1Q40B

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
186
Chain Sequence
SRNLATNFIANYLKLWDANRSELMILYQNESQFSMQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARMAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEVDGSASRYHSGPKHKRIPLSKKSFDRTFVVIPGSMIVASDTLLIRPYTSDFPWKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 42
structure length 186
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40B00
3CPOA 1ZX2A 4XDWA 1C7HA 1O7HB 3NBRA 4WP5A 5JPUA 2HMKB 1CQSA 4R9LA 5CLKA 2W2CA 1Z1SA 1JB2A 4LMIA 2RGQA 3EC9A 3B4PA 1OGZA 1TUHA 3NHXA 3A76A 1UUWB 3GRDA 3WMDA 5HGRA 3KZTA 1OPYA 3EF8A 3OX9A 5BXQA 3DXOA 2QGUA 1DMMA 3HK4A 3EHCA 5AIHA 2BMQB 1UUVB 1K41A 4STDA 3F9SA 4L8PA 3KSPA 4HKVB 3JUNA 4HZBB 3H3HA 3KE7A 3EBTA 2B1XB 1Q42A 5STDA 4LEHA 2R4IA 4HM2B 1E3RA 5CF2A 1HKXA 1BUQA 1EA2A 5AEWB 3OV4A 3MG2A 3K0ZA 3UNLA 3MG1A 3RGRA 3DUKA 4HM5B 3OWUA 2HMLB 1U5OA 3EX9A 4OUQA 3F8XA 3CNXA 2RFRA 4X2OA 3S5CA 1DMQA 1O7PB 2GEYA 5KP3A 1OCVA 5IERA 3CNMA 3SEDA 4ORLA 2BMOB 2XSOB 3F14A 3FGYA 4KVHA 2GBXB 3OXAA 2F98A 2Z76A 2HMNB 3EJVA 4HM1B 1O7WB 4XDVA 2XSHB 2GXFA 3HX8A 3KKGA 2HMMB 3BLZA 1DMNA 2BNGA 1OH0A 4HM7B 4K1UA 6STDA 2CKFB 4J8TA 2INXA 5CXOA 3FF0A 7STDA 4IIAA 3SOAA 3VSYA 3SOYA 4FCJA 1OF5A 2RCDA 3I0YA 4XM4A 1JKGA 1OF5B 1IDPA 1AR0A 3F40A 4FCMA 1SJWA 1JKGB 5AIFA 2HMOB 5D83A 5D81A 3JUMA 3ROBA 2PZVA 5IG4A 3B4OA 5DREA 3EBYA 1ASKA 4L7KA 4WWUC 1WQLB 5JPPA 3HZPA 3ECFA 3DM8A 4HM8B 1Q40A 4PEJA 2B24B 1NU3A 3FSDA 1Q40B 1GY5A 3IPTA 1JN5A 1W6YA 3JUPA 5CF1A 3GZBA 2JQ5A 3F7SA 2HMJB 3F7XA 4LGQA 3FH1A 3NV0A 3LYGA 1STDA 3F8HA 3NV0B 5AEUB 5EVHA 8CHOA 1EG9B 3MYTA 4CDLA 3T8NA 5IG3A 2F99A 3NM2A 3B7CA 1GY7A 3T8UA 1O7NB 3GZYB 3OWSA 3FF2A 1NWWA 3NUVA 4XB5A 1JB5A 2IMJA 2I9WA 5IENA 1E97A 2GEXA 3MKIA 3STDA 3LZAA 5IEPA 1GY6A 3EQQB 3GZXB 4H3UA 5G2GA 3EN8A 1W02A 5TGNA 2XRXB 1OHOA 3G8ZA 3FLJA 3VGNA 4MJDA 5BVBA 1OUNA 4HVNA 1QMAA 3JUOA 4XBTA 3MSOA 3B8LA 2F86B 3M8CA 3JUQA 2GBWB 3RGAA 4WYKA 5KP1A 4XBYA 4L8OA 2STDA 3H51A 4WYKB 3G16A 1ZO2A 1OHSA 4R9KA 4OVMA 1ULIB 2K54A 1ISKA 3K7CA 3CU3A 5IG5A 2Z77A 1A2KA 2YFLB 3FKAA 3FZWA 2YFIB 4N3VA 1NDOB 3NXJA 4HZ9B 1O7MB 4R1KA 2QIYA 3GZRA 1JN5B 5IG0A 3DZLA 1OGXA 4I4KA 3EN1B 3OWYA 2Z7AA 5CK6A 3MG3A 3D9RA 2OWPA 3MHEA 5DRVA 1JB4A 3UJMA 3G0KA 3GWRA 4U13A 3DMCA 1QJGA 5FW5A 4HM6B 4GB5A 4HM4B 5KP4A 4HM3B 2XR8B 1S5AA 2UX0A 4HJLB 5AIIA 5IF6A 4RZMA 5AI1A 4J9AA 1E3VA 4XBXA 3BB9A 1OHPA 1W00A 4X2HA 5IEOA 2CHCA 5AIGA 1ULJB 1GYBA 2A15A 2BMRB 3Q90A 4HM0B 1TP6A 1VZZA 2YFJB 1W01A 4Q53A 5D82A 3E99A 3ER7A 1O7GB 1GS3A 4K1VA
chains in the Genus database with same CATH superfamily
1STFI 1BSDA 3CPOA 9RNTA 1AVLA 2M7OA 2XFTA 1ZX2A 4XDWA 1DVDA 1IK3A 1Q824 8RNTA 1VQ83 1C7HA 1LOYA 1O7HB 3CCV3 1RGAA 3BNBA 4N6MA 3AGNA 3D4AA 3G6E3 3NBRA 1I2GA 2V1LA 4WP5A 4CPKA 1LVNA 5JPUA 2HMKB 1CQSA 2IYJA 4R9LA 5CLKA 3LT8A 3LTDA 2W2CA 1SQWA 1Z1SA 1JB2A 3FG4A 1GMRA 2RGQA 3EC9A 4LMIA 1LNHA 1N5HA 2Y74A 3SX1A 3B4PA 1OGZA 1K28A 1GMPA 1BNGA 1I2EA 1TRQA 1TUHA 3D3LA 3IMAB 3QRDA 4HOHA 4AKZA 4RBNA 3NHXA 4EYCA 2F5MA 1DE3A 3A76A 1UUWB 3GRDA 2ZA4A 4I5QA 2GU1A 2XGNA 3WMDA 5HGRA 3BU4A 3KZTA 1VQ53 1OPYA 3EF8A 3OX9A 3ALAA 5BXQA 3DXOA 2QGUA 1DMMA 3OW22 4GSPA 1UCKA 1IT7A 3K5TA 1JV2B 3HK4A 1WNHA 3EHCA 1JBSA 1OACA 5AIHA 2BMQB 1UUVB 4G1MB 1QAKA 1K41A 1FA3A 4STDA 3F9SA 4L8PA 3KSPA 4BU4A 4KFFA 1A2VA 2CWTA 1M9GA 1G02A 4HKVB 2KRTA 3JUNA 4HZBB 4J5KA 2XGLA 3CCS3 2KF3A 1BRGA 3H3HA 3KE7A 3EBTA 3LTAA 2B1XB 1Q42A 3NBBA 3JVCA 2OQEA 5STDA 5HOHA 4LEHA 3CPW2 2R4IA 3LT9A 1J2BA 2CFDA 1R4CA 2WOFA 1RNTA 1E3RA 1V58A 3MPHA 4HM2B 5CF2A 1HKXA 1X1WA 1VQK3 4WHAA 1BUQA 1FYSA 1EA2A 1LQGC 5FGOA 3WR2A 1GD3A 1B2SA 5AEWB 3OV4A 1VQO3 1JNQA 3MG2A 3K0ZA 3TDGA 3UNLA 1MNLA 3MG1A 3CD63 1JZOA 3RGRA 3DUKA 1ZGXA 3PCRA 4HM5B 2K3DA 3OWUA 1RGHA 1U5OA 2HMLB 3EX9A 5M19A 1WMPA 1IQ8A 3PZWA 2SARA 4OUQA 3F8XA 3CNXA 1I0VA 1SIIA 5M1AA 4KZ1A 1AVKA 3CCM3 3EE1A 4QWTA 1BSAA 1I3IA 2RFRA 4FMAA 4EV2A 1ZS7A 4X2OA 4HAAA 3S5CA 1DMQA 2W9QA 4N6LA 4CCVA 1O7PB 1D6YA 3CCR3 4MMYB 2GEYA 4KFEA 1B3SA 1Y4KA 4OK0A 2CFKA 5KP3A 2CG0A 1OCVA 5IERA 2OOVA 3CNMA 3SEDA 3SVAA 1Q814 2CIUA 4ORLA 1K9M4 2CX1A 3URPA 1VQL3 1IVUA 2BMOB 2XSOB 2RNTA 3F14A 2Q07A 2CG1A 3FGYA 4KVHA 3I553 5BU4A 1HYFA 2GBXB 3N54B 3OXAA 5AYSC 1BRSA 2F98A 5AYRB 1BRIA 2UGIA 2Z76A 2HMNB 3EJVA 7GSPA 2XEPA 2L4VA 4HM1B 4BL2A 1RHLA 3NBJA 2AADA 4TX4A 2F56A 2OTL3 1T2IA 1UI7A 4BTYA 1PY3A 1AY7A 1O7WB 1BUJA 2P05A 1GMQA 4N6NB 1AV4A 2MF7A 2W03A 3V99A 3ZG0A 1R4YA 1LXEA 3LTCA 4XDVA 1I2FA 3AGOA 3D5IA 2BU4A 4JRFA 2XSHB 2C11A 3X40A 1IVWA 2BHMA 2GXFA 4O3VA 1Q864 3HX8A 4K90B 1AQZA 4RNYA 3U1WA 1BSCA 3KKGA 2HMMB 1BRJA 2WGQA 2BO9B 3BLZA 3WA2X 1Q7HA 1DMNA 2BNGA 3NX0A 1OH0A 1B27A 4IPBA 4HM7B 1TFKA 1LQMB 5RNTA 2AAEA 5G1LA 1IVXA 2E2TA 1BNJA 1TRPA 1BGSA 2CH9A 4K1UA 3UL6A 4BTXA 6STDA 4EW5A 2CKFB 1M1K4 4J8TA 2INXA 1LOWA 1B20A 2BT3A 2KAAA 5CXOA 1LOVA 3FF0A 7STDA 4IIAA 5GSPA 3I563 3SYUA 2WOHA 2K0MA 2O3OA 1TJDA 1A2PA 1UCIA 1RJOA 3HOHA 3RNTA 3SOAA 1YJ93 1JRQA 4LZIA 3VSYA 3WOFB 4ZM8A 1RGFA 3DY5A 3V92A 3SOYA 4FCJA 2IY2A 1RN7A 2WGOA 2ZHXB 1RN1A 1OF5A 4GHOA 3CCE3 2RCDA 2XFSA 3I0YA 4XM4A 1TTOA 1RGLA 2H0IA 1JKGA 1OF5B 1IDPA 2IUJA 1AR0A 3D5GA 1EKMA 1IVVA 2KCDA 3F40A 1NB3I 4FCMA 1SJWA 2ZL8A 3L0RA 1JKGB 1BNEA 1JZDA 3KCHA 1TU5A 2R41A 5AIFA 1BNFA 2HMOB 5D83A 4DKIA 1VQ93 5D81A 1FGOA 3JUMA 3BNEA 2XH9A 2ML5A 3ROBA 2IUKA 2PZVA 5IG4A 3B4OA 3VF1A 5DREA 1W4NA 1QVG2 3BNCA 3WA3A 3J7Yd 3EBYA 1BANA 1PYLA 4N6UA 3GAXA 2P0MA 3KN4A 4NPBA 1ASKA 1YI23 5EEOA 1VQQA 3FG1A 1QALA 2CX0A 4L7KA 1W7CA 1YJN3 2E2VA 3AHWA 1N5PA 4GL6A 3U97A 4KT3B 2IA7A 4WWUC 1FGMA 1WQLB 5JPPA 4WFOA 4NREA 3HZPA 1TIJA 3A5EA 3ECFA 3X3YA 1BRHA 1BSBA 3DM8A 3K9MC 1SPUA 4HM8B 2CW9A 2L1SA 1Q40A 4PEJA 2B24B 1B2ZA 3CCJ3 4NHFA 1NU3A 3FSDA 1W5ZA 1Q40B 1RKYA 1RCKA 1GY5A 1UW1A 2OTJ3 1A67A 1YGEA 1W2B2 1YHQ3 1UI8A 3IPTA 1KD14 1GSPA 1VQN3 4BL3A 1B2UA 1YNVX 1JN5A 1W6YA 1YVBI 3JUPA 5CF1A 1D6UA 4N6TA 3GZBA 1NNVA 1VQM3 2JQ5A 2C4BA 2O9UX 2W56A 1Q7Y4 1SIHA 3HI7A 3F7SA 4FMCA 2YX9A 3PS8A 2HMJB 1D6ZA 3PCSA 3F7XA 4LGQA 3FH1A 3NV0A 4J5GA 4MMXB 3LYGA 1STDA 3F8HA 1RRHA 3NV0B 2D42A 1ROVA 5LC7A 5BIRA 1FUWA 2E2UA 3LOYA 5AEUB 1K734 2CFWA 3Q1CA 1RGCA 4FR9A 3WHOA 1CYVA 2P09A 1W2ZA 5EVHA 1RRLA 1T2HA 2OQEC 1IQYA 8CHOA 1UDII 1EG9B 1M904 1KWIA 2Z6BA 3MYTA 1NB5I 1B21A 4CDLA 3T8NA 5IG3A 2F99A 3NM2A 4MEIA 2GU3A 3B7CA 4RNTA 1RNBA 4EC6A 2QA43 3CC73 1GY7A 3T8UA 1O7NB 1WTHA 3GZYB 3CCU3 2LQVA 3V98A 3DGYA 1WMOA 2ZDJA 1QVF2 1RMSA 1V74A 3FF2A 3K63A 1NWWA 3OWSA 6GSPA 1JBTA 1UGHI 4O02B 3NUVA 1N9EA 1B2MA 1IQXA 1NO3A 1QAFA 4K61A 2QEX3 2H0HA 2FGTA 4XB5A 1YJW3 1JB5A 1HU9A 1N9JA 4LSOA 5JBSA 2IMJA 2I9WA 1MGRA 5IENA 1E97A 3CCQ3 1FUTA 2MC8A 3S28A 1UCJA 1UUGB 2GEXA 2W6JH 3X3ZA 3EB8A 1N8QA 3MKIA 1V57A 1L5GB 3G4S3 1G96A 1I8VA 3DGMA 3X42A 3NQYA 1U8CB 1FGQA 1LOXA 1RGKA 3S27A 4EXRA 3STDA 3LZAA 1KSIA 3WDGB 4AKYA 1FW7A 3IJEB 5IEPA 1KQS2 1GY6A 2OOVC 2W9PA 3EQQB 2PNCA 2Y73A 4LYLB 3GZXB 3ZFZA 4H3UA 1CH0A 5G2GA 1RN4A 3EN8A 4JF8A 1W02A 3DGNA 3PXMA 4BIRA 2RSXA 2XRXB 5TGNA 1BNRA 1OHOA 3G8ZA 1GOVA 1T5YA 3FLJA 1MWSA 2FNQA 2J8XB 1BIRA 4MJDA 5LC6A 3NM7A 3VGNA 4CJNA 1VQP3 5BVBA 2F4YA 2XF3A 1OUNA 3AMOA 1GD4A 1T3BA 2CC3A 4HVNA 1QMAA 1RTUA 1X1UA 2HOHA 1PFPA 3AMOB 1B2XA 3JUOA 4XBTA 5ELUA 1MWTA 3AHSA 1BNSA 3MSOA 1I0XA 1F8NA 1BVIA 3B8LA 1IYYA 2F86B 3M8CA 3SLUA 1DETA 3JUQA 3T0UA 4RNZA 2GBWB 3UL5A 3CME3 3RGAA 1X1YA 3KIIA 4WYKA 5KP1A 3Q2PA 3LH4A 4XBYA 4L8OA 1JBRA 4IT7A 2ML6A 1DVCA 1KC84 1N8R4 5IW9A 2STDA 3H51A 4WYKB 3G16A 1ZO2A 1A90A 2OCTA 2JDIH 3GSPA 7RNTA 2CFLA 1M1XB 1OHSA 5A0OB 1W6CA 4R9KA 1BOXA 1SARA 1ULIB 4OVMA 1X1XA 1RGEA 1LRAA 2BIRA 1FUSA 2FXTA 2K54A 1FGTA 3K7CA 3PYJA 1ISKA 1DYUA 1RCLA 3CU3A 4EBGA 1K8A4 2CWVA 3HIIA 3PGBA 3S29A 2W04A 5I97A 4O2HA 2CWUA 3CMA3 3X3XA 4AEQA 5IG5A 2C10A 2Z77A 3LTBA 1A2KA 1RGGA 3ZG5A 1IU7A 2YFLB 2UUGC 3WOEB 1NJI4 5ELJA 2KF4A 3FKAA 3QK9A 3Q3FA 6RNTA 2D1WA 5EQLA 3FZWA 1BSEA 2KXGA 2YFIB 1YIJ3 1MWUA 4HYZA 4N3VA 1BNIA 3KFQC 1WMNA 2KF5A 1NDOB 1CYUA 3NXJA 2GSPA 4KFDA 4HZ9B 1O7MB 1IT8A 2QIYA 3GZRA 3HIGA 1JN5B 4R1KA 5IG0A 1G0TA 2CK3H 3D79A 3DZLA 1OGXA 3LMLA 3NQZA 3EN1B 4I4KA 3CC23 3CCL3 5M18A 1VQ63 1EQKA 3CC43 2W56B 3DGOA 3OWYA 4H61A 4FMDA 3BNDA 4FMBA 3SXXA 2Z7AA 3CXC2 1IV7A 5CK6A 1CEWI 1MWRA 2F5WA 3MG3A 1EEJA 3D9RA 2OWPA 1EUIC 1YVSA 3MHEA 3LXUX 3S67A 5DRVA 1RDSA 1FGRA 1FZUA 1JB4A 4N6OB 3UJMA 1LNIA 1YIT3 3G0KA 3GWRA 4MMZB 1GOYA 2SBLA 1Q9EA 1I70A 1RLSA 4HBRA 4U13A 4BTWA 3G713 1VQ73 3DMCA 4O8SA 4ILFA 1C54A 1YGWA 2W0QA 1QJGA 5FW5A 4HM6B 2H0GA 1UCLA 3BIRA 4GB5A 4HM4B 5KP4A 3WODG 1US1A 3N9HA 1BU4A 4HM3B 2XR8B 1UGIA 1S5AA 2P38A 1HZ1A 3N8BA 2P0XA 1I3FA 2UX0A 3FG3A 4FCZA 4HJLB 5AIIA 2WO0A 5IF6A 4RZMA 5AI1A 3DH2A 4EV5A 1W6GA 3KSED 1JJ22 3RDEA 2LYXA 4J9AA 1E3VA 4XBXA 3X41A 3BB9A 4R80A 1BRNL 1OHPA 1IV9A 1W00A 3O8YA 1MGWA 1TFOA 4N6V0 4X2HA 5IEOA 1RSNA 2CHCA 5AIGA 1ULJB 1GYBA 1GOUA 4R4KA 2A15A 1VQ43 2BMRB 1BAOA 2KF6A 3DGLA 3Q90A 4HM0B 1TP6A 1VZZA 2YFJB 1W01A 1MOLA 2CFGA 4Q53A 1PU4A 5D82A 3MWZA 3E99A 3ER7A 3FCSB 2RBIA 1S723 1O7GB 1BRKA 1GS3A 1ROAA 3UB1A 4K1VA 5G1KA
chains in the Genus database with same CATH topology
1STFI 3CPOA 1AVLA 2M7OA 2XFTA 1ZX2A 4XDWA 1DVDA 1IK3A 1Q824 1VQ83 1C7HA 3CCV3 1O7HB 3BNBA 4N6MA 3G6E3 3NBRA 2V1LA 4WP5A 1LVNA 5JPUA 2HMKB 1CQSA 4R9LA 5CLKA 3LT8A 3LTDA 2W2CA 1SQWA 1Z1SA 1JB2A 3FG4A 4LMIA 2RGQA 3EC9A 1LNHA 1N5HA 2Y74A 3SX1A 3B4PA 1OGZA 1K28A 1TUHA 3D3LA 3IMAB 3QRDA 4AKZA 4EYCA 4RBNA 3NHXA 3A76A 1UUWB 3GRDA 3WMDA 2GU1A 2XGNA 5HGRA 3KZTA 1VQ53 1OPYA 3EF8A 3OX9A 3ALAA 5BXQA 3DXOA 2QGUA 1DMMA 3OW22 1IT7A 3K5TA 1JV2B 3HK4A 1WNHA 3EHCA 1OACA 5AIHA 2BMQB 1UUVB 4G1MB 1QAKA 1K41A 1FA3A 4STDA 3F9SA 4L8PA 3KSPA 4KFFA 1A2VA 2CWTA 1M9GA 4HKVB 2KRTA 3JUNA 4HZBB 2XGLA 3CCS3 3H3HA 3KE7A 3EBTA 3LTAA 2B1XB 1Q42A 3NBBA 3JVCA 2OQEA 5STDA 4LEHA 3CPW2 2R4IA 3LT9A 1J2BA 2CFDA 1R4CA 2WOFA 3MPHA 1E3RA 4HM2B 5CF2A 1HKXA 1VQK3 1BUQA 4WHAA 1EA2A 5AEWB 5FGOA 1VQO3 1GD3A 3OV4A 1JNQA 3MG2A 3K0ZA 3TDGA 3UNLA 1MNLA 3MG1A 3CD63 3RGRA 3DUKA 3PCRA 4HM5B 3OWUA 2HMLB 1U5OA 3EX9A 1WMPA 1IQ8A 3PZWA 4OUQA 3F8XA 3CNXA 1SIIA 4KZ1A 1AVKA 3CCM3 3EE1A 4QWTA 2RFRA 4EV2A 4FMAA 4X2OA 3S5CA 1DMQA 2W9QA 4N6LA 4CCVA 1O7PB 1D6YA 3CCR3 4MMYB 2GEYA 4KFEA 1Y4KA 4OK0A 2CFKA 5KP3A 2CG0A 1OCVA 5IERA 2OOVA 3CNMA 3SEDA 3SVAA 1Q814 2CIUA 4ORLA 1VQL3 1IVUA 2BMOB 2XSOB 3F14A 2Q07A 2CG1A 3FGYA 4KVHA 3I553 2GBXB 3N54B 3OXAA 5AYSC 2F98A 5AYRB 2Z76A 2HMNB 3EJVA 2XEPA 2L4VA 4HM1B 3NBJA 4TX4A 2OTL3 1UI7A 4BTYA 1O7WB 2P05A 4N6NB 1AV4A 2MF7A 2W03A 3V99A 1LXEA 3LTCA 4XDVA 4JRFA 2XSHB 2C11A 3X40A 1IVWA 2BHMA 2GXFA 4O3VA 1Q864 3HX8A 4K90B 4RNYA 3U1WA 3KKGA 2HMMB 2WGQA 2BO9B 3BLZA 3WA2X 1DMNA 2BNGA 3NX0A 1OH0A 4IPBA 4HM7B 1TFKA 1IVXA 2E2TA 4K1UA 3UL6A 2CH9A 4BTXA 6STDA 2CKFB 1M1K4 4J8TA 2INXA 2BT3A 5CXOA 3I563 3FF0A 7STDA 4IIAA 2WOHA 2K0MA 2O3OA 3SOAA 1YJ93 1RJOA 1JRQA 4LZIA 3VSYA 3WOFB 4ZM8A 3V92A 3DY5A 3SOYA 4FCJA 1RN7A 2WGOA 1OF5A 3CCE3 2RCDA 2XFSA 3I0YA 4XM4A 1JKGA 1OF5B 1IDPA 2IUJA 1AR0A 1EKMA 1IVVA 2KCDA 3F40A 1NB3I 4FCMA 1SJWA 2ZL8A 3L0RA 1JKGB 1TU5A 5AIFA 2HMOB 5D83A 1VQ93 5D81A 1FGOA 3JUMA 3BNEA 2XH9A 2ML5A 3ROBA 2IUKA 2PZVA 5IG4A 3B4OA 3VF1A 5DREA 1W4NA 1QVG2 3BNCA 3WA3A 3J7Yd 3EBYA 4N6UA 3GAXA 2P0MA 3KN4A 1ASKA 1YI23 5EEOA 3FG1A 1QALA 4L7KA 1W7CA 1YJN3 2E2VA 1N5PA 4GL6A 3U97A 2IA7A 4WWUC 1FGMA 1WQLB 5JPPA 4WFOA 4NREA 3HZPA 1TIJA 3X3YA 3ECFA 3DM8A 3K9MC 1SPUA 4HM8B 2CW9A 1Q40A 4PEJA 2B24B 3CCJ3 4NHFA 1NU3A 3FSDA 1W5ZA 1Q40B 1RKYA 2OTJ3 1GY5A 1UW1A 1A67A 1YGEA 1W2B2 1UI8A 3IPTA 1KD14 1VQN3 1JN5A 1W6YA 1YVBI 3JUPA 5CF1A 1D6UA 4N6TA 3GZBA 1VQM3 2JQ5A 2O9UX 2W56A 1Q7Y4 1SIHA 3HI7A 3F7SA 4FMCA 2YX9A 3PS8A 2HMJB 1D6ZA 3PCSA 3F7XA 4LGQA 3FH1A 3NV0A 4MMXB 3LYGA 1STDA 3F8HA 1RRHA 3NV0B 2D42A 1ROVA 5LC7A 1FUWA 2E2UA 3LOYA 5AEUB 1K734 2CFWA 3Q1CA 4FR9A 1CYVA 2P09A 1W2ZA 5EVHA 1RRLA 2OQEC 1IQYA 8CHOA 1EG9B 1M904 1KWIA 2Z6BA 3MYTA 1NB5I 4CDLA 3T8NA 5IG3A 2F99A 3NM2A 4MEIA 2GU3A 3B7CA 4EC6A 2QA43 3CC73 1GY7A 3T8UA 1O7NB 1WTHA 3GZYB 3CCU3 2LQVA 3V98A 1WMOA 2ZDJA 1QVF2 1V74A 3FF2A 3K63A 3OWSA 1NWWA 4O02B 3NUVA 1N9EA 1IQXA 1NO3A 1QAFA 4K61A 2QEX3 2FGTA 4XB5A 1JB5A 1HU9A 1N9JA 4LSOA 5JBSA 2IMJA 2I9WA 3CCQ3 5IENA 1E97A 2MC8A 3S28A 2GEXA 2W6JH 3X3ZA 3EB8A 1N8QA 3MKIA 1L5GB 3G4S3 1G96A 3DGMA 3X42A 3NQYA 1FGQA 1LOXA 1U8CB 3S27A 4EXRA 3STDA 3LZAA 1KSIA 3WDGB 4AKYA 3IJEB 5IEPA 1KQS2 1GY6A 2OOVC 2W9PA 3EQQB 2PNCA 2Y73A 3GZXB 4H3UA 5G2GA 3EN8A 4JF8A 1W02A 3DGNA 3PXMA 2RSXA 2XRXB 5TGNA 1OHOA 3G8ZA 1T5YA 3FLJA 2FNQA 3VGNA 4MJDA 5LC6A 3NM7A 1VQP3 5BVBA 2XF3A 3AMOA 1OUNA 1GD4A 2CC3A 4HVNA 1QMAA 1PFPA 3AMOB 3JUOA 4XBTA 5ELUA 3MSOA 1F8NA 3B8LA 2F86B 3M8CA 3SLUA 3JUQA 3T0UA 4RNZA 2GBWB 3UL5A 3CME3 3RGAA 3KIIA 4WYKA 5KP1A 3Q2PA 3LH4A 4XBYA 4L8OA 4IT7A 2ML6A 1DVCA 1KC84 1N8R4 5IW9A 2STDA 3H51A 4WYKB 3G16A 1ZO2A 1A90A 2OCTA 2JDIH 2CFLA 1M1XB 1OHSA 5A0OB 1W6CA 4R9KA 4OVMA 1ULIB 2FXTA 2K54A 1ISKA 1FGTA 3K7CA 3PYJA 1DYUA 3CU3A 1K8A4 4EBGA 1K9M4 2CWVA 3HIIA 3PGBA 3S29A 2W04A 5I97A 4O2HA 2CWUA 3CMA3 3X3XA 4AEQA 5IG5A 2C10A 2Z77A 3LTBA 1A2KA 1IU7A 2YFLB 3WOEB 1NJI4 5ELJA 3FKAA 3QK9A 2D1WA 5EQLA 3FZWA 2KXGA 2YFIB 1YIJ3 4HYZA 4N3VA 3KFQC 1WMNA 1NDOB 1CYUA 3NXJA 4KFDA 4HZ9B 1O7MB 1IT8A 2QIYA 3GZRA 3HIGA 1JN5B 4R1KA 5IG0A 2CK3H 3CCL3 3DZLA 3LMLA 1OGXA 3NQZA 4I4KA 3EN1B 3CC23 1VQ63 1EQKA 3CC43 2W56B 3DGOA 3OWYA 4H61A 4FMDA 3BNDA 4FMBA 3SXXA 2Z7AA 3CXC2 1IV7A 5CK6A 1CEWI 3MG3A 3D9RA 2OWPA 3MHEA 3LXUX 3S67A 5DRVA 1FGRA 4N6OB 1JB4A 3UJMA 1YIT3 3G0KA 3GWRA 4MMZB 2SBLA 3G713 1YJW3 4HBRA 4U13A 1YHQ3 4BTWA 1VQ73 3DMCA 4O8SA 2W0QA 1QJGA 5FW5A 4HM6B 4GB5A 4HM4B 5KP4A 3WODG 1US1A 3N9HA 4HM3B 2XR8B 1S5AA 2P38A 3N8BA 4FCZA 2P0XA 2UX0A 4HJLB 3FG3A 5AIIA 2WO0A 5IF6A 4RZMA 5AI1A 4EV5A 1W6GA 3KSED 1JJ22 3RDEA 2LYXA 4J9AA 1E3VA 4XBXA 3X41A 3BB9A 4R80A 1OHPA 1IV9A 1W00A 3O8YA 1TFOA 4N6V0 4X2HA 5IEOA 2CHCA 5AIGA 1ULJB 1GYBA 4R4KA 2A15A 1VQ43 2BMRB 3DGLA 3Q90A 4HM0B 1TP6A 1VZZA 2YFJB 1W01A 1MOLA 2CFGA 4Q53A 1PU4A 5D82A 3MWZA 3E99A 3ER7A 3FCSB 1S723 1O7GB 1GS3A 1ROAA 3UB1A 4K1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPO A;  1ZX2 A;  4XDW A;  1C7H A;  1O7H B;  3NBR A;  4WP5 A;  5JPU A;  2HMK B;  1CQS A;  4R9L A;  5CLK A;  2W2C A;  1Z1S A;  1JB2 A;  4LMI A;  2RGQ A;  3EC9 A;  3B4P A;  1OGZ A;  1TUH A;  3NHX A;  3A76 A;  1UUW B;  3GRD A;  3WMD A;  5HGR A;  3KZT A;  1OPY A;  3EF8 A;  3OX9 A;  5BXQ A;  3DXO A;  2QGU A;  1DMM A;  3HK4 A;  3EHC A;  5AIH A;  2BMQ B;  1UUV B;  1K41 A;  4STD A;  3F9S A;  4L8P A;  3KSP A;  4HKV B;  3JUN A;  4HZB B;  3H3H A;  3KE7 A;  3EBT A;  2B1X B;  1Q42 A;  5STD A;  4LEH A;  2R4I A;  4HM2 B;  1E3R A;  5CF2 A;  1HKX A;  1BUQ A;  1EA2 A;  5AEW B;  3OV4 A;  3MG2 A;  3K0Z A;  3UNL A;  3MG1 A;  3RGR A;  3DUK A;  4HM5 B;  3OWU A;  2HML B;  1U5O A;  3EX9 A;  4OUQ A;  3F8X A;  3CNX A;  2RFR A;  4X2O A;  3S5C A;  1DMQ A;  1O7P B;  2GEY A;  5KP3 A;  1OCV A;  5IER A;  3CNM A;  3SED A;  4ORL A;  2BMO B;  2XSO B;  3F14 A;  3FGY A;  4KVH A;  2GBX B;  3OXA A;  2F98 A;  2Z76 A;  2HMN B;  3EJV A;  4HM1 B;  1O7W B;  4XDV A;  2XSH B;  2GXF A;  3HX8 A;  3KKG A;  2HMM B;  3BLZ A;  1DMN A;  2BNG A;  1OH0 A;  4HM7 B;  4K1U A;  6STD A;  2CKF B;  4J8T A;  2INX A;  5CXO A;  3FF0 A;  7STD A;  4IIA A;  3SOA A;  3VSY A;  3SOY A;  4FCJ A;  1OF5 A;  2RCD A;  3I0Y A;  4XM4 A;  1JKG A;  1OF5 B;  1IDP A;  1AR0 A;  3F40 A;  4FCM A;  1SJW A;  1JKG B;  5AIF A;  2HMO B;  5D83 A;  5D81 A;  3JUM A;  3ROB A;  2PZV A;  5IG4 A;  3B4O A;  5DRE A;  3EBY A;  1ASK A;  4L7K A;  4WWU C;  1WQL B;  5JPP A;  3HZP A;  3ECF A;  3DM8 A;  4HM8 B;  1Q40 A;  4PEJ A;  2B24 B;  1NU3 A;  3FSD A;  1Q40 B;  1GY5 A;  3IPT A;  1JN5 A;  1W6Y A;  3JUP A;  5CF1 A;  3GZB A;  2JQ5 A;  3F7S A;  2HMJ B;  3F7X A;  4LGQ A;  3FH1 A;  3NV0 A;  3LYG A;  1STD A;  3F8H A;  3NV0 B;  5AEU B;  5EVH A;  8CHO A;  1EG9 B;  3MYT A;  4CDL A;  3T8N A;  5IG3 A;  2F99 A;  3NM2 A;  3B7C A;  1GY7 A;  3T8U A;  1O7N B;  3GZY B;  3OWS A;  3FF2 A;  1NWW A;  3NUV A;  4XB5 A;  1JB5 A;  2IMJ A;  2I9W A;  5IEN A;  1E97 A;  2GEX A;  3MKI A;  3STD A;  3LZA A;  5IEP A;  1GY6 A;  3EQQ B;  3GZX B;  4H3U A;  5G2G A;  3EN8 A;  1W02 A;  5TGN A;  2XRX B;  1OHO A;  3G8Z A;  3FLJ A;  3VGN A;  4MJD A;  5BVB A;  1OUN A;  4HVN A;  1QMA A;  3JUO A;  4XBT A;  3MSO A;  3B8L A;  2F86 B;  3M8C A;  3JUQ A;  2GBW B;  3RGA A;  4WYK A;  5KP1 A;  4XBY A;  4L8O A;  2STD A;  3H51 A;  4WYK B;  3G16 A;  1ZO2 A;  1OHS A;  4R9K A;  4OVM A;  1ULI B;  2K54 A;  1ISK A;  3K7C A;  3CU3 A;  5IG5 A;  2Z77 A;  1A2K A;  2YFL B;  3FKA A;  3FZW A;  2YFI B;  4N3V A;  1NDO B;  3NXJ A;  4HZ9 B;  1O7M B;  4R1K A;  2QIY A;  3GZR A;  1JN5 B;  5IG0 A;  3DZL A;  1OGX A;  4I4K A;  3EN1 B;  3OWY A;  2Z7A A;  5CK6 A;  3MG3 A;  3D9R A;  2OWP A;  3MHE A;  5DRV A;  1JB4 A;  3UJM A;  3G0K A;  3GWR A;  4U13 A;  3DMC A;  1QJG A;  5FW5 A;  4HM6 B;  4GB5 A;  4HM4 B;  5KP4 A;  4HM3 B;  2XR8 B;  1S5A A;  2UX0 A;  4HJL B;  5AII A;  5IF6 A;  4RZM A;  5AI1 A;  4J9A A;  1E3V A;  4XBX A;  3BB9 A;  1OHP A;  1W00 A;  4X2H A;  5IEO A;  2CHC A;  5AIG A;  1ULJ B;  1GYB A;  2A15 A;  2BMR B;  3Q90 A;  4HM0 B;  1TP6 A;  1VZZ A;  2YFJ B;  1W01 A;  4Q53 A;  5D82 A;  3E99 A;  3ER7 A;  1O7G B;  1GS3 A;  4K1V A; 
#chains in the Genus database with same CATH topology
 1STF I;  1BSD A;  3CPO A;  9RNT A;  1AVL A;  2M7O A;  2XFT A;  1ZX2 A;  4XDW A;  1DVD A;  1IK3 A;  1Q82 4;  8RNT A;  1VQ8 3;  1C7H A;  1LOY A;  1O7H B;  3CCV 3;  1RGA A;  3BNB A;  4N6M A;  3AGN A;  3D4A A;  3G6E 3;  3NBR A;  1I2G A;  2V1L A;  4WP5 A;  4CPK A;  1LVN A;  5JPU A;  2HMK B;  1CQS A;  2IYJ A;  4R9L A;  5CLK A;  3LT8 A;  3LTD A;  2W2C A;  1SQW A;  1Z1S A;  1JB2 A;  3FG4 A;  1GMR A;  2RGQ A;  3EC9 A;  4LMI A;  1LNH A;  1N5H A;  2Y74 A;  3SX1 A;  3B4P A;  1OGZ A;  1K28 A;  1GMP A;  1BNG A;  1I2E A;  1TRQ A;  1TUH A;  3D3L A;  3IMA B;  3QRD A;  4HOH A;  4AKZ A;  4RBN A;  3NHX A;  4EYC A;  2F5M A;  1DE3 A;  3A76 A;  1UUW B;  3GRD A;  2ZA4 A;  4I5Q A;  2GU1 A;  2XGN A;  3WMD A;  5HGR A;  3BU4 A;  3KZT A;  1VQ5 3;  1OPY A;  3EF8 A;  3OX9 A;  3ALA A;  5BXQ A;  3DXO A;  2QGU A;  1DMM A;  3OW2 2;  4GSP A;  1UCK A;  1IT7 A;  3K5T A;  1JV2 B;  3HK4 A;  1WNH A;  3EHC A;  1JBS A;  1OAC A;  5AIH A;  2BMQ B;  1UUV B;  4G1M B;  1QAK A;  1K41 A;  1FA3 A;  4STD A;  3F9S A;  4L8P A;  3KSP A;  4BU4 A;  4KFF A;  1A2V A;  2CWT A;  1M9G A;  1G02 A;  4HKV B;  2KRT A;  3JUN A;  4HZB B;  4J5K A;  2XGL A;  3CCS 3;  2KF3 A;  1BRG A;  3H3H A;  3KE7 A;  3EBT A;  3LTA A;  2B1X B;  1Q42 A;  3NBB A;  3JVC A;  2OQE A;  5STD A;  5HOH A;  4LEH A;  3CPW 2;  2R4I A;  3LT9 A;  1J2B A;  2CFD A;  1R4C A;  2WOF A;  1RNT A;  1E3R A;  1V58 A;  3MPH A;  4HM2 B;  5CF2 A;  1HKX A;  1X1W A;  1VQK 3;  4WHA A;  1BUQ A;  1FYS A;  1EA2 A;  1LQG C;  5FGO A;  3WR2 A;  1GD3 A;  1B2S A;  5AEW B;  3OV4 A;  1VQO 3;  1JNQ A;  3MG2 A;  3K0Z A;  3TDG A;  3UNL A;  1MNL A;  3MG1 A;  3CD6 3;  1JZO A;  3RGR A;  3DUK A;  1ZGX A;  3PCR A;  4HM5 B;  2K3D A;  3OWU A;  1RGH A;  1U5O A;  2HML B;  3EX9 A;  5M19 A;  1WMP A;  1IQ8 A;  3PZW A;  2SAR A;  4OUQ A;  3F8X A;  3CNX A;  1I0V A;  1SII A;  5M1A A;  4KZ1 A;  1AVK A;  3CCM 3;  3EE1 A;  4QWT A;  1BSA A;  1I3I A;  2RFR A;  4FMA A;  4EV2 A;  1ZS7 A;  4X2O A;  4HAA A;  3S5C A;  1DMQ A;  2W9Q A;  4N6L A;  4CCV A;  1O7P B;  1D6Y A;  3CCR 3;  4MMY B;  2GEY A;  4KFE A;  1B3S A;  1Y4K A;  4OK0 A;  2CFK A;  5KP3 A;  2CG0 A;  1OCV A;  5IER A;  2OOV A;  3CNM A;  3SED A;  3SVA A;  1Q81 4;  2CIU A;  4ORL A;  1K9M 4;  2CX1 A;  3URP A;  1VQL 3;  1IVU A;  2BMO B;  2XSO B;  2RNT A;  3F14 A;  2Q07 A;  2CG1 A;  3FGY A;  4KVH A;  3I55 3;  5BU4 A;  1HYF A;  2GBX B;  3N54 B;  3OXA A;  5AYS C;  1BRS A;  2F98 A;  5AYR B;  1BRI A;  2UGI A;  2Z76 A;  2HMN B;  3EJV A;  7GSP A;  2XEP A;  2L4V A;  4HM1 B;  4BL2 A;  1RHL A;  3NBJ A;  2AAD A;  4TX4 A;  2F56 A;  2OTL 3;  1T2I A;  1UI7 A;  4BTY A;  1PY3 A;  1AY7 A;  1O7W B;  1BUJ A;  2P05 A;  1GMQ A;  4N6N B;  1AV4 A;  2MF7 A;  2W03 A;  3V99 A;  3ZG0 A;  1R4Y A;  1LXE A;  3LTC A;  4XDV A;  1I2F A;  3AGO A;  3D5I A;  2BU4 A;  4JRF A;  2XSH B;  2C11 A;  3X40 A;  1IVW A;  2BHM A;  2GXF A;  4O3V A;  1Q86 4;  3HX8 A;  4K90 B;  1AQZ A;  4RNY A;  3U1W A;  1BSC A;  3KKG A;  2HMM B;  1BRJ A;  2WGQ A;  2BO9 B;  3BLZ A;  3WA2 X;  1Q7H A;  1DMN A;  2BNG A;  3NX0 A;  1OH0 A;  1B27 A;  4IPB A;  4HM7 B;  1TFK A;  1LQM B;  5RNT A;  2AAE A;  5G1L A;  1IVX A;  2E2T A;  1BNJ A;  1TRP A;  1BGS A;  2CH9 A;  4K1U A;  3UL6 A;  4BTX A;  6STD A;  4EW5 A;  2CKF B;  1M1K 4;  4J8T A;  2INX A;  1LOW A;  1B20 A;  2BT3 A;  2KAA A;  5CXO A;  1LOV A;  3FF0 A;  7STD A;  4IIA A;  5GSP A;  3I56 3;  3SYU A;  2WOH A;  2K0M A;  2O3O A;  1TJD A;  1A2P A;  1UCI A;  1RJO A;  3HOH A;  3RNT A;  3SOA A;  1YJ9 3;  1JRQ A;  4LZI A;  3VSY A;  3WOF B;  4ZM8 A;  1RGF A;  3DY5 A;  3V92 A;  3SOY A;  4FCJ A;  2IY2 A;  1RN7 A;  2WGO A;  2ZHX B;  1RN1 A;  1OF5 A;  4GHO A;  3CCE 3;  2RCD A;  2XFS A;  3I0Y A;  4XM4 A;  1TTO A;  1RGL A;  2H0I A;  1JKG A;  1OF5 B;  1IDP A;  2IUJ A;  1AR0 A;  3D5G A;  1EKM A;  1IVV A;  2KCD A;  3F40 A;  1NB3 I;  4FCM A;  1SJW A;  2ZL8 A;  3L0R A;  1JKG B;  1BNE A;  1JZD A;  3KCH A;  1TU5 A;  2R41 A;  5AIF A;  1BNF A;  2HMO B;  5D83 A;  4DKI A;  1VQ9 3;  5D81 A;  1FGO A;  3JUM A;  3BNE A;  2XH9 A;  2ML5 A;  3ROB A;  2IUK A;  2PZV A;  5IG4 A;  3B4O A;  3VF1 A;  5DRE A;  1W4N A;  1QVG 2;  3BNC A;  3WA3 A;  3J7Y d;  3EBY A;  1BAN A;  1PYL A;  4N6U A;  3GAX A;  2P0M A;  3KN4 A;  4NPB A;  1ASK A;  1YI2 3;  5EEO A;  1VQQ A;  3FG1 A;  1QAL A;  2CX0 A;  4L7K A;  1W7C A;  1YJN 3;  2E2V A;  3AHW A;  1N5P A;  4GL6 A;  3U97 A;  4KT3 B;  2IA7 A;  4WWU C;  1FGM A;  1WQL B;  5JPP A;  4WFO A;  4NRE A;  3HZP A;  1TIJ A;  3A5E A;  3ECF A;  3X3Y A;  1BRH A;  1BSB A;  3DM8 A;  3K9M C;  1SPU A;  4HM8 B;  2CW9 A;  2L1S A;  1Q40 A;  4PEJ A;  2B24 B;  1B2Z A;  3CCJ 3;  4NHF A;  1NU3 A;  3FSD A;  1W5Z A;  1Q40 B;  1RKY A;  1RCK A;  1GY5 A;  1UW1 A;  2OTJ 3;  1A67 A;  1YGE A;  1W2B 2;  1YHQ 3;  1UI8 A;  3IPT A;  1KD1 4;  1GSP A;  1VQN 3;  4BL3 A;  1B2U A;  1YNV X;  1JN5 A;  1W6Y A;  1YVB I;  3JUP A;  5CF1 A;  1D6U A;  4N6T A;  3GZB A;  1NNV A;  1VQM 3;  2JQ5 A;  2C4B A;  2O9U X;  2W56 A;  1Q7Y 4;  1SIH A;  3HI7 A;  3F7S A;  4FMC A;  2YX9 A;  3PS8 A;  2HMJ B;  1D6Z A;  3PCS A;  3F7X A;  4LGQ A;  3FH1 A;  3NV0 A;  4J5G A;  4MMX B;  3LYG A;  1STD A;  3F8H A;  1RRH A;  3NV0 B;  2D42 A;  1ROV A;  5LC7 A;  5BIR A;  1FUW A;  2E2U A;  3LOY A;  5AEU B;  1K73 4;  2CFW A;  3Q1C A;  1RGC A;  4FR9 A;  3WHO A;  1CYV A;  2P09 A;  1W2Z A;  5EVH A;  1RRL A;  1T2H A;  2OQE C;  1IQY A;  8CHO A;  1UDI I;  1EG9 B;  1M90 4;  1KWI A;  2Z6B A;  3MYT A;  1NB5 I;  1B21 A;  4CDL A;  3T8N A;  5IG3 A;  2F99 A;  3NM2 A;  4MEI A;  2GU3 A;  3B7C A;  4RNT A;  1RNB A;  4EC6 A;  2QA4 3;  3CC7 3;  1GY7 A;  3T8U A;  1O7N B;  1WTH A;  3GZY B;  3CCU 3;  2LQV A;  3V98 A;  3DGY A;  1WMO A;  2ZDJ A;  1QVF 2;  1RMS A;  1V74 A;  3FF2 A;  3K63 A;  1NWW A;  3OWS A;  6GSP A;  1JBT A;  1UGH I;  4O02 B;  3NUV A;  1N9E A;  1B2M A;  1IQX A;  1NO3 A;  1QAF A;  4K61 A;  2QEX 3;  2H0H A;  2FGT A;  4XB5 A;  1YJW 3;  1JB5 A;  1HU9 A;  1N9J A;  4LSO A;  5JBS A;  2IMJ A;  2I9W A;  1MGR A;  5IEN A;  1E97 A;  3CCQ 3;  1FUT A;  2MC8 A;  3S28 A;  1UCJ A;  1UUG B;  2GEX A;  2W6J H;  3X3Z A;  3EB8 A;  1N8Q A;  3MKI A;  1V57 A;  1L5G B;  3G4S 3;  1G96 A;  1I8V A;  3DGM A;  3X42 A;  3NQY A;  1U8C B;  1FGQ A;  1LOX A;  1RGK A;  3S27 A;  4EXR A;  3STD A;  3LZA A;  1KSI A;  3WDG B;  4AKY A;  1FW7 A;  3IJE B;  5IEP A;  1KQS 2;  1GY6 A;  2OOV C;  2W9P A;  3EQQ B;  2PNC A;  2Y73 A;  4LYL B;  3GZX B;  3ZFZ A;  4H3U A;  1CH0 A;  5G2G A;  1RN4 A;  3EN8 A;  4JF8 A;  1W02 A;  3DGN A;  3PXM A;  4BIR A;  2RSX A;  2XRX B;  5TGN A;  1BNR A;  1OHO A;  3G8Z A;  1GOV A;  1T5Y A;  3FLJ A;  1MWS A;  2FNQ A;  2J8X B;  1BIR A;  4MJD A;  5LC6 A;  3NM7 A;  3VGN A;  4CJN A;  1VQP 3;  5BVB A;  2F4Y A;  2XF3 A;  1OUN A;  3AMO A;  1GD4 A;  1T3B A;  2CC3 A;  4HVN A;  1QMA A;  1RTU A;  1X1U A;  2HOH A;  1PFP A;  3AMO B;  1B2X A;  3JUO A;  4XBT A;  5ELU A;  1MWT A;  3AHS A;  1BNS A;  3MSO A;  1I0X A;  1F8N A;  1BVI A;  3B8L A;  1IYY A;  2F86 B;  3M8C A;  3SLU A;  1DET A;  3JUQ A;  3T0U A;  4RNZ A;  2GBW B;  3UL5 A;  3CME 3;  3RGA A;  1X1Y A;  3KII A;  4WYK A;  5KP1 A;  3Q2P A;  3LH4 A;  4XBY A;  4L8O A;  1JBR A;  4IT7 A;  2ML6 A;  1DVC A;  1KC8 4;  1N8R 4;  5IW9 A;  2STD A;  3H51 A;  4WYK B;  3G16 A;  1ZO2 A;  1A90 A;  2OCT A;  2JDI H;  3GSP A;  7RNT A;  2CFL A;  1M1X B;  1OHS A;  5A0O B;  1W6C A;  4R9K A;  1BOX A;  1SAR A;  1ULI B;  4OVM A;  1X1X A;  1RGE A;  1LRA A;  2BIR A;  1FUS A;  2FXT A;  2K54 A;  1FGT A;  3K7C A;  3PYJ A;  1ISK A;  1DYU A;  1RCL A;  3CU3 A;  4EBG A;  1K8A 4;  2CWV A;  3HII A;  3PGB A;  3S29 A;  2W04 A;  5I97 A;  4O2H A;  2CWU A;  3CMA 3;  3X3X A;  4AEQ A;  5IG5 A;  2C10 A;  2Z77 A;  3LTB A;  1A2K A;  1RGG A;  3ZG5 A;  1IU7 A;  2YFL B;  2UUG C;  3WOE B;  1NJI 4;  5ELJ A;  2KF4 A;  3FKA A;  3QK9 A;  3Q3F A;  6RNT A;  2D1W A;  5EQL A;  3FZW A;  1BSE A;  2KXG A;  2YFI B;  1YIJ 3;  1MWU A;  4HYZ A;  4N3V A;  1BNI A;  3KFQ C;  1WMN A;  2KF5 A;  1NDO B;  1CYU A;  3NXJ A;  2GSP A;  4KFD A;  4HZ9 B;  1O7M B;  1IT8 A;  2QIY A;  3GZR A;  3HIG A;  1JN5 B;  4R1K A;  5IG0 A;  1G0T A;  2CK3 H;  3D79 A;  3DZL A;  1OGX A;  3LML A;  3NQZ A;  3EN1 B;  4I4K A;  3CC2 3;  3CCL 3;  5M18 A;  1VQ6 3;  1EQK A;  3CC4 3;  2W56 B;  3DGO A;  3OWY A;  4H61 A;  4FMD A;  3BND A;  4FMB A;  3SXX A;  2Z7A A;  3CXC 2;  1IV7 A;  5CK6 A;  1CEW I;  1MWR A;  2F5W A;  3MG3 A;  1EEJ A;  3D9R A;  2OWP A;  1EUI C;  1YVS A;  3MHE A;  3LXU X;  3S67 A;  5DRV A;  1RDS A;  1FGR A;  1FZU A;  1JB4 A;  4N6O B;  3UJM A;  1LNI A;  1YIT 3;  3G0K A;  3GWR A;  4MMZ B;  1GOY A;  2SBL A;  1Q9E A;  1I70 A;  1RLS A;  4HBR A;  4U13 A;  4BTW A;  3G71 3;  1VQ7 3;  3DMC A;  4O8S A;  4ILF A;  1C54 A;  1YGW A;  2W0Q A;  1QJG A;  5FW5 A;  4HM6 B;  2H0G A;  1UCL A;  3BIR A;  4GB5 A;  4HM4 B;  5KP4 A;  3WOD G;  1US1 A;  3N9H A;  1BU4 A;  4HM3 B;  2XR8 B;  1UGI A;  1S5A A;  2P38 A;  1HZ1 A;  3N8B A;  2P0X A;  1I3F A;  2UX0 A;  3FG3 A;  4FCZ A;  4HJL B;  5AII A;  2WO0 A;  5IF6 A;  4RZM A;  5AI1 A;  3DH2 A;  4EV5 A;  1W6G A;  3KSE D;  1JJ2 2;  3RDE A;  2LYX A;  4J9A A;  1E3V A;  4XBX A;  3X41 A;  3BB9 A;  4R80 A;  1BRN L;  1OHP A;  1IV9 A;  1W00 A;  3O8Y A;  1MGW A;  1TFO A;  4N6V 0;  4X2H A;  5IEO A;  1RSN A;  2CHC A;  5AIG A;  1ULJ B;  1GYB A;  1GOU A;  4R4K A;  2A15 A;  1VQ4 3;  2BMR B;  1BAO A;  2KF6 A;  3DGL A;  3Q90 A;  4HM0 B;  1TP6 A;  1VZZ A;  2YFJ B;  1W01 A;  1MOL A;  2CFG A;  4Q53 A;  1PU4 A;  5D82 A;  3MWZ A;  3E99 A;  3ER7 A;  3FCS B;  2RBI A;  1S72 3;  1O7G B;  1BRK A;  1GS3 A;  1ROA A;  3UB1 A;  4K1V A;  5G1K A; 
#chains in the Genus database with same CATH homology
 1STF I;  3CPO A;  1AVL A;  2M7O A;  2XFT A;  1ZX2 A;  4XDW A;  1DVD A;  1IK3 A;  1Q82 4;  1VQ8 3;  1C7H A;  3CCV 3;  1O7H B;  3BNB A;  4N6M A;  3G6E 3;  3NBR A;  2V1L A;  4WP5 A;  1LVN A;  5JPU A;  2HMK B;  1CQS A;  4R9L A;  5CLK A;  3LT8 A;  3LTD A;  2W2C A;  1SQW A;  1Z1S A;  1JB2 A;  3FG4 A;  4LMI A;  2RGQ A;  3EC9 A;  1LNH A;  1N5H A;  2Y74 A;  3SX1 A;  3B4P A;  1OGZ A;  1K28 A;  1TUH A;  3D3L A;  3IMA B;  3QRD A;  4AKZ A;  4EYC A;  4RBN A;  3NHX A;  3A76 A;  1UUW B;  3GRD A;  3WMD A;  2GU1 A;  2XGN A;  5HGR A;  3KZT A;  1VQ5 3;  1OPY A;  3EF8 A;  3OX9 A;  3ALA A;  5BXQ A;  3DXO A;  2QGU A;  1DMM A;  3OW2 2;  1IT7 A;  3K5T A;  1JV2 B;  3HK4 A;  1WNH A;  3EHC A;  1OAC A;  5AIH A;  2BMQ B;  1UUV B;  4G1M B;  1QAK A;  1K41 A;  1FA3 A;  4STD A;  3F9S A;  4L8P A;  3KSP A;  4KFF A;  1A2V A;  2CWT A;  1M9G A;  4HKV B;  2KRT A;  3JUN A;  4HZB B;  2XGL A;  3CCS 3;  3H3H A;  3KE7 A;  3EBT A;  3LTA A;  2B1X B;  1Q42 A;  3NBB A;  3JVC A;  2OQE A;  5STD A;  4LEH A;  3CPW 2;  2R4I A;  3LT9 A;  1J2B A;  2CFD A;  1R4C A;  2WOF A;  3MPH A;  1E3R A;  4HM2 B;  5CF2 A;  1HKX A;  1VQK 3;  1BUQ A;  4WHA A;  1EA2 A;  5AEW B;  5FGO A;  1VQO 3;  1GD3 A;  3OV4 A;  1JNQ A;  3MG2 A;  3K0Z A;  3TDG A;  3UNL A;  1MNL A;  3MG1 A;  3CD6 3;  3RGR A;  3DUK A;  3PCR A;  4HM5 B;  3OWU A;  2HML B;  1U5O A;  3EX9 A;  1WMP A;  1IQ8 A;  3PZW A;  4OUQ A;  3F8X A;  3CNX A;  1SII A;  4KZ1 A;  1AVK A;  3CCM 3;  3EE1 A;  4QWT A;  2RFR A;  4EV2 A;  4FMA A;  4X2O A;  3S5C A;  1DMQ A;  2W9Q A;  4N6L A;  4CCV A;  1O7P B;  1D6Y A;  3CCR 3;  4MMY B;  2GEY A;  4KFE A;  1Y4K A;  4OK0 A;  2CFK A;  5KP3 A;  2CG0 A;  1OCV A;  5IER A;  2OOV A;  3CNM A;  3SED A;  3SVA A;  1Q81 4;  2CIU A;  4ORL A;  1VQL 3;  1IVU A;  2BMO B;  2XSO B;  3F14 A;  2Q07 A;  2CG1 A;  3FGY A;  4KVH A;  3I55 3;  2GBX B;  3N54 B;  3OXA A;  5AYS C;  2F98 A;  5AYR B;  2Z76 A;  2HMN B;  3EJV A;  2XEP A;  2L4V A;  4HM1 B;  3NBJ A;  4TX4 A;  2OTL 3;  1UI7 A;  4BTY A;  1O7W B;  2P05 A;  4N6N B;  1AV4 A;  2MF7 A;  2W03 A;  3V99 A;  1LXE A;  3LTC A;  4XDV A;  4JRF A;  2XSH B;  2C11 A;  3X40 A;  1IVW A;  2BHM A;  2GXF A;  4O3V A;  1Q86 4;  3HX8 A;  4K90 B;  4RNY A;  3U1W A;  3KKG A;  2HMM B;  2WGQ A;  2BO9 B;  3BLZ A;  3WA2 X;  1DMN A;  2BNG A;  3NX0 A;  1OH0 A;  4IPB A;  4HM7 B;  1TFK A;  1IVX A;  2E2T A;  4K1U A;  3UL6 A;  2CH9 A;  4BTX A;  6STD A;  2CKF B;  1M1K 4;  4J8T A;  2INX A;  2BT3 A;  5CXO A;  3I56 3;  3FF0 A;  7STD A;  4IIA A;  2WOH A;  2K0M A;  2O3O A;  3SOA A;  1YJ9 3;  1RJO A;  1JRQ A;  4LZI A;  3VSY A;  3WOF B;  4ZM8 A;  3V92 A;  3DY5 A;  3SOY A;  4FCJ A;  1RN7 A;  2WGO A;  1OF5 A;  3CCE 3;  2RCD A;  2XFS A;  3I0Y A;  4XM4 A;  1JKG A;  1OF5 B;  1IDP A;  2IUJ A;  1AR0 A;  1EKM A;  1IVV A;  2KCD A;  3F40 A;  1NB3 I;  4FCM A;  1SJW A;  2ZL8 A;  3L0R A;  1JKG B;  1TU5 A;  5AIF A;  2HMO B;  5D83 A;  1VQ9 3;  5D81 A;  1FGO A;  3JUM A;  3BNE A;  2XH9 A;  2ML5 A;  3ROB A;  2IUK A;  2PZV A;  5IG4 A;  3B4O A;  3VF1 A;  5DRE A;  1W4N A;  1QVG 2;  3BNC A;  3WA3 A;  3J7Y d;  3EBY A;  4N6U A;  3GAX A;  2P0M A;  3KN4 A;  1ASK A;  1YI2 3;  5EEO A;  3FG1 A;  1QAL A;  4L7K A;  1W7C A;  1YJN 3;  2E2V A;  1N5P A;  4GL6 A;  3U97 A;  2IA7 A;  4WWU C;  1FGM A;  1WQL B;  5JPP A;  4WFO A;  4NRE A;  3HZP A;  1TIJ A;  3X3Y A;  3ECF A;  3DM8 A;  3K9M C;  1SPU A;  4HM8 B;  2CW9 A;  1Q40 A;  4PEJ A;  2B24 B;  3CCJ 3;  4NHF A;  1NU3 A;  3FSD A;  1W5Z A;  1Q40 B;  1RKY A;  2OTJ 3;  1GY5 A;  1UW1 A;  1A67 A;  1YGE A;  1W2B 2;  1UI8 A;  3IPT A;  1KD1 4;  1VQN 3;  1JN5 A;  1W6Y A;  1YVB I;  3JUP A;  5CF1 A;  1D6U A;  4N6T A;  3GZB A;  1VQM 3;  2JQ5 A;  2O9U X;  2W56 A;  1Q7Y 4;  1SIH A;  3HI7 A;  3F7S A;  4FMC A;  2YX9 A;  3PS8 A;  2HMJ B;  1D6Z A;  3PCS A;  3F7X A;  4LGQ A;  3FH1 A;  3NV0 A;  4MMX B;  3LYG A;  1STD A;  3F8H A;  1RRH A;  3NV0 B;  2D42 A;  1ROV A;  5LC7 A;  1FUW A;  2E2U A;  3LOY A;  5AEU B;  1K73 4;  2CFW A;  3Q1C A;  4FR9 A;  1CYV A;  2P09 A;  1W2Z A;  5EVH A;  1RRL A;  2OQE C;  1IQY A;  8CHO A;  1EG9 B;  1M90 4;  1KWI A;  2Z6B A;  3MYT A;  1NB5 I;  4CDL A;  3T8N A;  5IG3 A;  2F99 A;  3NM2 A;  4MEI A;  2GU3 A;  3B7C A;  4EC6 A;  2QA4 3;  3CC7 3;  1GY7 A;  3T8U A;  1O7N B;  1WTH A;  3GZY B;  3CCU 3;  2LQV A;  3V98 A;  1WMO A;  2ZDJ A;  1QVF 2;  1V74 A;  3FF2 A;  3K63 A;  3OWS A;  1NWW A;  4O02 B;  3NUV A;  1N9E A;  1IQX A;  1NO3 A;  1QAF A;  4K61 A;  2QEX 3;  2FGT A;  4XB5 A;  1JB5 A;  1HU9 A;  1N9J A;  4LSO A;  5JBS A;  2IMJ A;  2I9W A;  3CCQ 3;  5IEN A;  1E97 A;  2MC8 A;  3S28 A;  2GEX A;  2W6J H;  3X3Z A;  3EB8 A;  1N8Q A;  3MKI A;  1L5G B;  3G4S 3;  1G96 A;  3DGM A;  3X42 A;  3NQY A;  1FGQ A;  1LOX A;  1U8C B;  3S27 A;  4EXR A;  3STD A;  3LZA A;  1KSI A;  3WDG B;  4AKY A;  3IJE B;  5IEP A;  1KQS 2;  1GY6 A;  2OOV C;  2W9P A;  3EQQ B;  2PNC A;  2Y73 A;  3GZX B;  4H3U A;  5G2G A;  3EN8 A;  4JF8 A;  1W02 A;  3DGN A;  3PXM A;  2RSX A;  2XRX B;  5TGN A;  1OHO A;  3G8Z A;  1T5Y A;  3FLJ A;  2FNQ A;  3VGN A;  4MJD A;  5LC6 A;  3NM7 A;  1VQP 3;  5BVB A;  2XF3 A;  3AMO A;  1OUN A;  1GD4 A;  2CC3 A;  4HVN A;  1QMA A;  1PFP A;  3AMO B;  3JUO A;  4XBT A;  5ELU A;  3MSO A;  1F8N A;  3B8L A;  2F86 B;  3M8C A;  3SLU A;  3JUQ A;  3T0U A;  4RNZ A;  2GBW B;  3UL5 A;  3CME 3;  3RGA A;  3KII A;  4WYK A;  5KP1 A;  3Q2P A;  3LH4 A;  4XBY A;  4L8O A;  4IT7 A;  2ML6 A;  1DVC A;  1KC8 4;  1N8R 4;  5IW9 A;  2STD A;  3H51 A;  4WYK B;  3G16 A;  1ZO2 A;  1A90 A;  2OCT A;  2JDI H;  2CFL A;  1M1X B;  1OHS A;  5A0O B;  1W6C A;  4R9K A;  4OVM A;  1ULI B;  2FXT A;  2K54 A;  1ISK A;  1FGT A;  3K7C A;  3PYJ A;  1DYU A;  3CU3 A;  1K8A 4;  4EBG A;  1K9M 4;  2CWV A;  3HII A;  3PGB A;  3S29 A;  2W04 A;  5I97 A;  4O2H A;  2CWU A;  3CMA 3;  3X3X A;  4AEQ A;  5IG5 A;  2C10 A;  2Z77 A;  3LTB A;  1A2K A;  1IU7 A;  2YFL B;  3WOE B;  1NJI 4;  5ELJ A;  3FKA A;  3QK9 A;  2D1W A;  5EQL A;  3FZW A;  2KXG A;  2YFI B;  1YIJ 3;  4HYZ A;  4N3V A;  3KFQ C;  1WMN A;  1NDO B;  1CYU A;  3NXJ A;  4KFD A;  4HZ9 B;  1O7M B;  1IT8 A;  2QIY A;  3GZR A;  3HIG A;  1JN5 B;  4R1K A;  5IG0 A;  2CK3 H;  3CCL 3;  3DZL A;  3LML A;  1OGX A;  3NQZ A;  4I4K A;  3EN1 B;  3CC2 3;  1VQ6 3;  1EQK A;  3CC4 3;  2W56 B;  3DGO A;  3OWY A;  4H61 A;  4FMD A;  3BND A;  4FMB A;  3SXX A;  2Z7A A;  3CXC 2;  1IV7 A;  5CK6 A;  1CEW I;  3MG3 A;  3D9R A;  2OWP A;  3MHE A;  3LXU X;  3S67 A;  5DRV A;  1FGR A;  4N6O B;  1JB4 A;  3UJM A;  1YIT 3;  3G0K A;  3GWR A;  4MMZ B;  2SBL A;  3G71 3;  1YJW 3;  4HBR A;  4U13 A;  1YHQ 3;  4BTW A;  1VQ7 3;  3DMC A;  4O8S A;  2W0Q A;  1QJG A;  5FW5 A;  4HM6 B;  4GB5 A;  4HM4 B;  5KP4 A;  3WOD G;  1US1 A;  3N9H A;  4HM3 B;  2XR8 B;  1S5A A;  2P38 A;  3N8B A;  4FCZ A;  2P0X A;  2UX0 A;  4HJL B;  3FG3 A;  5AII A;  2WO0 A;  5IF6 A;  4RZM A;  5AI1 A;  4EV5 A;  1W6G A;  3KSE D;  1JJ2 2;  3RDE A;  2LYX A;  4J9A A;  1E3V A;  4XBX A;  3X41 A;  3BB9 A;  4R80 A;  1OHP A;  1IV9 A;  1W00 A;  3O8Y A;  1TFO A;  4N6V 0;  4X2H A;  5IEO A;  2CHC A;  5AIG A;  1ULJ B;  1GYB A;  4R4K A;  2A15 A;  1VQ4 3;  2BMR B;  3DGL A;  3Q90 A;  4HM0 B;  1TP6 A;  1VZZ A;  2YFJ B;  1W01 A;  1MOL A;  2CFG A;  4Q53 A;  1PU4 A;  5D82 A;  3MWZ A;  3E99 A;  3ER7 A;  3FCS B;  1S72 3;  1O7G B;  1GS3 A;  1ROA A;  3UB1 A;  4K1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...