1Q40B

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
186
Chain Sequence
SRNLATNFIANYLKLWDANRSELMILYQNESQFSMQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARMAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEVDGSASRYHSGPKHKRIPLSKKSFDRTFVVIPGSMIVASDTLLIRPYTSDFPWKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
total genus 42
structure length 186
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40B00
5CF2A 3DMCA 5IG3A 3M8CA 1OGZA 2OWPA 4HZ9B 3GWRA 1O7MB 1OHOA 3HZPA 5JPPA 3JUOA 2YFJB 2RCDA 6STDA 1BUQA 2F86B 3T8UA 2BMRB 4PEJA 3GZBA 2HMMB 3OWUA 2QGUA 5D82A 2HMKB 1E97A 3NV0B 4HM5B 5TGNA 1NWWA 5HGRA 3EHCA 3MYTA 2F99A 5G2GA 3UJMA 5DRVA 1EG9B 1Q40B 5IG4A 1JKGB 4I4KA 2RGQA 1OHPA 3JUNA 1TUHA 5AEWB 3FZWA 1ULIB 2XRXB 4Q53A 1K41A 5DREA 4XDVA 3FGYA 3LYGA 5IG5A 5IENA 5CK6A 3HK4A 3EN1B 3OXAA 4XBYA 1ZO2A 3BB9A 3FSDA 3IPTA 1IDPA 4XDWA 5JPUA 3F7SA 1DMQA 1OHSA 1O7PB 3DZLA 2RFRA 4R1KA 3EBTA 3Q90A 3D9RA 3DXOA 4HM3B 4CDLA 3OX9A 4HM1B 3FF0A 1OF5A 2HMJB 3STDA 3F8XA 4WP5A 3GZYB 3MKIA 3MG3A 5IERA 4HJLB 3FF2A 1JN5B 3OWYA 4FCMA 5IG0A 4H3UA 3KKGA 4X2HA 4LMIA 3ER7A 4XM4A 3SOYA 2HMNB 5FW5A 3I0YA 2INXA 2W2CA 3GZXB 2STDA 3EF8A 4MJDA 3RGRA 4HM2B 1O7HB 1U5OA 5AIFA 3SOAA 1GYBA 4X2OA 2GBWB 3FKAA 5CLKA 3EJVA 4FCJA 3NUVA 2XSHB 4XBXA 3EN8A 1UUVB 4RZMA 3EX9A 1W01A 3SEDA 2GXFA 3LZAA 3KSPA 3CNMA 5D83A 2XSOB 2GEXA 2A15A 1TP6A 5AIIA 1GY7A 5AEUB 1W02A 1QJGA 3RGAA 2B1XB 1W6YA 3GZRA 3F40A 2I9WA 1QMAA 3F9SA 1DMMA 2B24B 2YFIB 1JB4A 4XB5A 4LEHA 3F7XA 4N3VA 1NDOB 4HM6B 2UX0A 4WYKA 3NBRA 3HX8A 5D81A 3CPOA 3F14A 3MG2A 4K1UA 3FH1A 1CQSA 1A2KA 1C7HA 3B4OA 2CKFB 1E3VA 5KP4A 4K1VA 3G0KA 3K0ZA 4HM8B 4ORLA 1ISKA 1OCVA 3UNLA 3B7CA 2YFLB 4HVNA 4KVHA 1ASKA 3H51A 1OUNA 1STDA 1GS3A 1O7WB 3CNXA 3GRDA 1OH0A 4R9LA 3FLJA 2GBXB 3H3HA 3B8LA 3NHXA 1Q42A 1EA2A 2R4IA 1O7GB 4HM0B 3EQQB 4LGQA 3ECFA 5STDA 1Z1SA 3JUMA 1OF5B 3T8NA 1SJWA 2K54A 3G8ZA 4OVMA 3NV0A 4HKVB 3EBYA 1DMNA 4HM4B 2BMQB 2GEYA 1O7NB 1Q40A 1JKGA 1GY5A 3EC9A 4WWUC 3DM8A 1OGXA 2BMOB 2HMLB 1S5AA 5EVHA 5CXOA 5IEOA 4R9KA 3VSYA 1HKXA 3VGNA 2IMJA 5IEPA 4IIAA 2Z77A 5AIGA 5IF6A 5AIHA 3MHEA 2PZVA 5KP1A 2Z7AA 4STDA 1E3RA 1NU3A 5BXQA 2XR8B 3OV4A 3DUKA 3A76A 3CU3A 3BLZA 1JB2A 3KE7A 4OUQA 1ULJB 1WQLB 8CHOA 5KP3A 1JN5A 5BVBA 3OWSA 1VZZA 3F8HA 2CHCA 3WMDA 2JQ5A 4WYKB 4L8OA 3ROBA 3NXJA 2HMOB 2F98A 3S5CA 4HZBB 7STDA 3JUPA 4L7KA 1JB5A 4GB5A 3JUQA 3MG1A 4J9AA 5CF1A 2Z76A 3G16A 3E99A 4HM7B 4U13A 1W00A 2BNGA 1AR0A 2QIYA 4XBTA 3NM2A 1UUWB 1OPYA 1GY6A 3B4PA 3MSOA 3KZTA 4J8TA 5AI1A 4L8PA 1ZX2A 3K7CA
chains in the Genus database with same CATH superfamily
1TRPA 4DKIA 5CF2A 1KQS2 3DMCA 5IG3A 6RNTA 3OW22 1S723 3BNDA 3M8CA 3T0UA 1OGZA 1N9JA 1HZ1A 2OWPA 4HZ9B 3SVAA 1VQN3 3LTCA 1UUGB 3LOYA 3LT8A 3GWRA 1FA3A 1BSDA 1K734 1W7CA 3ALAA 1O7MB 2KF5A 2OQEC 3D5GA 1NB5I 1VQQA 1OHOA 3HZPA 3K7CA 3O8YA 1AVLA 5JPPA 1BAOA 2L1SA 2YFJB 3JUOA 1M1K4 3CCV3 2RCDA 1MWTA 2MF7A 4GL6A 1KC84 5LC6A 6STDA 3MWZA 3G713 1FGMA 1FGQA 1M1XB 1B2UA 1BUQA 2FXTA 3CCR3 2F86B 1IVVA 2F4YA 3Q2PA 3T8UA 2BMRB 4BL3A 1RGGA 4PEJA 4R80A 2XFSA 3GZBA 2HMMB 1U8CB 3OWUA 4GSPA 7RNTA 1AQZA 1NJI4 1UGIA 1JZDA 3FCSB 3LMLA 2QGUA 3A5EA 3GSPA 4EYCA 1RRHA 5D82A 2HMKB 1E97A 3NV0B 1BRHA 4HM5B 2OOVC 1I3IA 4QWTA 1UDII 5TGNA 3K63A 1N8R4 1NWWA 5HGRA 1RN4A 3DH2A 3EHCA 3MYTA 4IT7A 2F99A 3UL6A 1C54A 5G2GA 1VQO3 2KRTA 2OTL3 3UJMA 4NPBA 5DRVA 3HOHA 1B20A 1EG9B 1Q40B 2C4BA 2CFKA 3DGOA 5IG4A 1YJN3 1JKGB 3HIIA 2BHMA 2RGQA 4I4KA 1OHPA 1RN7A 3IMAB 3JUNA 1TUHA 4O02B 5JBSA 5AEWB 3FZWA 1D6YA 2W03A 3KSED 1ULIB 2W0QA 1KWIA 1TIJA 2XRXB 1K41A 4KFFA 4Q53A 3KN4A 5DREA 3CMA3 2E2UA 1BRSA 3X42A 1DVDA 4XDVA 3FGYA 2CFDA 5G1KA 3AMOB 3VF1A 3LYGA 4HAAA 1RGHA 3WOFB 1YGEA 5IENA 5IG5A 3WA3A 3EE1A 4FCZA 3HK4A 5CK6A 3EN1B 1I8VA 3OXAA 1ZO2A 3BB9A 2XEPA 4XBYA 1TU5A 1YI23 1CH0A 1RRLA 1YVSA 5A0OB 3FSDA 2IY2A 1RDSA 1JV2B 1W5ZA 2FNQA 2YX9A 1IDPA 3IPTA 1V58A 4XDWA 3SYUA 3WODG 5JPUA 3F7SA 3WR2A 1BOXA 3L0RA 1STFI 1DMQA 3U1WA 9RNTA 1OHSA 1O7PB 1N5HA 3DZLA 4N6UA 1JNQA 1GOYA 2H0IA 1KD14 2OTJ3 1IT8A 3JVCA 4JF8A 4NHFA 4MEIA 2RFRA 1JBSA 2CG0A 4K90B 4R1KA 2CW9A 3EBTA 3Q90A 3CPW2 1HU9A 2WGQA 3D9RA 3DXOA 2QEX3 1GMQA 2ZL8A 1I70A 2CG1A 3AHWA 4HM3B 5ELJA 3ZG0A 2E2VA 3N54B 1I3FA 4RNYA 1N9EA 1Q814 4CDLA 4WFOA 4K61A 1SIHA 2F56A 3OX9A 1B27A 4HM1B 3FF0A 1OF5A 2HMJB 3PZWA 1A67A 2Q07A 3STDA 3F8XA 5RNTA 1W4NA 3CCS3 4TX4A 4WP5A 3GZYB 2CFGA 3MG3A 3MKIA 1V57A 1MGRA 5IERA 3HIGA 2KAAA 3CC23 1EUIC 1LOWA 1B2MA 4HJLB 6GSPA 1G0TA 1IQXA 3FF2A 3LXUX 1G02A 1LVNA 1JN5B 1FUTA 1YJW3 1RNTA 3OWYA 1QALA 1Q7HA 3CD63 3QK9A 4FCMA 5IG0A 4MMXB 1ROAA 2BU4A 4H3UA 2XGNA 3KKGA 4CCVA 1DE3A 4X2HA 4LMIA 1GMRA 3ER7A 4XM4A 5FGOA 3V99A 3SOYA 3BNCA 1RSNA 2HMNB 3G6E3 5FW5A 1WTHA 2GU1A 2INXA 2W2CA 3GZXB 3I0YA 4EV2A 2STDA 3EF8A 4MJDA 3RGRA 1IK3A 2CFWA 4HM2B 1W6CA 1M904 1O7HB 1UCKA 1U5OA 3S28A 5AIFA 3SOAA 1GYBA 2L4VA 1MWRA 1F8NA 1T3BA 4FR9A 2W56A 4X2OA 2GBWB 3FKAA 2CX1A 1K28A 5CLKA 3EJVA 4FCJA 1VQM3 2WO0A 2P05A 1LNHA 3DGNA 2XSHB 1BRIA 3NUVA 4XBXA 1R4YA 1FW7A 1VQ73 1N5PA 2ML6A 4CJNA 3EN8A 2XF3A 1UUVB 1RLSA 4RZMA 4EW5A 1VQ93 4BL2A 1VQ83 1FZUA 1W01A 3EX9A 3SEDA 1BIRA 4EXRA 2GXFA 4FMCA 1JBRA 3AGNA 4N6LA 5GSPA 3J7Yd 4RBNA 3CME3 1T2IA 2H0GA 1B21A 3LZAA 3KSPA 1ROVA 3CNMA 4FMBA 2IYJA 5D83A 3KIIA 2XSOB 2P0XA 2GEXA 1IQYA 3Q3FA 1Q9EA 2A15A 2BT3A 1TP6A 3KCHA 3BNBA 1W6GA 3GAXA 4FMDA 5AIIA 1GY7A 2OCTA 1BSBA 5AEUB 3CCM3 1JZOA 1W02A 1QVG2 4N6NB 4AKYA 1IU7A 1MOLA 1BU4A 1QJGA 3RGAA 2B1XB 3S27A 2Y74A 1SIIA 2H0HA 2ZHXB 2CWTA 1VQ63 3K9MC 1W6YA 3GZRA 1I2FA 1NB3I 1A90A 1ZGXA 3D5IA 3F40A 1BSCA 5AYRB 2I9WA 1B2XA 1QMAA 3F9SA 1W2ZA 4N6OB 1FGRA 3TDGA 3CCE3 4MMZB 3CC43 1CYVA 1DMMA 2B24B 2R41A 4FMAA 1VQ43 1PYLA 1UCIA 2XH9A 2YFIB 1JB4A 3PS8A 2W6JH 4XB5A 3X3XA 1A2PA 2WGOA 1BSAA 1T2HA 1K8A4 3LTBA 1IYYA 4LEHA 2LQVA 5EEOA 3F7XA 3HI7A 4N3VA 1NDOB 4HM6B 2UX0A 1RGFA 4WYKA 3NBRA 3LTAA 3HX8A 5D81A 3CPOA 3S67A 2FGTA 4RNTA 3F14A 1LNIA 3MG2A 3X3ZA 4K1UA 1PU4A 3FH1A 1CQSA 1EKMA 1LOVA 1YIT3 1SPUA 3WA2X 1A2KA 2BIRA 1C7HA 1FGOA 3B4OA 2CKFB 2KF3A 3IJEB 2UUGC 5I97A 5M19A 2XFTA 5HOHA 1IT7A 1RGAA 4O8SA 5LC7A 3K5TA 3RDEA 1QVF2 1E3VA 5KP4A 3SXXA 4K1VA 1BRJA 1RHLA 3LH4A 4BU4A 2F5MA 4I5QA 3G0KA 1YNVX 2F5WA 3K0ZA 4HM8B 1SARA 4ORLA 1ISKA 1MGWA 1OCVA 3UNLA 4O3VA 3B7CA 5BIRA 1Q824 3V98A 3BU4A 2YFLB 3D79A 4HVNA 2MC8A 3FG1A 4KVHA 1ASKA 3H51A 1GD4A 3X40A 4IPBA 3NBBA 1N8QA 4GHOA 1AV4A 1D6UA 1BVIA 1RGLA 1OUNA 1RGKA 3NBJA 1STDA 1R4CA 1TTOA 1GS3A 1RGEA 1BNEA 4H61A 1O7WB 3CNXA 3PXMA 1LOXA 4BTWA 3GRDA 3N8BA 1US1A 1OH0A 1X1XA 1OACA 1LOYA 1RCLA 1TJDA 3SLUA 1Q7Y4 2CK3H 2AAEA 1QAKA 2E2TA 2W04A 4R9LA 2V1LA 2Y73A 3FLJA 4KFDA 3WHOA 2GBXB 2HOHA 3H3HA 4G1MB 3B8LA 3NHXA 1LRAA 4AKZA 1G96A 1Q42A 1PY3A 1B2SA 1QAFA 1EA2A 1DVCA 2CFLA 1O7GB 2R4IA 4HOHA 4BIRA 3I563 3CCJ3 4EBGA 3PYJA 4HM0B 2KF6A 2CX0A 4KZ1A 3NQZA 2W9QA 3EQQB 1FUWA 4LGQA 3ECFA 5STDA 1BGSA 1Z1SA 2LYXA 5M18A 3JUMA 1OF5B 4LZIA 3T8NA 1RNBA 1BNIA 1BNGA 1DETA 4JRFA 4HYZA 1SJWA 2K54A 3G8ZA 4OVMA 7GSPA 1AY7A 1D6ZA 1RGCA 5EQLA 2D1WA 1X1WA 3LTDA 4BTXA 3NV0A 1BSEA 4HKVB 3CCL3 1B2ZA 3EBYA 1DMNA 1I2EA 1WMOA 2RBIA 2BO9B 4HM4B 2BMQB 5G1LA 1EEJA 3NX0A 2CC3A 2GEYA 2SBLA 3WDGB 1DYUA 1O7NB 1KSIA 1Q40A 1EQKA 4LSOA 3LT9A 3MPHA 1JKGA 1UW1A 1BNSA 2Z6BA 1GY5A 3URPA 3EC9A 3BNEA 1IQ8A 2D42A 1VQ53 4EV5A 4ILFA 1ZS7A 4WWUC 3DM8A 1I0VA 1OGXA 4WHAA 1RJOA 1LQGC 2BMOB 2HMLB 2P0MA 1S5AA 1T5YA 1GOUA 5EVHA 4O2HA 1SQWA 5CXOA 1YJ93 1Y4KA 3G4S3 3AMOA 2RSXA 5IEOA 1WMPA 2W56B 3SX1A 4OK0A 4MMYB 1VQL3 1RMSA 1V74A 1RCKA 4R9KA 4N6V0 3VSYA 1MWUA 1TFOA 1HKXA 3VGNA 3N9HA 3D3LA 2IMJA 2W9PA 2IUKA 5IEPA 4BTYA 1X1UA 4IIAA 2Z77A 4KFEA 4N6MA 8RNTA 5AIGA 5IF6A 5AIHA 3U97A 4CPKA 1FUSA 1UI7A 3ZFZA 3MHEA 3DGMA 2WOHA 1CYUA 2PZVA 2K3DA 1BRGA 2C10A 4HBRA 1RKYA 2ZDJA 5KP1A 2CWUA 5ELUA 2Z7AA 1M9GA 2SARA 2QA43 2P09A 3CC73 1VQK3 2AADA 3DGLA 1IVXA 4STDA 1E3RA 1RN1A 2KCDA 3CXC2 1LQMB 1NU3A 2PNCA 4RNZA 3X41A 3PGBA 5BXQA 1A2VA 2XR8B 3PCRA 1YGWA 1UCLA 4ZM8A 4LYLB 4EC6A 1YIJ3 3FG4A 1GMPA 1GD3A 2IA7A 3AHSA 3OV4A 3DUKA 2XGLA 3A76A 1IV9A 3CU3A 3NQYA 3NM7A 1JRQA 4R4KA 1IVWA 2WOFA 3BLZA 1JB2A 3Q1CA 3KE7A 2O9UX 1UCJA 4OUQA 1VQP3 3CCQ3 4J5KA 3DGYA 1X1YA 3QRDA 1ULJB 1GOVA 1WQLB 5KP3A 3V92A 1JN5A 8CHOA 1BNJA 5BVBA 1TFKA 1LXEA 3UB1A 3OWSA 1VZZA 2GSPA 3F8HA 1GSPA 3FG3A 1RTUA 2CHCA 1CEWI 2J8XB 3WMDA 5BU4A 3DY5A 1BNRA 2JQ5A 1BRKA 3D4AA 4WYKB 1BNFA 1YHQ3 4L8OA 3ROBA 4AEQA 3NXJA 2HMOB 2KF4A 4N6TA 1Q864 2F98A 2O3OA 2KXGA 3S5CA 3S29A 4HZBB 7STDA 5AYSC 3JUPA 4L7KA 1JB5A 4KT3B 2OQEA 4GB5A 3ZG5A 1HYFA 2RNTA 4NREA 5IW9A 1W2B2 3JUQA 3EB8A 3MG1A 3UL5A 1BUJA 1FGTA 2CWVA 3RNTA 2IUJA 3X3YA 4J9AA 5CF1A 1I2GA 2Z76A 3G16A 4J5GA 3E99A 1NO3A 1TRQA 1FYSA 4HM7B 4U13A 3CCU3 1W00A 2BNGA 1J2BA 1YVBI 1JJ22 3I553 2GU3A 3PCSA 1L5GB 1I0XA 1AR0A 2CIUA 2QIYA 4XBTA 2CH9A 1PFPA 1UI8A 3NM2A 1UUWB 2ML5A 2OOVA 1MWSA 1OPYA 1K9M4 1NNVA 2K0MA 3AGOA 1WMNA 2M7OA 1MNLA 2C11A 3BIRA 1GY6A 1WNHA 5M1AA 1IVUA 3B4PA 1BRNL 2UGIA 1UGHI 1IV7A 3WOEB 3MSOA 3KFQC 1BANA 3KZTA 4J8TA 2P38A 2ZA4A 1JBTA 1AVKA 1B3SA 5AI1A 4L8PA 1ZX2A 2JDIH
chains in the Genus database with same CATH topology
5CF2A 1KQS2 3DMCA 5IG3A 1S723 3OW22 3BNDA 3M8CA 3T0UA 1OGZA 1N9JA 2OWPA 3SVAA 4HZ9B 1VQN3 3LTCA 3LOYA 3LT8A 3GWRA 1FA3A 1K734 1W7CA 3ALAA 1O7MB 2OQEC 1NB5I 1OHOA 3HZPA 3K7CA 3O8YA 1AVLA 5JPPA 3JUOA 2YFJB 1M1K4 3CCV3 2RCDA 4GL6A 2MF7A 1KC84 5LC6A 6STDA 3MWZA 3G713 1FGMA 1FGQA 1M1XB 1BUQA 2FXTA 3CCR3 2F86B 1IVVA 3Q2PA 3T8UA 2BMRB 4PEJA 4R80A 2XFSA 3GZBA 2HMMB 1U8CB 3OWUA 1NJI4 3FCSB 3LMLA 2QGUA 4EYCA 1RRHA 5D82A 2HMKB 1E97A 3NV0B 4HM5B 2OOVC 5TGNA 4QWTA 1N8R4 3K63A 1NWWA 5HGRA 3EHCA 4IT7A 3UL6A 3MYTA 2F99A 5G2GA 1VQO3 2KRTA 2OTL3 3UJMA 5DRVA 3DGOA 1EG9B 1Q40B 2CFKA 1YJN3 5IG4A 1JKGB 3HIIA 2BHMA 2RGQA 4I4KA 1OHPA 1RN7A 3IMAB 3JUNA 1TUHA 4O02B 5JBSA 5AEWB 3FZWA 1D6YA 2W03A 3KSED 1ULIB 2W0QA 1KWIA 1TIJA 2XRXB 1K41A 4KFFA 4Q53A 3KN4A 5DREA 3CMA3 2E2UA 1DVDA 3X42A 4XDVA 3FGYA 2CFDA 3VF1A 3AMOB 3LYGA 5IG5A 3WOFB 1YGEA 5IENA 3WA3A 3EE1A 4FCZA 3HK4A 5CK6A 3EN1B 3OXAA 4XBYA 1ZO2A 3BB9A 2XEPA 1TU5A 1YI23 1RRLA 5A0OB 3FSDA 1JV2B 1W5ZA 2FNQA 2YX9A 1IDPA 3IPTA 4XDWA 3WODG 5JPUA 3F7SA 3L0RA 1STFI 1DMQA 3U1WA 1OHSA 1O7PB 1N5HA 3DZLA 4N6UA 1JNQA 1KD14 2OTJ3 1IT8A 3JVCA 4JF8A 4NHFA 4MEIA 2RFRA 2CG0A 4K90B 4R1KA 2CW9A 3EBTA 3Q90A 3CPW2 2WGQA 1HU9A 3D9RA 3DXOA 2QEX3 2ZL8A 2CG1A 4HM3B 5ELJA 2E2VA 3N54B 4RNYA 1N9EA 1Q814 4CDLA 4WFOA 4K61A 1SIHA 3OX9A 4HM1B 3FF0A 1OF5A 2HMJB 3PZWA 1A67A 2Q07A 3STDA 3F8XA 1W4NA 3CCS3 4TX4A 4WP5A 3GZYB 2CFGA 3MG3A 3MKIA 5IERA 3HIGA 3CC23 4HJLB 1IQXA 3FF2A 3LXUX 1LVNA 1JN5B 1YJW3 3OWYA 1QALA 3CD63 3QK9A 4FCMA 5IG0A 4MMXB 1ROAA 4H3UA 2XGNA 3KKGA 4CCVA 4X2HA 4LMIA 5FGOA 3ER7A 4XM4A 3V99A 3SOYA 3BNCA 2HMNB 3G6E3 5FW5A 1WTHA 2GU1A 2INXA 2W2CA 3GZXB 3I0YA 4EV2A 2STDA 3EF8A 4MJDA 3RGRA 1IK3A 2CFWA 4HM2B 1W6CA 1M904 1O7HB 1U5OA 3S28A 5AIFA 3SOAA 1GYBA 2L4VA 1F8NA 4FR9A 2W56A 4X2OA 2GBWB 3FKAA 1K28A 5CLKA 3EJVA 4FCJA 1VQM3 2WO0A 2P05A 1LNHA 3DGNA 2XSHB 3NUVA 4XBXA 1VQ73 1N5PA 2ML6A 3EN8A 2XF3A 1UUVB 4RZMA 1VQ93 1VQ83 3EX9A 1W01A 3SEDA 4EXRA 2GXFA 4FMCA 3J7Yd 4N6LA 4RBNA 3CME3 3LZAA 3KSPA 1ROVA 3CNMA 4FMBA 5D83A 3KIIA 2XSOB 2P0XA 2GEXA 1IQYA 2A15A 2BT3A 1TP6A 3BNBA 1W6GA 3GAXA 4FMDA 5AIIA 1GY7A 2OCTA 5AEUB 3CCM3 1W02A 1QVG2 4N6NB 4AKYA 1IU7A 1MOLA 1QJGA 3RGAA 2B1XB 3S27A 2Y74A 1SIIA 2CWTA 1VQ63 3K9MC 1W6YA 3GZRA 1NB3I 1A90A 3F40A 5AYRB 2I9WA 1QMAA 3F9SA 1W2ZA 4N6OB 1FGRA 3TDGA 3CCE3 4MMZB 3CC43 1CYVA 1DMMA 2B24B 4FMAA 1VQ43 2XH9A 2YFIB 1JB4A 3PS8A 2W6JH 4XB5A 3X3XA 2WGOA 1K8A4 3LTBA 4LEHA 2LQVA 5EEOA 3F7XA 3HI7A 4N3VA 1NDOB 4HM6B 2UX0A 4WYKA 3NBRA 3LTAA 3HX8A 5D81A 3CPOA 3S67A 2FGTA 3F14A 3MG2A 3X3ZA 4K1UA 1PU4A 3FH1A 1CQSA 1EKMA 1YIT3 1SPUA 3WA2X 1A2KA 3IJEB 1C7HA 1FGOA 3B4OA 2CKFB 5I97A 2XFTA 1IT7A 4O8SA 5LC7A 3K5TA 3RDEA 1QVF2 1E3VA 5KP4A 3SXXA 4K1VA 3LH4A 3G0KA 3K0ZA 4HM8B 4ORLA 1ISKA 1OCVA 3UNLA 4O3VA 3B7CA 1Q824 3V98A 2YFLB 4HVNA 2MC8A 3FG1A 4KVHA 1ASKA 3H51A 1GD4A 3X40A 4IPBA 3NBBA 1N8QA 1AV4A 1D6UA 1OUNA 3NBJA 1STDA 1R4CA 1GS3A 4H61A 1O7WB 3CNXA 3PXMA 1LOXA 4BTWA 3GRDA 3N8BA 1US1A 1OH0A 3SLUA 1OACA 1Q7Y4 2CK3H 2E2TA 1QAKA 2W04A 4R9LA 2V1LA 2Y73A 3FLJA 4KFDA 2GBXB 3H3HA 4G1MB 3B8LA 3NHXA 4AKZA 1G96A 1Q42A 1QAFA 1EA2A 1DVCA 2CFLA 1O7GB 2R4IA 3CCJ3 3I563 4EBGA 3PYJA 4HM0B 4KZ1A 3NQZA 2W9QA 3EQQB 1FUWA 4LGQA 3ECFA 5STDA 1Z1SA 2LYXA 3JUMA 1OF5B 4LZIA 3T8NA 4JRFA 4HYZA 1SJWA 2K54A 3G8ZA 4OVMA 1D6ZA 5EQLA 2D1WA 3LTDA 4BTXA 3NV0A 4HKVB 3CCL3 3EBYA 1DMNA 1WMOA 2BO9B 4HM4B 2BMQB 3NX0A 2CC3A 2GEYA 2SBLA 3WDGB 1DYUA 1O7NB 1KSIA 1Q40A 1EQKA 4LSOA 3LT9A 3MPHA 1JKGA 1UW1A 2Z6BA 1GY5A 3EC9A 3BNEA 1IQ8A 2D42A 1VQ53 4EV5A 4WWUC 3DM8A 4WHAA 1OGXA 1RJOA 2BMOB 2HMLB 2P0MA 1S5AA 1T5YA 5EVHA 4O2HA 1SQWA 5CXOA 1YJ93 1Y4KA 3G4S3 3AMOA 2RSXA 5IEOA 1WMPA 2W56B 3SX1A 4OK0A 4MMYB 1VQL3 4R9KA 1V74A 3VSYA 4N6V0 1TFOA 1HKXA 3VGNA 3N9HA 3D3LA 2IMJA 2W9PA 2IUKA 5IEPA 4BTYA 4IIAA 2Z77A 4KFEA 4N6MA 5AIGA 5IF6A 5AIHA 3U97A 1UI7A 3MHEA 3DGMA 2WOHA 1CYUA 2PZVA 2C10A 1RKYA 4HBRA 2ZDJA 5KP1A 2CWUA 5ELUA 2Z7AA 1M9GA 2QA43 2P09A 3CC73 1VQK3 3DGLA 1IVXA 4STDA 1E3RA 3CXC2 2KCDA 1NU3A 2PNCA 4RNZA 3X41A 3PGBA 5BXQA 1A2VA 2XR8B 3PCRA 4ZM8A 4EC6A 1YIJ3 3FG4A 1GD3A 2IA7A 3OV4A 3DUKA 2XGLA 3A76A 1IV9A 3CU3A 3NQYA 3NM7A 1JRQA 4R4KA 1IVWA 2WOFA 3BLZA 1JB2A 3Q1CA 3KE7A 2O9UX 4OUQA 1VQP3 3CCQ3 3QRDA 1ULJB 1WQLB 3V92A 5KP3A 8CHOA 1JN5A 5BVBA 1TFKA 1LXEA 3UB1A 3OWSA 1VZZA 3F8HA 3FG3A 2CHCA 3WMDA 1CEWI 3DY5A 2JQ5A 4WYKB 1YHQ3 4L8OA 3ROBA 4AEQA 3NXJA 2HMOB 4N6TA 1Q864 2F98A 2O3OA 2KXGA 3S5CA 3S29A 4HZBB 7STDA 5AYSC 3JUPA 4L7KA 1JB5A 2OQEA 4GB5A 4NREA 5IW9A 1W2B2 3JUQA 3EB8A 3MG1A 3UL5A 1FGTA 2CWVA 2IUJA 3X3YA 4J9AA 5CF1A 2Z76A 3G16A 3E99A 1NO3A 4HM7B 4U13A 3CCU3 1J2BA 1W00A 2BNGA 1YVBI 1JJ22 3I553 2GU3A 3PCSA 1L5GB 1AR0A 2CIUA 2QIYA 4XBTA 2CH9A 1PFPA 1UI8A 3NM2A 1UUWB 2ML5A 2OOVA 1OPYA 1K9M4 2K0MA 1WMNA 2M7OA 1MNLA 2C11A 1GY6A 1WNHA 1IVUA 3B4PA 1IV7A 3WOEB 3MSOA 3KFQC 3KZTA 4J8TA 2P38A 1AVKA 5AI1A 4L8PA 1ZX2A 2JDIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CF2 A;  3DMC A;  5IG3 A;  3M8C A;  1OGZ A;  2OWP A;  4HZ9 B;  3GWR A;  1O7M B;  1OHO A;  3HZP A;  5JPP A;  3JUO A;  2YFJ B;  2RCD A;  6STD A;  1BUQ A;  2F86 B;  3T8U A;  2BMR B;  4PEJ A;  3GZB A;  2HMM B;  3OWU A;  2QGU A;  5D82 A;  2HMK B;  1E97 A;  3NV0 B;  4HM5 B;  5TGN A;  1NWW A;  5HGR A;  3EHC A;  3MYT A;  2F99 A;  5G2G A;  3UJM A;  5DRV A;  1EG9 B;  1Q40 B;  5IG4 A;  1JKG B;  4I4K A;  2RGQ A;  1OHP A;  3JUN A;  1TUH A;  5AEW B;  3FZW A;  1ULI B;  2XRX B;  4Q53 A;  1K41 A;  5DRE A;  4XDV A;  3FGY A;  3LYG A;  5IG5 A;  5IEN A;  5CK6 A;  3HK4 A;  3EN1 B;  3OXA A;  4XBY A;  1ZO2 A;  3BB9 A;  3FSD A;  3IPT A;  1IDP A;  4XDW A;  5JPU A;  3F7S A;  1DMQ A;  1OHS A;  1O7P B;  3DZL A;  2RFR A;  4R1K A;  3EBT A;  3Q90 A;  3D9R A;  3DXO A;  4HM3 B;  4CDL A;  3OX9 A;  4HM1 B;  3FF0 A;  1OF5 A;  2HMJ B;  3STD A;  3F8X A;  4WP5 A;  3GZY B;  3MKI A;  3MG3 A;  5IER A;  4HJL B;  3FF2 A;  1JN5 B;  3OWY A;  4FCM A;  5IG0 A;  4H3U A;  3KKG A;  4X2H A;  4LMI A;  3ER7 A;  4XM4 A;  3SOY A;  2HMN B;  5FW5 A;  3I0Y A;  2INX A;  2W2C A;  3GZX B;  2STD A;  3EF8 A;  4MJD A;  3RGR A;  4HM2 B;  1O7H B;  1U5O A;  5AIF A;  3SOA A;  1GYB A;  4X2O A;  2GBW B;  3FKA A;  5CLK A;  3EJV A;  4FCJ A;  3NUV A;  2XSH B;  4XBX A;  3EN8 A;  1UUV B;  4RZM A;  3EX9 A;  1W01 A;  3SED A;  2GXF A;  3LZA A;  3KSP A;  3CNM A;  5D83 A;  2XSO B;  2GEX A;  2A15 A;  1TP6 A;  5AII A;  1GY7 A;  5AEU B;  1W02 A;  1QJG A;  3RGA A;  2B1X B;  1W6Y A;  3GZR A;  3F40 A;  2I9W A;  1QMA A;  3F9S A;  1DMM A;  2B24 B;  2YFI B;  1JB4 A;  4XB5 A;  4LEH A;  3F7X A;  4N3V A;  1NDO B;  4HM6 B;  2UX0 A;  4WYK A;  3NBR A;  3HX8 A;  5D81 A;  3CPO A;  3F14 A;  3MG2 A;  4K1U A;  3FH1 A;  1CQS A;  1A2K A;  1C7H A;  3B4O A;  2CKF B;  1E3V A;  5KP4 A;  4K1V A;  3G0K A;  3K0Z A;  4HM8 B;  4ORL A;  1ISK A;  1OCV A;  3UNL A;  3B7C A;  2YFL B;  4HVN A;  4KVH A;  1ASK A;  3H51 A;  1OUN A;  1STD A;  1GS3 A;  1O7W B;  3CNX A;  3GRD A;  1OH0 A;  4R9L A;  3FLJ A;  2GBX B;  3H3H A;  3B8L A;  3NHX A;  1Q42 A;  1EA2 A;  2R4I A;  1O7G B;  4HM0 B;  3EQQ B;  4LGQ A;  3ECF A;  5STD A;  1Z1S A;  3JUM A;  1OF5 B;  3T8N A;  1SJW A;  2K54 A;  3G8Z A;  4OVM A;  3NV0 A;  4HKV B;  3EBY A;  1DMN A;  4HM4 B;  2BMQ B;  2GEY A;  1O7N B;  1Q40 A;  1JKG A;  1GY5 A;  3EC9 A;  4WWU C;  3DM8 A;  1OGX A;  2BMO B;  2HML B;  1S5A A;  5EVH A;  5CXO A;  5IEO A;  4R9K A;  3VSY A;  1HKX A;  3VGN A;  2IMJ A;  5IEP A;  4IIA A;  2Z77 A;  5AIG A;  5IF6 A;  5AIH A;  3MHE A;  2PZV A;  5KP1 A;  2Z7A A;  4STD A;  1E3R A;  1NU3 A;  5BXQ A;  2XR8 B;  3OV4 A;  3DUK A;  3A76 A;  3CU3 A;  3BLZ A;  1JB2 A;  3KE7 A;  4OUQ A;  1ULJ B;  1WQL B;  8CHO A;  5KP3 A;  1JN5 A;  5BVB A;  3OWS A;  1VZZ A;  3F8H A;  2CHC A;  3WMD A;  2JQ5 A;  4WYK B;  4L8O A;  3ROB A;  3NXJ A;  2HMO B;  2F98 A;  3S5C A;  4HZB B;  7STD A;  3JUP A;  4L7K A;  1JB5 A;  4GB5 A;  3JUQ A;  3MG1 A;  4J9A A;  5CF1 A;  2Z76 A;  3G16 A;  3E99 A;  4HM7 B;  4U13 A;  1W00 A;  2BNG A;  1AR0 A;  2QIY A;  4XBT A;  3NM2 A;  1UUW B;  1OPY A;  1GY6 A;  3B4P A;  3MSO A;  3KZT A;  4J8T A;  5AI1 A;  4L8P A;  1ZX2 A;  3K7C A; 
#chains in the Genus database with same CATH topology
 1TRP A;  4DKI A;  5CF2 A;  1KQS 2;  3DMC A;  5IG3 A;  6RNT A;  3OW2 2;  1S72 3;  3BND A;  3M8C A;  3T0U A;  1OGZ A;  1N9J A;  1HZ1 A;  2OWP A;  4HZ9 B;  3SVA A;  1VQN 3;  3LTC A;  1UUG B;  3LOY A;  3LT8 A;  3GWR A;  1FA3 A;  1BSD A;  1K73 4;  1W7C A;  3ALA A;  1O7M B;  2KF5 A;  2OQE C;  3D5G A;  1NB5 I;  1VQQ A;  1OHO A;  3HZP A;  3K7C A;  3O8Y A;  1AVL A;  5JPP A;  1BAO A;  2L1S A;  2YFJ B;  3JUO A;  1M1K 4;  3CCV 3;  2RCD A;  1MWT A;  2MF7 A;  4GL6 A;  1KC8 4;  5LC6 A;  6STD A;  3MWZ A;  3G71 3;  1FGM A;  1FGQ A;  1M1X B;  1B2U A;  1BUQ A;  2FXT A;  3CCR 3;  2F86 B;  1IVV A;  2F4Y A;  3Q2P A;  3T8U A;  2BMR B;  4BL3 A;  1RGG A;  4PEJ A;  4R80 A;  2XFS A;  3GZB A;  2HMM B;  1U8C B;  3OWU A;  4GSP A;  7RNT A;  1AQZ A;  1NJI 4;  1UGI A;  1JZD A;  3FCS B;  3LML A;  2QGU A;  3A5E A;  3GSP A;  4EYC A;  1RRH A;  5D82 A;  2HMK B;  1E97 A;  3NV0 B;  1BRH A;  4HM5 B;  2OOV C;  1I3I A;  4QWT A;  1UDI I;  5TGN A;  3K63 A;  1N8R 4;  1NWW A;  5HGR A;  1RN4 A;  3DH2 A;  3EHC A;  3MYT A;  4IT7 A;  2F99 A;  3UL6 A;  1C54 A;  5G2G A;  1VQO 3;  2KRT A;  2OTL 3;  3UJM A;  4NPB A;  5DRV A;  3HOH A;  1B20 A;  1EG9 B;  1Q40 B;  2C4B A;  2CFK A;  3DGO A;  5IG4 A;  1YJN 3;  1JKG B;  3HII A;  2BHM A;  2RGQ A;  4I4K A;  1OHP A;  1RN7 A;  3IMA B;  3JUN A;  1TUH A;  4O02 B;  5JBS A;  5AEW B;  3FZW A;  1D6Y A;  2W03 A;  3KSE D;  1ULI B;  2W0Q A;  1KWI A;  1TIJ A;  2XRX B;  1K41 A;  4KFF A;  4Q53 A;  3KN4 A;  5DRE A;  3CMA 3;  2E2U A;  1BRS A;  3X42 A;  1DVD A;  4XDV A;  3FGY A;  2CFD A;  5G1K A;  3AMO B;  3VF1 A;  3LYG A;  4HAA A;  1RGH A;  3WOF B;  1YGE A;  5IEN A;  5IG5 A;  3WA3 A;  3EE1 A;  4FCZ A;  3HK4 A;  5CK6 A;  3EN1 B;  1I8V A;  3OXA A;  1ZO2 A;  3BB9 A;  2XEP A;  4XBY A;  1TU5 A;  1YI2 3;  1CH0 A;  1RRL A;  1YVS A;  5A0O B;  3FSD A;  2IY2 A;  1RDS A;  1JV2 B;  1W5Z A;  2FNQ A;  2YX9 A;  1IDP A;  3IPT A;  1V58 A;  4XDW A;  3SYU A;  3WOD G;  5JPU A;  3F7S A;  3WR2 A;  1BOX A;  3L0R A;  1STF I;  1DMQ A;  3U1W A;  9RNT A;  1OHS A;  1O7P B;  1N5H A;  3DZL A;  4N6U A;  1JNQ A;  1GOY A;  2H0I A;  1KD1 4;  2OTJ 3;  1IT8 A;  3JVC A;  4JF8 A;  4NHF A;  4MEI A;  2RFR A;  1JBS A;  2CG0 A;  4K90 B;  4R1K A;  2CW9 A;  3EBT A;  3Q90 A;  3CPW 2;  1HU9 A;  2WGQ A;  3D9R A;  3DXO A;  2QEX 3;  1GMQ A;  2ZL8 A;  1I70 A;  2CG1 A;  3AHW A;  4HM3 B;  5ELJ A;  3ZG0 A;  2E2V A;  3N54 B;  1I3F A;  4RNY A;  1N9E A;  1Q81 4;  4CDL A;  4WFO A;  4K61 A;  1SIH A;  2F56 A;  3OX9 A;  1B27 A;  4HM1 B;  3FF0 A;  1OF5 A;  2HMJ B;  3PZW A;  1A67 A;  2Q07 A;  3STD A;  3F8X A;  5RNT A;  1W4N A;  3CCS 3;  4TX4 A;  4WP5 A;  3GZY B;  2CFG A;  3MG3 A;  3MKI A;  1V57 A;  1MGR A;  5IER A;  3HIG A;  2KAA A;  3CC2 3;  1EUI C;  1LOW A;  1B2M A;  4HJL B;  6GSP A;  1G0T A;  1IQX A;  3FF2 A;  3LXU X;  1G02 A;  1LVN A;  1JN5 B;  1FUT A;  1YJW 3;  1RNT A;  3OWY A;  1QAL A;  1Q7H A;  3CD6 3;  3QK9 A;  4FCM A;  5IG0 A;  4MMX B;  1ROA A;  2BU4 A;  4H3U A;  2XGN A;  3KKG A;  4CCV A;  1DE3 A;  4X2H A;  4LMI A;  1GMR A;  3ER7 A;  4XM4 A;  5FGO A;  3V99 A;  3SOY A;  3BNC A;  1RSN A;  2HMN B;  3G6E 3;  5FW5 A;  1WTH A;  2GU1 A;  2INX A;  2W2C A;  3GZX B;  3I0Y A;  4EV2 A;  2STD A;  3EF8 A;  4MJD A;  3RGR A;  1IK3 A;  2CFW A;  4HM2 B;  1W6C A;  1M90 4;  1O7H B;  1UCK A;  1U5O A;  3S28 A;  5AIF A;  3SOA A;  1GYB A;  2L4V A;  1MWR A;  1F8N A;  1T3B A;  4FR9 A;  2W56 A;  4X2O A;  2GBW B;  3FKA A;  2CX1 A;  1K28 A;  5CLK A;  3EJV A;  4FCJ A;  1VQM 3;  2WO0 A;  2P05 A;  1LNH A;  3DGN A;  2XSH B;  1BRI A;  3NUV A;  4XBX A;  1R4Y A;  1FW7 A;  1VQ7 3;  1N5P A;  2ML6 A;  4CJN A;  3EN8 A;  2XF3 A;  1UUV B;  1RLS A;  4RZM A;  4EW5 A;  1VQ9 3;  4BL2 A;  1VQ8 3;  1FZU A;  1W01 A;  3EX9 A;  3SED A;  1BIR A;  4EXR A;  2GXF A;  4FMC A;  1JBR A;  3AGN A;  4N6L A;  5GSP A;  3J7Y d;  4RBN A;  3CME 3;  1T2I A;  2H0G A;  1B21 A;  3LZA A;  3KSP A;  1ROV A;  3CNM A;  4FMB A;  2IYJ A;  5D83 A;  3KII A;  2XSO B;  2P0X A;  2GEX A;  1IQY A;  3Q3F A;  1Q9E A;  2A15 A;  2BT3 A;  1TP6 A;  3KCH A;  3BNB A;  1W6G A;  3GAX A;  4FMD A;  5AII A;  1GY7 A;  2OCT A;  1BSB A;  5AEU B;  3CCM 3;  1JZO A;  1W02 A;  1QVG 2;  4N6N B;  4AKY A;  1IU7 A;  1MOL A;  1BU4 A;  1QJG A;  3RGA A;  2B1X B;  3S27 A;  2Y74 A;  1SII A;  2H0H A;  2ZHX B;  2CWT A;  1VQ6 3;  3K9M C;  1W6Y A;  3GZR A;  1I2F A;  1NB3 I;  1A90 A;  1ZGX A;  3D5I A;  3F40 A;  1BSC A;  5AYR B;  2I9W A;  1B2X A;  1QMA A;  3F9S A;  1W2Z A;  4N6O B;  1FGR A;  3TDG A;  3CCE 3;  4MMZ B;  3CC4 3;  1CYV A;  1DMM A;  2B24 B;  2R41 A;  4FMA A;  1VQ4 3;  1PYL A;  1UCI A;  2XH9 A;  2YFI B;  1JB4 A;  3PS8 A;  2W6J H;  4XB5 A;  3X3X A;  1A2P A;  2WGO A;  1BSA A;  1T2H A;  1K8A 4;  3LTB A;  1IYY A;  4LEH A;  2LQV A;  5EEO A;  3F7X A;  3HI7 A;  4N3V A;  1NDO B;  4HM6 B;  2UX0 A;  1RGF A;  4WYK A;  3NBR A;  3LTA A;  3HX8 A;  5D81 A;  3CPO A;  3S67 A;  2FGT A;  4RNT A;  3F14 A;  1LNI A;  3MG2 A;  3X3Z A;  4K1U A;  1PU4 A;  3FH1 A;  1CQS A;  1EKM A;  1LOV A;  1YIT 3;  1SPU A;  3WA2 X;  1A2K A;  2BIR A;  1C7H A;  1FGO A;  3B4O A;  2CKF B;  2KF3 A;  3IJE B;  2UUG C;  5I97 A;  5M19 A;  2XFT A;  5HOH A;  1IT7 A;  1RGA A;  4O8S A;  5LC7 A;  3K5T A;  3RDE A;  1QVF 2;  1E3V A;  5KP4 A;  3SXX A;  4K1V A;  1BRJ A;  1RHL A;  3LH4 A;  4BU4 A;  2F5M A;  4I5Q A;  3G0K A;  1YNV X;  2F5W A;  3K0Z A;  4HM8 B;  1SAR A;  4ORL A;  1ISK A;  1MGW A;  1OCV A;  3UNL A;  4O3V A;  3B7C A;  5BIR A;  1Q82 4;  3V98 A;  3BU4 A;  2YFL B;  3D79 A;  4HVN A;  2MC8 A;  3FG1 A;  4KVH A;  1ASK A;  3H51 A;  1GD4 A;  3X40 A;  4IPB A;  3NBB A;  1N8Q A;  4GHO A;  1AV4 A;  1D6U A;  1BVI A;  1RGL A;  1OUN A;  1RGK A;  3NBJ A;  1STD A;  1R4C A;  1TTO A;  1GS3 A;  1RGE A;  1BNE A;  4H61 A;  1O7W B;  3CNX A;  3PXM A;  1LOX A;  4BTW A;  3GRD A;  3N8B A;  1US1 A;  1OH0 A;  1X1X A;  1OAC A;  1LOY A;  1RCL A;  1TJD A;  3SLU A;  1Q7Y 4;  2CK3 H;  2AAE A;  1QAK A;  2E2T A;  2W04 A;  4R9L A;  2V1L A;  2Y73 A;  3FLJ A;  4KFD A;  3WHO A;  2GBX B;  2HOH A;  3H3H A;  4G1M B;  3B8L A;  3NHX A;  1LRA A;  4AKZ A;  1G96 A;  1Q42 A;  1PY3 A;  1B2S A;  1QAF A;  1EA2 A;  1DVC A;  2CFL A;  1O7G B;  2R4I A;  4HOH A;  4BIR A;  3I56 3;  3CCJ 3;  4EBG A;  3PYJ A;  4HM0 B;  2KF6 A;  2CX0 A;  4KZ1 A;  3NQZ A;  2W9Q A;  3EQQ B;  1FUW A;  4LGQ A;  3ECF A;  5STD A;  1BGS A;  1Z1S A;  2LYX A;  5M18 A;  3JUM A;  1OF5 B;  4LZI A;  3T8N A;  1RNB A;  1BNI A;  1BNG A;  1DET A;  4JRF A;  4HYZ A;  1SJW A;  2K54 A;  3G8Z A;  4OVM A;  7GSP A;  1AY7 A;  1D6Z A;  1RGC A;  5EQL A;  2D1W A;  1X1W A;  3LTD A;  4BTX A;  3NV0 A;  1BSE A;  4HKV B;  3CCL 3;  1B2Z A;  3EBY A;  1DMN A;  1I2E A;  1WMO A;  2RBI A;  2BO9 B;  4HM4 B;  2BMQ B;  5G1L A;  1EEJ A;  3NX0 A;  2CC3 A;  2GEY A;  2SBL A;  3WDG B;  1DYU A;  1O7N B;  1KSI A;  1Q40 A;  1EQK A;  4LSO A;  3LT9 A;  3MPH A;  1JKG A;  1UW1 A;  1BNS A;  2Z6B A;  1GY5 A;  3URP A;  3EC9 A;  3BNE A;  1IQ8 A;  2D42 A;  1VQ5 3;  4EV5 A;  4ILF A;  1ZS7 A;  4WWU C;  3DM8 A;  1I0V A;  1OGX A;  4WHA A;  1RJO A;  1LQG C;  2BMO B;  2HML B;  2P0M A;  1S5A A;  1T5Y A;  1GOU A;  5EVH A;  4O2H A;  1SQW A;  5CXO A;  1YJ9 3;  1Y4K A;  3G4S 3;  3AMO A;  2RSX A;  5IEO A;  1WMP A;  2W56 B;  3SX1 A;  4OK0 A;  4MMY B;  1VQL 3;  1RMS A;  1V74 A;  1RCK A;  4R9K A;  4N6V 0;  3VSY A;  1MWU A;  1TFO A;  1HKX A;  3VGN A;  3N9H A;  3D3L A;  2IMJ A;  2W9P A;  2IUK A;  5IEP A;  4BTY A;  1X1U A;  4IIA A;  2Z77 A;  4KFE A;  4N6M A;  8RNT A;  5AIG A;  5IF6 A;  5AIH A;  3U97 A;  4CPK A;  1FUS A;  1UI7 A;  3ZFZ A;  3MHE A;  3DGM A;  2WOH A;  1CYU A;  2PZV A;  2K3D A;  1BRG A;  2C10 A;  4HBR A;  1RKY A;  2ZDJ A;  5KP1 A;  2CWU A;  5ELU A;  2Z7A A;  1M9G A;  2SAR A;  2QA4 3;  2P09 A;  3CC7 3;  1VQK 3;  2AAD A;  3DGL A;  1IVX A;  4STD A;  1E3R A;  1RN1 A;  2KCD A;  3CXC 2;  1LQM B;  1NU3 A;  2PNC A;  4RNZ A;  3X41 A;  3PGB A;  5BXQ A;  1A2V A;  2XR8 B;  3PCR A;  1YGW A;  1UCL A;  4ZM8 A;  4LYL B;  4EC6 A;  1YIJ 3;  3FG4 A;  1GMP A;  1GD3 A;  2IA7 A;  3AHS A;  3OV4 A;  3DUK A;  2XGL A;  3A76 A;  1IV9 A;  3CU3 A;  3NQY A;  3NM7 A;  1JRQ A;  4R4K A;  1IVW A;  2WOF A;  3BLZ A;  1JB2 A;  3Q1C A;  3KE7 A;  2O9U X;  1UCJ A;  4OUQ A;  1VQP 3;  3CCQ 3;  4J5K A;  3DGY A;  1X1Y A;  3QRD A;  1ULJ B;  1GOV A;  1WQL B;  5KP3 A;  3V92 A;  1JN5 A;  8CHO A;  1BNJ A;  5BVB A;  1TFK A;  1LXE A;  3UB1 A;  3OWS A;  1VZZ A;  2GSP A;  3F8H A;  1GSP A;  3FG3 A;  1RTU A;  2CHC A;  1CEW I;  2J8X B;  3WMD A;  5BU4 A;  3DY5 A;  1BNR A;  2JQ5 A;  1BRK A;  3D4A A;  4WYK B;  1BNF A;  1YHQ 3;  4L8O A;  3ROB A;  4AEQ A;  3NXJ A;  2HMO B;  2KF4 A;  4N6T A;  1Q86 4;  2F98 A;  2O3O A;  2KXG A;  3S5C A;  3S29 A;  4HZB B;  7STD A;  5AYS C;  3JUP A;  4L7K A;  1JB5 A;  4KT3 B;  2OQE A;  4GB5 A;  3ZG5 A;  1HYF A;  2RNT A;  4NRE A;  5IW9 A;  1W2B 2;  3JUQ A;  3EB8 A;  3MG1 A;  3UL5 A;  1BUJ A;  1FGT A;  2CWV A;  3RNT A;  2IUJ A;  3X3Y A;  4J9A A;  5CF1 A;  1I2G A;  2Z76 A;  3G16 A;  4J5G A;  3E99 A;  1NO3 A;  1TRQ A;  1FYS A;  4HM7 B;  4U13 A;  3CCU 3;  1W00 A;  2BNG A;  1J2B A;  1YVB I;  1JJ2 2;  3I55 3;  2GU3 A;  3PCS A;  1L5G B;  1I0X A;  1AR0 A;  2CIU A;  2QIY A;  4XBT A;  2CH9 A;  1PFP A;  1UI8 A;  3NM2 A;  1UUW B;  2ML5 A;  2OOV A;  1MWS A;  1OPY A;  1K9M 4;  1NNV A;  2K0M A;  3AGO A;  1WMN A;  2M7O A;  1MNL A;  2C11 A;  3BIR A;  1GY6 A;  1WNH A;  5M1A A;  1IVU A;  3B4P A;  1BRN L;  2UGI A;  1UGH I;  1IV7 A;  3WOE B;  3MSO A;  3KFQ C;  1BAN A;  3KZT A;  4J8T A;  2P38 A;  2ZA4 A;  1JBT A;  1AVK A;  1B3S A;  5AI1 A;  4L8P A;  1ZX2 A;  2JDI H; 
#chains in the Genus database with same CATH homology
 5CF2 A;  1KQS 2;  3DMC A;  5IG3 A;  1S72 3;  3OW2 2;  3BND A;  3M8C A;  3T0U A;  1OGZ A;  1N9J A;  2OWP A;  3SVA A;  4HZ9 B;  1VQN 3;  3LTC A;  3LOY A;  3LT8 A;  3GWR A;  1FA3 A;  1K73 4;  1W7C A;  3ALA A;  1O7M B;  2OQE C;  1NB5 I;  1OHO A;  3HZP A;  3K7C A;  3O8Y A;  1AVL A;  5JPP A;  3JUO A;  2YFJ B;  1M1K 4;  3CCV 3;  2RCD A;  4GL6 A;  2MF7 A;  1KC8 4;  5LC6 A;  6STD A;  3MWZ A;  3G71 3;  1FGM A;  1FGQ A;  1M1X B;  1BUQ A;  2FXT A;  3CCR 3;  2F86 B;  1IVV A;  3Q2P A;  3T8U A;  2BMR B;  4PEJ A;  4R80 A;  2XFS A;  3GZB A;  2HMM B;  1U8C B;  3OWU A;  1NJI 4;  3FCS B;  3LML A;  2QGU A;  4EYC A;  1RRH A;  5D82 A;  2HMK B;  1E97 A;  3NV0 B;  4HM5 B;  2OOV C;  5TGN A;  4QWT A;  1N8R 4;  3K63 A;  1NWW A;  5HGR A;  3EHC A;  4IT7 A;  3UL6 A;  3MYT A;  2F99 A;  5G2G A;  1VQO 3;  2KRT A;  2OTL 3;  3UJM A;  5DRV A;  3DGO A;  1EG9 B;  1Q40 B;  2CFK A;  1YJN 3;  5IG4 A;  1JKG B;  3HII A;  2BHM A;  2RGQ A;  4I4K A;  1OHP A;  1RN7 A;  3IMA B;  3JUN A;  1TUH A;  4O02 B;  5JBS A;  5AEW B;  3FZW A;  1D6Y A;  2W03 A;  3KSE D;  1ULI B;  2W0Q A;  1KWI A;  1TIJ A;  2XRX B;  1K41 A;  4KFF A;  4Q53 A;  3KN4 A;  5DRE A;  3CMA 3;  2E2U A;  1DVD A;  3X42 A;  4XDV A;  3FGY A;  2CFD A;  3VF1 A;  3AMO B;  3LYG A;  5IG5 A;  3WOF B;  1YGE A;  5IEN A;  3WA3 A;  3EE1 A;  4FCZ A;  3HK4 A;  5CK6 A;  3EN1 B;  3OXA A;  4XBY A;  1ZO2 A;  3BB9 A;  2XEP A;  1TU5 A;  1YI2 3;  1RRL A;  5A0O B;  3FSD A;  1JV2 B;  1W5Z A;  2FNQ A;  2YX9 A;  1IDP A;  3IPT A;  4XDW A;  3WOD G;  5JPU A;  3F7S A;  3L0R A;  1STF I;  1DMQ A;  3U1W A;  1OHS A;  1O7P B;  1N5H A;  3DZL A;  4N6U A;  1JNQ A;  1KD1 4;  2OTJ 3;  1IT8 A;  3JVC A;  4JF8 A;  4NHF A;  4MEI A;  2RFR A;  2CG0 A;  4K90 B;  4R1K A;  2CW9 A;  3EBT A;  3Q90 A;  3CPW 2;  2WGQ A;  1HU9 A;  3D9R A;  3DXO A;  2QEX 3;  2ZL8 A;  2CG1 A;  4HM3 B;  5ELJ A;  2E2V A;  3N54 B;  4RNY A;  1N9E A;  1Q81 4;  4CDL A;  4WFO A;  4K61 A;  1SIH A;  3OX9 A;  4HM1 B;  3FF0 A;  1OF5 A;  2HMJ B;  3PZW A;  1A67 A;  2Q07 A;  3STD A;  3F8X A;  1W4N A;  3CCS 3;  4TX4 A;  4WP5 A;  3GZY B;  2CFG A;  3MG3 A;  3MKI A;  5IER A;  3HIG A;  3CC2 3;  4HJL B;  1IQX A;  3FF2 A;  3LXU X;  1LVN A;  1JN5 B;  1YJW 3;  3OWY A;  1QAL A;  3CD6 3;  3QK9 A;  4FCM A;  5IG0 A;  4MMX B;  1ROA A;  4H3U A;  2XGN A;  3KKG A;  4CCV A;  4X2H A;  4LMI A;  5FGO A;  3ER7 A;  4XM4 A;  3V99 A;  3SOY A;  3BNC A;  2HMN B;  3G6E 3;  5FW5 A;  1WTH A;  2GU1 A;  2INX A;  2W2C A;  3GZX B;  3I0Y A;  4EV2 A;  2STD A;  3EF8 A;  4MJD A;  3RGR A;  1IK3 A;  2CFW A;  4HM2 B;  1W6C A;  1M90 4;  1O7H B;  1U5O A;  3S28 A;  5AIF A;  3SOA A;  1GYB A;  2L4V A;  1F8N A;  4FR9 A;  2W56 A;  4X2O A;  2GBW B;  3FKA A;  1K28 A;  5CLK A;  3EJV A;  4FCJ A;  1VQM 3;  2WO0 A;  2P05 A;  1LNH A;  3DGN A;  2XSH B;  3NUV A;  4XBX A;  1VQ7 3;  1N5P A;  2ML6 A;  3EN8 A;  2XF3 A;  1UUV B;  4RZM A;  1VQ9 3;  1VQ8 3;  3EX9 A;  1W01 A;  3SED A;  4EXR A;  2GXF A;  4FMC A;  3J7Y d;  4N6L A;  4RBN A;  3CME 3;  3LZA A;  3KSP A;  1ROV A;  3CNM A;  4FMB A;  5D83 A;  3KII A;  2XSO B;  2P0X A;  2GEX A;  1IQY A;  2A15 A;  2BT3 A;  1TP6 A;  3BNB A;  1W6G A;  3GAX A;  4FMD A;  5AII A;  1GY7 A;  2OCT A;  5AEU B;  3CCM 3;  1W02 A;  1QVG 2;  4N6N B;  4AKY A;  1IU7 A;  1MOL A;  1QJG A;  3RGA A;  2B1X B;  3S27 A;  2Y74 A;  1SII A;  2CWT A;  1VQ6 3;  3K9M C;  1W6Y A;  3GZR A;  1NB3 I;  1A90 A;  3F40 A;  5AYR B;  2I9W A;  1QMA A;  3F9S A;  1W2Z A;  4N6O B;  1FGR A;  3TDG A;  3CCE 3;  4MMZ B;  3CC4 3;  1CYV A;  1DMM A;  2B24 B;  4FMA A;  1VQ4 3;  2XH9 A;  2YFI B;  1JB4 A;  3PS8 A;  2W6J H;  4XB5 A;  3X3X A;  2WGO A;  1K8A 4;  3LTB A;  4LEH A;  2LQV A;  5EEO A;  3F7X A;  3HI7 A;  4N3V A;  1NDO B;  4HM6 B;  2UX0 A;  4WYK A;  3NBR A;  3LTA A;  3HX8 A;  5D81 A;  3CPO A;  3S67 A;  2FGT A;  3F14 A;  3MG2 A;  3X3Z A;  4K1U A;  1PU4 A;  3FH1 A;  1CQS A;  1EKM A;  1YIT 3;  1SPU A;  3WA2 X;  1A2K A;  3IJE B;  1C7H A;  1FGO A;  3B4O A;  2CKF B;  5I97 A;  2XFT A;  1IT7 A;  4O8S A;  5LC7 A;  3K5T A;  3RDE A;  1QVF 2;  1E3V A;  5KP4 A;  3SXX A;  4K1V A;  3LH4 A;  3G0K A;  3K0Z A;  4HM8 B;  4ORL A;  1ISK A;  1OCV A;  3UNL A;  4O3V A;  3B7C A;  1Q82 4;  3V98 A;  2YFL B;  4HVN A;  2MC8 A;  3FG1 A;  4KVH A;  1ASK A;  3H51 A;  1GD4 A;  3X40 A;  4IPB A;  3NBB A;  1N8Q A;  1AV4 A;  1D6U A;  1OUN A;  3NBJ A;  1STD A;  1R4C A;  1GS3 A;  4H61 A;  1O7W B;  3CNX A;  3PXM A;  1LOX A;  4BTW A;  3GRD A;  3N8B A;  1US1 A;  1OH0 A;  3SLU A;  1OAC A;  1Q7Y 4;  2CK3 H;  2E2T A;  1QAK A;  2W04 A;  4R9L A;  2V1L A;  2Y73 A;  3FLJ A;  4KFD A;  2GBX B;  3H3H A;  4G1M B;  3B8L A;  3NHX A;  4AKZ A;  1G96 A;  1Q42 A;  1QAF A;  1EA2 A;  1DVC A;  2CFL A;  1O7G B;  2R4I A;  3CCJ 3;  3I56 3;  4EBG A;  3PYJ A;  4HM0 B;  4KZ1 A;  3NQZ A;  2W9Q A;  3EQQ B;  1FUW A;  4LGQ A;  3ECF A;  5STD A;  1Z1S A;  2LYX A;  3JUM A;  1OF5 B;  4LZI A;  3T8N A;  4JRF A;  4HYZ A;  1SJW A;  2K54 A;  3G8Z A;  4OVM A;  1D6Z A;  5EQL A;  2D1W A;  3LTD A;  4BTX A;  3NV0 A;  4HKV B;  3CCL 3;  3EBY A;  1DMN A;  1WMO A;  2BO9 B;  4HM4 B;  2BMQ B;  3NX0 A;  2CC3 A;  2GEY A;  2SBL A;  3WDG B;  1DYU A;  1O7N B;  1KSI A;  1Q40 A;  1EQK A;  4LSO A;  3LT9 A;  3MPH A;  1JKG A;  1UW1 A;  2Z6B A;  1GY5 A;  3EC9 A;  3BNE A;  1IQ8 A;  2D42 A;  1VQ5 3;  4EV5 A;  4WWU C;  3DM8 A;  4WHA A;  1OGX A;  1RJO A;  2BMO B;  2HML B;  2P0M A;  1S5A A;  1T5Y A;  5EVH A;  4O2H A;  1SQW A;  5CXO A;  1YJ9 3;  1Y4K A;  3G4S 3;  3AMO A;  2RSX A;  5IEO A;  1WMP A;  2W56 B;  3SX1 A;  4OK0 A;  4MMY B;  1VQL 3;  4R9K A;  1V74 A;  3VSY A;  4N6V 0;  1TFO A;  1HKX A;  3VGN A;  3N9H A;  3D3L A;  2IMJ A;  2W9P A;  2IUK A;  5IEP A;  4BTY A;  4IIA A;  2Z77 A;  4KFE A;  4N6M A;  5AIG A;  5IF6 A;  5AIH A;  3U97 A;  1UI7 A;  3MHE A;  3DGM A;  2WOH A;  1CYU A;  2PZV A;  2C10 A;  1RKY A;  4HBR A;  2ZDJ A;  5KP1 A;  2CWU A;  5ELU A;  2Z7A A;  1M9G A;  2QA4 3;  2P09 A;  3CC7 3;  1VQK 3;  3DGL A;  1IVX A;  4STD A;  1E3R A;  3CXC 2;  2KCD A;  1NU3 A;  2PNC A;  4RNZ A;  3X41 A;  3PGB A;  5BXQ A;  1A2V A;  2XR8 B;  3PCR A;  4ZM8 A;  4EC6 A;  1YIJ 3;  3FG4 A;  1GD3 A;  2IA7 A;  3OV4 A;  3DUK A;  2XGL A;  3A76 A;  1IV9 A;  3CU3 A;  3NQY A;  3NM7 A;  1JRQ A;  4R4K A;  1IVW A;  2WOF A;  3BLZ A;  1JB2 A;  3Q1C A;  3KE7 A;  2O9U X;  4OUQ A;  1VQP 3;  3CCQ 3;  3QRD A;  1ULJ B;  1WQL B;  3V92 A;  5KP3 A;  8CHO A;  1JN5 A;  5BVB A;  1TFK A;  1LXE A;  3UB1 A;  3OWS A;  1VZZ A;  3F8H A;  3FG3 A;  2CHC A;  3WMD A;  1CEW I;  3DY5 A;  2JQ5 A;  4WYK B;  1YHQ 3;  4L8O A;  3ROB A;  4AEQ A;  3NXJ A;  2HMO B;  4N6T A;  1Q86 4;  2F98 A;  2O3O A;  2KXG A;  3S5C A;  3S29 A;  4HZB B;  7STD A;  5AYS C;  3JUP A;  4L7K A;  1JB5 A;  2OQE A;  4GB5 A;  4NRE A;  5IW9 A;  1W2B 2;  3JUQ A;  3EB8 A;  3MG1 A;  3UL5 A;  1FGT A;  2CWV A;  2IUJ A;  3X3Y A;  4J9A A;  5CF1 A;  2Z76 A;  3G16 A;  3E99 A;  1NO3 A;  4HM7 B;  4U13 A;  3CCU 3;  1J2B A;  1W00 A;  2BNG A;  1YVB I;  1JJ2 2;  3I55 3;  2GU3 A;  3PCS A;  1L5G B;  1AR0 A;  2CIU A;  2QIY A;  4XBT A;  2CH9 A;  1PFP A;  1UI8 A;  3NM2 A;  1UUW B;  2ML5 A;  2OOV A;  1OPY A;  1K9M 4;  2K0M A;  1WMN A;  2M7O A;  1MNL A;  2C11 A;  1GY6 A;  1WNH A;  1IVU A;  3B4P A;  1IV7 A;  3WOE B;  3MSO A;  3KFQ C;  3KZT A;  4J8T A;  2P38 A;  1AVK A;  5AI1 A;  4L8P A;  1ZX2 A;  2JDI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...