3UJMA

Crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Rasputin NTF2-like domain from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
molecule keywords Rasputin
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ujmA00
4CDLA 3EHCA 5EVHA 4HM1B 1W01A 4WWUC 3DXOA 5CK6A 5D83A 3F7XA 1GS3A 5IENA 2B1XB 2CHCA 3EC9A 3FKAA 3JUMA 3MKIA 4HKVB 4R9KA 4XB5A 4XDVA 8CHOA 4XBYA 1O7HB 1NU3A 3DZLA 5JPPA 1E3VA 1ZX2A 3FH1A 4L8PA 5DRVA 3FGYA 2GEYA 2CKFB 3CPOA 3KZTA 1QJGA 2HMNB 4H3UA 5BVBA 1Z1SA 5CF1A 1OHSA 1CQSA 3F9SA 2GBWB 3K7CA 1UUVB 2F98A 2Z77A 3OXAA 5FW5A 1W02A 3DMCA 1TUHA 1O7MB 3HZPA 3MSOA 4PEJA 3F14A 3SEDA 3T8NA 2QGUA 1JKGA 3KSPA 4FCMA 4HM6B 5AIFA 4LGQA 4KVHA 5KP4A 1E3RA 2PZVA 3FF2A 1VZZA 3OV4A 4WYKB 3B4OA 3ROBA 2IMJA 4U13A 1A2KA 4HM7B 5CLKA 3Q90A 1OF5A 4IIAA 1DMMA 3H3HA 1W00A 5KP1A 5AIIA 5AEWB 1E97A 1DMQA 2RCDA 1OCVA 1EA2A 2I9WA 4Q53A 2F99A 1QMAA 2XSOB 1WQLB 1JB4A 1EG9B 2W2CA 3K0ZA 4HJLB 1OPYA 2HMMB 1ASKA 3F8HA 1K41A 1OHOA 1Q40A 3B8LA 3EBYA 3GRDA 3B4PA 1JN5A 3GWRA 1SJWA 3LZAA 3GZRA 4HM8B 3CU3A 3BLZA 2A15A 3CNMA 3NXJA 3RGAA 1ZO2A 1O7GB 4ORLA 3EQQB 3H51A 4WP5A 2HMKB 3GZXB 3NUVA 4RZMA 4HM5B 4X2OA 1OUNA 3NV0B 5AI1A 4K1UA 3SOAA 1OF5B 3ER7A 3EX9A 4XBTA 4R9LA 5IEPA 1GY6A 3NV0A 1HKXA 1GY7A 2QIYA 3DM8A 3EF8A 2GXFA 3JUOA 3JUNA 3MG3A 4LEHA 5CXOA 5DREA 5AEUB 2OWPA 4K1VA 2XSHB 3EN8A 2STDA 3GZBA 3JUPA 3FF0A 1O7NB 1OH0A 2Z7AA 3NBRA 2Z76A 1C7HA 3EBTA 3B7CA 3F7SA 3M8CA 3OWYA 3WMDA 5CF2A 2BMRB 3A76A 5IG5A 3G16A 3UJMA 1NDOB 1GY5A 4MJDA 4XBXA 3DUKA 1S5AA 2F86B 2XR8B 5IG3A 5TGNA 5IERA 1AR0A 3HX8A 3EJVA 3GZYB 5D82A 3FSDA 3IPTA 2JQ5A 2YFJB 4J8TA 1JB5A 1ULIB 2BMOB 1UUWB 3HK4A 1IDPA 3JUQA 3MYTA 1Q42A 2RFRA 3MG2A 5KP3A 1OGXA 4I4KA 4L7KA 3OX9A 1JKGB 3BB9A 2UX0A 3VGNA 5BXQA 3T8UA 6STDA 4HM0B 4HZ9B 2HMLB 2HMJB 2R4IA 1JN5B 1U5OA 4HM3B 4HVNA 4OUQA 1Q40B 7STDA 2GBXB 2YFIB 3G8ZA 1GYBA 1O7PB 5IEOA 4HZBB 3S5CA 2XRXB 3I0YA 3E99A 4STDA 1TP6A 3NHXA 3OWSA 4L8OA 2K54A 1W6YA 4R1KA 1JB2A 3CNXA 4GB5A 2RGQA 4FCJA 1BUQA 3G0KA 5AIGA 4WYKA 5D81A 4XDWA 3OWUA 2BNGA 3KE7A 1ISKA 3MHEA 3NM2A 4XM4A 3UNLA 1ULJB 1OGZA 4LMIA 3STDA 3MG1A 1DMNA 3LYGA 3RGRA 3SOYA 4HM4B 3D9RA 5IG4A 5HGRA 3KKGA 4J9AA 5JPUA 5IG0A 1OHPA 4HM2B 4X2HA 3FLJA 3EN1B 1O7WB 4OVMA 2BMQB 3FZWA 5AIHA 4N3VA 5STDA 1NWWA 5G2GA 1STDA 2YFLB 2INXA 2HMOB 5IF6A 2GEXA 3VSYA 3ECFA 2B24B 3F8XA 3F40A
chains in the Genus database with same CATH superfamily
3AHWA 3EHCA 4HM1B 4WWUC 5D83A 1GS3A 2C4BA 1JZDA 2CHCA 3FKAA 3JUMA 3MKIA 2KF6A 4HKVB 1AQZA 4XB5A 1K734 3X3XA 2GU3A 3MPHA 4XBYA 2XEPA 1IV7A 3AMOB 1UCLA 2CC3A 3X42A 4BTYA 1K28A 1TU5A 1HYFA 1QJGA 3LTCA 2H0IA 2GBWB 3JVCA 1YJW3 2W6JH 2F98A 2Z77A 3OXAA 5ELUA 3G6E3 3K5TA 1TUHA 1MWRA 1D6UA 3LMLA 3MSOA 3CC43 3CMA3 3CCE3 2QA43 1K9M4 1RRHA 1VQ83 3FF2A 1TJDA 1LQMB 2XGLA 1T2HA 4LYLB 1BIRA 4FCZA 3SXXA 4U13A 2HOHA 3Q90A 4IIAA 1IVUA 9RNTA 3D5GA 1RGEA 2RCDA 3RNTA 1B2ZA 1EA2A 1LQGC 1I2GA 1OCVA 1Y4KA 2F99A 1QMAA 2I9WA 2ML6A 1WQLB 2SARA 2W2CA 3FG1A 5BIRA 1L5GB 3EBYA 3B8LA 1FYSA 3GWRA 1BRGA 2W56A 1SJWA 3GZRA 3CU3A 2CG0A 3MWZA 3RGAA 1ROAA 1IV9A 2P09A 3EQQB 2HMKB 2F5MA 6STDA 1OUNA 1WTHA 3NV0B 5AI1A 3EX9A 2W9QA 1I70A 4CJNA 3LTBA 5LC7A 5CXOA 4J5GA 1YHQ3 3CCL3 1Q814 4G1MB 1SIHA 1JV2B 4K1VA 4N6LA 1JBRA 2STDA 1O7NB 2Z7AA 3LXUX 3NBRA 1VQP3 2UUGC 2Z76A 1C7HA 1R4YA 3AHSA 1VQ63 3OWYA 1IQYA 1MWSA 4RNYA 5IG5A 3G16A 3Q3FA 3FG4A 1RSNA 1RN1A 1GY5A 1Q9EA 1TRPA 1SIIA 3KCHA 3PCSA 5IG3A 5G1LA 1FW7A 5IERA 3HX8A 1BU4A 1BNJA 2YFJB 3MYTA 3JUQA 4R4KA 1Q42A 2RFRA 2BT3A 1GD3A 1JKGB 3VGNA 3CCJ3 5JBSA 2D1WA 2HMLB 2HMJB 4HM3B 1U5OA 1D6ZA 1Q40B 3S27A 2Z6BA 4RNTA 3NQZA 3D4AA 3BNCA 4NREA 3DGLA 4STDA 5FGOA 3NHXA 2IUKA 3SLUA 1JBTA 1MGRA 3NM7A 1BNSA 1RGHA 2MF7A 3CME3 1FUTA 1CEWI 2RGQA 1VQQA 4FCJA 4FMDA 1BUQA 4GL6A 5D81A 3SX1A 5ELJA 2RSXA 2WO0A 1TRQA 4XM4A 1ULJB 3PCRA 3MG1A 5M18A 3BIRA 2WOFA 4EYCA 1BSCA 5IG4A 5EEOA 1JJ22 1IQ8A 1A67A 1M1K4 2CFDA 3FLJA 3PXMA 1WNHA 5AIHA 1C54A 1B2MA 1FUWA 2OOVA 4N6NB 1NWWA 1J2BA 2P05A 4O3VA 1EUIC 1TTOA 3Q2PA 2K0MA 4KFFA 3ECFA 2E2VA 1PYLA 2KAAA 2O3OA 2CFGA 3DXOA 3F7XA 5IENA 2B1XB 2Y74A 1YNVX 4R9KA 8CHOA 1UI8A 1MWUA 1UCJA 3OW22 1RRLA 3TDGA 1IU7A 5JPPA 3IJEB 1M9GA 1RDSA 2GEYA 3CPOA 2CW9A 3QRDA 4EW5A 1Z1SA 1KSIA 3URPA 1CQSA 3F9SA 1IVWA 3K7CA 1UUVB 2GU1A 5FW5A 4IT7A 4FMCA 1O7MB 3KSPA 5KP4A 3NBJA 3F8XA 1YJ93 3PS8A 1VZZA 1W6GA 4NPBA 3B4OA 1T3BA 1OACA 2IMJA 3D3LA 1WMPA 4HM7B 1DETA 1OF5A 1AVKA 4RBNA 3HI7A 5KP1A 2L4VA 5AIIA 4FMBA 1T2IA 1WMOA 1DMQA 1YVSA 4O8SA 2XF3A 3CPW2 2Y73A 4EXRA 1PFPA 1V57A 4LZIA 2D42A 1EG9B 4HJLB 3K0ZA 2HMMB 1K41A 3BNDA 1BNRA 3B4PA 4N6MA 3PZWA 2C11A 2H0HA 4HM8B 1F8NA 3BLZA 4Q53A 3CCQ3 1BRSA 1BSAA 4ORLA 3GZXB 2E2UA 4K90B 4RZMA 2MC8A 5HOHA 3I553 4K1UA 4XBTA 3ER7A 1UI7A 4NHFA 4H61A 3DM8A 4CPKA 2GXFA 1STFI 1U8CB 1RGKA 2OWPA 1EEJA 1GOYA 4ZM8A 2LQVA 2CFKA 2K3DA 1RCKA 2WOHA 3M8CA 6RNTA 3B7CA 1N5HA 1W2B2 2IY2A 2BMRB 1Q7Y4 1I3FA 1X1XA 1NDOB 4N6OB 3CCR3 2OQEC 1KQS2 1W7CA 1N8QA 1S5AA 2F86B 3ZFZA 3EE1A 1VQ53 4QWTA 3GZYB 5D82A 3DY5A 1W2ZA 2BMOB 3HK4A 1UGIA 1UUWB 1IDPA 4MMZB 3UNLA 1K8A4 4AKYA 1W6CA 3SVAA 3OX9A 1I2EA 1BSEA 2UX0A 3BB9A 4TX4A 2CIUA 3LTAA 5BXQA 1B3SA 1N9JA 1VQ93 2Q07A 4HM0B 5RNTA 3KIIA 1JN5B 4HVNA 5I97A 3WODG 2YFIB 3CCU3 1GYBA 1O7PB 3G713 5G1KA 3WOFB 2BIRA 1VQL3 3S5CA 1LRAA 3FCSB 3DGYA 2CX0A 3E99A 4O2HA 2K54A 1BRIA 1W6YA 1LXEA 1MOLA 5AIGA 4WYKA 3V92A 1UUGB 1YGEA 2KRTA 3LT9A 1ISKA 1VQM3 2YX9A 4I5QA 5BU4A 1DMNA 1M904 1BGSA 3LYGA 4HOHA 1D6YA 4HM4B 3WDGB 3CCM3 2W9PA 4J9AA 4MMXB 5JPUA 5IG0A 4HM2B 1FGOA 4KFDA 2W03A 1GOVA 2BMQB 1AV4A 1R4CA 4N3VA 2AAEA 2J8XB 4MMYB 5STDA 6GSPA 1DE3A 4FMAA 2P38A 2ZA4A 5EVHA 4HYZA 1W01A 4LSOA 1BUJA 5CK6A 1DYUA 4EC6A 3EC9A 4XDVA 1RN4A 3HOHA 1BRKA 1O7HB 1SPUA 3DZLA 1RJOA 1E3VA 1KD14 1V58A 3FH1A 4L8PA 3X41A 2CKFB 4H3UA 2R41A 3KZTA 4RNZA 3RDEA 4WHAA 5BVBA 1B2XA 1RHLA 3I563 1AVLA 1OHSA 2QEX3 1BNEA 3DH2A 3LH4A 1FGQA 1W02A 1ROVA 3AMOA 3DMCA 3GSPA 1IYYA 3T8NA 2CK3H 3F14A 4PEJA 2QGUA 1JKGA 1I2FA 3T0UA 1FA3A 3NQYA 4HM6B 4LGQA 4KVHA 1E3RA 2OOVC 4K61A 3WR2A 3CXC2 3UB1A 3DGOA 4WYKB 5AYSC 1MWTA 1NO3A 1A2KA 1QALA 2KXGA 3WA3A 1YIT3 1DMMA 2OQEA 3H3HA 1CYVA 1W00A 4WFOA 3K63A 1VQN3 5AEWB 1E97A 2F56A 2RNTA 1AY7A 3PGBA 1IVVA 1QAKA 1W5ZA 1ASKA 1OHOA 3FG3A 3HIGA 3U1WA 3V99A 2L1SA 1JN5A 1VQ43 2F5WA 1N8R4 1HU9A 3LOYA 1KWIA 1A2VA 3CNMA 3IMAB 4ILFA 1O7GB 3BU4A 3H51A 4WP5A 3X3ZA 1LNIA 1MGWA 1X1WA 3NUVA 4X2OA 2CG1A 1GMRA 3SOAA 1B2SA 1LOXA 4R9LA 1G96A 4BIRA 3NV0A 5EQLA 1HKXA 1GY7A 3J7Yd 5AEUB 2PNCA 2XSHB 3JUPA 3S28A 3FF0A 1T5YA 1CYUA 3F7SA 3WMDA 3EBTA 1G02A 2XH9A 2P0XA 1RTUA 1I3IA 2OTL3 3EB8A 2P0MA 1BNGA 1GD4A 1RCLA 2KF4A 3DUKA 2XR8B 1RLSA 3S29A 4GSPA 1KC84 3KN4A 1BRJA 3KSED 4R80A 3EJVA 1IT8A 3O8YA 1BVIA 3AGNA 1ZGXA 3FSDA 1B2UA 1W4NA 1IT7A 1HZ1A 4CCVA 1US1A 4J8TA 1PU4A 1YIJ3 1EQKA 5KP3A 3WA2X 3MG2A 1FUSA 1OGXA 3LT8A 4L7KA 2IUJA 3T8UA 2F4YA 3LTDA 4HZ9B 2R4IA 3ZG5A 2GBXB 1FGTA 4KT3B 5IEOA 1PY3A 5LC6A 1Q864 3S67A 2KF5A 2W56B 8RNTA 1UW1A 1WMNA 2XFTA 3KFQC 4HBRA 1N9EA 4L8OA 1RGCA 7RNTA 4R1KA 1JB2A 3CNXA 4GB5A 3G0KA 1VQK3 3DGMA 3UL5A 1UDII 3OWUA 2BNGA 4XDWA 2W0QA 3MHEA 3NM2A 1FGMA 1OGZA 4LMIA 3STDA 4BTWA 1RKYA 2WGOA 3RGRA 3SOYA 3D9RA 1UGHI 4EV2A 2FGTA 4X2HA 5A0OB 1O7WB 4OVMA 2CWUA 1TFKA 1STDA 1B21A 2BO9B 4KZ1A 5M1AA 1RN7A 4MEIA 3CC23 5IF6A 1GMQA 3CD63 3AGOA 2W04A 1BANA 1BAOA 3F40A 4CDLA 4N6UA 1VQO3 1BSBA 1LNHA 1YGWA 2CWVA 1JNQA 3L0RA 4KFEA 3X3YA 4DKIA 1EKMA 3G4S3 1G0TA 1NU3A 1RNTA 3N9HA 3WOEB 1ZX2A 5DRVA 3FGYA 1JZOA 3CC73 2HMNB 1FZUA 5CF1A 1GSPA 2UGIA 4GHOA 3QK9A 4AEQA 2V1LA 1QVG2 2CH9A 4BL3A 1DVDA 1LOWA 2RBIA 1BRHA 1RGAA 4EBGA 1B20A 1YJN3 2LYXA 2CFLA 4FR9A 4N6TA 3NBBA 3HZPA 3ALAA 3SEDA 7STDA 2OTJ3 2BU4A 4FCMA 2IA7A 5AIFA 2PZVA 2KCDA 2JDIH 5AYRB 3OV4A 2CFWA 3ROBA 1RGGA 5CLKA 3GAXA 1ZS7A 1S723 1TIJA 4OK0A 2H0GA 2C10A 1UCKA 2XSOB 1NB3I 2O9UX 5G2GA 1JB4A 3ZG0A 1OPYA 2OCTA 3F8HA 1LOVA 1Q40A 3GRDA 1GOUA 2FNQA 2BHMA 3N8BA 1JBSA 1N5PA 3LZAA 3Q1CA 3CCV3 1UCIA 3DGNA 2SBLA 2A15A 4BTXA 3NXJA 1ZO2A 1LVNA 1IVXA 1QAFA 4HM5B 4AKZA 1I8VA 4BL2A 3SYUA 1OF5B 1A90A 5IEPA 1GY6A 4JF8A 2QIYA 1NB5I 3EF8A 3JUOA 3JUNA 3MG3A 4LEHA 5DREA 1BRNL 3EN8A 3GZBA 1YI23 1BNFA 1NJI4 1M1XB 1OH0A 2ZL8A 3A5EA 1QVF2 1V74A 4IPBA 5CF2A 4O02B 7GSPA 3A76A 3D79A 2XFSA 4JRFA 2ZHXB 1DVCA 3UJMA 1I0VA 1RGFA 3UL6A 5IW9A 2AADA 4MJDA 4XBXA 1JRQA 1NNVA 5TGNA 3CCS3 1AR0A 1GMPA 4BU4A 2IYJA 3N54B 2CWTA 1SQWA 3IPTA 2JQ5A 1Q7HA 1JB5A 1ULIB 3PYJA 1CH0A 1BNIA 2FXTA 4I4KA 3U97A 1X1YA 1B27A 4N6V0 3HIIA 2E2TA 4OUQA 1A2PA 1RGLA 3G8ZA 3WHOA 3BNBA 1X1UA 1RMSA 4HZBB 3X40A 2XRXB 3I0YA 1IQXA 1TP6A 3V98A 3OWSA 2WGQA 2KF3A 3BNEA 3NX0A 1BOXA 3D5IA 1Q824 4J5KA 1IK3A 1MNLA 3KE7A 4EV5A 1VQ73 3VF1A 1RNBA 2ML5A 1TFOA 2XGNA 5GSPA 5M19A 5HGRA 3KKGA 3K9MC 1OHPA 1I0XA 4HAAA 1BSDA 2M7OA 3EN1B 3FZWA 2GSPA 1SARA 2YFLB 2INXA 1YVBI 2HMOB 2GEXA 3VSYA 2CX1A 2B24B 1FGRA 1LOYA 2ZDJA
chains in the Genus database with same CATH topology
3EHCA 4HM1B 4WWUC 5D83A 1GS3A 3MKIA 2CHCA 3FKAA 3JUMA 4HKVB 1K734 4XB5A 3X3XA 2GU3A 3MPHA 4XBYA 2XEPA 1IV7A 3AMOB 2CC3A 3X42A 4BTYA 1K28A 1TU5A 1QJGA 3LTCA 2GBWB 3JVCA 1YJW3 2W6JH 2F98A 2Z77A 3OXAA 5ELUA 3G6E3 3K5TA 1TUHA 3LMLA 1D6UA 3MSOA 3CMA3 3CC43 3CCE3 2QA43 1K9M4 1RRHA 1VQ83 3FF2A 2XGLA 4FCZA 3SXXA 4U13A 3Q90A 4IIAA 1IVUA 2RCDA 2ML6A 1OCVA 1EA2A 1Y4KA 2F99A 2I9WA 4IPBA 1QMAA 4Q53A 4R4KA 2W2CA 1WQLB 3FG1A 1L5GB 3EBYA 3B8LA 3GWRA 2W56A 1SJWA 3GZRA 3CU3A 2CG0A 3MWZA 3RGAA 1ROAA 1IV9A 2P09A 3EQQB 2HMKB 6STDA 1OUNA 1WTHA 3NV0B 5AI1A 3EX9A 2W9QA 3LTBA 5LC7A 5CXOA 1YHQ3 3CCL3 1Q814 4G1MB 1SIHA 1JV2B 4K1VA 4N6LA 2STDA 1O7NB 2Z7AA 3LXUX 3NBRA 1VQP3 1VQ63 2Z76A 1C7HA 3OWYA 1IQYA 4RNYA 5IG5A 3G16A 3FG4A 1GY5A 1SIIA 3PCSA 5IG3A 5IERA 3HX8A 2YFJB 3MYTA 3JUQA 1Q42A 2RFRA 2BT3A 1GD3A 1JKGB 3VGNA 3CCJ3 5JBSA 2D1WA 2HMLB 2HMJB 4HM3B 1U5OA 1D6ZA 1Q40B 3S27A 2Z6BA 3NQZA 4NREA 3BNCA 3DGLA 4STDA 5FGOA 3NHXA 2IUKA 3SLUA 3NM7A 2MF7A 3CME3 1CEWI 2RGQA 4FCJA 4FMDA 1BUQA 4GL6A 5D81A 3SX1A 5ELJA 2RSXA 2WO0A 4XM4A 1ULJB 3PCRA 3MG1A 2WOFA 4EYCA 5IG4A 5EEOA 1JJ22 1IQ8A 1A67A 1M1K4 2CFDA 3FLJA 3PXMA 1WNHA 5AIHA 1FUWA 2OOVA 4N6NB 1NWWA 1J2BA 2P05A 4O3VA 3Q2PA 2K0MA 4KFFA 3ECFA 2E2VA 2O3OA 2CFGA 3DXOA 3F7XA 5IENA 2B1XB 2Y74A 4R9KA 8CHOA 1UI8A 3OW22 1RRLA 3TDGA 1IU7A 5JPPA 3IJEB 1M9GA 2GEYA 3CPOA 2CW9A 3QRDA 1Z1SA 1KSIA 1CQSA 3F9SA 1IVWA 3K7CA 1UUVB 2GU1A 5FW5A 4IT7A 4FMCA 1O7MB 3KSPA 5KP4A 3NBJA 1YJ93 3PS8A 1VZZA 1W6GA 3B4OA 1OACA 2IMJA 3D3LA 1WMPA 4HM7B 1OF5A 1AVKA 4RBNA 3HI7A 5KP1A 2L4VA 5AIIA 4FMBA 1WMOA 1DMQA 4O8SA 2XF3A 3CPW2 2Y73A 4EXRA 1PFPA 4LZIA 2D42A 1EG9B 4HJLB 3K0ZA 2HMMB 1K41A 3BNDA 3B4PA 4N6MA 3PZWA 2C11A 4HM8B 1F8NA 3BLZA 3CCQ3 4ORLA 3GZXB 2E2UA 4K90B 4RZMA 2MC8A 3I553 4K1UA 4XBTA 3ER7A 1UI7A 4NHFA 4H61A 3DM8A 2GXFA 1STFI 1U8CB 2OWPA 4ZM8A 2LQVA 2CFKA 2WOHA 3M8CA 3B7CA 1N5HA 1W2B2 2BMRB 1Q7Y4 1NDOB 4N6OB 3CCR3 2OQEC 1KQS2 1W7CA 1N8QA 1S5AA 2F86B 3EE1A 1VQ53 4QWTA 3GZYB 5D82A 3DY5A 1W2ZA 2BMOB 3HK4A 1UUWB 4MMZB 1IDPA 3UNLA 1K8A4 4AKYA 1W6CA 3SVAA 3OX9A 3BB9A 2UX0A 4TX4A 5BXQA 1M904 2CIUA 3LTAA 1N9JA 1VQ93 2Q07A 4HM0B 3KIIA 1JN5B 4HVNA 5I97A 3WODG 2YFIB 3CCU3 1GYBA 1O7PB 3G713 3WOFB 1VQL3 3S5CA 3FCSB 3E99A 4O2HA 2K54A 1W6YA 1LXEA 1MOLA 5AIGA 4WYKA 3V92A 2KRTA 1YGEA 1ISKA 3LT9A 1VQM3 2YX9A 1DMNA 3LYGA 1D6YA 4HM4B 3WDGB 3CCM3 2W9PA 4J9AA 4MMXB 5JPUA 5IG0A 4HM2B 1FGOA 4KFDA 2W03A 2BMQB 1AV4A 1R4CA 4N3VA 5STDA 4MMYB 4FMAA 2P38A 5EVHA 4HYZA 1W01A 4LSOA 5CK6A 1DYUA 4EC6A 3EC9A 4XDVA 1O7HB 1SPUA 3DZLA 1RJOA 1E3VA 1KD14 3FH1A 4L8PA 3X41A 2CKFB 4H3UA 3KZTA 4RNZA 3RDEA 5BVBA 4WHAA 3I563 1AVLA 1OHSA 2QEX3 3LH4A 1FGQA 1W02A 1ROVA 3AMOA 3DMCA 3T8NA 2CK3H 3F14A 4PEJA 2QGUA 1JKGA 3T0UA 1FA3A 3NQYA 4HM6B 4LGQA 4KVHA 1E3RA 2OOVC 4K61A 3CXC2 3UB1A 3DGOA 4WYKB 5AYSC 1NO3A 1A2KA 1QALA 2KXGA 3WA3A 1YIT3 1DMMA 2OQEA 3H3HA 1CYVA 1W00A 4WFOA 3K63A 1VQN3 5AEWB 1E97A 3PGBA 1IVVA 1QAKA 1W5ZA 1ASKA 1OHOA 3FG3A 3HIGA 3U1WA 3V99A 1JN5A 1VQ43 1N8R4 1HU9A 3LOYA 1KWIA 1A2VA 3CNMA 3IMAB 1O7GB 3H51A 4WP5A 3X3ZA 3NUVA 4X2OA 2CG1A 3SOAA 1LOXA 4R9LA 1G96A 3J7Yd 3NV0A 5EQLA 1HKXA 1GY7A 5AEUB 2PNCA 2XSHB 3JUPA 3S28A 3FF0A 1T5YA 1CYUA 3F7SA 3WMDA 3EBTA 2XH9A 2P0XA 2OTL3 3EB8A 2P0MA 1GD4A 3DUKA 2XR8B 3S29A 1KC84 3KN4A 3KSED 4R80A 3EJVA 1IT8A 3O8YA 3FSDA 4CCVA 1W4NA 1IT7A 1PU4A 1US1A 4J8TA 1YIJ3 1EQKA 5KP3A 3WA2X 3MG2A 3LT8A 1OGXA 4L7KA 2IUJA 3T8UA 3LTDA 4HZ9B 2R4IA 2GBXB 1FGTA 5IEOA 5LC6A 1Q864 3S67A 2W56B 1UW1A 1WMNA 2XFTA 3KFQC 4HBRA 1N9EA 4L8OA 4R1KA 1JB2A 3CNXA 4GB5A 3G0KA 1VQK3 3DGMA 3UL5A 4XDWA 3OWUA 2BNGA 2W0QA 3MHEA 3NM2A 1FGMA 1OGZA 4LMIA 3STDA 4BTWA 1RKYA 2WGOA 3RGRA 3SOYA 3D9RA 4EV2A 2FGTA 4X2HA 5A0OB 1O7WB 4OVMA 2CWUA 1TFKA 1STDA 2BO9B 4KZ1A 3CC23 1RN7A 4MEIA 5IF6A 3CD63 2W04A 3F40A 4CDLA 4N6UA 1VQO3 1LNHA 3L0RA 2CWVA 4KFEA 1JNQA 3X3YA 1EKMA 3G4S3 3N9HA 1NU3A 3WOEB 1ZX2A 5DRVA 3FGYA 3CC73 2HMNB 5CF1A 1QVG2 4AEQA 3QK9A 2V1LA 2CH9A 1DVDA 4EBGA 1YJN3 2LYXA 2CFLA 4FR9A 4N6TA 3NBBA 3HZPA 3ALAA 3SEDA 7STDA 2OTJ3 4FCMA 2IA7A 5AIFA 2PZVA 2KCDA 2JDIH 5AYRB 3OV4A 2CFWA 3ROBA 5CLKA 3GAXA 1S723 1TIJA 4OK0A 2C10A 2XSOB 1NB3I 2O9UX 5G2GA 1JB4A 1OPYA 2OCTA 3F8HA 1Q40A 3GRDA 2FNQA 2BHMA 3N8BA 1N5PA 3LZAA 3Q1CA 3CCV3 3DGNA 2SBLA 2A15A 4BTXA 3NXJA 1ZO2A 1LVNA 1IVXA 1QAFA 4HM5B 4AKZA 1OF5B 1A90A 5IEPA 1GY6A 4JF8A 2QIYA 1NB5I 3EF8A 3JUOA 3JUNA 3MG3A 4LEHA 5DREA 3EN8A 3GZBA 1YI23 1NJI4 1M1XB 1OH0A 2ZL8A 1QVF2 1V74A 5CF2A 4O02B 3A76A 2XFSA 4JRFA 3UJMA 1DVCA 3UL6A 5IW9A 4MJDA 4XBXA 1JRQA 5TGNA 3CCS3 1AR0A 3N54B 1SQWA 2CWTA 3IPTA 2JQ5A 1JB5A 1ULIB 3PYJA 2FXTA 4I4KA 3U97A 4N6V0 3HIIA 2E2TA 4OUQA 3G8ZA 3BNBA 3X40A 4HZBB 2XRXB 3I0YA 1IQXA 1TP6A 3V98A 3OWSA 2WGQA 3BNEA 3NX0A 1Q824 1IK3A 1MNLA 3KE7A 4EV5A 1VQ73 3VF1A 2ML5A 1TFOA 2XGNA 5HGRA 3KKGA 3K9MC 1OHPA 2M7OA 3EN1B 3FZWA 2YFLB 2INXA 1YVBI 2HMOB 2GEXA 3VSYA 2B24B 1FGRA 3F8XA 2ZDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDL A;  3EHC A;  5EVH A;  4HM1 B;  1W01 A;  4WWU C;  3DXO A;  5CK6 A;  5D83 A;  3F7X A;  1GS3 A;  5IEN A;  2B1X B;  2CHC A;  3EC9 A;  3FKA A;  3JUM A;  3MKI A;  4HKV B;  4R9K A;  4XB5 A;  4XDV A;  8CHO A;  4XBY A;  1O7H B;  1NU3 A;  3DZL A;  5JPP A;  1E3V A;  1ZX2 A;  3FH1 A;  4L8P A;  5DRV A;  3FGY A;  2GEY A;  2CKF B;  3CPO A;  3KZT A;  1QJG A;  2HMN B;  4H3U A;  5BVB A;  1Z1S A;  5CF1 A;  1OHS A;  1CQS A;  3F9S A;  2GBW B;  3K7C A;  1UUV B;  2F98 A;  2Z77 A;  3OXA A;  5FW5 A;  1W02 A;  3DMC A;  1TUH A;  1O7M B;  3HZP A;  3MSO A;  4PEJ A;  3F14 A;  3SED A;  3T8N A;  2QGU A;  1JKG A;  3KSP A;  4FCM A;  4HM6 B;  5AIF A;  4LGQ A;  4KVH A;  5KP4 A;  1E3R A;  2PZV A;  3FF2 A;  1VZZ A;  3OV4 A;  4WYK B;  3B4O A;  3ROB A;  2IMJ A;  4U13 A;  1A2K A;  4HM7 B;  5CLK A;  3Q90 A;  1OF5 A;  4IIA A;  1DMM A;  3H3H A;  1W00 A;  5KP1 A;  5AII A;  5AEW B;  1E97 A;  1DMQ A;  2RCD A;  1OCV A;  1EA2 A;  2I9W A;  4Q53 A;  2F99 A;  1QMA A;  2XSO B;  1WQL B;  1JB4 A;  1EG9 B;  2W2C A;  3K0Z A;  4HJL B;  1OPY A;  2HMM B;  1ASK A;  3F8H A;  1K41 A;  1OHO A;  1Q40 A;  3B8L A;  3EBY A;  3GRD A;  3B4P A;  1JN5 A;  3GWR A;  1SJW A;  3LZA A;  3GZR A;  4HM8 B;  3CU3 A;  3BLZ A;  2A15 A;  3CNM A;  3NXJ A;  3RGA A;  1ZO2 A;  1O7G B;  4ORL A;  3EQQ B;  3H51 A;  4WP5 A;  2HMK B;  3GZX B;  3NUV A;  4RZM A;  4HM5 B;  4X2O A;  1OUN A;  3NV0 B;  5AI1 A;  4K1U A;  3SOA A;  1OF5 B;  3ER7 A;  3EX9 A;  4XBT A;  4R9L A;  5IEP A;  1GY6 A;  3NV0 A;  1HKX A;  1GY7 A;  2QIY A;  3DM8 A;  3EF8 A;  2GXF A;  3JUO A;  3JUN A;  3MG3 A;  4LEH A;  5CXO A;  5DRE A;  5AEU B;  2OWP A;  4K1V A;  2XSH B;  3EN8 A;  2STD A;  3GZB A;  3JUP A;  3FF0 A;  1O7N B;  1OH0 A;  2Z7A A;  3NBR A;  2Z76 A;  1C7H A;  3EBT A;  3B7C A;  3F7S A;  3M8C A;  3OWY A;  3WMD A;  5CF2 A;  2BMR B;  3A76 A;  5IG5 A;  3G16 A;  3UJM A;  1NDO B;  1GY5 A;  4MJD A;  4XBX A;  3DUK A;  1S5A A;  2F86 B;  2XR8 B;  5IG3 A;  5TGN A;  5IER A;  1AR0 A;  3HX8 A;  3EJV A;  3GZY B;  5D82 A;  3FSD A;  3IPT A;  2JQ5 A;  2YFJ B;  4J8T A;  1JB5 A;  1ULI B;  2BMO B;  1UUW B;  3HK4 A;  1IDP A;  3JUQ A;  3MYT A;  1Q42 A;  2RFR A;  3MG2 A;  5KP3 A;  1OGX A;  4I4K A;  4L7K A;  3OX9 A;  1JKG B;  3BB9 A;  2UX0 A;  3VGN A;  5BXQ A;  3T8U A;  6STD A;  4HM0 B;  4HZ9 B;  2HML B;  2HMJ B;  2R4I A;  1JN5 B;  1U5O A;  4HM3 B;  4HVN A;  4OUQ A;  1Q40 B;  7STD A;  2GBX B;  2YFI B;  3G8Z A;  1GYB A;  1O7P B;  5IEO A;  4HZB B;  3S5C A;  2XRX B;  3I0Y A;  3E99 A;  4STD A;  1TP6 A;  3NHX A;  3OWS A;  4L8O A;  2K54 A;  1W6Y A;  4R1K A;  1JB2 A;  3CNX A;  4GB5 A;  2RGQ A;  4FCJ A;  1BUQ A;  3G0K A;  5AIG A;  4WYK A;  5D81 A;  4XDW A;  3OWU A;  2BNG A;  3KE7 A;  1ISK A;  3MHE A;  3NM2 A;  4XM4 A;  3UNL A;  1ULJ B;  1OGZ A;  4LMI A;  3STD A;  3MG1 A;  1DMN A;  3LYG A;  3RGR A;  3SOY A;  4HM4 B;  3D9R A;  5IG4 A;  5HGR A;  3KKG A;  4J9A A;  5JPU A;  5IG0 A;  1OHP A;  4HM2 B;  4X2H A;  3FLJ A;  3EN1 B;  1O7W B;  4OVM A;  2BMQ B;  3FZW A;  5AIH A;  4N3V A;  5STD A;  1NWW A;  5G2G A;  1STD A;  2YFL B;  2INX A;  2HMO B;  5IF6 A;  2GEX A;  3VSY A;  3ECF A;  2B24 B;  3F8X A;  3F40 A; 
#chains in the Genus database with same CATH topology
 3AHW A;  3EHC A;  4HM1 B;  4WWU C;  5D83 A;  1GS3 A;  2C4B A;  1JZD A;  2CHC A;  3FKA A;  3JUM A;  3MKI A;  2KF6 A;  4HKV B;  1AQZ A;  4XB5 A;  1K73 4;  3X3X A;  2GU3 A;  3MPH A;  4XBY A;  2XEP A;  1IV7 A;  3AMO B;  1UCL A;  2CC3 A;  3X42 A;  4BTY A;  1K28 A;  1TU5 A;  1HYF A;  1QJG A;  3LTC A;  2H0I A;  2GBW B;  3JVC A;  1YJW 3;  2W6J H;  2F98 A;  2Z77 A;  3OXA A;  5ELU A;  3G6E 3;  3K5T A;  1TUH A;  1MWR A;  1D6U A;  3LML A;  3MSO A;  3CC4 3;  3CMA 3;  3CCE 3;  2QA4 3;  1K9M 4;  1RRH A;  1VQ8 3;  3FF2 A;  1TJD A;  1LQM B;  2XGL A;  1T2H A;  4LYL B;  1BIR A;  4FCZ A;  3SXX A;  4U13 A;  2HOH A;  3Q90 A;  4IIA A;  1IVU A;  9RNT A;  3D5G A;  1RGE A;  2RCD A;  3RNT A;  1B2Z A;  1EA2 A;  1LQG C;  1I2G A;  1OCV A;  1Y4K A;  2F99 A;  1QMA A;  2I9W A;  2ML6 A;  1WQL B;  2SAR A;  2W2C A;  3FG1 A;  5BIR A;  1L5G B;  3EBY A;  3B8L A;  1FYS A;  3GWR A;  1BRG A;  2W56 A;  1SJW A;  3GZR A;  3CU3 A;  2CG0 A;  3MWZ A;  3RGA A;  1ROA A;  1IV9 A;  2P09 A;  3EQQ B;  2HMK B;  2F5M A;  6STD A;  1OUN A;  1WTH A;  3NV0 B;  5AI1 A;  3EX9 A;  2W9Q A;  1I70 A;  4CJN A;  3LTB A;  5LC7 A;  5CXO A;  4J5G A;  1YHQ 3;  3CCL 3;  1Q81 4;  4G1M B;  1SIH A;  1JV2 B;  4K1V A;  4N6L A;  1JBR A;  2STD A;  1O7N B;  2Z7A A;  3LXU X;  3NBR A;  1VQP 3;  2UUG C;  2Z76 A;  1C7H A;  1R4Y A;  3AHS A;  1VQ6 3;  3OWY A;  1IQY A;  1MWS A;  4RNY A;  5IG5 A;  3G16 A;  3Q3F A;  3FG4 A;  1RSN A;  1RN1 A;  1GY5 A;  1Q9E A;  1TRP A;  1SII A;  3KCH A;  3PCS A;  5IG3 A;  5G1L A;  1FW7 A;  5IER A;  3HX8 A;  1BU4 A;  1BNJ A;  2YFJ B;  3MYT A;  3JUQ A;  4R4K A;  1Q42 A;  2RFR A;  2BT3 A;  1GD3 A;  1JKG B;  3VGN A;  3CCJ 3;  5JBS A;  2D1W A;  2HML B;  2HMJ B;  4HM3 B;  1U5O A;  1D6Z A;  1Q40 B;  3S27 A;  2Z6B A;  4RNT A;  3NQZ A;  3D4A A;  3BNC A;  4NRE A;  3DGL A;  4STD A;  5FGO A;  3NHX A;  2IUK A;  3SLU A;  1JBT A;  1MGR A;  3NM7 A;  1BNS A;  1RGH A;  2MF7 A;  3CME 3;  1FUT A;  1CEW I;  2RGQ A;  1VQQ A;  4FCJ A;  4FMD A;  1BUQ A;  4GL6 A;  5D81 A;  3SX1 A;  5ELJ A;  2RSX A;  2WO0 A;  1TRQ A;  4XM4 A;  1ULJ B;  3PCR A;  3MG1 A;  5M18 A;  3BIR A;  2WOF A;  4EYC A;  1BSC A;  5IG4 A;  5EEO A;  1JJ2 2;  1IQ8 A;  1A67 A;  1M1K 4;  2CFD A;  3FLJ A;  3PXM A;  1WNH A;  5AIH A;  1C54 A;  1B2M A;  1FUW A;  2OOV A;  4N6N B;  1NWW A;  1J2B A;  2P05 A;  4O3V A;  1EUI C;  1TTO A;  3Q2P A;  2K0M A;  4KFF A;  3ECF A;  2E2V A;  1PYL A;  2KAA A;  2O3O A;  2CFG A;  3DXO A;  3F7X A;  5IEN A;  2B1X B;  2Y74 A;  1YNV X;  4R9K A;  8CHO A;  1UI8 A;  1MWU A;  1UCJ A;  3OW2 2;  1RRL A;  3TDG A;  1IU7 A;  5JPP A;  3IJE B;  1M9G A;  1RDS A;  2GEY A;  3CPO A;  2CW9 A;  3QRD A;  4EW5 A;  1Z1S A;  1KSI A;  3URP A;  1CQS A;  3F9S A;  1IVW A;  3K7C A;  1UUV B;  2GU1 A;  5FW5 A;  4IT7 A;  4FMC A;  1O7M B;  3KSP A;  5KP4 A;  3NBJ A;  3F8X A;  1YJ9 3;  3PS8 A;  1VZZ A;  1W6G A;  4NPB A;  3B4O A;  1T3B A;  1OAC A;  2IMJ A;  3D3L A;  1WMP A;  4HM7 B;  1DET A;  1OF5 A;  1AVK A;  4RBN A;  3HI7 A;  5KP1 A;  2L4V A;  5AII A;  4FMB A;  1T2I A;  1WMO A;  1DMQ A;  1YVS A;  4O8S A;  2XF3 A;  3CPW 2;  2Y73 A;  4EXR A;  1PFP A;  1V57 A;  4LZI A;  2D42 A;  1EG9 B;  4HJL B;  3K0Z A;  2HMM B;  1K41 A;  3BND A;  1BNR A;  3B4P A;  4N6M A;  3PZW A;  2C11 A;  2H0H A;  4HM8 B;  1F8N A;  3BLZ A;  4Q53 A;  3CCQ 3;  1BRS A;  1BSA A;  4ORL A;  3GZX B;  2E2U A;  4K90 B;  4RZM A;  2MC8 A;  5HOH A;  3I55 3;  4K1U A;  4XBT A;  3ER7 A;  1UI7 A;  4NHF A;  4H61 A;  3DM8 A;  4CPK A;  2GXF A;  1STF I;  1U8C B;  1RGK A;  2OWP A;  1EEJ A;  1GOY A;  4ZM8 A;  2LQV A;  2CFK A;  2K3D A;  1RCK A;  2WOH A;  3M8C A;  6RNT A;  3B7C A;  1N5H A;  1W2B 2;  2IY2 A;  2BMR B;  1Q7Y 4;  1I3F A;  1X1X A;  1NDO B;  4N6O B;  3CCR 3;  2OQE C;  1KQS 2;  1W7C A;  1N8Q A;  1S5A A;  2F86 B;  3ZFZ A;  3EE1 A;  1VQ5 3;  4QWT A;  3GZY B;  5D82 A;  3DY5 A;  1W2Z A;  2BMO B;  3HK4 A;  1UGI A;  1UUW B;  1IDP A;  4MMZ B;  3UNL A;  1K8A 4;  4AKY A;  1W6C A;  3SVA A;  3OX9 A;  1I2E A;  1BSE A;  2UX0 A;  3BB9 A;  4TX4 A;  2CIU A;  3LTA A;  5BXQ A;  1B3S A;  1N9J A;  1VQ9 3;  2Q07 A;  4HM0 B;  5RNT A;  3KII A;  1JN5 B;  4HVN A;  5I97 A;  3WOD G;  2YFI B;  3CCU 3;  1GYB A;  1O7P B;  3G71 3;  5G1K A;  3WOF B;  2BIR A;  1VQL 3;  3S5C A;  1LRA A;  3FCS B;  3DGY A;  2CX0 A;  3E99 A;  4O2H A;  2K54 A;  1BRI A;  1W6Y A;  1LXE A;  1MOL A;  5AIG A;  4WYK A;  3V92 A;  1UUG B;  1YGE A;  2KRT A;  3LT9 A;  1ISK A;  1VQM 3;  2YX9 A;  4I5Q A;  5BU4 A;  1DMN A;  1M90 4;  1BGS A;  3LYG A;  4HOH A;  1D6Y A;  4HM4 B;  3WDG B;  3CCM 3;  2W9P A;  4J9A A;  4MMX B;  5JPU A;  5IG0 A;  4HM2 B;  1FGO A;  4KFD A;  2W03 A;  1GOV A;  2BMQ B;  1AV4 A;  1R4C A;  4N3V A;  2AAE A;  2J8X B;  4MMY B;  5STD A;  6GSP A;  1DE3 A;  4FMA A;  2P38 A;  2ZA4 A;  5EVH A;  4HYZ A;  1W01 A;  4LSO A;  1BUJ A;  5CK6 A;  1DYU A;  4EC6 A;  3EC9 A;  4XDV A;  1RN4 A;  3HOH A;  1BRK A;  1O7H B;  1SPU A;  3DZL A;  1RJO A;  1E3V A;  1KD1 4;  1V58 A;  3FH1 A;  4L8P A;  3X41 A;  2CKF B;  4H3U A;  2R41 A;  3KZT A;  4RNZ A;  3RDE A;  4WHA A;  5BVB A;  1B2X A;  1RHL A;  3I56 3;  1AVL A;  1OHS A;  2QEX 3;  1BNE A;  3DH2 A;  3LH4 A;  1FGQ A;  1W02 A;  1ROV A;  3AMO A;  3DMC A;  3GSP A;  1IYY A;  3T8N A;  2CK3 H;  3F14 A;  4PEJ A;  2QGU A;  1JKG A;  1I2F A;  3T0U A;  1FA3 A;  3NQY A;  4HM6 B;  4LGQ A;  4KVH A;  1E3R A;  2OOV C;  4K61 A;  3WR2 A;  3CXC 2;  3UB1 A;  3DGO A;  4WYK B;  5AYS C;  1MWT A;  1NO3 A;  1A2K A;  1QAL A;  2KXG A;  3WA3 A;  1YIT 3;  1DMM A;  2OQE A;  3H3H A;  1CYV A;  1W00 A;  4WFO A;  3K63 A;  1VQN 3;  5AEW B;  1E97 A;  2F56 A;  2RNT A;  1AY7 A;  3PGB A;  1IVV A;  1QAK A;  1W5Z A;  1ASK A;  1OHO A;  3FG3 A;  3HIG A;  3U1W A;  3V99 A;  2L1S A;  1JN5 A;  1VQ4 3;  2F5W A;  1N8R 4;  1HU9 A;  3LOY A;  1KWI A;  1A2V A;  3CNM A;  3IMA B;  4ILF A;  1O7G B;  3BU4 A;  3H51 A;  4WP5 A;  3X3Z A;  1LNI A;  1MGW A;  1X1W A;  3NUV A;  4X2O A;  2CG1 A;  1GMR A;  3SOA A;  1B2S A;  1LOX A;  4R9L A;  1G96 A;  4BIR A;  3NV0 A;  5EQL A;  1HKX A;  1GY7 A;  3J7Y d;  5AEU B;  2PNC A;  2XSH B;  3JUP A;  3S28 A;  3FF0 A;  1T5Y A;  1CYU A;  3F7S A;  3WMD A;  3EBT A;  1G02 A;  2XH9 A;  2P0X A;  1RTU A;  1I3I A;  2OTL 3;  3EB8 A;  2P0M A;  1BNG A;  1GD4 A;  1RCL A;  2KF4 A;  3DUK A;  2XR8 B;  1RLS A;  3S29 A;  4GSP A;  1KC8 4;  3KN4 A;  1BRJ A;  3KSE D;  4R80 A;  3EJV A;  1IT8 A;  3O8Y A;  1BVI A;  3AGN A;  1ZGX A;  3FSD A;  1B2U A;  1W4N A;  1IT7 A;  1HZ1 A;  4CCV A;  1US1 A;  4J8T A;  1PU4 A;  1YIJ 3;  1EQK A;  5KP3 A;  3WA2 X;  3MG2 A;  1FUS A;  1OGX A;  3LT8 A;  4L7K A;  2IUJ A;  3T8U A;  2F4Y A;  3LTD A;  4HZ9 B;  2R4I A;  3ZG5 A;  2GBX B;  1FGT A;  4KT3 B;  5IEO A;  1PY3 A;  5LC6 A;  1Q86 4;  3S67 A;  2KF5 A;  2W56 B;  8RNT A;  1UW1 A;  1WMN A;  2XFT A;  3KFQ C;  4HBR A;  1N9E A;  4L8O A;  1RGC A;  7RNT A;  4R1K A;  1JB2 A;  3CNX A;  4GB5 A;  3G0K A;  1VQK 3;  3DGM A;  3UL5 A;  1UDI I;  3OWU A;  2BNG A;  4XDW A;  2W0Q A;  3MHE A;  3NM2 A;  1FGM A;  1OGZ A;  4LMI A;  3STD A;  4BTW A;  1RKY A;  2WGO A;  3RGR A;  3SOY A;  3D9R A;  1UGH I;  4EV2 A;  2FGT A;  4X2H A;  5A0O B;  1O7W B;  4OVM A;  2CWU A;  1TFK A;  1STD A;  1B21 A;  2BO9 B;  4KZ1 A;  5M1A A;  1RN7 A;  4MEI A;  3CC2 3;  5IF6 A;  1GMQ A;  3CD6 3;  3AGO A;  2W04 A;  1BAN A;  1BAO A;  3F40 A;  4CDL A;  4N6U A;  1VQO 3;  1BSB A;  1LNH A;  1YGW A;  2CWV A;  1JNQ A;  3L0R A;  4KFE A;  3X3Y A;  4DKI A;  1EKM A;  3G4S 3;  1G0T A;  1NU3 A;  1RNT A;  3N9H A;  3WOE B;  1ZX2 A;  5DRV A;  3FGY A;  1JZO A;  3CC7 3;  2HMN B;  1FZU A;  5CF1 A;  1GSP A;  2UGI A;  4GHO A;  3QK9 A;  4AEQ A;  2V1L A;  1QVG 2;  2CH9 A;  4BL3 A;  1DVD A;  1LOW A;  2RBI A;  1BRH A;  1RGA A;  4EBG A;  1B20 A;  1YJN 3;  2LYX A;  2CFL A;  4FR9 A;  4N6T A;  3NBB A;  3HZP A;  3ALA A;  3SED A;  7STD A;  2OTJ 3;  2BU4 A;  4FCM A;  2IA7 A;  5AIF A;  2PZV A;  2KCD A;  2JDI H;  5AYR B;  3OV4 A;  2CFW A;  3ROB A;  1RGG A;  5CLK A;  3GAX A;  1ZS7 A;  1S72 3;  1TIJ A;  4OK0 A;  2H0G A;  2C10 A;  1UCK A;  2XSO B;  1NB3 I;  2O9U X;  5G2G A;  1JB4 A;  3ZG0 A;  1OPY A;  2OCT A;  3F8H A;  1LOV A;  1Q40 A;  3GRD A;  1GOU A;  2FNQ A;  2BHM A;  3N8B A;  1JBS A;  1N5P A;  3LZA A;  3Q1C A;  3CCV 3;  1UCI A;  3DGN A;  2SBL A;  2A15 A;  4BTX A;  3NXJ A;  1ZO2 A;  1LVN A;  1IVX A;  1QAF A;  4HM5 B;  4AKZ A;  1I8V A;  4BL2 A;  3SYU A;  1OF5 B;  1A90 A;  5IEP A;  1GY6 A;  4JF8 A;  2QIY A;  1NB5 I;  3EF8 A;  3JUO A;  3JUN A;  3MG3 A;  4LEH A;  5DRE A;  1BRN L;  3EN8 A;  3GZB A;  1YI2 3;  1BNF A;  1NJI 4;  1M1X B;  1OH0 A;  2ZL8 A;  3A5E A;  1QVF 2;  1V74 A;  4IPB A;  5CF2 A;  4O02 B;  7GSP A;  3A76 A;  3D79 A;  2XFS A;  4JRF A;  2ZHX B;  1DVC A;  3UJM A;  1I0V A;  1RGF A;  3UL6 A;  5IW9 A;  2AAD A;  4MJD A;  4XBX A;  1JRQ A;  1NNV A;  5TGN A;  3CCS 3;  1AR0 A;  1GMP A;  4BU4 A;  2IYJ A;  3N54 B;  2CWT A;  1SQW A;  3IPT A;  2JQ5 A;  1Q7H A;  1JB5 A;  1ULI B;  3PYJ A;  1CH0 A;  1BNI A;  2FXT A;  4I4K A;  3U97 A;  1X1Y A;  1B27 A;  4N6V 0;  3HII A;  2E2T A;  4OUQ A;  1A2P A;  1RGL A;  3G8Z A;  3WHO A;  3BNB A;  1X1U A;  1RMS A;  4HZB B;  3X40 A;  2XRX B;  3I0Y A;  1IQX A;  1TP6 A;  3V98 A;  3OWS A;  2WGQ A;  2KF3 A;  3BNE A;  3NX0 A;  1BOX A;  3D5I A;  1Q82 4;  4J5K A;  1IK3 A;  1MNL A;  3KE7 A;  4EV5 A;  1VQ7 3;  3VF1 A;  1RNB A;  2ML5 A;  1TFO A;  2XGN A;  5GSP A;  5M19 A;  5HGR A;  3KKG A;  3K9M C;  1OHP A;  1I0X A;  4HAA A;  1BSD A;  2M7O A;  3EN1 B;  3FZW A;  2GSP A;  1SAR A;  2YFL B;  2INX A;  1YVB I;  2HMO B;  2GEX A;  3VSY A;  2CX1 A;  2B24 B;  1FGR A;  1LOY A;  2ZDJ A; 
#chains in the Genus database with same CATH homology
 3EHC A;  4HM1 B;  4WWU C;  5D83 A;  1GS3 A;  3MKI A;  2CHC A;  3FKA A;  3JUM A;  4HKV B;  1K73 4;  4XB5 A;  3X3X A;  2GU3 A;  3MPH A;  4XBY A;  2XEP A;  1IV7 A;  3AMO B;  2CC3 A;  3X42 A;  4BTY A;  1K28 A;  1TU5 A;  1QJG A;  3LTC A;  2GBW B;  3JVC A;  1YJW 3;  2W6J H;  2F98 A;  2Z77 A;  3OXA A;  5ELU A;  3G6E 3;  3K5T A;  1TUH A;  3LML A;  1D6U A;  3MSO A;  3CMA 3;  3CC4 3;  3CCE 3;  2QA4 3;  1K9M 4;  1RRH A;  1VQ8 3;  3FF2 A;  2XGL A;  4FCZ A;  3SXX A;  4U13 A;  3Q90 A;  4IIA A;  1IVU A;  2RCD A;  2ML6 A;  1OCV A;  1EA2 A;  1Y4K A;  2F99 A;  2I9W A;  4IPB A;  1QMA A;  4Q53 A;  4R4K A;  2W2C A;  1WQL B;  3FG1 A;  1L5G B;  3EBY A;  3B8L A;  3GWR A;  2W56 A;  1SJW A;  3GZR A;  3CU3 A;  2CG0 A;  3MWZ A;  3RGA A;  1ROA A;  1IV9 A;  2P09 A;  3EQQ B;  2HMK B;  6STD A;  1OUN A;  1WTH A;  3NV0 B;  5AI1 A;  3EX9 A;  2W9Q A;  3LTB A;  5LC7 A;  5CXO A;  1YHQ 3;  3CCL 3;  1Q81 4;  4G1M B;  1SIH A;  1JV2 B;  4K1V A;  4N6L A;  2STD A;  1O7N B;  2Z7A A;  3LXU X;  3NBR A;  1VQP 3;  1VQ6 3;  2Z76 A;  1C7H A;  3OWY A;  1IQY A;  4RNY A;  5IG5 A;  3G16 A;  3FG4 A;  1GY5 A;  1SII A;  3PCS A;  5IG3 A;  5IER A;  3HX8 A;  2YFJ B;  3MYT A;  3JUQ A;  1Q42 A;  2RFR A;  2BT3 A;  1GD3 A;  1JKG B;  3VGN A;  3CCJ 3;  5JBS A;  2D1W A;  2HML B;  2HMJ B;  4HM3 B;  1U5O A;  1D6Z A;  1Q40 B;  3S27 A;  2Z6B A;  3NQZ A;  4NRE A;  3BNC A;  3DGL A;  4STD A;  5FGO A;  3NHX A;  2IUK A;  3SLU A;  3NM7 A;  2MF7 A;  3CME 3;  1CEW I;  2RGQ A;  4FCJ A;  4FMD A;  1BUQ A;  4GL6 A;  5D81 A;  3SX1 A;  5ELJ A;  2RSX A;  2WO0 A;  4XM4 A;  1ULJ B;  3PCR A;  3MG1 A;  2WOF A;  4EYC A;  5IG4 A;  5EEO A;  1JJ2 2;  1IQ8 A;  1A67 A;  1M1K 4;  2CFD A;  3FLJ A;  3PXM A;  1WNH A;  5AIH A;  1FUW A;  2OOV A;  4N6N B;  1NWW A;  1J2B A;  2P05 A;  4O3V A;  3Q2P A;  2K0M A;  4KFF A;  3ECF A;  2E2V A;  2O3O A;  2CFG A;  3DXO A;  3F7X A;  5IEN A;  2B1X B;  2Y74 A;  4R9K A;  8CHO A;  1UI8 A;  3OW2 2;  1RRL A;  3TDG A;  1IU7 A;  5JPP A;  3IJE B;  1M9G A;  2GEY A;  3CPO A;  2CW9 A;  3QRD A;  1Z1S A;  1KSI A;  1CQS A;  3F9S A;  1IVW A;  3K7C A;  1UUV B;  2GU1 A;  5FW5 A;  4IT7 A;  4FMC A;  1O7M B;  3KSP A;  5KP4 A;  3NBJ A;  1YJ9 3;  3PS8 A;  1VZZ A;  1W6G A;  3B4O A;  1OAC A;  2IMJ A;  3D3L A;  1WMP A;  4HM7 B;  1OF5 A;  1AVK A;  4RBN A;  3HI7 A;  5KP1 A;  2L4V A;  5AII A;  4FMB A;  1WMO A;  1DMQ A;  4O8S A;  2XF3 A;  3CPW 2;  2Y73 A;  4EXR A;  1PFP A;  4LZI A;  2D42 A;  1EG9 B;  4HJL B;  3K0Z A;  2HMM B;  1K41 A;  3BND A;  3B4P A;  4N6M A;  3PZW A;  2C11 A;  4HM8 B;  1F8N A;  3BLZ A;  3CCQ 3;  4ORL A;  3GZX B;  2E2U A;  4K90 B;  4RZM A;  2MC8 A;  3I55 3;  4K1U A;  4XBT A;  3ER7 A;  1UI7 A;  4NHF A;  4H61 A;  3DM8 A;  2GXF A;  1STF I;  1U8C B;  2OWP A;  4ZM8 A;  2LQV A;  2CFK A;  2WOH A;  3M8C A;  3B7C A;  1N5H A;  1W2B 2;  2BMR B;  1Q7Y 4;  1NDO B;  4N6O B;  3CCR 3;  2OQE C;  1KQS 2;  1W7C A;  1N8Q A;  1S5A A;  2F86 B;  3EE1 A;  1VQ5 3;  4QWT A;  3GZY B;  5D82 A;  3DY5 A;  1W2Z A;  2BMO B;  3HK4 A;  1UUW B;  4MMZ B;  1IDP A;  3UNL A;  1K8A 4;  4AKY A;  1W6C A;  3SVA A;  3OX9 A;  3BB9 A;  2UX0 A;  4TX4 A;  5BXQ A;  1M90 4;  2CIU A;  3LTA A;  1N9J A;  1VQ9 3;  2Q07 A;  4HM0 B;  3KII A;  1JN5 B;  4HVN A;  5I97 A;  3WOD G;  2YFI B;  3CCU 3;  1GYB A;  1O7P B;  3G71 3;  3WOF B;  1VQL 3;  3S5C A;  3FCS B;  3E99 A;  4O2H A;  2K54 A;  1W6Y A;  1LXE A;  1MOL A;  5AIG A;  4WYK A;  3V92 A;  2KRT A;  1YGE A;  1ISK A;  3LT9 A;  1VQM 3;  2YX9 A;  1DMN A;  3LYG A;  1D6Y A;  4HM4 B;  3WDG B;  3CCM 3;  2W9P A;  4J9A A;  4MMX B;  5JPU A;  5IG0 A;  4HM2 B;  1FGO A;  4KFD A;  2W03 A;  2BMQ B;  1AV4 A;  1R4C A;  4N3V A;  5STD A;  4MMY B;  4FMA A;  2P38 A;  5EVH A;  4HYZ A;  1W01 A;  4LSO A;  5CK6 A;  1DYU A;  4EC6 A;  3EC9 A;  4XDV A;  1O7H B;  1SPU A;  3DZL A;  1RJO A;  1E3V A;  1KD1 4;  3FH1 A;  4L8P A;  3X41 A;  2CKF B;  4H3U A;  3KZT A;  4RNZ A;  3RDE A;  5BVB A;  4WHA A;  3I56 3;  1AVL A;  1OHS A;  2QEX 3;  3LH4 A;  1FGQ A;  1W02 A;  1ROV A;  3AMO A;  3DMC A;  3T8N A;  2CK3 H;  3F14 A;  4PEJ A;  2QGU A;  1JKG A;  3T0U A;  1FA3 A;  3NQY A;  4HM6 B;  4LGQ A;  4KVH A;  1E3R A;  2OOV C;  4K61 A;  3CXC 2;  3UB1 A;  3DGO A;  4WYK B;  5AYS C;  1NO3 A;  1A2K A;  1QAL A;  2KXG A;  3WA3 A;  1YIT 3;  1DMM A;  2OQE A;  3H3H A;  1CYV A;  1W00 A;  4WFO A;  3K63 A;  1VQN 3;  5AEW B;  1E97 A;  3PGB A;  1IVV A;  1QAK A;  1W5Z A;  1ASK A;  1OHO A;  3FG3 A;  3HIG A;  3U1W A;  3V99 A;  1JN5 A;  1VQ4 3;  1N8R 4;  1HU9 A;  3LOY A;  1KWI A;  1A2V A;  3CNM A;  3IMA B;  1O7G B;  3H51 A;  4WP5 A;  3X3Z A;  3NUV A;  4X2O A;  2CG1 A;  3SOA A;  1LOX A;  4R9L A;  1G96 A;  3J7Y d;  3NV0 A;  5EQL A;  1HKX A;  1GY7 A;  5AEU B;  2PNC A;  2XSH B;  3JUP A;  3S28 A;  3FF0 A;  1T5Y A;  1CYU A;  3F7S A;  3WMD A;  3EBT A;  2XH9 A;  2P0X A;  2OTL 3;  3EB8 A;  2P0M A;  1GD4 A;  3DUK A;  2XR8 B;  3S29 A;  1KC8 4;  3KN4 A;  3KSE D;  4R80 A;  3EJV A;  1IT8 A;  3O8Y A;  3FSD A;  4CCV A;  1W4N A;  1IT7 A;  1PU4 A;  1US1 A;  4J8T A;  1YIJ 3;  1EQK A;  5KP3 A;  3WA2 X;  3MG2 A;  3LT8 A;  1OGX A;  4L7K A;  2IUJ A;  3T8U A;  3LTD A;  4HZ9 B;  2R4I A;  2GBX B;  1FGT A;  5IEO A;  5LC6 A;  1Q86 4;  3S67 A;  2W56 B;  1UW1 A;  1WMN A;  2XFT A;  3KFQ C;  4HBR A;  1N9E A;  4L8O A;  4R1K A;  1JB2 A;  3CNX A;  4GB5 A;  3G0K A;  1VQK 3;  3DGM A;  3UL5 A;  4XDW A;  3OWU A;  2BNG A;  2W0Q A;  3MHE A;  3NM2 A;  1FGM A;  1OGZ A;  4LMI A;  3STD A;  4BTW A;  1RKY A;  2WGO A;  3RGR A;  3SOY A;  3D9R A;  4EV2 A;  2FGT A;  4X2H A;  5A0O B;  1O7W B;  4OVM A;  2CWU A;  1TFK A;  1STD A;  2BO9 B;  4KZ1 A;  3CC2 3;  1RN7 A;  4MEI A;  5IF6 A;  3CD6 3;  2W04 A;  3F40 A;  4CDL A;  4N6U A;  1VQO 3;  1LNH A;  3L0R A;  2CWV A;  4KFE A;  1JNQ A;  3X3Y A;  1EKM A;  3G4S 3;  3N9H A;  1NU3 A;  3WOE B;  1ZX2 A;  5DRV A;  3FGY A;  3CC7 3;  2HMN B;  5CF1 A;  1QVG 2;  4AEQ A;  3QK9 A;  2V1L A;  2CH9 A;  1DVD A;  4EBG A;  1YJN 3;  2LYX A;  2CFL A;  4FR9 A;  4N6T A;  3NBB A;  3HZP A;  3ALA A;  3SED A;  7STD A;  2OTJ 3;  4FCM A;  2IA7 A;  5AIF A;  2PZV A;  2KCD A;  2JDI H;  5AYR B;  3OV4 A;  2CFW A;  3ROB A;  5CLK A;  3GAX A;  1S72 3;  1TIJ A;  4OK0 A;  2C10 A;  2XSO B;  1NB3 I;  2O9U X;  5G2G A;  1JB4 A;  1OPY A;  2OCT A;  3F8H A;  1Q40 A;  3GRD A;  2FNQ A;  2BHM A;  3N8B A;  1N5P A;  3LZA A;  3Q1C A;  3CCV 3;  3DGN A;  2SBL A;  2A15 A;  4BTX A;  3NXJ A;  1ZO2 A;  1LVN A;  1IVX A;  1QAF A;  4HM5 B;  4AKZ A;  1OF5 B;  1A90 A;  5IEP A;  1GY6 A;  4JF8 A;  2QIY A;  1NB5 I;  3EF8 A;  3JUO A;  3JUN A;  3MG3 A;  4LEH A;  5DRE A;  3EN8 A;  3GZB A;  1YI2 3;  1NJI 4;  1M1X B;  1OH0 A;  2ZL8 A;  1QVF 2;  1V74 A;  5CF2 A;  4O02 B;  3A76 A;  2XFS A;  4JRF A;  3UJM A;  1DVC A;  3UL6 A;  5IW9 A;  4MJD A;  4XBX A;  1JRQ A;  5TGN A;  3CCS 3;  1AR0 A;  3N54 B;  1SQW A;  2CWT A;  3IPT A;  2JQ5 A;  1JB5 A;  1ULI B;  3PYJ A;  2FXT A;  4I4K A;  3U97 A;  4N6V 0;  3HII A;  2E2T A;  4OUQ A;  3G8Z A;  3BNB A;  3X40 A;  4HZB B;  2XRX B;  3I0Y A;  1IQX A;  1TP6 A;  3V98 A;  3OWS A;  2WGQ A;  3BNE A;  3NX0 A;  1Q82 4;  1IK3 A;  1MNL A;  3KE7 A;  4EV5 A;  1VQ7 3;  3VF1 A;  2ML5 A;  1TFO A;  2XGN A;  5HGR A;  3KKG A;  3K9M C;  1OHP A;  2M7O A;  3EN1 B;  3FZW A;  2YFL B;  2INX A;  1YVB I;  2HMO B;  2GEX A;  3VSY A;  2B24 B;  1FGR A;  3F8X A;  2ZDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...