3UJMA

Crystal structure of the ntf2-like domain of the drosophila melanogaster rasputin protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
117
structure length
117
Chain Sequence
MSVGREFVRQYYTLLNKAPNHLHRFYNHNSSYIHGESKLVVGQREIHNRIQQLNFNDCHAKISQVDAQATLGNGVVVQVTGELSNDGQPMRRFTQTFVLAAQSPKKYYVHNDIFRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rasputin
publication title Crystal structure of the Rasputin NTF2-like domain from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 29
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ujmA00
4HM0B 5DREA 1IDPA 4R9KA 3FH1A 1O7MB 1JB5A 3I0YA 3ER7A 5KP1A 2BNGA 1O7PB 3K7CA 4PEJA 3FKAA 3GZBA 1UUWB 1A2KA 3KSPA 5BXQA 1TUHA 3B7CA 3EF8A 3BLZA 1BUQA 1OHSA 4HM7B 4K1VA 4N3VA 1W02A 2RGQA 4XDWA 3NM2A 1ZO2A 4J8TA 3DXOA 2BMOB 1JN5B 2RCDA 1GYBA 3NBRA 1DMMA 1O7GB 3OV4A 3K0ZA 5AIIA 1Q40B 4GB5A 1S5AA 3JUPA 3STDA 3OXAA 1O7NB 2CKFB 4WWUC 5D81A 3S5CA 1ZX2A 3GWRA 3BB9A 3F9SA 2BMQB 3GZRA 3MG3A 5IG0A 4HKVB 5IEOA 3MG2A 4LGQA 1DMNA 1W00A 3MHEA 3M8CA 1E97A 2BMRB 2QIYA 1SJWA 3CNMA 3EN8A 3Q90A 2K54A 3NV0B 6STDA 4ORLA 5FW5A 5AIGA 1WQLB 5AEUB 2Z77A 4XBXA 4L8OA 4FCJA 4WYKA 3T8UA 2I9WA 3NV0A 3OWSA 1GY6A 3LZAA 4H3UA 3H51A 3F40A 4HM3B 4WP5A 2RFRA 3FGYA 3EX9A 3NXJA 4Q53A 4HJLB 5HGRA 3LYGA 1K41A 2YFIB 3B8LA 2STDA 3EC9A 3G16A 3NHXA 4OUQA 2CHCA 5AIHA 4XB5A 5IG4A 3MKIA 5IERA 3RGRA 4HVNA 1E3RA 1JKGA 2PZVA 1TP6A 3EQQB 1NWWA 1CQSA 2GXFA 2GBXB 1OHPA 2F86B 5AIFA 1NDOB 1JB4A 1ASKA 2HMJB 3UJMA 5G2GA 2Z7AA 2HMOB 3KE7A 5JPPA 5IENA 5CF2A 3MSOA 4STDA 1JB2A 4I4KA 3GRDA 4HM1B 1Z1SA 1OGXA 1E3VA 3JUQA 3ECFA 3JUMA 2GBWB 3FSDA 3T8NA 4LMIA 2R4IA 3KZTA 1OUNA 4WYKB 3B4PA 2XR8B 2A15A 4R9LA 5CF1A 5BVBA 3CU3A 1GS3A 1QJGA 4FCMA 3VSYA 3ROBA 5EVHA 1GY7A 2B1XB 2HMLB 2YFJB 3F7SA 3DZLA 2HMMB 3F7XA 3EBYA 3WMDA 3VGNA 5CLKA 8CHOA 5KP3A 1OHOA 3EBTA 5CXOA 3FF2A 3DM8A 3DUKA 1JKGB 4HM6B 3SOYA 5DRVA 1EA2A 2QGUA 3SEDA 1UUVB 2INXA 1OF5A 4HZBB 4RZMA 1QMAA 5IEPA 2GEXA 3G0KA 3JUNA 4L7KA 2B24B 7STDA 3FF0A 2XRXB 3OX9A 4HM8B 3SOAA 1ULIB 4HM2B 3FZWA 3KKGA 1C7HA 2XSOB 4MJDA 1OPYA 5IG3A 5D82A 4L8PA 1O7WB 2GEYA 5D83A 5IG5A 4KVHA 1W6YA 3GZXB 2IMJA 5STDA 4HM4B 5AEWB 1O7HB 2F98A 1HKXA 3D9RA 3DMCA 1U5OA 2XSHB 1GY5A 2UX0A 3F8HA 1ISKA 3CPOA 4LEHA 4XBYA 5KP4A 1OCVA 3E99A 3OWUA 3EJVA 4HZ9B 1OH0A 1AR0A 3NUVA 4XM4A 4IIAA 4XBTA 5AI1A 3CNXA 3GZYB 3OWYA 3JUOA 3EN1B 3EHCA 1ULJB 4K1UA 3A76A 2F99A 1DMQA 3UNLA 2Z76A 3B4OA 4XDVA 1STDA 4U13A 4CDLA 3F8XA 1JN5A 4J9AA 3IPTA 5CK6A 1OF5B 1VZZA 1Q40A 2YFLB 1Q42A 3MYTA 5JPUA 1W01A 3FLJA 3HX8A 3HZPA 4X2HA 2OWPA 1NU3A 2HMNB 2JQ5A 3G8ZA 1OGZA 4HM5B 3H3HA 4X2OA 3MG1A 3RGAA 1EG9B 4OVMA 5TGNA 5IF6A 3HK4A 2HMKB 4R1KA 2W2CA 3F14A
chains in the Genus database with same CATH superfamily
1L5GB 1W7CA 3FCSB 4HM0B 6RNTA 2OTJ3 3GSPA 5DREA 1IDPA 4O2HA 3NX0A 4R9KA 3FH1A 3ZFZA 4N6UA 1N9JA 1YGWA 3L0RA 2F4YA 1O7MB 5JBSA 1JB5A 4AKZA 2CWUA 1K9M4 3I0YA 3ER7A 4IT7A 4DKIA 5KP1A 1EUIC 2BNGA 5ELJA 1O7PB 1MGRA 3K7CA 1VQ83 4PEJA 3FKAA 3KSED 4K90B 3GZBA 1UUWB 1A2KA 3KSPA 5BXQA 1TUHA 3IJEB 3LXUX 4BU4A 2W0QA 3B7CA 1B2SA 1BVIA 2SARA 2H0IA 5M18A 3DH2A 1B3SA 1T3BA 3BLZA 3EF8A 2AAEA 3SXXA 4FMAA 1BUQA 3CCE3 2BIRA 3KN4A 3BNDA 1HU9A 1OHSA 4HM7B 4K1VA 4N3VA 1RGFA 1W02A 1W6GA 2RGQA 4XDWA 3NM2A 1RLSA 1B2ZA 1ZO2A 5M1AA 3WOFB 1LOWA 1UCLA 2P09A 4J8TA 2ZDJA 3DXOA 2BMOB 1MNLA 1JN5B 2RCDA 5AYRB 1X1WA 1VQ53 1GYBA 3NBRA 1DMMA 1O7GB 3HIIA 1GMQA 3OV4A 3QK9A 4EV5A 3WA3A 1I2EA 1TFOA 3DGLA 1JRQA 3K0ZA 5AIIA 1IVXA 1Q40B 1RGLA 2AADA 4GB5A 3RNTA 3DGYA 1S5AA 3JUPA 4KZ1A 1JNQA 3STDA 2GU1A 1GMRA 2CWTA 4EV2A 3OXAA 6GSPA 1O7NB 2CKFB 4WWUC 1GOYA 4KT3B 4LYLB 5A0OB 3LOYA 5D81A 3S5CA 4R80A 1MWUA 1ZX2A 2IYJA 3RDEA 2KF6A 3GWRA 2QEX3 1VQ73 1Q9EA 2P05A 2BMQB 3BB9A 3F9SA 2P0XA 3GZRA 3D5IA 3MG3A 3S28A 1RRLA 1FUTA 3O8YA 1V57A 3Q1CA 5IG0A 1YVBI 4HKVB 4BIRA 3CC73 5IEOA 1IYYA 3BNCA 3MG2A 1IVWA 4LGQA 1DMNA 5FGOA 1KQS2 1S723 1W00A 1BRGA 1RHLA 3MHEA 3M8CA 1TRQA 1IT7A 1RRHA 1RGGA 2OQEC 3G713 1PFPA 1GMPA 1E97A 2BMRB 5GSPA 1UCJA 2QIYA 4BTWA 1SJWA 3CNMA 1BAOA 3PCSA 3EN8A 3Q90A 1UCIA 2K54A 3NV0B 2OOVA 6STDA 1VQP3 4ORLA 3LTBA 5FW5A 1RN4A 3BU4A 3K63A 5AIGA 2C11A 3X40A 3CD63 1BNRA 1WQLB 1BNSA 3TDGA 5AEUB 1BSAA 3K5TA 5I97A 3UL5A 3LT9A 1KWIA 1STFI 3EB8A 3EE1A 2Z77A 1TFKA 3LTAA 3WOEB 1VQK3 1VQL3 4AEQA 5LC7A 1YIT3 1BRNL 4BTYA 4GHOA 4XBXA 1IQXA 2CK3H 4L8OA 4RNTA 1RCKA 3X3XA 2L1SA 1YI23 4R4KA 4FCJA 1QAKA 1RNBA 2CFWA 4N6TA 4WYKA 3S29A 1WTHA 1Q814 3JVCA 1BU4A 1IU7A 3T8UA 1JBRA 2KF4A 4BL3A 2BO9B 2I9WA 1FW7A 2KAAA 3V99A 1EKMA 3NV0A 4RNZA 3OWSA 1DYUA 1GY6A 3LZAA 3MWZA 4H3UA 3H51A 5IW9A 2FXTA 3F40A 4EBGA 1RN7A 1QVG2 2WOHA 5G1LA 1BRJA 1RJOA 2Y74A 2P38A 4HM3B 4WP5A 3LMLA 2RFRA 3FGYA 3EX9A 2KRTA 3NXJA 4Q53A 3V98A 4HJLB 5HGRA 1RKYA 1EQKA 2C4BA 3LYGA 1K41A 1N5HA 2XGNA 1FGMA 2YFIB 3PZWA 3B8LA 2IUKA 4TX4A 2STDA 3EC9A 1T5YA 1DETA 1WNHA 3G16A 2R41A 3NHXA 2D42A 1YVSA 1GD4A 2BHMA 4OUQA 2QA43 2CHCA 1A2VA 1BRHA 1FGQA 1BSBA 1D6UA 1GSPA 1RCLA 3FG4A 5AIHA 4XB5A 5IG4A 2KCDA 1GOUA 4NPBA 3MKIA 3LT8A 1Q7Y4 5IERA 1AVKA 3RGRA 1BSEA 1RTUA 1JV2B 1YGEA 1E3RA 1BRKA 1JKGA 2J8XB 3MPHA 4HVNA 1ROVA 2XGLA 3NM7A 2E2TA 2PZVA 1TP6A 1I2FA 3EQQB 1NWWA 1CQSA 2CC3A 1BOXA 1GOVA 1LRAA 2GXFA 4N6LA 3WA2X 1LVNA 1K8A4 3CCS3 1YIJ3 1W2ZA 2GBXB 1OHPA 2F86B 1W4NA 1RDSA 5AIFA 1M9GA 1GD3A 3CCJ3 1NDOB 3PS8A 2KF5A 1JB4A 2F5MA 1ASKA 2HMJB 1UGIA 1LOXA 1SIHA 3FG1A 1SARA 2W6JH 1J2BA 1BNGA 3UJMA 1UW1A 1RGEA 5G2GA 2W04A 1LOYA 3PGBA 7GSPA 3AGOA 1VQ43 2Z7AA 1IV9A 1CYVA 1TRPA 1UI8A 2HMOB 3KE7A 1LQGC 1K734 3Q3FA 1G02A 5G1KA 5JPPA 1W5ZA 2CX0A 1RNTA 5IENA 8RNTA 1R4CA 5CF2A 1BGSA 3D5GA 3MSOA 1BNIA 3N8BA 3WR2A 4MEIA 4STDA 1UDII 5BU4A 1G96A 1JB2A 2CX1A 4I4KA 2SBLA 3GRDA 1NB3I 3SX1A 4HM1B 1Z1SA 2RNTA 2IUJA 4O02B 1OGXA 1Y4KA 3SYUA 1E3VA 1DVCA 3JUQA 4ILFA 3ECFA 3JUMA 1AV4A 2GBWB 2UUGC 3FSDA 1B27A 4IPBA 2IA7A 5EEOA 3T8NA 4LMIA 1A90A 2R4IA 3ZG0A 1PU4A 3CC43 1ROAA 1QVF2 3KZTA 1OUNA 3CPW2 4WYKB 1EEJA 3B4PA 5RNTA 4HYZA 2XR8B 1A2PA 1BNEA 3K9MC 1IQ8A 3DGNA 2A15A 4N6OB 2OQEA 4R9LA 4JF8A 1BANA 3UB1A 1KD14 2GU3A 2KXGA 1B2XA 5CF1A 3BNBA 5BVBA 2PNCA 3CU3A 3U97A 1YHQ3 1GS3A 1SQWA 1QJGA 2F5WA 4LSOA 1I2GA 3AHSA 1V74A 2LQVA 4FCMA 3BIRA 1JBTA 1FYSA 3VSYA 1V58A 5EVHA 3ROBA 1Q864 4O8SA 2W9QA 1GY7A 1NO3A 3HI7A 2B1XB 2CFGA 2HMLB 2YFJB 3F7SA 1IQYA 3DZLA 1FGTA 1LQMB 2W03A 2O9UX 2HMMB 2BU4A 3AHWA 3F7XA 1UUGB 4CCVA 3EBYA 4FR9A 3WMDA 5AYSC 3DGOA 4MMXB 2ZL8A 3VGNA 1N5PA 5CLKA 8CHOA 1AY7A 5KP3A 1WMNA 1Q824 2CG1A 1OHOA 2C10A 3EBTA 5CXOA 2CFKA 3FF2A 4GSPA 1I8VA 2ZA4A 3DM8A 4MMYB 3DUKA 4EYCA 1KSIA 3PCRA 1JKGB 1LXEA 4WFOA 1I3FA 4HM6B 1M1XB 3SOYA 3Q2PA 4J5GA 5DRVA 9RNTA 4QWTA 4O3VA 3CCR3 1EA2A 2QGUA 2CW9A 1DE3A 1FA3A 3SEDA 1UUVB 3KIIA 1BSCA 3BNEA 3D79A 1RSNA 1OF5A 2INXA 3NQZA 4FMDA 4HZBB 4RZMA 4WHAA 3X41A 5BIRA 3I553 1VQO3 1QMAA 2D1WA 5IEPA 2OTL3 2GEXA 3CCM3 1FZUA 3G0KA 1CH0A 3JUNA 1JBSA 1PY3A 4L7KA 2M7OA 2B24B 7STDA 1B21A 4GL6A 2Y73A 2XRXB 3FF0A 3KFQC 4KFDA 3X42A 3I563 4KFEA 1QAFA 1NNVA 3OX9A 4HM8B 3SLUA 3SOAA 1VQ93 1ULIB 4HM2B 1B20A 3FZWA 2K3DA 3X3ZA 1IVVA 3G4S3 3KKGA 3NBBA 4NREA 1US1A 1MWRA 1C7HA 4LZIA 4BTXA 1IV7A 1IVUA 2XSOB 4MJDA 2ZHXB 4J5KA 1OPYA 3PYJA 1HYFA 2L4VA 3HOHA 3S27A 2CFLA 5IG3A 2WGOA 5D82A 1M1K4 4L8PA 2OCTA 3CME3 1O7WB 2GEYA 4FCZA 5D83A 5IG5A 3CC23 4KVHA 4EXRA 1ZS7A 1RMSA 1W6YA 3GZXB 2IMJA 2KF3A 3SVAA 4FMCA 2Q07A 5STDA 1U8CB 4HM4B 1F8NA 4MMZB 1W6CA 4N6MA 5AEWB 1O7HB 2F98A 3DY5A 2V1LA 3URPA 3V92A 1HKXA 1TTOA 1FGRA 1I3IA 3D9RA 4CJNA 3DMCA 2XFTA 1YJN3 1WMPA 1U5OA 4NHFA 1B2MA 4BL2A 2XSHB 3CMA3 1SPUA 5LC6A 1X1XA 1GY5A 2UX0A 1BRIA 3F8HA 3NQYA 4G1MB 2RBIA 1ISKA 1RGHA 1UGHI 3CPOA 3AMOA 4LEHA 3LTCA 1WMOA 4HOHA 4RBNA 4XBYA 5HOHA 5KP4A 1OCVA 1ZGXA 3LH4A 3E99A 3D4AA 2XF3A 3OWUA 4I5QA 3EJVA 4HZ9B 3GAXA 1YJ93 4ZM8A 1OH0A 1AR0A 4RNYA 1K28A 1BIRA 1X1UA 2MF7A 3ZG5A 3NUVA 1IT8A 4XM4A 2H0HA 1D6ZA 2O3OA 4IIAA 3S67A 3T0UA 3CCV3 2XFSA 2XH9A 1BSDA 2FNQA 1BNFA 4AKYA 1VQ63 2BT3A 1B2UA 2WGQA 3X3YA 4XBTA 1YJW3 1BUJA 1CYUA 3AGNA 5AI1A 3PXMA 1NJI4 3CCU3 2CG0A 1JZOA 3CNXA 1D6YA 3GZYB 2ML5A 3JUOA 1I70A 1TJDA 3EN1B 3LTDA 3OWYA 3WDGB 2LYXA 2HOHA 1VQQA 3EHCA 1M904 1AQZA 1ULJB 3A76A 4K1UA 3CCQ3 2F99A 1DMQA 2WOFA 3UNLA 3J7Yd 2CH9A 2Z76A 3B4OA 4H61A 1JJ22 3KCHA 4XDVA 2IY2A 1SIIA 2W56B 1W2B2 1STDA 4U13A 1MWSA 2FGTA 4CPKA 1N9EA 3F8XA 1JN5A 4CDLA 1KC84 4J9AA 1PYLA 3NBJA 1MWTA 1TIJA 3WHOA 4JRFA 3IPTA 3U1WA 1R4YA 5CK6A 1OF5B 1JZDA 1N8R4 1T2IA 1VZZA 3A5EA 5M19A 1Q40A 1UCKA 4N6V0 1DVDA 2YFLB 1Q42A 3MYTA 5JPUA 1W01A 3FLJA 4OK0A 1LOVA 3HX8A 3HZPA 1UI7A 4X2HA 1RGKA 1G0TA 2OOVC 1FGOA 3QRDA 3UL6A 2OWPA 1I0VA 2E2VA 2UGIA 2F56A 1TU5A 1NU3A 2K0MA 3DGMA 4K61A 1RGCA 4KFFA 2HMNB 1FUSA 2W56A 3ALAA 2CFDA 2JQ5A 3N54B 1Q7HA 5EQLA 3G8ZA 1OGZA 1A67A 4HM5B 2XEPA 3H3HA 5ELUA 3D3LA 4X2OA 3OW22 1OACA 1N8QA 1MOLA 1I0XA 1LNIA 2H0GA 2E2UA 2P0MA 1VQN3 3MG1A 1BNJA 3CXC2 1NB5I 1CEWI 3RGAA 3FG3A 2MC8A 2WO0A 7RNTA 4EC6A 2W9PA 2ML6A 3N9HA 4FMBA 1YNVX 2CWVA 3CCL3 1EG9B 1MGWA 3G6E3 1LNHA 4OVMA 4HBRA 5TGNA 3HK4A 5IF6A 1AVLA 1RGAA 4EW5A 1C54A 1X1YA 3HIGA 2GSPA 2HMKB 3VF1A 1BRSA 2RSXA 4N6NB 4R1KA 3IMAB 2CIUA 2YX9A 2Z6BA 2W2CA 1HZ1A 1FUWA 1RN1A 1T2HA 1VQM3 1IK3A 3AMOB 3WODG 3F14A 4HAAA 2JDIH 1QALA
chains in the Genus database with same CATH topology
1L5GB 1W7CA 3FCSB 4HM0B 2OTJ3 5DREA 1IDPA 4O2HA 3NX0A 4R9KA 3FH1A 4N6UA 1N9JA 3L0RA 1O7MB 5JBSA 1JB5A 4AKZA 2CWUA 1K9M4 3I0YA 3ER7A 4IT7A 5KP1A 2BNGA 5ELJA 1O7PB 3K7CA 1VQ83 4PEJA 3FKAA 3KSED 4K90B 3GZBA 1UUWB 1A2KA 3KSPA 5BXQA 1TUHA 3IJEB 3LXUX 2W0QA 3B7CA 3EF8A 3BLZA 3SXXA 4FMAA 1BUQA 3CCE3 3KN4A 3BNDA 1HU9A 1OHSA 4HM7B 4K1VA 4N3VA 1W02A 1W6GA 2RGQA 4XDWA 3NM2A 1ZO2A 3WOFB 2P09A 4J8TA 2ZDJA 3DXOA 2BMOB 1MNLA 1JN5B 2RCDA 5AYRB 1VQ53 1GYBA 3NBRA 1DMMA 1O7GB 3HIIA 3OV4A 3QK9A 4EV5A 3WA3A 1VQM3 1TFOA 3K0ZA 3DGLA 1JRQA 5AIIA 1IVXA 1Q40B 3G713 4GB5A 1S5AA 3JUPA 4KZ1A 1JNQA 3STDA 2GU1A 2CWTA 4EV2A 3OXAA 1O7NB 2CKFB 4WWUC 5A0OB 3LOYA 5D81A 3S5CA 4R80A 1ZX2A 3RDEA 3GWRA 2QEX3 1VQ73 2P05A 3BB9A 2BMQB 3F9SA 3GZRA 2P0XA 3MG3A 3S28A 1RRLA 3O8YA 5IG0A 3Q1CA 1YVBI 4HKVB 3CC73 5IEOA 3BNCA 3MG2A 1IVWA 4LGQA 1DMNA 5FGOA 1KQS2 1S723 1W00A 3MHEA 3M8CA 1IT7A 1RRHA 2OQEC 1PFPA 1E97A 2BMRB 2QIYA 4BTWA 1SJWA 3CNMA 3PCSA 3EN8A 3Q90A 2K54A 3NV0B 2OOVA 6STDA 1VQP3 4ORLA 3LTBA 5FW5A 3K63A 5AIGA 3X40A 2C11A 3CD63 1WQLB 3TDGA 5AEUB 3K5TA 5I97A 3UL5A 3LT9A 1KWIA 1STFI 3EB8A 3EE1A 2Z77A 1TFKA 3LTAA 3WOEB 1VQK3 1VQL3 4AEQA 5LC7A 1YIT3 4BTYA 4XBXA 1IQXA 2CK3H 4L8OA 3X3XA 1YI23 4R4KA 4FCJA 1QAKA 2CFWA 4N6TA 4WYKA 3S29A 1WTHA 1Q814 3JVCA 1IU7A 3T8UA 2BO9B 2I9WA 3V99A 1EKMA 3NV0A 4RNZA 3OWSA 1DYUA 1GY6A 3LZAA 3MWZA 4H3UA 3H51A 5IW9A 2FXTA 3F40A 4EBGA 1RN7A 1QVG2 2WOHA 2Y74A 1RJOA 2P38A 4HM3B 4WP5A 3LMLA 2RFRA 3FGYA 3EX9A 2KRTA 3NXJA 4Q53A 3V98A 4HJLB 5HGRA 1RKYA 1EQKA 3LYGA 3PZWA 1K41A 1N5HA 2XGNA 1FGMA 2YFIB 3B8LA 2IUKA 4TX4A 2STDA 3EC9A 1T5YA 1WNHA 3G16A 3NHXA 2D42A 4OUQA 1GD4A 2BHMA 2QA43 2CHCA 1A2VA 1FGQA 1D6UA 3FG4A 5AIHA 4XB5A 5IG4A 2KCDA 3MKIA 3LT8A 1Q7Y4 5IERA 1AVKA 3RGRA 1JV2B 1YGEA 1E3RA 1JKGA 3MPHA 4HVNA 1ROVA 2XGLA 3NM7A 2E2TA 2PZVA 1TP6A 3EQQB 1NWWA 1CQSA 2CC3A 2GXFA 4N6LA 3WA2X 1LVNA 1K8A4 3CCS3 1YIJ3 1W2ZA 2GBXB 1OHPA 2F86B 1W4NA 5AIFA 1M9GA 1GD3A 3CCJ3 1NDOB 3PS8A 1JB4A 1ASKA 2HMJB 1LOXA 1SIHA 3FG1A 2W6JH 1J2BA 3UJMA 1UW1A 5G2GA 2W04A 3PGBA 1VQ43 2Z7AA 1IV9A 1CYVA 1UI8A 2HMOB 3KE7A 1K734 5JPPA 1W5ZA 5IENA 1R4CA 5CF2A 3MSOA 3N8BA 4MEIA 4STDA 1G96A 1JB2A 4I4KA 2SBLA 3GRDA 1NB3I 3SX1A 4HM1B 1Z1SA 2IUJA 4O02B 1OGXA 1Y4KA 1E3VA 1DVCA 3JUQA 3ECFA 3JUMA 1AV4A 2GBWB 3FSDA 4IPBA 2IA7A 5EEOA 3T8NA 4LMIA 1A90A 2R4IA 1PU4A 3CC43 1ROAA 1QVF2 3KZTA 1OUNA 3CPW2 4WYKB 3B4PA 4HYZA 2XR8B 3K9MC 4N6OB 2OQEA 1IQ8A 3DGNA 2A15A 4R9LA 4JF8A 3UB1A 1KD14 2GU3A 2KXGA 5CF1A 3BNBA 5BVBA 2PNCA 3CU3A 3U97A 1YHQ3 1GS3A 1SQWA 1QJGA 4LSOA 1V74A 2LQVA 4FCMA 3VSYA 3ROBA 5EVHA 1Q864 4O8SA 2W9QA 1GY7A 1NO3A 3HI7A 2B1XB 2CFGA 2HMLB 2YFJB 3F7SA 1IQYA 3DZLA 1FGTA 2W03A 2O9UX 2HMMB 3F7XA 4CCVA 3EBYA 4FR9A 3WMDA 5AYSC 3DGOA 4MMXB 2ZL8A 3VGNA 1N5PA 5CLKA 8CHOA 5KP3A 1WMNA 1Q824 2CG1A 1OHOA 2C10A 3EBTA 5CXOA 2CFKA 3FF2A 3DM8A 4MMYB 3DUKA 4EYCA 1KSIA 3PCRA 1JKGB 1LXEA 4WFOA 4HM6B 1M1XB 3SOYA 3Q2PA 5DRVA 3CCR3 4QWTA 4O3VA 1EA2A 2QGUA 2CW9A 1FA3A 3SEDA 1UUVB 3KIIA 3BNEA 4WHAA 2INXA 1OF5A 3NQZA 4FMDA 4HZBB 4RZMA 3X41A 3I553 1VQO3 2OTL3 1QMAA 2D1WA 5IEPA 2GEXA 3CCM3 3G0KA 3JUNA 4L7KA 2M7OA 2B24B 7STDA 4GL6A 2Y73A 2XRXB 3FF0A 3KFQC 4KFDA 3X42A 3I563 4KFEA 1QAFA 3OX9A 4HM8B 3SLUA 3SOAA 1VQ93 1ULIB 4HM2B 3FZWA 3X3ZA 1IVVA 3G4S3 3KKGA 3NBBA 4NREA 1US1A 1C7HA 4LZIA 4BTXA 1IV7A 1IVUA 2XSOB 4MJDA 1OPYA 3PYJA 2L4VA 3S27A 2CFLA 5IG3A 2WGOA 5D82A 1M1K4 4L8PA 2OCTA 3CME3 1O7WB 2GEYA 4FCZA 5D83A 5IG5A 3CC23 4KVHA 4EXRA 1W6YA 3GZXB 2IMJA 3SVAA 4FMCA 2Q07A 5STDA 1U8CB 4HM4B 1F8NA 4MMZB 1W6CA 4N6MA 5AEWB 1O7HB 2F98A 3DY5A 2V1LA 3V92A 1HKXA 1FGRA 3D9RA 3DMCA 2XFTA 1YJN3 1WMPA 1U5OA 4NHFA 2XSHB 3CMA3 1SPUA 5LC6A 1GY5A 2UX0A 3F8HA 3NQYA 4G1MB 1ISKA 3CPOA 3AMOA 4LEHA 3LTCA 1WMOA 4RBNA 4XBYA 5KP4A 1OCVA 3LH4A 3E99A 3OWUA 2XF3A 3EJVA 4HZ9B 3GAXA 1YJ93 4ZM8A 1OH0A 1AR0A 4RNYA 1K28A 2MF7A 3NUVA 1IT8A 4XM4A 2O3OA 1D6ZA 4IIAA 3S67A 3T0UA 3CCV3 2XFSA 2XH9A 2FNQA 4AKYA 1VQ63 2BT3A 2WGQA 3X3YA 4XBTA 1YJW3 1CYUA 5AI1A 3PXMA 1NJI4 3CCU3 2CG0A 3CNXA 3GZYB 1D6YA 3JUOA 2ML5A 3OWYA 3EN1B 3LTDA 3WDGB 2LYXA 3EHCA 1M904 1ULJB 4K1UA 3A76A 3CCQ3 2F99A 1DMQA 2WOFA 3UNLA 3J7Yd 2CH9A 2Z76A 3B4OA 4H61A 1JJ22 4XDVA 1SIIA 2W56B 1W2B2 1STDA 4U13A 2FGTA 1N9EA 3F8XA 1JN5A 4CDLA 1KC84 4J9AA 3NBJA 1TIJA 4JRFA 3IPTA 3U1WA 5CK6A 1OF5B 1N8R4 1VZZA 1Q40A 4N6V0 1DVDA 2YFLB 1Q42A 3MYTA 5JPUA 1W01A 3FLJA 4OK0A 3HX8A 3HZPA 1UI7A 4X2HA 2OOVC 3QRDA 1FGOA 3UL6A 2OWPA 2E2VA 1TU5A 1NU3A 2K0MA 3DGMA 4K61A 4KFFA 2HMNB 2W56A 3ALAA 2CFDA 2JQ5A 3N54B 5EQLA 3G8ZA 1OGZA 1A67A 4HM5B 2XEPA 3H3HA 5ELUA 3D3LA 4X2OA 3OW22 1OACA 1N8QA 1MOLA 2E2UA 2P0MA 1VQN3 3MG1A 3CXC2 1NB5I 1CEWI 3RGAA 3FG3A 2MC8A 2WO0A 4EC6A 2W9PA 2ML6A 3N9HA 4FMBA 2CWVA 3CCL3 1EG9B 3G6E3 1LNHA 4OVMA 4HBRA 5TGNA 3HK4A 5IF6A 1AVLA 3HIGA 2HMKB 3VF1A 2RSXA 4N6NB 4R1KA 3IMAB 2CIUA 2YX9A 2Z6BA 2W2CA 1FUWA 1IK3A 3AMOB 3WODG 3F14A 2JDIH 1QALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HM0 B;  5DRE A;  1IDP A;  4R9K A;  3FH1 A;  1O7M B;  1JB5 A;  3I0Y A;  3ER7 A;  5KP1 A;  2BNG A;  1O7P B;  3K7C A;  4PEJ A;  3FKA A;  3GZB A;  1UUW B;  1A2K A;  3KSP A;  5BXQ A;  1TUH A;  3B7C A;  3EF8 A;  3BLZ A;  1BUQ A;  1OHS A;  4HM7 B;  4K1V A;  4N3V A;  1W02 A;  2RGQ A;  4XDW A;  3NM2 A;  1ZO2 A;  4J8T A;  3DXO A;  2BMO B;  1JN5 B;  2RCD A;  1GYB A;  3NBR A;  1DMM A;  1O7G B;  3OV4 A;  3K0Z A;  5AII A;  1Q40 B;  4GB5 A;  1S5A A;  3JUP A;  3STD A;  3OXA A;  1O7N B;  2CKF B;  4WWU C;  5D81 A;  3S5C A;  1ZX2 A;  3GWR A;  3BB9 A;  3F9S A;  2BMQ B;  3GZR A;  3MG3 A;  5IG0 A;  4HKV B;  5IEO A;  3MG2 A;  4LGQ A;  1DMN A;  1W00 A;  3MHE A;  3M8C A;  1E97 A;  2BMR B;  2QIY A;  1SJW A;  3CNM A;  3EN8 A;  3Q90 A;  2K54 A;  3NV0 B;  6STD A;  4ORL A;  5FW5 A;  5AIG A;  1WQL B;  5AEU B;  2Z77 A;  4XBX A;  4L8O A;  4FCJ A;  4WYK A;  3T8U A;  2I9W A;  3NV0 A;  3OWS A;  1GY6 A;  3LZA A;  4H3U A;  3H51 A;  3F40 A;  4HM3 B;  4WP5 A;  2RFR A;  3FGY A;  3EX9 A;  3NXJ A;  4Q53 A;  4HJL B;  5HGR A;  3LYG A;  1K41 A;  2YFI B;  3B8L A;  2STD A;  3EC9 A;  3G16 A;  3NHX A;  4OUQ A;  2CHC A;  5AIH A;  4XB5 A;  5IG4 A;  3MKI A;  5IER A;  3RGR A;  4HVN A;  1E3R A;  1JKG A;  2PZV A;  1TP6 A;  3EQQ B;  1NWW A;  1CQS A;  2GXF A;  2GBX B;  1OHP A;  2F86 B;  5AIF A;  1NDO B;  1JB4 A;  1ASK A;  2HMJ B;  3UJM A;  5G2G A;  2Z7A A;  2HMO B;  3KE7 A;  5JPP A;  5IEN A;  5CF2 A;  3MSO A;  4STD A;  1JB2 A;  4I4K A;  3GRD A;  4HM1 B;  1Z1S A;  1OGX A;  1E3V A;  3JUQ A;  3ECF A;  3JUM A;  2GBW B;  3FSD A;  3T8N A;  4LMI A;  2R4I A;  3KZT A;  1OUN A;  4WYK B;  3B4P A;  2XR8 B;  2A15 A;  4R9L A;  5CF1 A;  5BVB A;  3CU3 A;  1GS3 A;  1QJG A;  4FCM A;  3VSY A;  3ROB A;  5EVH A;  1GY7 A;  2B1X B;  2HML B;  2YFJ B;  3F7S A;  3DZL A;  2HMM B;  3F7X A;  3EBY A;  3WMD A;  3VGN A;  5CLK A;  8CHO A;  5KP3 A;  1OHO A;  3EBT A;  5CXO A;  3FF2 A;  3DM8 A;  3DUK A;  1JKG B;  4HM6 B;  3SOY A;  5DRV A;  1EA2 A;  2QGU A;  3SED A;  1UUV B;  2INX A;  1OF5 A;  4HZB B;  4RZM A;  1QMA A;  5IEP A;  2GEX A;  3G0K A;  3JUN A;  4L7K A;  2B24 B;  7STD A;  3FF0 A;  2XRX B;  3OX9 A;  4HM8 B;  3SOA A;  1ULI B;  4HM2 B;  3FZW A;  3KKG A;  1C7H A;  2XSO B;  4MJD A;  1OPY A;  5IG3 A;  5D82 A;  4L8P A;  1O7W B;  2GEY A;  5D83 A;  5IG5 A;  4KVH A;  1W6Y A;  3GZX B;  2IMJ A;  5STD A;  4HM4 B;  5AEW B;  1O7H B;  2F98 A;  1HKX A;  3D9R A;  3DMC A;  1U5O A;  2XSH B;  1GY5 A;  2UX0 A;  3F8H A;  1ISK A;  3CPO A;  4LEH A;  4XBY A;  5KP4 A;  1OCV A;  3E99 A;  3OWU A;  3EJV A;  4HZ9 B;  1OH0 A;  1AR0 A;  3NUV A;  4XM4 A;  4IIA A;  4XBT A;  5AI1 A;  3CNX A;  3GZY B;  3OWY A;  3JUO A;  3EN1 B;  3EHC A;  1ULJ B;  4K1U A;  3A76 A;  2F99 A;  1DMQ A;  3UNL A;  2Z76 A;  3B4O A;  4XDV A;  1STD A;  4U13 A;  4CDL A;  3F8X A;  1JN5 A;  4J9A A;  3IPT A;  5CK6 A;  1OF5 B;  1VZZ A;  1Q40 A;  2YFL B;  1Q42 A;  3MYT A;  5JPU A;  1W01 A;  3FLJ A;  3HX8 A;  3HZP A;  4X2H A;  2OWP A;  1NU3 A;  2HMN B;  2JQ5 A;  3G8Z A;  1OGZ A;  4HM5 B;  3H3H A;  4X2O A;  3MG1 A;  3RGA A;  1EG9 B;  4OVM A;  5TGN A;  5IF6 A;  3HK4 A;  2HMK B;  4R1K A;  2W2C A;  3F14 A; 
#chains in the Genus database with same CATH topology
 1L5G B;  1W7C A;  3FCS B;  4HM0 B;  6RNT A;  2OTJ 3;  3GSP A;  5DRE A;  1IDP A;  4O2H A;  3NX0 A;  4R9K A;  3FH1 A;  3ZFZ A;  4N6U A;  1N9J A;  1YGW A;  3L0R A;  2F4Y A;  1O7M B;  5JBS A;  1JB5 A;  4AKZ A;  2CWU A;  1K9M 4;  3I0Y A;  3ER7 A;  4IT7 A;  4DKI A;  5KP1 A;  1EUI C;  2BNG A;  5ELJ A;  1O7P B;  1MGR A;  3K7C A;  1VQ8 3;  4PEJ A;  3FKA A;  3KSE D;  4K90 B;  3GZB A;  1UUW B;  1A2K A;  3KSP A;  5BXQ A;  1TUH A;  3IJE B;  3LXU X;  4BU4 A;  2W0Q A;  3B7C A;  1B2S A;  1BVI A;  2SAR A;  2H0I A;  5M18 A;  3DH2 A;  1B3S A;  1T3B A;  3BLZ A;  3EF8 A;  2AAE A;  3SXX A;  4FMA A;  1BUQ A;  3CCE 3;  2BIR A;  3KN4 A;  3BND A;  1HU9 A;  1OHS A;  4HM7 B;  4K1V A;  4N3V A;  1RGF A;  1W02 A;  1W6G A;  2RGQ A;  4XDW A;  3NM2 A;  1RLS A;  1B2Z A;  1ZO2 A;  5M1A A;  3WOF B;  1LOW A;  1UCL A;  2P09 A;  4J8T A;  2ZDJ A;  3DXO A;  2BMO B;  1MNL A;  1JN5 B;  2RCD A;  5AYR B;  1X1W A;  1VQ5 3;  1GYB A;  3NBR A;  1DMM A;  1O7G B;  3HII A;  1GMQ A;  3OV4 A;  3QK9 A;  4EV5 A;  3WA3 A;  1I2E A;  1TFO A;  3DGL A;  1JRQ A;  3K0Z A;  5AII A;  1IVX A;  1Q40 B;  1RGL A;  2AAD A;  4GB5 A;  3RNT A;  3DGY A;  1S5A A;  3JUP A;  4KZ1 A;  1JNQ A;  3STD A;  2GU1 A;  1GMR A;  2CWT A;  4EV2 A;  3OXA A;  6GSP A;  1O7N B;  2CKF B;  4WWU C;  1GOY A;  4KT3 B;  4LYL B;  5A0O B;  3LOY A;  5D81 A;  3S5C A;  4R80 A;  1MWU A;  1ZX2 A;  2IYJ A;  3RDE A;  2KF6 A;  3GWR A;  2QEX 3;  1VQ7 3;  1Q9E A;  2P05 A;  2BMQ B;  3BB9 A;  3F9S A;  2P0X A;  3GZR A;  3D5I A;  3MG3 A;  3S28 A;  1RRL A;  1FUT A;  3O8Y A;  1V57 A;  3Q1C A;  5IG0 A;  1YVB I;  4HKV B;  4BIR A;  3CC7 3;  5IEO A;  1IYY A;  3BNC A;  3MG2 A;  1IVW A;  4LGQ A;  1DMN A;  5FGO A;  1KQS 2;  1S72 3;  1W00 A;  1BRG A;  1RHL A;  3MHE A;  3M8C A;  1TRQ A;  1IT7 A;  1RRH A;  1RGG A;  2OQE C;  3G71 3;  1PFP A;  1GMP A;  1E97 A;  2BMR B;  5GSP A;  1UCJ A;  2QIY A;  4BTW A;  1SJW A;  3CNM A;  1BAO A;  3PCS A;  3EN8 A;  3Q90 A;  1UCI A;  2K54 A;  3NV0 B;  2OOV A;  6STD A;  1VQP 3;  4ORL A;  3LTB A;  5FW5 A;  1RN4 A;  3BU4 A;  3K63 A;  5AIG A;  2C11 A;  3X40 A;  3CD6 3;  1BNR A;  1WQL B;  1BNS A;  3TDG A;  5AEU B;  1BSA A;  3K5T A;  5I97 A;  3UL5 A;  3LT9 A;  1KWI A;  1STF I;  3EB8 A;  3EE1 A;  2Z77 A;  1TFK A;  3LTA A;  3WOE B;  1VQK 3;  1VQL 3;  4AEQ A;  5LC7 A;  1YIT 3;  1BRN L;  4BTY A;  4GHO A;  4XBX A;  1IQX A;  2CK3 H;  4L8O A;  4RNT A;  1RCK A;  3X3X A;  2L1S A;  1YI2 3;  4R4K A;  4FCJ A;  1QAK A;  1RNB A;  2CFW A;  4N6T A;  4WYK A;  3S29 A;  1WTH A;  1Q81 4;  3JVC A;  1BU4 A;  1IU7 A;  3T8U A;  1JBR A;  2KF4 A;  4BL3 A;  2BO9 B;  2I9W A;  1FW7 A;  2KAA A;  3V99 A;  1EKM A;  3NV0 A;  4RNZ A;  3OWS A;  1DYU A;  1GY6 A;  3LZA A;  3MWZ A;  4H3U A;  3H51 A;  5IW9 A;  2FXT A;  3F40 A;  4EBG A;  1RN7 A;  1QVG 2;  2WOH A;  5G1L A;  1BRJ A;  1RJO A;  2Y74 A;  2P38 A;  4HM3 B;  4WP5 A;  3LML A;  2RFR A;  3FGY A;  3EX9 A;  2KRT A;  3NXJ A;  4Q53 A;  3V98 A;  4HJL B;  5HGR A;  1RKY A;  1EQK A;  2C4B A;  3LYG A;  1K41 A;  1N5H A;  2XGN A;  1FGM A;  2YFI B;  3PZW A;  3B8L A;  2IUK A;  4TX4 A;  2STD A;  3EC9 A;  1T5Y A;  1DET A;  1WNH A;  3G16 A;  2R41 A;  3NHX A;  2D42 A;  1YVS A;  1GD4 A;  2BHM A;  4OUQ A;  2QA4 3;  2CHC A;  1A2V A;  1BRH A;  1FGQ A;  1BSB A;  1D6U A;  1GSP A;  1RCL A;  3FG4 A;  5AIH A;  4XB5 A;  5IG4 A;  2KCD A;  1GOU A;  4NPB A;  3MKI A;  3LT8 A;  1Q7Y 4;  5IER A;  1AVK A;  3RGR A;  1BSE A;  1RTU A;  1JV2 B;  1YGE A;  1E3R A;  1BRK A;  1JKG A;  2J8X B;  3MPH A;  4HVN A;  1ROV A;  2XGL A;  3NM7 A;  2E2T A;  2PZV A;  1TP6 A;  1I2F A;  3EQQ B;  1NWW A;  1CQS A;  2CC3 A;  1BOX A;  1GOV A;  1LRA A;  2GXF A;  4N6L A;  3WA2 X;  1LVN A;  1K8A 4;  3CCS 3;  1YIJ 3;  1W2Z A;  2GBX B;  1OHP A;  2F86 B;  1W4N A;  1RDS A;  5AIF A;  1M9G A;  1GD3 A;  3CCJ 3;  1NDO B;  3PS8 A;  2KF5 A;  1JB4 A;  2F5M A;  1ASK A;  2HMJ B;  1UGI A;  1LOX A;  1SIH A;  3FG1 A;  1SAR A;  2W6J H;  1J2B A;  1BNG A;  3UJM A;  1UW1 A;  1RGE A;  5G2G A;  2W04 A;  1LOY A;  3PGB A;  7GSP A;  3AGO A;  1VQ4 3;  2Z7A A;  1IV9 A;  1CYV A;  1TRP A;  1UI8 A;  2HMO B;  3KE7 A;  1LQG C;  1K73 4;  3Q3F A;  1G02 A;  5G1K A;  5JPP A;  1W5Z A;  2CX0 A;  1RNT A;  5IEN A;  8RNT A;  1R4C A;  5CF2 A;  1BGS A;  3D5G A;  3MSO A;  1BNI A;  3N8B A;  3WR2 A;  4MEI A;  4STD A;  1UDI I;  5BU4 A;  1G96 A;  1JB2 A;  2CX1 A;  4I4K A;  2SBL A;  3GRD A;  1NB3 I;  3SX1 A;  4HM1 B;  1Z1S A;  2RNT A;  2IUJ A;  4O02 B;  1OGX A;  1Y4K A;  3SYU A;  1E3V A;  1DVC A;  3JUQ A;  4ILF A;  3ECF A;  3JUM A;  1AV4 A;  2GBW B;  2UUG C;  3FSD A;  1B27 A;  4IPB A;  2IA7 A;  5EEO A;  3T8N A;  4LMI A;  1A90 A;  2R4I A;  3ZG0 A;  1PU4 A;  3CC4 3;  1ROA A;  1QVF 2;  3KZT A;  1OUN A;  3CPW 2;  4WYK B;  1EEJ A;  3B4P A;  5RNT A;  4HYZ A;  2XR8 B;  1A2P A;  1BNE A;  3K9M C;  1IQ8 A;  3DGN A;  2A15 A;  4N6O B;  2OQE A;  4R9L A;  4JF8 A;  1BAN A;  3UB1 A;  1KD1 4;  2GU3 A;  2KXG A;  1B2X A;  5CF1 A;  3BNB A;  5BVB A;  2PNC A;  3CU3 A;  3U97 A;  1YHQ 3;  1GS3 A;  1SQW A;  1QJG A;  2F5W A;  4LSO A;  1I2G A;  3AHS A;  1V74 A;  2LQV A;  4FCM A;  3BIR A;  1JBT A;  1FYS A;  3VSY A;  1V58 A;  5EVH A;  3ROB A;  1Q86 4;  4O8S A;  2W9Q A;  1GY7 A;  1NO3 A;  3HI7 A;  2B1X B;  2CFG A;  2HML B;  2YFJ B;  3F7S A;  1IQY A;  3DZL A;  1FGT A;  1LQM B;  2W03 A;  2O9U X;  2HMM B;  2BU4 A;  3AHW A;  3F7X A;  1UUG B;  4CCV A;  3EBY A;  4FR9 A;  3WMD A;  5AYS C;  3DGO A;  4MMX B;  2ZL8 A;  3VGN A;  1N5P A;  5CLK A;  8CHO A;  1AY7 A;  5KP3 A;  1WMN A;  1Q82 4;  2CG1 A;  1OHO A;  2C10 A;  3EBT A;  5CXO A;  2CFK A;  3FF2 A;  4GSP A;  1I8V A;  2ZA4 A;  3DM8 A;  4MMY B;  3DUK A;  4EYC A;  1KSI A;  3PCR A;  1JKG B;  1LXE A;  4WFO A;  1I3F A;  4HM6 B;  1M1X B;  3SOY A;  3Q2P A;  4J5G A;  5DRV A;  9RNT A;  4QWT A;  4O3V A;  3CCR 3;  1EA2 A;  2QGU A;  2CW9 A;  1DE3 A;  1FA3 A;  3SED A;  1UUV B;  3KII A;  1BSC A;  3BNE A;  3D79 A;  1RSN A;  1OF5 A;  2INX A;  3NQZ A;  4FMD A;  4HZB B;  4RZM A;  4WHA A;  3X41 A;  5BIR A;  3I55 3;  1VQO 3;  1QMA A;  2D1W A;  5IEP A;  2OTL 3;  2GEX A;  3CCM 3;  1FZU A;  3G0K A;  1CH0 A;  3JUN A;  1JBS A;  1PY3 A;  4L7K A;  2M7O A;  2B24 B;  7STD A;  1B21 A;  4GL6 A;  2Y73 A;  2XRX B;  3FF0 A;  3KFQ C;  4KFD A;  3X42 A;  3I56 3;  4KFE A;  1QAF A;  1NNV A;  3OX9 A;  4HM8 B;  3SLU A;  3SOA A;  1VQ9 3;  1ULI B;  4HM2 B;  1B20 A;  3FZW A;  2K3D A;  3X3Z A;  1IVV A;  3G4S 3;  3KKG A;  3NBB A;  4NRE A;  1US1 A;  1MWR A;  1C7H A;  4LZI A;  4BTX A;  1IV7 A;  1IVU A;  2XSO B;  4MJD A;  2ZHX B;  4J5K A;  1OPY A;  3PYJ A;  1HYF A;  2L4V A;  3HOH A;  3S27 A;  2CFL A;  5IG3 A;  2WGO A;  5D82 A;  1M1K 4;  4L8P A;  2OCT A;  3CME 3;  1O7W B;  2GEY A;  4FCZ A;  5D83 A;  5IG5 A;  3CC2 3;  4KVH A;  4EXR A;  1ZS7 A;  1RMS A;  1W6Y A;  3GZX B;  2IMJ A;  2KF3 A;  3SVA A;  4FMC A;  2Q07 A;  5STD A;  1U8C B;  4HM4 B;  1F8N A;  4MMZ B;  1W6C A;  4N6M A;  5AEW B;  1O7H B;  2F98 A;  3DY5 A;  2V1L A;  3URP A;  3V92 A;  1HKX A;  1TTO A;  1FGR A;  1I3I A;  3D9R A;  4CJN A;  3DMC A;  2XFT A;  1YJN 3;  1WMP A;  1U5O A;  4NHF A;  1B2M A;  4BL2 A;  2XSH B;  3CMA 3;  1SPU A;  5LC6 A;  1X1X A;  1GY5 A;  2UX0 A;  1BRI A;  3F8H A;  3NQY A;  4G1M B;  2RBI A;  1ISK A;  1RGH A;  1UGH I;  3CPO A;  3AMO A;  4LEH A;  3LTC A;  1WMO A;  4HOH A;  4RBN A;  4XBY A;  5HOH A;  5KP4 A;  1OCV A;  1ZGX A;  3LH4 A;  3E99 A;  3D4A A;  2XF3 A;  3OWU A;  4I5Q A;  3EJV A;  4HZ9 B;  3GAX A;  1YJ9 3;  4ZM8 A;  1OH0 A;  1AR0 A;  4RNY A;  1K28 A;  1BIR A;  1X1U A;  2MF7 A;  3ZG5 A;  3NUV A;  1IT8 A;  4XM4 A;  2H0H A;  1D6Z A;  2O3O A;  4IIA A;  3S67 A;  3T0U A;  3CCV 3;  2XFS A;  2XH9 A;  1BSD A;  2FNQ A;  1BNF A;  4AKY A;  1VQ6 3;  2BT3 A;  1B2U A;  2WGQ A;  3X3Y A;  4XBT A;  1YJW 3;  1BUJ A;  1CYU A;  3AGN A;  5AI1 A;  3PXM A;  1NJI 4;  3CCU 3;  2CG0 A;  1JZO A;  3CNX A;  1D6Y A;  3GZY B;  2ML5 A;  3JUO A;  1I70 A;  1TJD A;  3EN1 B;  3LTD A;  3OWY A;  3WDG B;  2LYX A;  2HOH A;  1VQQ A;  3EHC A;  1M90 4;  1AQZ A;  1ULJ B;  3A76 A;  4K1U A;  3CCQ 3;  2F99 A;  1DMQ A;  2WOF A;  3UNL A;  3J7Y d;  2CH9 A;  2Z76 A;  3B4O A;  4H61 A;  1JJ2 2;  3KCH A;  4XDV A;  2IY2 A;  1SII A;  2W56 B;  1W2B 2;  1STD A;  4U13 A;  1MWS A;  2FGT A;  4CPK A;  1N9E A;  3F8X A;  1JN5 A;  4CDL A;  1KC8 4;  4J9A A;  1PYL A;  3NBJ A;  1MWT A;  1TIJ A;  3WHO A;  4JRF A;  3IPT A;  3U1W A;  1R4Y A;  5CK6 A;  1OF5 B;  1JZD A;  1N8R 4;  1T2I A;  1VZZ A;  3A5E A;  5M19 A;  1Q40 A;  1UCK A;  4N6V 0;  1DVD A;  2YFL B;  1Q42 A;  3MYT A;  5JPU A;  1W01 A;  3FLJ A;  4OK0 A;  1LOV A;  3HX8 A;  3HZP A;  1UI7 A;  4X2H A;  1RGK A;  1G0T A;  2OOV C;  1FGO A;  3QRD A;  3UL6 A;  2OWP A;  1I0V A;  2E2V A;  2UGI A;  2F56 A;  1TU5 A;  1NU3 A;  2K0M A;  3DGM A;  4K61 A;  1RGC A;  4KFF A;  2HMN B;  1FUS A;  2W56 A;  3ALA A;  2CFD A;  2JQ5 A;  3N54 B;  1Q7H A;  5EQL A;  3G8Z A;  1OGZ A;  1A67 A;  4HM5 B;  2XEP A;  3H3H A;  5ELU A;  3D3L A;  4X2O A;  3OW2 2;  1OAC A;  1N8Q A;  1MOL A;  1I0X A;  1LNI A;  2H0G A;  2E2U A;  2P0M A;  1VQN 3;  3MG1 A;  1BNJ A;  3CXC 2;  1NB5 I;  1CEW I;  3RGA A;  3FG3 A;  2MC8 A;  2WO0 A;  7RNT A;  4EC6 A;  2W9P A;  2ML6 A;  3N9H A;  4FMB A;  1YNV X;  2CWV A;  3CCL 3;  1EG9 B;  1MGW A;  3G6E 3;  1LNH A;  4OVM A;  4HBR A;  5TGN A;  3HK4 A;  5IF6 A;  1AVL A;  1RGA A;  4EW5 A;  1C54 A;  1X1Y A;  3HIG A;  2GSP A;  2HMK B;  3VF1 A;  1BRS A;  2RSX A;  4N6N B;  4R1K A;  3IMA B;  2CIU A;  2YX9 A;  2Z6B A;  2W2C A;  1HZ1 A;  1FUW A;  1RN1 A;  1T2H A;  1VQM 3;  1IK3 A;  3AMO B;  3WOD G;  3F14 A;  4HAA A;  2JDI H;  1QAL A; 
#chains in the Genus database with same CATH homology
 1L5G B;  1W7C A;  3FCS B;  4HM0 B;  2OTJ 3;  5DRE A;  1IDP A;  4O2H A;  3NX0 A;  4R9K A;  3FH1 A;  4N6U A;  1N9J A;  3L0R A;  1O7M B;  5JBS A;  1JB5 A;  4AKZ A;  2CWU A;  1K9M 4;  3I0Y A;  3ER7 A;  4IT7 A;  5KP1 A;  2BNG A;  5ELJ A;  1O7P B;  3K7C A;  1VQ8 3;  4PEJ A;  3FKA A;  3KSE D;  4K90 B;  3GZB A;  1UUW B;  1A2K A;  3KSP A;  5BXQ A;  1TUH A;  3IJE B;  3LXU X;  2W0Q A;  3B7C A;  3EF8 A;  3BLZ A;  3SXX A;  4FMA A;  1BUQ A;  3CCE 3;  3KN4 A;  3BND A;  1HU9 A;  1OHS A;  4HM7 B;  4K1V A;  4N3V A;  1W02 A;  1W6G A;  2RGQ A;  4XDW A;  3NM2 A;  1ZO2 A;  3WOF B;  2P09 A;  4J8T A;  2ZDJ A;  3DXO A;  2BMO B;  1MNL A;  1JN5 B;  2RCD A;  5AYR B;  1VQ5 3;  1GYB A;  3NBR A;  1DMM A;  1O7G B;  3HII A;  3OV4 A;  3QK9 A;  4EV5 A;  3WA3 A;  1VQM 3;  1TFO A;  3K0Z A;  3DGL A;  1JRQ A;  5AII A;  1IVX A;  1Q40 B;  3G71 3;  4GB5 A;  1S5A A;  3JUP A;  4KZ1 A;  1JNQ A;  3STD A;  2GU1 A;  2CWT A;  4EV2 A;  3OXA A;  1O7N B;  2CKF B;  4WWU C;  5A0O B;  3LOY A;  5D81 A;  3S5C A;  4R80 A;  1ZX2 A;  3RDE A;  3GWR A;  2QEX 3;  1VQ7 3;  2P05 A;  3BB9 A;  2BMQ B;  3F9S A;  3GZR A;  2P0X A;  3MG3 A;  3S28 A;  1RRL A;  3O8Y A;  5IG0 A;  3Q1C A;  1YVB I;  4HKV B;  3CC7 3;  5IEO A;  3BNC A;  3MG2 A;  1IVW A;  4LGQ A;  1DMN A;  5FGO A;  1KQS 2;  1S72 3;  1W00 A;  3MHE A;  3M8C A;  1IT7 A;  1RRH A;  2OQE C;  1PFP A;  1E97 A;  2BMR B;  2QIY A;  4BTW A;  1SJW A;  3CNM A;  3PCS A;  3EN8 A;  3Q90 A;  2K54 A;  3NV0 B;  2OOV A;  6STD A;  1VQP 3;  4ORL A;  3LTB A;  5FW5 A;  3K63 A;  5AIG A;  3X40 A;  2C11 A;  3CD6 3;  1WQL B;  3TDG A;  5AEU B;  3K5T A;  5I97 A;  3UL5 A;  3LT9 A;  1KWI A;  1STF I;  3EB8 A;  3EE1 A;  2Z77 A;  1TFK A;  3LTA A;  3WOE B;  1VQK 3;  1VQL 3;  4AEQ A;  5LC7 A;  1YIT 3;  4BTY A;  4XBX A;  1IQX A;  2CK3 H;  4L8O A;  3X3X A;  1YI2 3;  4R4K A;  4FCJ A;  1QAK A;  2CFW A;  4N6T A;  4WYK A;  3S29 A;  1WTH A;  1Q81 4;  3JVC A;  1IU7 A;  3T8U A;  2BO9 B;  2I9W A;  3V99 A;  1EKM A;  3NV0 A;  4RNZ A;  3OWS A;  1DYU A;  1GY6 A;  3LZA A;  3MWZ A;  4H3U A;  3H51 A;  5IW9 A;  2FXT A;  3F40 A;  4EBG A;  1RN7 A;  1QVG 2;  2WOH A;  2Y74 A;  1RJO A;  2P38 A;  4HM3 B;  4WP5 A;  3LML A;  2RFR A;  3FGY A;  3EX9 A;  2KRT A;  3NXJ A;  4Q53 A;  3V98 A;  4HJL B;  5HGR A;  1RKY A;  1EQK A;  3LYG A;  3PZW A;  1K41 A;  1N5H A;  2XGN A;  1FGM A;  2YFI B;  3B8L A;  2IUK A;  4TX4 A;  2STD A;  3EC9 A;  1T5Y A;  1WNH A;  3G16 A;  3NHX A;  2D42 A;  4OUQ A;  1GD4 A;  2BHM A;  2QA4 3;  2CHC A;  1A2V A;  1FGQ A;  1D6U A;  3FG4 A;  5AIH A;  4XB5 A;  5IG4 A;  2KCD A;  3MKI A;  3LT8 A;  1Q7Y 4;  5IER A;  1AVK A;  3RGR A;  1JV2 B;  1YGE A;  1E3R A;  1JKG A;  3MPH A;  4HVN A;  1ROV A;  2XGL A;  3NM7 A;  2E2T A;  2PZV A;  1TP6 A;  3EQQ B;  1NWW A;  1CQS A;  2CC3 A;  2GXF A;  4N6L A;  3WA2 X;  1LVN A;  1K8A 4;  3CCS 3;  1YIJ 3;  1W2Z A;  2GBX B;  1OHP A;  2F86 B;  1W4N A;  5AIF A;  1M9G A;  1GD3 A;  3CCJ 3;  1NDO B;  3PS8 A;  1JB4 A;  1ASK A;  2HMJ B;  1LOX A;  1SIH A;  3FG1 A;  2W6J H;  1J2B A;  3UJM A;  1UW1 A;  5G2G A;  2W04 A;  3PGB A;  1VQ4 3;  2Z7A A;  1IV9 A;  1CYV A;  1UI8 A;  2HMO B;  3KE7 A;  1K73 4;  5JPP A;  1W5Z A;  5IEN A;  1R4C A;  5CF2 A;  3MSO A;  3N8B A;  4MEI A;  4STD A;  1G96 A;  1JB2 A;  4I4K A;  2SBL A;  3GRD A;  1NB3 I;  3SX1 A;  4HM1 B;  1Z1S A;  2IUJ A;  4O02 B;  1OGX A;  1Y4K A;  1E3V A;  1DVC A;  3JUQ A;  3ECF A;  3JUM A;  1AV4 A;  2GBW B;  3FSD A;  4IPB A;  2IA7 A;  5EEO A;  3T8N A;  4LMI A;  1A90 A;  2R4I A;  1PU4 A;  3CC4 3;  1ROA A;  1QVF 2;  3KZT A;  1OUN A;  3CPW 2;  4WYK B;  3B4P A;  4HYZ A;  2XR8 B;  3K9M C;  4N6O B;  2OQE A;  1IQ8 A;  3DGN A;  2A15 A;  4R9L A;  4JF8 A;  3UB1 A;  1KD1 4;  2GU3 A;  2KXG A;  5CF1 A;  3BNB A;  5BVB A;  2PNC A;  3CU3 A;  3U97 A;  1YHQ 3;  1GS3 A;  1SQW A;  1QJG A;  4LSO A;  1V74 A;  2LQV A;  4FCM A;  3VSY A;  3ROB A;  5EVH A;  1Q86 4;  4O8S A;  2W9Q A;  1GY7 A;  1NO3 A;  3HI7 A;  2B1X B;  2CFG A;  2HML B;  2YFJ B;  3F7S A;  1IQY A;  3DZL A;  1FGT A;  2W03 A;  2O9U X;  2HMM B;  3F7X A;  4CCV A;  3EBY A;  4FR9 A;  3WMD A;  5AYS C;  3DGO A;  4MMX B;  2ZL8 A;  3VGN A;  1N5P A;  5CLK A;  8CHO A;  5KP3 A;  1WMN A;  1Q82 4;  2CG1 A;  1OHO A;  2C10 A;  3EBT A;  5CXO A;  2CFK A;  3FF2 A;  3DM8 A;  4MMY B;  3DUK A;  4EYC A;  1KSI A;  3PCR A;  1JKG B;  1LXE A;  4WFO A;  4HM6 B;  1M1X B;  3SOY A;  3Q2P A;  5DRV A;  3CCR 3;  4QWT A;  4O3V A;  1EA2 A;  2QGU A;  2CW9 A;  1FA3 A;  3SED A;  1UUV B;  3KII A;  3BNE A;  4WHA A;  2INX A;  1OF5 A;  3NQZ A;  4FMD A;  4HZB B;  4RZM A;  3X41 A;  3I55 3;  1VQO 3;  2OTL 3;  1QMA A;  2D1W A;  5IEP A;  2GEX A;  3CCM 3;  3G0K A;  3JUN A;  4L7K A;  2M7O A;  2B24 B;  7STD A;  4GL6 A;  2Y73 A;  2XRX B;  3FF0 A;  3KFQ C;  4KFD A;  3X42 A;  3I56 3;  4KFE A;  1QAF A;  3OX9 A;  4HM8 B;  3SLU A;  3SOA A;  1VQ9 3;  1ULI B;  4HM2 B;  3FZW A;  3X3Z A;  1IVV A;  3G4S 3;  3KKG A;  3NBB A;  4NRE A;  1US1 A;  1C7H A;  4LZI A;  4BTX A;  1IV7 A;  1IVU A;  2XSO B;  4MJD A;  1OPY A;  3PYJ A;  2L4V A;  3S27 A;  2CFL A;  5IG3 A;  2WGO A;  5D82 A;  1M1K 4;  4L8P A;  2OCT A;  3CME 3;  1O7W B;  2GEY A;  4FCZ A;  5D83 A;  5IG5 A;  3CC2 3;  4KVH A;  4EXR A;  1W6Y A;  3GZX B;  2IMJ A;  3SVA A;  4FMC A;  2Q07 A;  5STD A;  1U8C B;  4HM4 B;  1F8N A;  4MMZ B;  1W6C A;  4N6M A;  5AEW B;  1O7H B;  2F98 A;  3DY5 A;  2V1L A;  3V92 A;  1HKX A;  1FGR A;  3D9R A;  3DMC A;  2XFT A;  1YJN 3;  1WMP A;  1U5O A;  4NHF A;  2XSH B;  3CMA 3;  1SPU A;  5LC6 A;  1GY5 A;  2UX0 A;  3F8H A;  3NQY A;  4G1M B;  1ISK A;  3CPO A;  3AMO A;  4LEH A;  3LTC A;  1WMO A;  4RBN A;  4XBY A;  5KP4 A;  1OCV A;  3LH4 A;  3E99 A;  3OWU A;  2XF3 A;  3EJV A;  4HZ9 B;  3GAX A;  1YJ9 3;  4ZM8 A;  1OH0 A;  1AR0 A;  4RNY A;  1K28 A;  2MF7 A;  3NUV A;  1IT8 A;  4XM4 A;  2O3O A;  1D6Z A;  4IIA A;  3S67 A;  3T0U A;  3CCV 3;  2XFS A;  2XH9 A;  2FNQ A;  4AKY A;  1VQ6 3;  2BT3 A;  2WGQ A;  3X3Y A;  4XBT A;  1YJW 3;  1CYU A;  5AI1 A;  3PXM A;  1NJI 4;  3CCU 3;  2CG0 A;  3CNX A;  3GZY B;  1D6Y A;  3JUO A;  2ML5 A;  3OWY A;  3EN1 B;  3LTD A;  3WDG B;  2LYX A;  3EHC A;  1M90 4;  1ULJ B;  4K1U A;  3A76 A;  3CCQ 3;  2F99 A;  1DMQ A;  2WOF A;  3UNL A;  3J7Y d;  2CH9 A;  2Z76 A;  3B4O A;  4H61 A;  1JJ2 2;  4XDV A;  1SII A;  2W56 B;  1W2B 2;  1STD A;  4U13 A;  2FGT A;  1N9E A;  3F8X A;  1JN5 A;  4CDL A;  1KC8 4;  4J9A A;  3NBJ A;  1TIJ A;  4JRF A;  3IPT A;  3U1W A;  5CK6 A;  1OF5 B;  1N8R 4;  1VZZ A;  1Q40 A;  4N6V 0;  1DVD A;  2YFL B;  1Q42 A;  3MYT A;  5JPU A;  1W01 A;  3FLJ A;  4OK0 A;  3HX8 A;  3HZP A;  1UI7 A;  4X2H A;  2OOV C;  3QRD A;  1FGO A;  3UL6 A;  2OWP A;  2E2V A;  1TU5 A;  1NU3 A;  2K0M A;  3DGM A;  4K61 A;  4KFF A;  2HMN B;  2W56 A;  3ALA A;  2CFD A;  2JQ5 A;  3N54 B;  5EQL A;  3G8Z A;  1OGZ A;  1A67 A;  4HM5 B;  2XEP A;  3H3H A;  5ELU A;  3D3L A;  4X2O A;  3OW2 2;  1OAC A;  1N8Q A;  1MOL A;  2E2U A;  2P0M A;  1VQN 3;  3MG1 A;  3CXC 2;  1NB5 I;  1CEW I;  3RGA A;  3FG3 A;  2MC8 A;  2WO0 A;  4EC6 A;  2W9P A;  2ML6 A;  3N9H A;  4FMB A;  2CWV A;  3CCL 3;  1EG9 B;  3G6E 3;  1LNH A;  4OVM A;  4HBR A;  5TGN A;  3HK4 A;  5IF6 A;  1AVL A;  3HIG A;  2HMK B;  3VF1 A;  2RSX A;  4N6N B;  4R1K A;  3IMA B;  2CIU A;  2YX9 A;  2Z6B A;  2W2C A;  1FUW A;  1IK3 A;  3AMO B;  3WOD G;  3F14 A;  2JDI H;  1QAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...