XBYA 4WHAA 4AKYA 3N8BA 5IERA 3IPTA 1WQLB 1VQM3 5JPPA 3BU4A 1PFPA 3DH2A 1W00A 1PY3A 3GAXA 3L0RA 1BRSA 2CK3H 4HBRA 4HOHA 4LMIA 4O2HA 4X2HA 5AI1A 3VGNA 3I563 1SIIA 5FGOA 2E2VA 3NM2A 4N6UA 1S723 1JB5A 1W7CA 1Q42A 4KFFA 4HAAA 3WMDA 2WOFA 7RNTA 2RBIA 4GHOA 3FF0A 3ZG5A 2R41A 3CME3 1D6UA 1N5PA 1W6CA 2YFIB 1GMQA 4RNYA 1DE3A 1KWIA 1T5YA 3GWRA 1W6GA 1AVLA 3UL6A 1GSPA 1VQN3 4HM8B 3DY5A 2OCTA 3WDGB 1RGKA 1I0XA 1VQQA 2RNTA 2D42A 2IMJA 1RGEA 4IPBA 2RFRA 2B1XB 1DMMA 1IQ8A 1MGRA 1RN1A 1EKMA 1Q7Y4 1AQZA 1MWSA 4HM4B 1QALA 2CFWA 2HMMB 2WGOA 1GOUA 1HU9A 3FSDA 2V1LA 3Q2PA 1BSEA 1RNTA 3BNBA 5IENA 1V57A 1DMNA 1LQGC 1BSBA 1TIJA 2W56B 2O3OA 1BRHA 7STDA 3B4OA 5STDA 1CEWI 1I0VA 3FCSB 2W0QA 5AIHA 1J2BA 2GEXA 1D6ZA 3SYUA 3CU3A 3QK9A 1UCKA 4ORLA 3VSYA 3NV0A 1BUJA 2W04A 1DMQA 2Y73A 3NX0A 3WODG 1UCLA 1ROAA 4ZM8A 1GS3A 1IU7A 1N9JA 6RNTA 1JN5A 3GZBA 4LYLB 3FG4A 3HI7A 1HZ1A 1CH0A 1JKGA 4U13A 3DGLA 1FGQA 1LNIA 1VQ93 1OF5A 3BNDA 1OGXA 1BNSA 2CFKA 1JZDA 3B8LA 4NPBA 3UNLA 1VQP3 5D81A 1RGCA 4N6LA 3DGYA 2PNCA 4EV2A 3V98A 1B2UA 1G02A 1IDPA 1U5OA 1RKYA 1JBRA 5IG0A 3SXXA 2W9PA 1N9EA 5KP4A 3NQZA 1RRHA 5CF1A 3MHEA 2CIUA 1N5HA 1A2PA 4HKVB 2ZDJA 3U1WA 3EHCA 1YVSA 5RNTA 1BRNL 1BIRA 3LXUX 1YJ93 1RN4A 1ROVA 1V58A 2RCDA 1AY7A 3GSPA 4HVNA 3PXMA 2KAAA 3LT8A 1BNGA 2IUJA 2JDIH 1TP6A 2QGUA 4KVHA 2GSPA 4KFEA 1FGMA 4EYCA 5EQLA 4N6NB 1W6YA 1YVBI 5D82A 5AYRB 3CNMA 3F7XA 1Q814 3DM8A 1VQ53 3NUVA 1OHSA 1RLSA 2A15A 1W02A 2IY2A 2YX9A 3G0KA 3WA2X 1GOVA 1C7HA 4NHFA 1G96A 2GEYA 3PGBA 5LC6A 1I70A 5ELJA 1I3FA 3NBBA 3MG2A 3G4S3 3EJVA 3MYTA 4EBGA 1QAKA 2FXTA 3PS8A 4WYKB 2XSOB 3BNCA 2E2TA 1EEJA 3LZAA 5ELUA 3X3XA 1BRIA 5FW5A 1MWRA 4LZIA 1Q7HA 3CNXA 4EW5A 2Z7AA 1MWTA 3DGOA 1BNRA 1RCLA 1R4YA 3LTDA 3S5CA 5A0OB 1LOXA 3JUPA 2MC8A 1SQWA 1WMOA 1IVVA 3NBRA 5IF6A 3CMA3 1IQYA 1Q40B 3WA3A 3OWUA 1R4CA 1TRPA 3CC43 4HM1B 4TX4A 5EVHA 1VQK3 1N8QA 1PYLA 1O7NB 2RGQA 3H51A 3OWYA 1UGIA 3RGRA 5IEPA 3T8UA 1E97A 1SIHA 1YHQ3 1B2XA 3X42A 3NQYA 2K3DA 1ULIB 2J8XB 3AHWA 2HMOB 3JUQA 3MWZA 1FGOA 3SOAA 3D3LA 4OK0A 2GU3A 1E3RA 3EC9A 1BNIA 1RNBA 3G16A 1EA2A 1YNVX 3FKAA 5BXQA 3HK4A 3OWSA 3F8HA 4BTXA 1QJGA 3KSPA 2QEX3 1NDOB 3AGNA 5CXOA 1I8VA 5JPUA 2KRTA 2BHMA 3CCM3 2CHCA 2YFJB 2HMLB 5KP3A 3K0ZA 1CYVA 4JRFA 3CCV3 3MPHA 5IEOA 3OX9A 2BO9B 2KF4A 3NBJA 4LEHA 2CKFB 1QMAA 3CCR3 2CW9A 2XGLA 4RBNA 1O7MB 1X1WA 1ZS7A 2CFGA 2P05A 4IT7A 1VQL3 1UI8A 2CC3A 5IW9A 2BMRB 3K7CA 2JQ5A 1T2IA 4J5KA 3V99A 3EE1A 2C11A 4FCMA 4EV5A 5TGNA 2Z76A 3CPOA 3AMOB 3X3YA 4FMDA 4XM4A 1YI23 1X1XA 3GZRA 1NWWA 3NM7A 1W5ZA 3PZWA 3BIRA 1STFI 1W4NA 4BTWA 2XR8B 3K9MC 1L5GB 2MF7A 1GY5A 1LQMB 4I5QA 4BIRA 1Q824 1ASKA 5CF2A 1BNJA 4GL6A 5AIFA 1YJN3 5BIRA 4WYKA 1QVF2 1VQ63 2OQEA 1STDA 2O9UX 2BMOB 1RGLA 1TUHA 1IYYA 2F5MA 5AIIA 1FYSA 1LNHA 5DREA 4WFOA 1T2HA 4FMBA 4LSOA 4FCJA 3HX8A 1GD4A 1RN7A 4L8OA 1KSIA 3I0YA 3KE7A 4MMXB 3WOEB 1Q40A 1Q864 1M1K4 4R4KA 3WHOA 1YJW3 3KSED 4XBTA 2KF6A 1JB2A 5EEOA 5AEWB 3DZLA 4IIAA 2P09A 1K734 5AEUB 1JNQA 4CDLA 3G713 1B2ZA 3RNTA 3CCQ3 2CG1A 3GZYB 3K5TA 3EBTA 3ZFZA 3G8ZA 6GSPA 3EN8A 1ZX2A 2YFLB 1X1UA 1EG9B 3T0UA 4O3VA 2CH9A 2CWTA 4HJLB 2OOVA 5AYSC 3NHXA 2H0HA 1W01A 3JVCA 2F56A 2P38A 4HM6B 1FA3A 4HM2B 5IG4A 2F4YA 3D5GA 4OVMA 1IT8A 1BOXA 1WTHA 5KP1A 2HMJB 4N6V0 3F7SA 3S67A 3NXJA 2UX0A 5M19A 3IMAB 3FZWA 2L1SA 3EN1B 4QWTA 1CQSA 2LYXA 1IVXA 3FGYA 1UDII 1AVKA 1ULJB 1VZZA 2CG0A 3SLUA 1X1YA 1NB3I 1RSNA 2QIYA 3EBYA 8CHOA 1UUGB 2QA43 1UI7A 2UUGC 3AMOA 4HM7B 1KD14 1SJWA 2CWVA 3KCHA 4K1UA 1W2B2 1FGTA 1SPUA 4X2OA 1O7HB 3TDGA 3LYGA 4MEIA 2AAEA 3D4AA 3KFQC 4J8TA 2M7OA 2H0GA 4G1MB 3OXAA 3ER7A 2OTJ3 3X41A 1G0TA 3WOFB 2GU1A 1BU4A 2Z77A 3X40A 3HZPA 2KXGA 2W56A 4HM3B 4HYZA 2XFTA 5D83A 4EC6A 3OW22 1VQO3 2P0XA 4BTYA 4N3VA 4FR9A 1LVNA 2HMNB 3MG3A 1GY6A 1B3SA 1OUNA 2ML6A 1NJI4 1KQS2 1O7WB 1BRKA 5M1AA 1GD3A 3EF8A 3MSOA 4FMAA 3SVAA 3CCJ3 5CK6A 6STDA 3PYJA 3DGNA 4XB5A 5HGRA 1KC84 1B21A 1OGZA 1WNHA 1JJ22 2F98A 3B7CA 3CD63 2CFDA 1LXEA 3LMLA 1M904 2XFSA 1JZOA 3LT9A 2AADA
chains in the Genus database with same CATH topology
3HIIA 3J7Yd 4H3UA 1CYUA 3SOYA 3DMCA 3LOYA 2XEPA 3B4PA 3IJEB 3Q1CA 2OQEC 2BT3A 1OCVA 1N8R4 3NV0B 4MMZB 2XH9A 4GB5A 5G2GA 3F9SA 5BVBA 4R80A 1E3VA 1MNLA 4STDA 3N9HA 1JKGB 3I553 3EX9A 3ALAA 4HZ9B 3CCU3 1U8CB 4NREA 2XF3A 3UL5A 3CPW2 2XSHB 3UB1A 2HMKB 3JUNA 3OV4A 1K28A 1JRQA 3CC73 3BNEA 4FMCA 4K61A 3K63A 4HZBB 1YIJ3 1FGRA 3EB8A 3LTCA 1YGEA 2ZL8A 2C10A 2FGTA 2INXA 2OOVC 4MMYB 1VQ73 5CLKA 1NO3A 1D6YA 4OUQA 4EXRA 1A90A 1IV7A 1IQXA 2RSXA 5IG3A 4KZ1A 4R9LA 4L8PA 1UUVB 3X3ZA 2Q07A 3G6E3 1A2VA 1US1A 2GBXB 1JB4A 3LTAA 1UW1A 3FLJA 3F14A 1IV9A 3DUKA 3LTBA 2XRXB 3KZTA 1NB5I 2GBWB 4XDVA 3T8NA 4HM5B 2D1WA 2GXFA 2SBLA 3D9RA 3MG1A 4N6MA 4FCZA 2L4VA 3KN4A 4H61A 3O8YA 3QRDA 2IUKA 1A67A 3RDEA 3UJMA 3V92A 1GY7A 4R1KA 1OHPA 2Z6BA 3CCE3 4O02B 4CCVA 2W9QA 1IVUA 3ECFA 3F40A 1Y4KA 3VF1A 3U97A 3N54B 1IK3A 3Q90A 1O7GB 1OHOA 3GRDA 1ZO2A 2CFLA 3SEDA 3FH1A 4MJDA 4Q53A 1W2ZA 2F86B 2I9WA 2KCDA 1OH0A 3HIGA 1BUQA 1DVDA 1IVWA 3S27A 1UUWB 1JV2B 3ROBA 4XBXA 2K0MA 1Z1SA 3H3HA 1FUWA 2W6JH 3STDA 2E2UA 2B24B 2XGNA 4O8SA 4N6OB 1K9M4 3FG3A 2FNQA 1DYUA 1GYBA 4I4KA 1EQKA 4AEQA 1V74A 3CC23 1K41A 3BB9A 1TFOA 1PU4A 3E99A 1HKXA 5LC7A 1WMNA 4AKZA 3F8XA 1QVG2 1A2KA 2W2CA 3BLZA 4JF8A 5JBSA 1QAFA 3FF2A 1RRLA 3A76A 3DGMA 1MOLA 3DXOA 4HM0B 3PCSA 2BNGA 3MKIA 3CCL3 1K8A4 1RJOA 1M1XB 2W03A 1NU3A 2R4IA 4WP5A 4XDWA 2IA7A 2WOHA 2OTL3 2WGQA 4LGQA 1AV4A 1M9GA 3CXC2 1IT7A 3JUOA 1YIT3 3FG1A 3M8CA 1VQ43 1AR0A 3KKGA 3SX1A 1TFKA 3KIIA 3EQQB 4R9KA 1WMPA 5I97A 3LH4A 2OWPA 1DVCA 1VQ83 2ML5A 2CWUA 2Y74A 3GZXB 2STDA 3RGAA 4N6TA 2PZVA 4K1VA 4L7KA 2LQVA 4KFDA 1TU5A 5IG5A 3JUMA 1OPYA 4WWUC 3S29A 4PEJA 5DRVA 1OACA 1O7PB 1JN5B 2WO0A 3CCS3 3S28A 4RNZA 1OF5B 2BMQB 2F99A 1ISKA 1F8NA 4K90B 5AIGA 2K54A 4RZMA 1S5AA 4J9AA 3PCRA 2P0MA 4XBYA 4WHAA 4AKYA 3N8BA 5IERA 3IPTA 1WQLB 1VQM3 5JPPA 3L0RA 1PFPA 4HBRA 1W00A 3GAXA 4O2HA 4X2HA 2CK3H 2MC8A 4LMIA 5AI1A 3VGNA 1SIIA 5FGOA 2E2VA 3NM2A 4N6UA 1S723 1JB5A 1W7CA 1Q42A 4KFFA 3WMDA 2WOFA 3FF0A 3CME3 1D6UA 1N5PA 1W6CA 2YFIB 4RNYA 1KWIA 1T5YA 3GWRA 1W6GA 1AVLA 3UL6A 1VQN3 4HM8B 3DY5A 2OCTA 3WDGB 2D42A 2IMJA 4IPBA 2RFRA 2B1XB 1DMMA 1IQ8A 1EKMA 1Q7Y4 4HM4B 1QALA 2CFWA 2HMMB 2WGOA 1HU9A 3FSDA 2V1LA 3Q2PA 3BNBA 5IENA 1DMNA 1TIJA 2W56B 2O3OA 7STDA 3B4OA 5STDA 1CEWI 3FCSB 2W0QA 5AIHA 1J2BA 2GEXA 1D6ZA 3CU3A 3QK9A 4ORLA 3VSYA 3NV0A 2W04A 1DMQA 2Y73A 3NX0A 3WODG 1ROAA 4ZM8A 1GS3A 1IU7A 1N9JA 3I563 1JN5A 3GZBA 3FG4A 3HI7A 1JKGA 4U13A 3DGLA 1FGQA 1VQ93 1OF5A 3BNDA 1OGXA 2CFKA 3B8LA 1VQP3 3UNLA 5D81A 4N6LA 2PNCA 4EV2A 3V98A 1IDPA 1U5OA 1RKYA 5IG0A 3SXXA 2W9PA 1N9EA 5KP4A 3NQZA 1RRHA 5CF1A 3MHEA 2CIUA 1N5HA 4HKVB 2ZDJA 3U1WA 3EHCA 3LXUX 1YJ93 1ROVA 2RCDA 4HVNA 3PXMA 3LT8A 2IUJA 2JDIH 1TP6A 2QGUA 4KVHA 4KFEA 1FGMA 4EYCA 5EQLA 4N6NB 1W6YA 1YVBI 5D82A 5AYRB 3CNMA 3F7XA 1Q814 3DM8A 1VQ53 3NUVA 1OHSA 3WA2X 2A15A 1W02A 3G0KA 2YX9A 1C7HA 4NHFA 1G96A 2GEYA 3PGBA 5LC6A 5ELJA 3NBBA 3MG2A 3G4S3 3EJVA 3MYTA 4EBGA 1QAKA 2FXTA 3PS8A 4WYKB 2XSOB 3BNCA 2E2TA 3LZAA 5ELUA 3X3XA 5FW5A 4LZIA 3CNXA 2Z7AA 3DGOA 3LTDA 3S5CA 5A0OB 1LOXA 3JUPA 1SQWA 1WMOA 1IVVA 3NBRA 5IF6A 3CMA3 1IQYA 1Q40B 3WA3A 3OWUA 1R4CA 3CC43 4HM1B 4TX4A 5EVHA 1VQK3 1N8QA 1O7NB 2RGQA 3H51A 3OWYA 3RGRA 5IEPA 3T8UA 1E97A 1SIHA 1YHQ3 3X42A 3NQYA 1ULIB 2HMOB 3JUQA 3MWZA 1FGOA 3SOAA 3D3LA 4OK0A 2GU3A 1E3RA 3EC9A 3G16A 1EA2A 3FKAA 5BXQA 3HK4A 3OWSA 3F8HA 4BTXA 1QJGA 3KSPA 2QEX3 1NDOB 5CXOA 5JPUA 2KRTA 2BHMA 3CCM3 2CHCA 2YFJB 2HMLB 5KP3A 3K0ZA 1CYVA 4JRFA 3CCV3 3MPHA 5IEOA 3OX9A 2BO9B 3NBJA 4LEHA 2CKFB 1QMAA 3CCR3 2CW9A 2XGLA 4RBNA 1O7MB 2CFGA 2P05A 4IT7A 1VQL3 1UI8A 2CC3A 5IW9A 2BMRB 3K7CA 2JQ5A 3V99A 3EE1A 2C11A 4FCMA 4EV5A 5TGNA 2Z76A 3CPOA 3AMOB 3X3YA 4FMDA 4XM4A 1YI23 3GZRA 3PZWA 1NWWA 3NM7A 1W5ZA 1STFI 1W4NA 4BTWA 2XR8B 3K9MC 1L5GB 2MF7A 1GY5A 1Q824 1ASKA 5CF2A 4GL6A 5AIFA 1YJN3 4WYKA 1QVF2 1VQ63 2OQEA 1STDA 2O9UX 2BMOB 1TUHA 5AIIA 5DREA 1LNHA 4WFOA 4FMBA 4LSOA 4FCJA 3HX8A 1GD4A 1RN7A 4L8OA 1KSIA 3I0YA 3KE7A 4MMXB 3WOEB 1Q40A 1Q864 1M1K4 4R4KA 1YJW3 3KSED 4XBTA 1JB2A 5EEOA 5AEWB 3DZLA 4IIAA 2P09A 1K734 5AEUB 1JNQA 4CDLA 3G713 3CCQ3 2CG1A 3GZYB 3K5TA 3EBTA 3G8ZA 3EN8A 1ZX2A 2YFLB 1EG9B 3T0UA 4O3VA 2CH9A 2CWTA 4HJLB 2OOVA 5AYSC 3NHXA 1W01A 3JVCA 4HM6B 2P38A 1FA3A 4HM2B 5IG4A 4OVMA 1IT8A 1WTHA 5KP1A 2HMJB 4N6V0 3F7SA 3S67A 3NXJA 2UX0A 3IMAB 3FZWA 3EN1B 4QWTA 1CQSA 2LYXA 1IVXA 3FGYA 1AVKA 1ULJB 1VZZA 2CG0A 3SLUA 1NB3I 3EBYA 2QIYA 8CHOA 2QA43 1UI7A 3AMOA 4HM7B 1KD14 1SJWA 2CWVA 4K1UA 1W2B2 1FGTA 1SPUA 4X2OA 1O7HB 3TDGA 3LYGA 4MEIA 3KFQC 4J8TA 2M7OA 4G1MB 3OXAA 3ER7A 2OTJ3 3X41A 3WOFB 2GU1A 3X40A 2Z77A 3HZPA 2KXGA 2W56A 4HM3B 4HYZA 2XFTA 5D83A 4EC6A 3OW22 1VQO3 2P0XA 4BTYA 4N3VA 4FR9A 1LVNA 2HMNB 3MG3A 1GY6A 1OUNA 1NJI4 2ML6A 1KQS2 1O7WB 1GD3A 3EF8A 3MSOA 4FMAA 3SVAA 3CCJ3 5CK6A 6STDA 3PYJA 3DGNA 4XB5A 5HGRA 1KC84 1OGZA 1WNHA 1JJ22 2F98A 3B7CA 3CD63 2CFDA 1LXEA 3LMLA 1M904 2XFSA 3LT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3U A;  3SOY A;  3DMC A;  3B4P A;  1OCV A;  3NV0 B;  4GB5 A;  5G2G A;  3F9S A;  5BVB A;  1E3V A;  4STD A;  1JKG B;  3EX9 A;  4HZ9 B;  2XSH B;  2HMK B;  3JUN A;  3OV4 A;  4HZB B;  2INX A;  5CLK A;  4OUQ A;  5IG3 A;  4R9L A;  4L8P A;  1UUV B;  2GBX B;  1JB4 A;  3FLJ A;  3F14 A;  3DUK A;  2XRX B;  3KZT A;  2GBW B;  4XDV A;  3T8N A;  4HM5 B;  2GXF A;  3D9R A;  3MG1 A;  3UJM A;  1GY7 A;  4R1K A;  1OHP A;  3ECF A;  3F40 A;  3Q90 A;  1O7G B;  1OHO A;  3GRD A;  1ZO2 A;  3SED A;  3FH1 A;  4MJD A;  4Q53 A;  2I9W A;  2F86 B;  1BUQ A;  1OH0 A;  1UUW B;  3ROB A;  4XBX A;  1Z1S A;  3H3H A;  3STD A;  2B24 B;  4I4K A;  1GYB A;  1K41 A;  3BB9 A;  3E99 A;  1HKX A;  3F8X A;  1A2K A;  2W2C A;  3BLZ A;  3FF2 A;  3A76 A;  3DXO A;  4HM0 B;  2BNG A;  3MKI A;  1NU3 A;  2R4I A;  4WP5 A;  4XDW A;  4LGQ A;  3JUO A;  3M8C A;  1AR0 A;  3KKG A;  3EQQ B;  4R9K A;  2OWP A;  3GZX B;  2STD A;  3RGA A;  2PZV A;  4K1V A;  4L7K A;  5IG5 A;  3JUM A;  1OPY A;  4WWU C;  4PEJ A;  5DRV A;  1O7P B;  1JN5 B;  1OF5 B;  2BMQ B;  2F99 A;  1ISK A;  5AIG A;  2K54 A;  4RZM A;  1S5A A;  4J9A A;  4XBY A;  5IER A;  3IPT A;  1WQL B;  5JPP A;  1W00 A;  4X2H A;  4LMI A;  5AI1 A;  3VGN A;  3NM2 A;  1JB5 A;  1Q42 A;  3WMD A;  3FF0 A;  2YFI B;  3GWR A;  4HM8 B;  2IMJ A;  2RFR A;  2B1X B;  1DMM A;  4HM4 B;  2HMM B;  3FSD A;  5IEN A;  1DMN A;  7STD A;  3B4O A;  5STD A;  5AIH A;  2GEX A;  3CU3 A;  4ORL A;  3VSY A;  3NV0 A;  1DMQ A;  1GS3 A;  1JN5 A;  3GZB A;  1JKG A;  4U13 A;  1OF5 A;  1OGX A;  3B8L A;  3UNL A;  5D81 A;  1IDP A;  1U5O A;  5IG0 A;  5KP4 A;  5CF1 A;  3MHE A;  4HKV B;  3EHC A;  2RCD A;  4HVN A;  4KVH A;  1TP6 A;  2QGU A;  1W6Y A;  5D82 A;  3CNM A;  3F7X A;  3DM8 A;  3NUV A;  1OHS A;  2A15 A;  1W02 A;  3G0K A;  1C7H A;  2GEY A;  3MG2 A;  3EJV A;  3MYT A;  4WYK B;  2XSO B;  3LZA A;  5FW5 A;  3CNX A;  2Z7A A;  3S5C A;  3JUP A;  3NBR A;  5IF6 A;  1Q40 B;  3OWU A;  4HM1 B;  5EVH A;  1O7N B;  2RGQ A;  3H51 A;  3OWY A;  3RGR A;  5IEP A;  3T8U A;  1E97 A;  1ULI B;  2HMO B;  3JUQ A;  3SOA A;  1E3R A;  3EC9 A;  3G16 A;  1EA2 A;  3FKA A;  5BXQ A;  3HK4 A;  3OWS A;  3F8H A;  1QJG A;  3KSP A;  1NDO B;  5CXO A;  5JPU A;  2CHC A;  2YFJ B;  2HML B;  5KP3 A;  3K0Z A;  5IEO A;  3OX9 A;  4LEH A;  2CKF B;  1QMA A;  1O7M B;  2BMR B;  3K7C A;  2JQ5 A;  4FCM A;  5TGN A;  2Z76 A;  3CPO A;  4XM4 A;  3GZR A;  1NWW A;  2XR8 B;  1GY5 A;  1ASK A;  5CF2 A;  5AIF A;  4WYK A;  1STD A;  2BMO B;  1TUH A;  5AII A;  5DRE A;  4FCJ A;  3HX8 A;  4L8O A;  3KE7 A;  3I0Y A;  1Q40 A;  4XBT A;  1JB2 A;  5AEW B;  3DZL A;  4IIA A;  5AEU B;  4CDL A;  3GZY B;  3EBT A;  3G8Z A;  3EN8 A;  1ZX2 A;  2YFL B;  1EG9 B;  4HJL B;  3NHX A;  1W01 A;  4HM6 B;  4HM2 B;  5IG4 A;  4OVM A;  5KP1 A;  2HMJ B;  3F7S A;  3NXJ A;  2UX0 A;  3FZW A;  3EN1 B;  1CQS A;  3FGY A;  1ULJ B;  1VZZ A;  3EBY A;  2QIY A;  8CHO A;  4HM7 B;  1SJW A;  4K1U A;  4X2O A;  1O7H B;  3LYG A;  4J8T A;  3OXA A;  3ER7 A;  2Z77 A;  3HZP A;  4HM3 B;  5D83 A;  4N3V A;  2HMN B;  3MG3 A;  1GY6 A;  1OUN A;  1O7W B;  3EF8 A;  3MSO A;  5CK6 A;  6STD A;  5HGR A;  4XB5 A;  1OGZ A;  2F98 A;  3B7C A; 
#chains in the Genus database with same CATH topology
 3HII A;  1TTO A;  3J7Y d;  4H3U A;  1CYU A;  3SOY A;  3DMC A;  3LOY A;  3ZG0 A;  2XEP A;  3B4P A;  3IJE B;  3Q1C A;  2OQE C;  1FZU A;  2BT3 A;  1BNF A;  1B27 A;  1OCV A;  1N8R 4;  2UGI A;  3URP A;  3D79 A;  3NV0 B;  4MMZ B;  2XH9 A;  4GB5 A;  5G2G A;  3F9S A;  5BVB A;  5HOH A;  1EUI C;  1E3V A;  1MNL A;  4R80 A;  4STD A;  3N9H A;  1JKG B;  1I2F A;  3I55 3;  3EX9 A;  4J5G A;  4RNT A;  1BRJ A;  3ALA A;  4HZ9 B;  3CCU 3;  1BSC A;  1U8C B;  4NRE A;  2XF3 A;  3AGO A;  1LOY A;  2KF3 A;  3UL5 A;  3CPW 2;  2XSH B;  5G1L A;  3UB1 A;  1GMR A;  1BRG A;  1RCK A;  2HMK B;  3JUN A;  3OV4 A;  2ZHX B;  1K28 A;  1JRQ A;  3CC7 3;  3BNE A;  1RDS A;  4FMC A;  4K61 A;  3K63 A;  4HZB B;  1YIJ 3;  1I3I A;  1FGR A;  1YGW A;  3EB8 A;  3LTC A;  1YGE A;  2ZL8 A;  2C10 A;  4BL3 A;  2F5W A;  2FGT A;  2INX A;  2OOV C;  4MMY B;  1VQ7 3;  5CLK A;  1NO3 A;  1D6Y A;  4OUQ A;  4EXR A;  1A90 A;  1IV7 A;  1IQX A;  2RSX A;  5IG3 A;  4KZ1 A;  4R9L A;  4L8P A;  1UUV B;  3X3Z A;  2Q07 A;  4ILF A;  7GSP A;  3G6E 3;  1A2V A;  1US1 A;  2KF5 A;  2GBX B;  1JB4 A;  3LTA A;  1UW1 A;  3FLJ A;  3F14 A;  1IV9 A;  2BU4 A;  3DUK A;  3LTB A;  2XRX B;  3KZT A;  1NB5 I;  2GBW B;  1RGG A;  1LOW A;  1DET A;  1BAN A;  4XDV A;  1ZGX A;  3T8N A;  3WR2 A;  4HM5 B;  1JBT A;  2D1W A;  1TJD A;  2GXF A;  2SBL A;  3D9R A;  3MG1 A;  4FCZ A;  4N6M A;  2L4V A;  4GSP A;  1B2M A;  3KN4 A;  4H61 A;  1MWU A;  3O8Y A;  3QRD A;  5BU4 A;  2IUK A;  1A67 A;  1B20 A;  3RDE A;  3UJM A;  3V92 A;  1I2E A;  1GY7 A;  4R1K A;  1OHP A;  1I2G A;  2Z6B A;  2IYJ A;  1MGW A;  1RHL A;  3CCE 3;  4O02 B;  4CCV A;  2W9Q A;  1IVU A;  1RGF A;  3ECF A;  1Y4K A;  2C4B A;  3F40 A;  4KT3 B;  3U97 A;  3N54 B;  3VF1 A;  1IK3 A;  4CPK A;  3Q90 A;  1O7G B;  1OHO A;  2HOH A;  1ZO2 A;  2CFL A;  2CX1 A;  3GRD A;  3SED A;  3Q3F A;  3FH1 A;  4MJD A;  4Q53 A;  1UGH I;  1W2Z A;  2F86 B;  2BIR A;  1LOV A;  1OH0 A;  2I9W A;  2KCD A;  3HIG A;  1BUQ A;  1IVW A;  3S27 A;  1DVD A;  1UUW B;  1JV2 B;  3ROB A;  1HYF A;  4XBX A;  1UCJ A;  2K0M A;  1Z1S A;  3H3H A;  1FUW A;  2W6J H;  3STD A;  2E2U A;  2B24 B;  2XGN A;  9RNT A;  2ZA4 A;  4O8S A;  3AHS A;  4N6O B;  1K9M 4;  3FG3 A;  2FNQ A;  1JBS A;  1FW7 A;  1BNE A;  1DYU A;  1GYB A;  3HOH A;  4I4K A;  4AEQ A;  1EQK A;  1V74 A;  5G1K A;  3CC2 3;  1K41 A;  1FUS A;  3BB9 A;  1T3B A;  1BAO A;  1TFO A;  2CX0 A;  1PU4 A;  3E99 A;  1HKX A;  5LC7 A;  1WMN A;  4AKZ A;  3F8X A;  1QVG 2;  1A2K A;  2W2C A;  3BLZ A;  4JF8 A;  5JBS A;  1QAF A;  3FF2 A;  1RRL A;  1RGA A;  3A76 A;  3DGM A;  1FUT A;  1MOL A;  3DXO A;  1BVI A;  1BSD A;  4HM0 B;  3PCS A;  2BNG A;  3MKI A;  3CCL 3;  1RMS A;  5M18 A;  1RJO A;  1M1X B;  1K8A 4;  1BSA A;  8RNT A;  2W03 A;  1NU3 A;  2R4I A;  4WP5 A;  4XDW A;  1RGH A;  2IA7 A;  2WOH A;  2SAR A;  2OTL 3;  2WGQ A;  4LGQ A;  1Q9E A;  4CJN A;  2H0I A;  5GSP A;  1AV4 A;  1M9G A;  3CXC 2;  1IT7 A;  3JUO A;  1YIT 3;  3FG1 A;  1NNV A;  3M8C A;  1VQ4 3;  1AR0 A;  3KKG A;  3SX1 A;  1TFK A;  3KII A;  3EQQ B;  4R9K A;  1RTU A;  1GMP A;  1WMP A;  5I97 A;  1LRA A;  3LH4 A;  2OWP A;  1DVC A;  1VQ8 3;  2ML5 A;  2CWU A;  2Y74 A;  4BL2 A;  3GZX B;  1B2S A;  2STD A;  3RGA A;  1GOY A;  2PZV A;  4K1V A;  4N6T A;  4L7K A;  2LQV A;  4KFD A;  1TU5 A;  1C54 A;  5IG5 A;  1TRQ A;  3JUM A;  1OPY A;  4WWU C;  3S29 A;  4PEJ A;  5DRV A;  1OAC A;  1O7P B;  1SAR A;  1JN5 B;  2WO0 A;  3CCS 3;  3S28 A;  1BGS A;  3D5I A;  4BU4 A;  4RNZ A;  3A5E A;  1OF5 B;  2BMQ B;  4DKI A;  2F99 A;  1ISK A;  1F8N A;  4K90 B;  5AIG A;  2K54 A;  4RZM A;  1S5A A;  4J9A A;  3PCR A;  1UCI A;  2P0M A;  4XBY A;  4WHA A;  4AKY A;  3N8B A;  5IER A;  3IPT A;  1WQL B;  1VQM 3;  5JPP A;  3BU4 A;  1PFP A;  3DH2 A;  1W00 A;  1PY3 A;  3GAX A;  3L0R A;  1BRS A;  2CK3 H;  4HBR A;  4HOH A;  4LMI A;  4O2H A;  4X2H A;  5AI1 A;  3VGN A;  3I56 3;  1SII A;  5FGO A;  2E2V A;  3NM2 A;  4N6U A;  1S72 3;  1JB5 A;  1W7C A;  1Q42 A;  4KFF A;  4HAA A;  3WMD A;  2WOF A;  7RNT A;  2RBI A;  4GHO A;  3FF0 A;  3ZG5 A;  2R41 A;  3CME 3;  1D6U A;  1N5P A;  1W6C A;  2YFI B;  1GMQ A;  4RNY A;  1DE3 A;  1KWI A;  1T5Y A;  3GWR A;  1W6G A;  1AVL A;  3UL6 A;  1GSP A;  1VQN 3;  4HM8 B;  3DY5 A;  2OCT A;  3WDG B;  1RGK A;  1I0X A;  1VQQ A;  2RNT A;  2D42 A;  2IMJ A;  1RGE A;  4IPB A;  2RFR A;  2B1X B;  1DMM A;  1IQ8 A;  1MGR A;  1RN1 A;  1EKM A;  1Q7Y 4;  1AQZ A;  1MWS A;  4HM4 B;  1QAL A;  2CFW A;  2HMM B;  2WGO A;  1GOU A;  1HU9 A;  3FSD A;  2V1L A;  3Q2P A;  1BSE A;  1RNT A;  3BNB A;  5IEN A;  1V57 A;  1DMN A;  1LQG C;  1BSB A;  1TIJ A;  2W56 B;  2O3O A;  1BRH A;  7STD A;  3B4O A;  5STD A;  1CEW I;  1I0V A;  3FCS B;  2W0Q A;  5AIH A;  1J2B A;  2GEX A;  1D6Z A;  3SYU A;  3CU3 A;  3QK9 A;  1UCK A;  4ORL A;  3VSY A;  3NV0 A;  1BUJ A;  2W04 A;  1DMQ A;  2Y73 A;  3NX0 A;  3WOD G;  1UCL A;  1ROA A;  4ZM8 A;  1GS3 A;  1IU7 A;  1N9J A;  6RNT A;  1JN5 A;  3GZB A;  4LYL B;  3FG4 A;  3HI7 A;  1HZ1 A;  1CH0 A;  1JKG A;  4U13 A;  3DGL A;  1FGQ A;  1LNI A;  1VQ9 3;  1OF5 A;  3BND A;  1OGX A;  1BNS A;  2CFK A;  1JZD A;  3B8L A;  4NPB A;  3UNL A;  1VQP 3;  5D81 A;  1RGC A;  4N6L A;  3DGY A;  2PNC A;  4EV2 A;  3V98 A;  1B2U A;  1G02 A;  1IDP A;  1U5O A;  1RKY A;  1JBR A;  5IG0 A;  3SXX A;  2W9P A;  1N9E A;  5KP4 A;  3NQZ A;  1RRH A;  5CF1 A;  3MHE A;  2CIU A;  1N5H A;  1A2P A;  4HKV B;  2ZDJ A;  3U1W A;  3EHC A;  1YVS A;  5RNT A;  1BRN L;  1BIR A;  3LXU X;  1YJ9 3;  1RN4 A;  1ROV A;  1V58 A;  2RCD A;  1AY7 A;  3GSP A;  4HVN A;  3PXM A;  2KAA A;  3LT8 A;  1BNG A;  2IUJ A;  2JDI H;  1TP6 A;  2QGU A;  4KVH A;  2GSP A;  4KFE A;  1FGM A;  4EYC A;  5EQL A;  4N6N B;  1W6Y A;  1YVB I;  5D82 A;  5AYR B;  3CNM A;  3F7X A;  1Q81 4;  3DM8 A;  1VQ5 3;  3NUV A;  1OHS A;  1RLS A;  2A15 A;  1W02 A;  2IY2 A;  2YX9 A;  3G0K A;  3WA2 X;  1GOV A;  1C7H A;  4NHF A;  1G96 A;  2GEY A;  3PGB A;  5LC6 A;  1I70 A;  5ELJ A;  1I3F A;  3NBB A;  3MG2 A;  3G4S 3;  3EJV A;  3MYT A;  4EBG A;  1QAK A;  2FXT A;  3PS8 A;  4WYK B;  2XSO B;  3BNC A;  2E2T A;  1EEJ A;  3LZA A;  5ELU A;  3X3X A;  1BRI A;  5FW5 A;  1MWR A;  4LZI A;  1Q7H A;  3CNX A;  4EW5 A;  2Z7A A;  1MWT A;  3DGO A;  1BNR A;  1RCL A;  1R4Y A;  3LTD A;  3S5C A;  5A0O B;  1LOX A;  3JUP A;  2MC8 A;  1SQW A;  1WMO A;  1IVV A;  3NBR A;  5IF6 A;  3CMA 3;  1IQY A;  1Q40 B;  3WA3 A;  3OWU A;  1R4C A;  1TRP A;  3CC4 3;  4HM1 B;  4TX4 A;  5EVH A;  1VQK 3;  1N8Q A;  1PYL A;  1O7N B;  2RGQ A;  3H51 A;  3OWY A;  1UGI A;  3RGR A;  5IEP A;  3T8U A;  1E97 A;  1SIH A;  1YHQ 3;  1B2X A;  3X42 A;  3NQY A;  2K3D A;  1ULI B;  2J8X B;  3AHW A;  2HMO B;  3JUQ A;  3MWZ A;  1FGO A;  3SOA A;  3D3L A;  4OK0 A;  2GU3 A;  1E3R A;  3EC9 A;  1BNI A;  1RNB A;  3G16 A;  1EA2 A;  1YNV X;  3FKA A;  5BXQ A;  3HK4 A;  3OWS A;  3F8H A;  4BTX A;  1QJG A;  3KSP A;  2QEX 3;  1NDO B;  3AGN A;  5CXO A;  1I8V A;  5JPU A;  2KRT A;  2BHM A;  3CCM 3;  2CHC A;  2YFJ B;  2HML B;  5KP3 A;  3K0Z A;  1CYV A;  4JRF A;  3CCV 3;  3MPH A;  5IEO A;  3OX9 A;  2BO9 B;  2KF4 A;  3NBJ A;  4LEH A;  2CKF B;  1QMA A;  3CCR 3;  2CW9 A;  2XGL A;  4RBN A;  1O7M B;  1X1W A;  1ZS7 A;  2CFG A;  2P05 A;  4IT7 A;  1VQL 3;  1UI8 A;  2CC3 A;  5IW9 A;  2BMR B;  3K7C A;  2JQ5 A;  1T2I A;  4J5K A;  3V99 A;  3EE1 A;  2C11 A;  4FCM A;  4EV5 A;  5TGN A;  2Z76 A;  3CPO A;  3AMO B;  3X3Y A;  4FMD A;  4XM4 A;  1YI2 3;  1X1X A;  3GZR A;  1NWW A;  3NM7 A;  1W5Z A;  3PZW A;  3BIR A;  1STF I;  1W4N A;  4BTW A;  2XR8 B;  3K9M C;  1L5G B;  2MF7 A;  1GY5 A;  1LQM B;  4I5Q A;  4BIR A;  1Q82 4;  1ASK A;  5CF2 A;  1BNJ A;  4GL6 A;  5AIF A;  1YJN 3;  5BIR A;  4WYK A;  1QVF 2;  1VQ6 3;  2OQE A;  1STD A;  2O9U X;  2BMO B;  1RGL A;  1TUH A;  1IYY A;  2F5M A;  5AII A;  1FYS A;  1LNH A;  5DRE A;  4WFO A;  1T2H A;  4FMB A;  4LSO A;  4FCJ A;  3HX8 A;  1GD4 A;  1RN7 A;  4L8O A;  1KSI A;  3I0Y A;  3KE7 A;  4MMX B;  3WOE B;  1Q40 A;  1Q86 4;  1M1K 4;  4R4K A;  3WHO A;  1YJW 3;  3KSE D;  4XBT A;  2KF6 A;  1JB2 A;  5EEO A;  5AEW B;  3DZL A;  4IIA A;  2P09 A;  1K73 4;  5AEU B;  1JNQ A;  4CDL A;  3G71 3;  1B2Z A;  3RNT A;  3CCQ 3;  2CG1 A;  3GZY B;  3K5T A;  3EBT A;  3ZFZ A;  3G8Z A;  6GSP A;  3EN8 A;  1ZX2 A;  2YFL B;  1X1U A;  1EG9 B;  3T0U A;  4O3V A;  2CH9 A;  2CWT A;  4HJL B;  2OOV A;  5AYS C;  3NHX A;  2H0H A;  1W01 A;  3JVC A;  2F56 A;  2P38 A;  4HM6 B;  1FA3 A;  4HM2 B;  5IG4 A;  2F4Y A;  3D5G A;  4OVM A;  1IT8 A;  1BOX A;  1WTH A;  5KP1 A;  2HMJ B;  4N6V 0;  3F7S A;  3S67 A;  3NXJ A;  2UX0 A;  5M19 A;  3IMA B;  3FZW A;  2L1S A;  3EN1 B;  4QWT A;  1CQS A;  2LYX A;  1IVX A;  3FGY A;  1UDI I;  1AVK A;  1ULJ B;  1VZZ A;  2CG0 A;  3SLU A;  1X1Y A;  1NB3 I;  1RSN A;  2QIY A;  3EBY A;  8CHO A;  1UUG B;  2QA4 3;  1UI7 A;  2UUG C;  3AMO A;  4HM7 B;  1KD1 4;  1SJW A;  2CWV A;  3KCH A;  4K1U A;  1W2B 2;  1FGT A;  1SPU A;  4X2O A;  1O7H B;  3TDG A;  3LYG A;  4MEI A;  2AAE A;  3D4A A;  3KFQ C;  4J8T A;  2M7O A;  2H0G A;  4G1M B;  3OXA A;  3ER7 A;  2OTJ 3;  3X41 A;  1G0T A;  3WOF B;  2GU1 A;  1BU4 A;  2Z77 A;  3X40 A;  3HZP A;  2KXG A;  2W56 A;  4HM3 B;  4HYZ A;  2XFT A;  5D83 A;  4EC6 A;  3OW2 2;  1VQO 3;  2P0X A;  4BTY A;  4N3V A;  4FR9 A;  1LVN A;  2HMN B;  3MG3 A;  1GY6 A;  1B3S A;  1OUN A;  2ML6 A;  1NJI 4;  1KQS 2;  1O7W B;  1BRK A;  5M1A A;  1GD3 A;  3EF8 A;  3MSO A;  4FMA A;  3SVA A;  3CCJ 3;  5CK6 A;  6STD A;  3PYJ A;  3DGN A;  4XB5 A;  5HGR A;  1KC8 4;  1B21 A;  1OGZ A;  1WNH A;  1JJ2 2;  2F98 A;  3B7C A;  3CD6 3;  2CFD A;  1LXE A;  3LML A;  1M90 4;  2XFS A;  1JZO A;  3LT9 A;  2AAD A; 
#chains in the Genus database with same CATH homology
 3HII A;  3J7Y d;  4H3U A;  1CYU A;  3SOY A;  3DMC A;  3LOY A;  2XEP A;  3B4P A;  3IJE B;  3Q1C A;  2OQE C;  2BT3 A;  1OCV A;  1N8R 4;  3NV0 B;  4MMZ B;  2XH9 A;  4GB5 A;  5G2G A;  3F9S A;  5BVB A;  4R80 A;  1E3V A;  1MNL A;  4STD A;  3N9H A;  1JKG B;  3I55 3;  3EX9 A;  3ALA A;  4HZ9 B;  3CCU 3;  1U8C B;  4NRE A;  2XF3 A;  3UL5 A;  3CPW 2;  2XSH B;  3UB1 A;  2HMK B;  3JUN A;  3OV4 A;  1K28 A;  1JRQ A;  3CC7 3;  3BNE A;  4FMC A;  4K61 A;  3K63 A;  4HZB B;  1YIJ 3;  1FGR A;  3EB8 A;  3LTC A;  1YGE A;  2ZL8 A;  2C10 A;  2FGT A;  2INX A;  2OOV C;  4MMY B;  1VQ7 3;  5CLK A;  1NO3 A;  1D6Y A;  4OUQ A;  4EXR A;  1A90 A;  1IV7 A;  1IQX A;  2RSX A;  5IG3 A;  4KZ1 A;  4R9L A;  4L8P A;  1UUV B;  3X3Z A;  2Q07 A;  3G6E 3;  1A2V A;  1US1 A;  2GBX B;  1JB4 A;  3LTA A;  1UW1 A;  3FLJ A;  3F14 A;  1IV9 A;  3DUK A;  3LTB A;  2XRX B;  3KZT A;  1NB5 I;  2GBW B;  4XDV A;  3T8N A;  4HM5 B;  2D1W A;  2GXF A;  2SBL A;  3D9R A;  3MG1 A;  4N6M A;  4FCZ A;  2L4V A;  3KN4 A;  4H61 A;  3O8Y A;  3QRD A;  2IUK A;  1A67 A;  3RDE A;  3UJM A;  3V92 A;  1GY7 A;  4R1K A;  1OHP A;  2Z6B A;  3CCE 3;  4O02 B;  4CCV A;  2W9Q A;  1IVU A;  3ECF A;  3F40 A;  1Y4K A;  3VF1 A;  3U97 A;  3N54 B;  1IK3 A;  3Q90 A;  1O7G B;  1OHO A;  3GRD A;  1ZO2 A;  2CFL A;  3SED A;  3FH1 A;  4MJD A;  4Q53 A;  1W2Z A;  2F86 B;  2I9W A;  2KCD A;  1OH0 A;  3HIG A;  1BUQ A;  1DVD A;  1IVW A;  3S27 A;  1UUW B;  1JV2 B;  3ROB A;  4XBX A;  2K0M A;  1Z1S A;  3H3H A;  1FUW A;  2W6J H;  3STD A;  2E2U A;  2B24 B;  2XGN A;  4O8S A;  4N6O B;  1K9M 4;  3FG3 A;  2FNQ A;  1DYU A;  1GYB A;  4I4K A;  1EQK A;  4AEQ A;  1V74 A;  3CC2 3;  1K41 A;  3BB9 A;  1TFO A;  1PU4 A;  3E99 A;  1HKX A;  5LC7 A;  1WMN A;  4AKZ A;  3F8X A;  1QVG 2;  1A2K A;  2W2C A;  3BLZ A;  4JF8 A;  5JBS A;  1QAF A;  3FF2 A;  1RRL A;  3A76 A;  3DGM A;  1MOL A;  3DXO A;  4HM0 B;  3PCS A;  2BNG A;  3MKI A;  3CCL 3;  1K8A 4;  1RJO A;  1M1X B;  2W03 A;  1NU3 A;  2R4I A;  4WP5 A;  4XDW A;  2IA7 A;  2WOH A;  2OTL 3;  2WGQ A;  4LGQ A;  1AV4 A;  1M9G A;  3CXC 2;  1IT7 A;  3JUO A;  1YIT 3;  3FG1 A;  3M8C A;  1VQ4 3;  1AR0 A;  3KKG A;  3SX1 A;  1TFK A;  3KII A;  3EQQ B;  4R9K A;  1WMP A;  5I97 A;  3LH4 A;  2OWP A;  1DVC A;  1VQ8 3;  2ML5 A;  2CWU A;  2Y74 A;  3GZX B;  2STD A;  3RGA A;  4N6T A;  2PZV A;  4K1V A;  4L7K A;  2LQV A;  4KFD A;  1TU5 A;  5IG5 A;  3JUM A;  1OPY A;  4WWU C;  3S29 A;  4PEJ A;  5DRV A;  1OAC A;  1O7P B;  1JN5 B;  2WO0 A;  3CCS 3;  3S28 A;  4RNZ A;  1OF5 B;  2BMQ B;  2F99 A;  1ISK A;  1F8N A;  4K90 B;  5AIG A;  2K54 A;  4RZM A;  1S5A A;  4J9A A;  3PCR A;  2P0M A;  4XBY A;  4WHA A;  4AKY A;  3N8B A;  5IER A;  3IPT A;  1WQL B;  1VQM 3;  5JPP A;  3L0R A;  1PFP A;  4HBR A;  1W00 A;  3GAX A;  4O2H A;  4X2H A;  2CK3 H;  2MC8 A;  4LMI A;  5AI1 A;  3VGN A;  1SII A;  5FGO A;  2E2V A;  3NM2 A;  4N6U A;  1S72 3;  1JB5 A;  1W7C A;  1Q42 A;  4KFF A;  3WMD A;  2WOF A;  3FF0 A;  3CME 3;  1D6U A;  1N5P A;  1W6C A;  2YFI B;  4RNY A;  1KWI A;  1T5Y A;  3GWR A;  1W6G A;  1AVL A;  3UL6 A;  1VQN 3;  4HM8 B;  3DY5 A;  2OCT A;  3WDG B;  2D42 A;  2IMJ A;  4IPB A;  2RFR A;  2B1X B;  1DMM A;  1IQ8 A;  1EKM A;  1Q7Y 4;  4HM4 B;  1QAL A;  2CFW A;  2HMM B;  2WGO A;  1HU9 A;  3FSD A;  2V1L A;  3Q2P A;  3BNB A;  5IEN A;  1DMN A;  1TIJ A;  2W56 B;  2O3O A;  7STD A;  3B4O A;  5STD A;  1CEW I;  3FCS B;  2W0Q A;  5AIH A;  1J2B A;  2GEX A;  1D6Z A;  3CU3 A;  3QK9 A;  4ORL A;  3VSY A;  3NV0 A;  2W04 A;  1DMQ A;  2Y73 A;  3NX0 A;  3WOD G;  1ROA A;  4ZM8 A;  1GS3 A;  1IU7 A;  1N9J A;  3I56 3;  1JN5 A;  3GZB A;  3FG4 A;  3HI7 A;  1JKG A;  4U13 A;  3DGL A;  1FGQ A;  1VQ9 3;  1OF5 A;  3BND A;  1OGX A;  2CFK A;  3B8L A;  1VQP 3;  3UNL A;  5D81 A;  4N6L A;  2PNC A;  4EV2 A;  3V98 A;  1IDP A;  1U5O A;  1RKY A;  5IG0 A;  3SXX A;  2W9P A;  1N9E A;  5KP4 A;  3NQZ A;  1RRH A;  5CF1 A;  3MHE A;  2CIU A;  1N5H A;  4HKV B;  2ZDJ A;  3U1W A;  3EHC A;  3LXU X;  1YJ9 3;  1ROV A;  2RCD A;  4HVN A;  3PXM A;  3LT8 A;  2IUJ A;  2JDI H;  1TP6 A;  2QGU A;  4KVH A;  4KFE A;  1FGM A;  4EYC A;  5EQL A;  4N6N B;  1W6Y A;  1YVB I;  5D82 A;  5AYR B;  3CNM A;  3F7X A;  1Q81 4;  3DM8 A;  1VQ5 3;  3NUV A;  1OHS A;  3WA2 X;  2A15 A;  1W02 A;  3G0K A;  2YX9 A;  1C7H A;  4NHF A;  1G96 A;  2GEY A;  3PGB A;  5LC6 A;  5ELJ A;  3NBB A;  3MG2 A;  3G4S 3;  3EJV A;  3MYT A;  4EBG A;  1QAK A;  2FXT A;  3PS8 A;  4WYK B;  2XSO B;  3BNC A;  2E2T A;  3LZA A;  5ELU A;  3X3X A;  5FW5 A;  4LZI A;  3CNX A;  2Z7A A;  3DGO A;  3LTD A;  3S5C A;  5A0O B;  1LOX A;  3JUP A;  1SQW A;  1WMO A;  1IVV A;  3NBR A;  5IF6 A;  3CMA 3;  1IQY A;  1Q40 B;  3WA3 A;  3OWU A;  1R4C A;  3CC4 3;  4HM1 B;  4TX4 A;  5EVH A;  1VQK 3;  1N8Q A;  1O7N B;  2RGQ A;  3H51 A;  3OWY A;  3RGR A;  5IEP A;  3T8U A;  1E97 A;  1SIH A;  1YHQ 3;  3X42 A;  3NQY A;  1ULI B;  2HMO B;  3JUQ A;  3MWZ A;  1FGO A;  3SOA A;  3D3L A;  4OK0 A;  2GU3 A;  1E3R A;  3EC9 A;  3G16 A;  1EA2 A;  3FKA A;  5BXQ A;  3HK4 A;  3OWS A;  3F8H A;  4BTX A;  1QJG A;  3KSP A;  2QEX 3;  1NDO B;  5CXO A;  5JPU A;  2KRT A;  2BHM A;  3CCM 3;  2CHC A;  2YFJ B;  2HML B;  5KP3 A;  3K0Z A;  1CYV A;  4JRF A;  3CCV 3;  3MPH A;  5IEO A;  3OX9 A;  2BO9 B;  3NBJ A;  4LEH A;  2CKF B;  1QMA A;  3CCR 3;  2CW9 A;  2XGL A;  4RBN A;  1O7M B;  2CFG A;  2P05 A;  4IT7 A;  1VQL 3;  1UI8 A;  2CC3 A;  5IW9 A;  2BMR B;  3K7C A;  2JQ5 A;  3V99 A;  3EE1 A;  2C11 A;  4FCM A;  4EV5 A;  5TGN A;  2Z76 A;  3CPO A;  3AMO B;  3X3Y A;  4FMD A;  4XM4 A;  1YI2 3;  3GZR A;  3PZW A;  1NWW A;  3NM7 A;  1W5Z A;  1STF I;  1W4N A;  4BTW A;  2XR8 B;  3K9M C;  1L5G B;  2MF7 A;  1GY5 A;  1Q82 4;  1ASK A;  5CF2 A;  4GL6 A;  5AIF A;  1YJN 3;  4WYK A;  1QVF 2;  1VQ6 3;  2OQE A;  1STD A;  2O9U X;  2BMO B;  1TUH A;  5AII A;  5DRE A;  1LNH A;  4WFO A;  4FMB A;  4LSO A;  4FCJ A;  3HX8 A;  1GD4 A;  1RN7 A;  4L8O A;  1KSI A;  3I0Y A;  3KE7 A;  4MMX B;  3WOE B;  1Q40 A;  1Q86 4;  1M1K 4;  4R4K A;  1YJW 3;  3KSE D;  4XBT A;  1JB2 A;  5EEO A;  5AEW B;  3DZL A;  4IIA A;  2P09 A;  1K73 4;  5AEU B;  1JNQ A;  4CDL A;  3G71 3;  3CCQ 3;  2CG1 A;  3GZY B;  3K5T A;  3EBT A;  3G8Z A;  3EN8 A;  1ZX2 A;  2YFL B;  1EG9 B;  3T0U A;  4O3V A;  2CH9 A;  2CWT A;  4HJL B;  2OOV A;  5AYS C;  3NHX A;  1W01 A;  3JVC A;  4HM6 B;  2P38 A;  1FA3 A;  4HM2 B;  5IG4 A;  4OVM A;  1IT8 A;  1WTH A;  5KP1 A;  2HMJ B;  4N6V 0;  3F7S A;  3S67 A;  3NXJ A;  2UX0 A;  3IMA B;  3FZW A;  3EN1 B;  4QWT A;  1CQS A;  2LYX A;  1IVX A;  3FGY A;  1AVK A;  1ULJ B;  1VZZ A;  2CG0 A;  3SLU A;  1NB3 I;  3EBY A;  2QIY A;  8CHO A;  2QA4 3;  1UI7 A;  3AMO A;  4HM7 B;  1KD1 4;  1SJW A;  2CWV A;  4K1U A;  1W2B 2;  1FGT A;  1SPU A;  4X2O A;  1O7H B;  3TDG A;  3LYG A;  4MEI A;  3KFQ C;  4J8T A;  2M7O A;  4G1M B;  3OXA A;  3ER7 A;  2OTJ 3;  3X41 A;  3WOF B;  2GU1 A;  3X40 A;  2Z77 A;  3HZP A;  2KXG A;  2W56 A;  4HM3 B;  4HYZ A;  2XFT A;  5D83 A;  4EC6 A;  3OW2 2;  1VQO 3;  2P0X A;  4BTY A;  4N3V A;  4FR9 A;  1LVN A;  2HMN B;  3MG3 A;  1GY6 A;  1OUN A;  1NJI 4;  2ML6 A;  1KQS 2;  1O7W B;  1GD3 A;  3EF8 A;  3MSO A;  4FMA A;  3SVA A;  3CCJ 3;  5CK6 A;  6STD A;  3PYJ A;  3DGN A;  4XB5 A;  5HGR A;  1KC8 4;  1OGZ A;  1WNH A;  1JJ2 2;  2F98 A;  3B7C A;  3CD6 3;  2CFD A;  1LXE A;  3LML A;  1M90 4;  2XFS A;  3LT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...