1Q40B

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
186
Chain Sequence
SRNLATNFIANYLKLWDANRSELMILYQNESQFSMQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARMAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEVDGSASRYHSGPKHKRIPLSKKSFDRTFVVIPGSMIVASDTLLIRPYTSDFPWKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 42
structure length 186
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40B00
3F7XA 1OHSA 4HJLB 4HM2B 3OXAA 4HM3B 2UX0A 5IG3A 5KP1A 4IIAA 2GBWB 2RFRA 3GZRA 3E99A 5D81A 1Q42A 3STDA 4KVHA 1GY7A 5AIFA 5AIIA 2F98A 3KKGA 3WMDA 3A76A 2XSOB 1ZO2A 3MG3A 2XR8B 4HM4B 4R1KA 4ORLA 3JUOA 1ISKA 1NDOB 1W02A 5CF2A 2BNGA 1ZX2A 4H3UA 2XSHB 2HMLB 3NXJA 2IMJA 4I4KA 4GB5A 4HVNA 1DMNA 4XDWA 3JUPA 3JUNA 3F40A 3CU3A 4L8PA 1O7NB 5AIHA 4WYKB 1Z1SA 1OUNA 3JUMA 4HM6B 3K7CA 2A15A 1JB4A 5JPPA 3EBYA 4X2OA 1W01A 1NU3A 3KSPA 3Q90A 1OHPA 1C7HA 2YFLB 1EG9B 5BVBA 1O7GB 3DMCA 4WP5A 1O7WB 3UJMA 2RCDA 1GS3A 4STDA 1W00A 1WQLB 3K0ZA 3KE7A 5IERA 1O7MB 3LZAA 5KP3A 1OCVA 4XB5A 5IG5A 1UUWB 3SOYA 4R9KA 5IG4A 3MG1A 1K41A 3SEDA 1IDPA 2I9WA 3VGNA 5STDA 2GBXB 3OWUA 3H51A 5D83A 3EF8A 2BMRB 1A2KA 1OH0A 2HMOB 2GEYA 3FKAA 5EVHA 2F99A 4WWUC 3H3HA 3EX9A 3EN8A 1STDA 5CXOA 3G16A 7STDA 2Z76A 4MJDA 4J8TA 3DZLA 2GXFA 4LMIA 2HMMB 1OPYA 3MG2A 5KP4A 2B24B 4L7KA 3B4PA 4FCMA 3NBRA 3F9SA 3EHCA 4Q53A 1TUHA 2GEXA 3BLZA 3G0KA 6STDA 1QJGA 3GZXB 5HGRA 4HZ9B 1S5AA 2HMJB 3HK4A 4HM1B 3NV0A 2Z7AA 2INXA 3OWSA 3FSDA 1DMMA 3GRDA 3HX8A 3D9RA 1E3RA 1CQSA 3CNMA 4L8OA 1Q40A 3CNXA 3T8NA 3G8ZA 2YFIB 4HM5B 1OHOA 3NM2A 1GYBA 2F86B 3ER7A 4U13A 4FCJA 5IF6A 1OGZA 3MYTA 3F8XA 2RGQA 3I0YA 3NUVA 5FW5A 1GY5A 3S5CA 1O7PB 3EN1B 3KZTA 3JUQA 3DM8A 2HMKB 1AR0A 3EJVA 4K1UA 2BMOB 2W2CA 3EC9A 8CHOA 3HZPA 3FLJA 4HM8B 5IENA 4OUQA 3RGRA 3ROBA 5AI1A 3M8CA 3NV0B 3EBTA 2CKFB 3T8UA 3UNLA 1JN5A 3MSOA 5CLKA 3RGAA 5BXQA 1JKGA 5CF1A 3B7CA 1GY6A 3OV4A 4XM4A 1O7HB 1VZZA 4N3VA 1Q40B 5TGNA 2QGUA 1TP6A 4HM7B 1ASKA 5DRVA 3OWYA 3GWRA 2XRXB 2Z77A 1QMAA 1W6YA 1OGXA 3SOAA 3VSYA 5IEPA 1SJWA 2OWPA 3B8LA 2BMQB 5JPUA 5AEUB 3FF2A 4LEHA 1JB5A 4CDLA 4RZMA 2JQ5A 3MHEA 3FGYA 1OF5A 4XBXA 1EA2A 5AEWB 5IG0A 1NWWA 3FF0A 3IPTA 2STDA 4XDVA 3EQQB 4HM0B 5D82A 5AIGA 4PEJA 5IEOA 1E97A 1JN5B 1JB2A 3LYGA 3BB9A 5G2GA 3CPOA 4HZBB 1JKGB 4J9AA 1U5OA 1E3VA 1BUQA 3NHXA 3FH1A 2HMNB 2YFJB 3F14A 4R9LA 3B4OA 2QIYA 1UUVB 4LGQA 5CK6A 3DXOA 3DUKA 2R4IA 2CHCA 3GZBA 4XBYA 4WYKA 3FZWA 3GZYB 1ULIB 1ULJB 3F7SA 4X2HA 2PZVA 3F8HA 3MKIA 1OF5B 1HKXA 4HKVB 3OX9A 1DMQA 4XBTA 4OVMA 2K54A 5DREA 2B1XB 3ECFA 4K1VA
chains in the Genus database with same CATH superfamily
3F7XA 1LOWA 3BIRA 4WFOA 3DGOA 3CC73 1JJ22 1RSNA 1LQMB 1Q7Y4 3X41A 3I553 1UCLA 3ZG5A 1RJOA 1OHSA 1US1A 4HJLB 4HM2B 3OXAA 4WHAA 4HM3B 2UX0A 5IG3A 1VQ63 3LT8A 5KP1A 2IUJA 2C10A 3PXMA 4H61A 4AKYA 3CCU3 4IIAA 5FGOA 1VQQA 5M18A 2GBWB 2RFRA 1I8VA 5ELJA 1GD3A 3PGBA 4N6TA 3GZRA 3E99A 1B21A 1IQYA 3CME3 1NO3A 1BVIA 5D81A 3HI7A 3CMA3 1Q42A 1L5GB 3STDA 4KVHA 1CYUA 1WMNA 1GY7A 5AIFA 1Q7HA 2OQEC 3G713 1BRJA 5AIIA 2F98A 2ML6A 4BTXA 2F5MA 3KKGA 3PCRA 3WMDA 1YGWA 3MPHA 2XFTA 3A76A 2XSOB 3DGYA 4R80A 1ZO2A 3FG4A 3MG3A 2XR8B 3O8YA 2PNCA 4HM4B 4R1KA 1BSCA 4ORLA 3I563 1BSEA 3JUOA 2CG1A 1NDOB 1RTUA 3PYJA 5EEOA 1ISKA 1W02A 5CF2A 1UW1A 2BNGA 1ZX2A 4H3UA 4CJNA 2L1SA 2XSHB 2HMLB 1YJN3 3NXJA 2IMJA 1T5YA 1UDII 4I4KA 4GB5A 4HVNA 1AVLA 1TTOA 1DMNA 4XDWA 3JUPA 3JUNA 3F40A 1W6CA 1JNQA 1N5HA 3CU3A 1NB5I 4L8PA 1O7NB 1GOUA 3S28A 1FGOA 5AIHA 4WYKB 1Z1SA 1IQ8A 1GOYA 1K734 1SIHA 1DYUA 1OUNA 7RNTA 2Y73A 3JUMA 1F8NA 4HM6B 1WNHA 1RGCA 3K7CA 3V98A 4FR9A 2P0XA 5RNTA 2A15A 1JB4A 1RNTA 6RNTA 5JPPA 4IT7A 4LZIA 1TRQA 2D42A 2Z6BA 3EBYA 1VQO3 4X2OA 1W01A 5AYRB 1I2GA 1Q814 2KXGA 1NU3A 3KSPA 2ZL8A 3Q90A 2P0MA 1OHPA 1C7HA 2FXTA 2YFLB 1EG9B 1MNLA 3Q2PA 5BVBA 3WODG 4RBNA 1BNFA 4EW5A 2XGLA 1O7GB 1UCKA 3A5EA 3DMCA 4BIRA 1U8CB 2OQEA 2C11A 4WP5A 3UL5A 1R4CA 3CD63 1IK3A 4FCZA 1UCIA 4K90B 1O7WB 1ROAA 1KD14 3CC43 1IU7A 1DE3A 1EKMA 3UJMA 1BNJA 2RCDA 1I3IA 4CPKA 2CWUA 1FYSA 1GS3A 3D5GA 3UB1A 1FZUA 3DGNA 4STDA 1N9JA 1FW7A 4HAAA 1I2EA 1PYLA 1W00A 1WQLB 1RN7A 2M7OA 1RRHA 1CEWI 1YVBI 3K0ZA 4EV5A 3KE7A 1JRQA 5IERA 1O7MB 1KSIA 2SARA 3LZAA 5KP3A 1OCVA 4JRFA 4XB5A 1V57A 5IG5A 3Q1CA 1UUWB 4O8SA 3SOYA 2LYXA 1OACA 4R9KA 4N6MA 3KSED 1T2HA 3CCM3 3G4S3 4K61A 2CC3A 1D6ZA 3KN4A 3CCE3 1QVG2 1WTHA 1BSBA 3PS8A 3CCL3 5IG4A 3MG1A 1K41A 4HOHA 1VQ53 5GSPA 1B20A 2R41A 4GSPA 3K63A 1CYVA 3SEDA 1RGFA 1D6YA 3RDEA 1IDPA 2I9WA 1MOLA 1LNHA 1JBTA 4N6NB 3VGNA 5STDA 3S67A 2GBXB 3OWUA 1M9GA 1X1UA 1M1XB 3HOHA 2FGTA 3K5TA 3H51A 5D83A 3EF8A 4FMBA 2WGQA 1IVUA 1A67A 2BMRB 1A2KA 1YJW3 1OH0A 2HMOB 2GEYA 2CFGA 2KF4A 1RN1A 2KCDA 2JDIH 3D4AA 2H0HA 3FKAA 4N6OB 3CPW2 1UI7A 1BANA 5EVHA 2F99A 1LNIA 2ZHXB 1YJ93 1JBSA 1RN4A 3LH4A 4BL2A 4WWUC 3H3HA 1MWSA 3EX9A 2Y74A 3EN8A 1R4YA 3SLUA 1STDA 3LTAA 5CXOA 2YX9A 4G1MB 3G16A 3NX0A 4O02B 3X40A 7STDA 3CC23 2Z76A 3QK9A 4MJDA 3G6E3 1N8R4 1RHLA 4J8TA 1BNGA 3N9HA 1BNSA 2CFDA 2CFKA 2H0GA 1NB3I 2K0MA 4NPBA 3UL6A 3J7Yd 3DZLA 1AVKA 1IV7A 4ZM8A 5A0OB 1KWIA 2GXFA 4LMIA 1J2BA 1TRPA 2HMMB 1YIT3 1OPYA 3MG2A 3CCS3 3BNDA 4EYCA 2B24B 5KP4A 1IQXA 4L7KA 4EXRA 3LTBA 3B4PA 1WMPA 2D1WA 2CWVA 4FCMA 1IT8A 3NBRA 3EE1A 1I3FA 2CX0A 3AGOA 1A2VA 3F9SA 1EQKA 1YVSA 3N54B 3EHCA 4Q53A 1BRGA 3OW22 3FG1A 2W9QA 1IVXA 1TUHA 2GEXA 1GOVA 3BLZA 3G0KA 4RNZA 1QJGA 6STDA 3GZXB 2KF5A 5HGRA 4HZ9B 1EEJA 2CIUA 1S5AA 2BO9B 1LOXA 2HMJB 1AV4A 1JV2B 3GSPA 2E2VA 3HK4A 3BNBA 4HM1B 1IVVA 1HU9A 1AQZA 2GU3A 1VQM3 3NV0A 3CCQ3 3BNCA 1B2UA 2Z7AA 4LYLB 2INXA 2WOFA 3OWSA 4NREA 3S29A 3FSDA 2IYJA 1DMMA 3GRDA 3HX8A 1C54A 1W7CA 4NHFA 3D9RA 1E3RA 2P05A 3EB8A 1VQ43 1RCLA 3WA2X 1CQSA 2H0IA 3N8BA 3CNMA 3DY5A 2E2TA 3PCSA 4L8OA 3WR2A 2XH9A 1YI23 3FCSB 3ALAA 2O9UX 1BRIA 1Q40A 1IT7A 1A2PA 1ZS7A 3CNXA 3NBJA 2V1LA 3SVAA 4I5QA 3T8NA 1RGEA 1RKYA 4TX4A 1K28A 1HZ1A 5BIRA 3WA3A 3HIIA 2BU4A 2Q07A 5IW9A 3G8ZA 2YFIB 3LMLA 3LTCA 2KF3A 2HOHA 1X1XA 1OHOA 4HM5B 3NM2A 5I97A 1GYBA 3FG3A 3JVCA 1RDSA 2F86B 3K9MC 3ER7A 4U13A 2W03A 2IY2A 2CG0A 4FCJA 1BSAA 1TU5A 3KIIA 1FUSA 5IF6A 2OCTA 1OGZA 3SXXA 1VQ93 3LT9A 3MYTA 1RMSA 3F8XA 2RGQA 1V58A 3I0YA 3NUVA 4KFFA 2SBLA 5LC7A 5FW5A 3URPA 8RNTA 1JBRA 1G96A 1GY5A 3S5CA 1LOVA 1O7PB 1RNBA 4DKIA 3BU4A 1GMPA 2MF7A 1YGEA 2KRTA 3DGLA 4BTYA 2QA43 1M1K4 3EN1B 3KZTA 1ROVA 3JUQA 3DM8A 3CXC2 1BNEA 2HMKB 1AR0A 3EJVA 4MEIA 1Q824 1A90A 1BAOA 4K1UA 2BMOB 2W2CA 1B3SA 3EC9A 5M1AA 2WO0A 8CHOA 3SYUA 1GMQA 1MGWA 3KFQC 9RNTA 3AHSA 3CCV3 1N8QA 1W6GA 5HOHA 3HZPA 3FLJA 4HM8B 3PZWA 3D79A 2F56A 5IENA 2IA7A 4OUQA 1W4NA 3RGRA 1BU4A 4KT3B 3ROBA 5AI1A 1BOXA 3IJEB 3M8CA 2GU1A 4KFDA 3U1WA 3NV0B 1UCJA 2CKFB 3EBTA 1WMOA 3T8UA 3UNLA 4EC6A 1FGMA 3ZFZA 4ILFA 1BNRA 1JN5A 3D5IA 1SARA 3LXUX 3MSOA 5CLKA 3RGAA 4EBGA 5BXQA 1BRNL 1EUIC 1JKGA 1DVDA 5CF1A 1RGHA 4O2HA 4CCVA 3B7CA 3NQZA 5G1KA 5EQLA 1B2MA 1GY6A 3OV4A 5ELUA 1MWUA 2BHMA 1UI8A 2KAAA 4XM4A 3X3ZA 1TFKA 3X3XA 1O7HB 2AAEA 4FMCA 1TJDA 1VZZA 4MMZB 1BUJA 1IVWA 4N3VA 1Q40B 3KCHA 5TGNA 2QGUA 1JZOA 1TP6A 4HM7B 1ASKA 3AMOA 3OWYA 5DRVA 3GWRA 1MGRA 2P09A 2CX1A 2XRXB 4MMXB 2Z77A 4N6LA 1QMAA 2WOHA 4FMDA 1W6YA 3V99A 1OGXA 1I0VA 1MWTA 1FUWA 2RNTA 3SOAA 1K9M4 3VSYA 5IEPA 4GL6A 2L4VA 2ZA4A 4HBRA 1SJWA 1B2XA 1QALA 2AADA 4BL3A 2BIRA 2OWPA 3IMAB 3B8LA 1SQWA 1DETA 2BMQB 2O3OA 4RNTA 1LXEA 4BTWA 1GD4A 5JPUA 5AEUB 4N6UA 2FNQA 4BU4A 2OTL3 3FF2A 4LEHA 1JB5A 4CDLA 5M19A 2GSPA 1HYFA 2W04A 4RZMA 2JQ5A 1Q864 3MHEA 5AYSC 3FGYA 2CWTA 1RCKA 1BSDA 1SPUA 3CCR3 1KQS2 2CH9A 2UGIA 1STFI 2IUKA 3HIGA 3S27A 1QVF2 1BRHA 1CH0A 1T2IA 1OF5A 4XBXA 1FGQA 4O3VA 1NJI4 1EA2A 1X1WA 1G0TA 6GSPA 1PU4A 3TDGA 5AEWB 4N6V0 1NWWA 3FF0A 3IPTA 5IG0A 4AKZA 1YHQ3 2XGNA 1LRAA 2STDA 2ML5A 4XDVA 4JF8A 3EQQB 1BRKA 1I0XA 3CCJ3 3LTDA 4HM0B 1V74A 4MMYB 3D3LA 4FMAA 2K3DA 2E2UA 5D82A 3U97A 1GSPA 2CFLA 5AIGA 4PEJA 2W56A 5IEOA 1W2B2 3V92A 3LOYA 1E97A 1BIRA 1JN5B 1JB2A 1RGLA 3LYGA 3QRDA 3BB9A 3L0RA 1VQP3 5G2GA 4OK0A 3CPOA 4HZBB 1KC84 1IV9A 2MC8A 3SX1A 1JKGB 2OOVC 1Q9EA 4KFEA 3VF1A 4EV2A 4J5KA 1QAKA 4J9AA 2ZDJA 2W9PA 1MWRA 1RGAA 1UUGB 1U5OA 1BGSA 1E3VA 1NNVA 1T3BA 3BNEA 3AHWA 1S723 3X42A 2QEX3 1BUQA 5BU4A 1ZGXA 4KZ1A 4R4KA 2XEPA 2KF6A 1N9EA 4GHOA 3NHXA 1B2ZA 2RBIA 2W0QA 2WGOA 3AMOB 2UUGC 3FH1A 4AEQA 1IYYA 1W5ZA 3NQYA 2CK3H 4J5GA 3WOFB 1X1YA 3DH2A 1PY3A 2HMNB 3MWZA 4RNYA 1LOYA 3WHOA 1BNIA 1N5PA 2P38A 2YFJB 5G1LA 1RGKA 1FGTA 1SIIA 1B2SA 2OTJ3 1UGHI 3F14A 4R9LA 1M904 3AGNA 2F4YA 3ZG0A 3DGMA 1RRLA 4QWTA 4IPBA 1QAFA 3B4OA 3X3YA 2QIYA 1FUTA 1G02A 1RLSA 3WOEB 5JBSA 1UUVB 1D6UA 2CW9A 4LGQA 1TIJA 5CK6A 4HYZA 1W2ZA 1DVCA 3DXOA 4LSOA 3DUKA 7GSPA 1I70A 1VQN3 1JZDA 3NBBA 2R4IA 2CFWA 1VQK3 3T0UA 2CHCA 3GZBA 4WYKA 4XBYA 1K8A4 3FZWA 3GZYB 1ULIB 1ULJB 3F7SA 4X2HA 2PZVA 1YIJ3 1GMRA 3F8HA 3MKIA 1OF5B 1HKXA 2W56B 1BRSA 2W6JH 4HKVB 3OX9A 1DMQA 2RSXA 3Q3FA 1YNVX 4XBTA 1RGGA 2XFSA 4OVMA 1Y4KA 2K54A 2LQVA 1VQL3 2XF3A 3RNTA 1LVNA 3GAXA 1FA3A 1VQ73 1FGRA 3NM7A 2BT3A 1B27A 5DREA 2B1XB 3WDGB 5LC6A 2OOVA 1VQ83 2F5WA 1I2FA 1LQGC 1PFPA 3ECFA 4K1VA 1TFOA 1UGIA 1AY7A 2C4BA 2J8XB
chains in the Genus database with same CATH topology
3F7XA 4WFOA 3DGOA 3CC73 1JJ22 1Q7Y4 3X41A 3I553 1RJOA 1OHSA 1US1A 4HJLB 4HM2B 3OXAA 4WHAA 4HM3B 2UX0A 5IG3A 1VQ63 3LT8A 5KP1A 2IUJA 2C10A 3PXMA 4H61A 4AKYA 3CCU3 4IIAA 5FGOA 2GBWB 2RFRA 5ELJA 1GD3A 3PGBA 4N6TA 3GZRA 3E99A 1IQYA 3CME3 1NO3A 5D81A 3HI7A 3CMA3 1Q42A 1L5GB 3STDA 4KVHA 1CYUA 1WMNA 1GY7A 5AIFA 2OQEC 3G713 5AIIA 2F98A 2ML6A 4BTXA 3KKGA 3PCRA 3WMDA 3MPHA 2XFTA 3A76A 2XSOB 4R80A 1ZO2A 3FG4A 3MG3A 2XR8B 3O8YA 2PNCA 4HM4B 4R1KA 4ORLA 3I563 3JUOA 2CG1A 1NDOB 3PYJA 5EEOA 1ISKA 1W02A 5CF2A 1UW1A 2BNGA 1ZX2A 4H3UA 2XSHB 2HMLB 1YJN3 3NXJA 2IMJA 1T5YA 4I4KA 4GB5A 4HVNA 1AVLA 1DMNA 4XDWA 3JUPA 3JUNA 3F40A 1W6CA 1JNQA 1N5HA 3CU3A 1NB5I 4L8PA 1O7NB 3S28A 1FGOA 5AIHA 4WYKB 1Z1SA 1IQ8A 1K734 1SIHA 1DYUA 1OUNA 2Y73A 3JUMA 1F8NA 4HM6B 1WNHA 3K7CA 3V98A 4FR9A 2P0XA 2A15A 1JB4A 5JPPA 4IT7A 4LZIA 2D42A 2Z6BA 3EBYA 1VQO3 4X2OA 1W01A 5AYRB 1Q814 2KXGA 1NU3A 3KSPA 2ZL8A 3Q90A 2P0MA 1OHPA 1C7HA 2FXTA 2YFLB 1EG9B 1MNLA 3Q2PA 5BVBA 3WODG 4RBNA 2XGLA 1O7GB 3DMCA 1U8CB 2OQEA 2C11A 4WP5A 3UL5A 1R4CA 3CD63 1IK3A 4FCZA 4K90B 1O7WB 1ROAA 1KD14 3CC43 1IU7A 1EKMA 3UJMA 2RCDA 2CWUA 1GS3A 3UB1A 3DGNA 4STDA 1N9JA 1W00A 1WQLB 1RN7A 2M7OA 1RRHA 1CEWI 1YVBI 3K0ZA 4EV5A 3KE7A 1JRQA 5IERA 1O7MB 1KSIA 3LZAA 5KP3A 1OCVA 4JRFA 4XB5A 5IG5A 3Q1CA 1UUWB 4O8SA 3SOYA 2LYXA 1OACA 4R9KA 4N6MA 3KSED 3CCM3 3G4S3 4K61A 2CC3A 1D6ZA 3KN4A 3CCE3 1QVG2 1WTHA 3PS8A 3CCL3 5IG4A 3MG1A 1K41A 1VQ53 3K63A 1CYVA 3SEDA 1D6YA 3RDEA 1IDPA 2I9WA 1MOLA 1LNHA 4N6NB 3VGNA 5STDA 3S67A 2GBXB 3OWUA 1M9GA 1M1XB 2FGTA 3K5TA 3H51A 5D83A 3EF8A 4FMBA 2WGQA 1IVUA 2BMRB 1A2KA 1OH0A 2HMOB 2GEYA 2CFGA 3FKAA 4N6OB 2KCDA 2JDIH 3CPW2 1YJW3 1A67A 1UI7A 5EVHA 2F99A 1YJ93 3LH4A 4WWUC 3H3HA 3EX9A 2Y74A 3EN8A 3SLUA 1STDA 3LTAA 5CXOA 2YX9A 4G1MB 3G16A 3NX0A 4O02B 3X40A 7STDA 3CC23 2Z76A 3QK9A 4MJDA 3G6E3 1N8R4 4J8TA 3N9HA 2CFDA 2CFKA 1NB3I 2K0MA 3UL6A 3J7Yd 3DZLA 1AVKA 1IV7A 4ZM8A 5A0OB 1KWIA 2GXFA 4LMIA 1J2BA 2HMMB 1YIT3 1OPYA 3MG2A 3CCS3 3BNDA 4EYCA 2B24B 5KP4A 1IQXA 4L7KA 4EXRA 3LTBA 3B4PA 1WMPA 2D1WA 2CWVA 4FCMA 1IT8A 3NBRA 3EE1A 1A2VA 3F9SA 1EQKA 3N54B 3EHCA 4Q53A 3OW22 3FG1A 2W9QA 1IVXA 1TUHA 2GEXA 3BLZA 3G0KA 4RNZA 1QJGA 6STDA 3GZXB 5HGRA 4HZ9B 2CIUA 1S5AA 2BO9B 1LOXA 2HMJB 1AV4A 1JV2B 2E2VA 3HK4A 3BNBA 4HM1B 1IVVA 1HU9A 2GU3A 1VQM3 3NV0A 3CCQ3 3BNCA 2Z7AA 2INXA 2WOFA 3OWSA 4NREA 3S29A 3FSDA 1DMMA 3GRDA 3HX8A 1W7CA 4NHFA 3D9RA 1E3RA 2P05A 3EB8A 1VQ43 3WA2X 1CQSA 3N8BA 3CNMA 3DY5A 2E2TA 3PCSA 4L8OA 2XH9A 1YI23 3FCSB 3ALAA 2O9UX 1Q40A 1IT7A 3CNXA 3NBJA 2V1LA 3SVAA 3T8NA 1RKYA 4TX4A 1K28A 3WA3A 3HIIA 2Q07A 5IW9A 3G8ZA 2YFIB 3LMLA 3LTCA 4HM5B 1OHOA 3NM2A 5I97A 1GYBA 3FG3A 3JVCA 2F86B 3K9MC 3ER7A 4U13A 2W03A 2CG0A 4FCJA 1TU5A 3KIIA 5IF6A 2OCTA 1OGZA 3SXXA 1VQ93 3LT9A 3MYTA 3F8XA 2RGQA 3I0YA 3NUVA 5LC7A 4KFFA 2SBLA 5FW5A 1G96A 1GY5A 3S5CA 1O7PB 2MF7A 1YGEA 2KRTA 3DGLA 4BTYA 2QA43 1M1K4 3EN1B 3KZTA 1ROVA 3JUQA 3DM8A 3CXC2 2HMKB 1Q824 1AR0A 3EJVA 4MEIA 1A90A 4K1UA 2BMOB 2W2CA 3EC9A 2WO0A 8CHOA 3KFQC 3CCV3 1N8QA 1W6GA 3HZPA 3FLJA 4HM8B 3PZWA 5IENA 2IA7A 4OUQA 1W4NA 3RGRA 3ROBA 5AI1A 3IJEB 3M8CA 2GU1A 4KFDA 3U1WA 3NV0B 3EBTA 2CKFB 3T8UA 1WMOA 3UNLA 4EC6A 1FGMA 1JN5A 3LXUX 3MSOA 5CLKA 3RGAA 4EBGA 5BXQA 1JKGA 1DVDA 5CF1A 4O2HA 4CCVA 3B7CA 3NQZA 5EQLA 1GY6A 3OV4A 5ELUA 2BHMA 1UI8A 4XM4A 3X3ZA 1TFKA 3X3XA 1O7HB 4FMCA 1VZZA 4MMZB 1IVWA 4N3VA 1Q40B 5TGNA 2QGUA 1TP6A 4HM7B 1ASKA 3AMOA 3OWYA 5DRVA 3GWRA 2P09A 4N6LA 2XRXB 4MMXB 2Z77A 1QMAA 2WOHA 4FMDA 1W6YA 3V99A 1OGXA 1FUWA 1K9M4 3SOAA 3VSYA 5IEPA 4GL6A 2L4VA 4HBRA 1SJWA 1QALA 2OWPA 3IMAB 3B8LA 1SQWA 2BMQB 2O3OA 1LXEA 4BTWA 1GD4A 5JPUA 5AEUB 4N6UA 2FNQA 2OTL3 3FF2A 4LEHA 1JB5A 4CDLA 2W04A 4RZMA 2JQ5A 1Q864 3MHEA 5AYSC 3FGYA 2CWTA 1SPUA 3CCR3 1KQS2 2CH9A 1STFI 2IUKA 3HIGA 3S27A 1QVF2 1OF5A 4XBXA 1FGQA 4O3VA 1NJI4 1EA2A 1PU4A 3TDGA 5AEWB 4N6V0 1NWWA 3FF0A 3IPTA 5IG0A 4AKZA 1YHQ3 2XGNA 2STDA 2ML5A 4XDVA 4JF8A 3EQQB 3CCJ3 3LTDA 4HM0B 1V74A 4MMYB 3D3LA 4FMAA 5D82A 2E2UA 3U97A 2CFLA 5AIGA 4PEJA 2W56A 5IEOA 1W2B2 3V92A 3LOYA 1E97A 1JN5B 1JB2A 3QRDA 3LYGA 1VQP3 3BB9A 3L0RA 5G2GA 4OK0A 3CPOA 4HZBB 1KC84 1IV9A 2MC8A 3SX1A 1JKGB 2OOVC 4KFEA 3VF1A 4EV2A 1QAKA 4J9AA 2ZDJA 2W9PA 1U5OA 1E3VA 3BNEA 1S723 3X42A 2QEX3 1BUQA 4KZ1A 4R4KA 2XEPA 1N9EA 3NHXA 2WGOA 2W0QA 3AMOB 3FH1A 4AEQA 1W5ZA 3NQYA 2CK3H 3WOFB 2HMNB 3MWZA 4RNYA 1N5PA 2P38A 2YFJB 1FGTA 1SIIA 2OTJ3 3F14A 4R9LA 1M904 3DGMA 1RRLA 4QWTA 4IPBA 1QAFA 3B4OA 3X3YA 2QIYA 3WOEB 5JBSA 1UUVB 1D6UA 2CW9A 4LGQA 1TIJA 5CK6A 4HYZA 1W2ZA 1DVCA 3DXOA 4LSOA 3DUKA 1VQN3 3NBBA 2R4IA 2CFWA 1VQK3 3T0UA 2CHCA 3GZBA 4WYKA 4XBYA 1K8A4 3FZWA 3GZYB 1ULIB 1ULJB 3F7SA 4X2HA 2PZVA 1YIJ3 3F8HA 3MKIA 1OF5B 1HKXA 2W6JH 4HKVB 3OX9A 1DMQA 2RSXA 4XBTA 4OVMA 2XFSA 1Y4KA 2K54A 2LQVA 1VQL3 2XF3A 1FA3A 1LVNA 3GAXA 1VQ73 1FGRA 3NM7A 2BT3A 5DREA 2B1XB 3WDGB 5LC6A 2OOVA 1VQ83 1PFPA 3ECFA 4K1VA 1TFOA 2W56B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7X A;  1OHS A;  4HJL B;  4HM2 B;  3OXA A;  4HM3 B;  2UX0 A;  5IG3 A;  5KP1 A;  4IIA A;  2GBW B;  2RFR A;  3GZR A;  3E99 A;  5D81 A;  1Q42 A;  3STD A;  4KVH A;  1GY7 A;  5AIF A;  5AII A;  2F98 A;  3KKG A;  3WMD A;  3A76 A;  2XSO B;  1ZO2 A;  3MG3 A;  2XR8 B;  4HM4 B;  4R1K A;  4ORL A;  3JUO A;  1ISK A;  1NDO B;  1W02 A;  5CF2 A;  2BNG A;  1ZX2 A;  4H3U A;  2XSH B;  2HML B;  3NXJ A;  2IMJ A;  4I4K A;  4GB5 A;  4HVN A;  1DMN A;  4XDW A;  3JUP A;  3JUN A;  3F40 A;  3CU3 A;  4L8P A;  1O7N B;  5AIH A;  4WYK B;  1Z1S A;  1OUN A;  3JUM A;  4HM6 B;  3K7C A;  2A15 A;  1JB4 A;  5JPP A;  3EBY A;  4X2O A;  1W01 A;  1NU3 A;  3KSP A;  3Q90 A;  1OHP A;  1C7H A;  2YFL B;  1EG9 B;  5BVB A;  1O7G B;  3DMC A;  4WP5 A;  1O7W B;  3UJM A;  2RCD A;  1GS3 A;  4STD A;  1W00 A;  1WQL B;  3K0Z A;  3KE7 A;  5IER A;  1O7M B;  3LZA A;  5KP3 A;  1OCV A;  4XB5 A;  5IG5 A;  1UUW B;  3SOY A;  4R9K A;  5IG4 A;  3MG1 A;  1K41 A;  3SED A;  1IDP A;  2I9W A;  3VGN A;  5STD A;  2GBX B;  3OWU A;  3H51 A;  5D83 A;  3EF8 A;  2BMR B;  1A2K A;  1OH0 A;  2HMO B;  2GEY A;  3FKA A;  5EVH A;  2F99 A;  4WWU C;  3H3H A;  3EX9 A;  3EN8 A;  1STD A;  5CXO A;  3G16 A;  7STD A;  2Z76 A;  4MJD A;  4J8T A;  3DZL A;  2GXF A;  4LMI A;  2HMM B;  1OPY A;  3MG2 A;  5KP4 A;  2B24 B;  4L7K A;  3B4P A;  4FCM A;  3NBR A;  3F9S A;  3EHC A;  4Q53 A;  1TUH A;  2GEX A;  3BLZ A;  3G0K A;  6STD A;  1QJG A;  3GZX B;  5HGR A;  4HZ9 B;  1S5A A;  2HMJ B;  3HK4 A;  4HM1 B;  3NV0 A;  2Z7A A;  2INX A;  3OWS A;  3FSD A;  1DMM A;  3GRD A;  3HX8 A;  3D9R A;  1E3R A;  1CQS A;  3CNM A;  4L8O A;  1Q40 A;  3CNX A;  3T8N A;  3G8Z A;  2YFI B;  4HM5 B;  1OHO A;  3NM2 A;  1GYB A;  2F86 B;  3ER7 A;  4U13 A;  4FCJ A;  5IF6 A;  1OGZ A;  3MYT A;  3F8X A;  2RGQ A;  3I0Y A;  3NUV A;  5FW5 A;  1GY5 A;  3S5C A;  1O7P B;  3EN1 B;  3KZT A;  3JUQ A;  3DM8 A;  2HMK B;  1AR0 A;  3EJV A;  4K1U A;  2BMO B;  2W2C A;  3EC9 A;  8CHO A;  3HZP A;  3FLJ A;  4HM8 B;  5IEN A;  4OUQ A;  3RGR A;  3ROB A;  5AI1 A;  3M8C A;  3NV0 B;  3EBT A;  2CKF B;  3T8U A;  3UNL A;  1JN5 A;  3MSO A;  5CLK A;  3RGA A;  5BXQ A;  1JKG A;  5CF1 A;  3B7C A;  1GY6 A;  3OV4 A;  4XM4 A;  1O7H B;  1VZZ A;  4N3V A;  1Q40 B;  5TGN A;  2QGU A;  1TP6 A;  4HM7 B;  1ASK A;  5DRV A;  3OWY A;  3GWR A;  2XRX B;  2Z77 A;  1QMA A;  1W6Y A;  1OGX A;  3SOA A;  3VSY A;  5IEP A;  1SJW A;  2OWP A;  3B8L A;  2BMQ B;  5JPU A;  5AEU B;  3FF2 A;  4LEH A;  1JB5 A;  4CDL A;  4RZM A;  2JQ5 A;  3MHE A;  3FGY A;  1OF5 A;  4XBX A;  1EA2 A;  5AEW B;  5IG0 A;  1NWW A;  3FF0 A;  3IPT A;  2STD A;  4XDV A;  3EQQ B;  4HM0 B;  5D82 A;  5AIG A;  4PEJ A;  5IEO A;  1E97 A;  1JN5 B;  1JB2 A;  3LYG A;  3BB9 A;  5G2G A;  3CPO A;  4HZB B;  1JKG B;  4J9A A;  1U5O A;  1E3V A;  1BUQ A;  3NHX A;  3FH1 A;  2HMN B;  2YFJ B;  3F14 A;  4R9L A;  3B4O A;  2QIY A;  1UUV B;  4LGQ A;  5CK6 A;  3DXO A;  3DUK A;  2R4I A;  2CHC A;  3GZB A;  4XBY A;  4WYK A;  3FZW A;  3GZY B;  1ULI B;  1ULJ B;  3F7S A;  4X2H A;  2PZV A;  3F8H A;  3MKI A;  1OF5 B;  1HKX A;  4HKV B;  3OX9 A;  1DMQ A;  4XBT A;  4OVM A;  2K54 A;  5DRE A;  2B1X B;  3ECF A;  4K1V A; 
#chains in the Genus database with same CATH topology
 3F7X A;  1LOW A;  3BIR A;  4WFO A;  3DGO A;  3CC7 3;  1JJ2 2;  1RSN A;  1LQM B;  1Q7Y 4;  3X41 A;  3I55 3;  1UCL A;  3ZG5 A;  1RJO A;  1OHS A;  1US1 A;  4HJL B;  4HM2 B;  3OXA A;  4WHA A;  4HM3 B;  2UX0 A;  5IG3 A;  1VQ6 3;  3LT8 A;  5KP1 A;  2IUJ A;  2C10 A;  3PXM A;  4H61 A;  4AKY A;  3CCU 3;  4IIA A;  5FGO A;  1VQQ A;  5M18 A;  2GBW B;  2RFR A;  1I8V A;  5ELJ A;  1GD3 A;  3PGB A;  4N6T A;  3GZR A;  3E99 A;  1B21 A;  1IQY A;  3CME 3;  1NO3 A;  1BVI A;  5D81 A;  3HI7 A;  3CMA 3;  1Q42 A;  1L5G B;  3STD A;  4KVH A;  1CYU A;  1WMN A;  1GY7 A;  5AIF A;  1Q7H A;  2OQE C;  3G71 3;  1BRJ A;  5AII A;  2F98 A;  2ML6 A;  4BTX A;  2F5M A;  3KKG A;  3PCR A;  3WMD A;  1YGW A;  3MPH A;  2XFT A;  3A76 A;  2XSO B;  3DGY A;  4R80 A;  1ZO2 A;  3FG4 A;  3MG3 A;  2XR8 B;  3O8Y A;  2PNC A;  4HM4 B;  4R1K A;  1BSC A;  4ORL A;  3I56 3;  1BSE A;  3JUO A;  2CG1 A;  1NDO B;  1RTU A;  3PYJ A;  5EEO A;  1ISK A;  1W02 A;  5CF2 A;  1UW1 A;  2BNG A;  1ZX2 A;  4H3U A;  4CJN A;  2L1S A;  2XSH B;  2HML B;  1YJN 3;  3NXJ A;  2IMJ A;  1T5Y A;  1UDI I;  4I4K A;  4GB5 A;  4HVN A;  1AVL A;  1TTO A;  1DMN A;  4XDW A;  3JUP A;  3JUN A;  3F40 A;  1W6C A;  1JNQ A;  1N5H A;  3CU3 A;  1NB5 I;  4L8P A;  1O7N B;  1GOU A;  3S28 A;  1FGO A;  5AIH A;  4WYK B;  1Z1S A;  1IQ8 A;  1GOY A;  1K73 4;  1SIH A;  1DYU A;  1OUN A;  7RNT A;  2Y73 A;  3JUM A;  1F8N A;  4HM6 B;  1WNH A;  1RGC A;  3K7C A;  3V98 A;  4FR9 A;  2P0X A;  5RNT A;  2A15 A;  1JB4 A;  1RNT A;  6RNT A;  5JPP A;  4IT7 A;  4LZI A;  1TRQ A;  2D42 A;  2Z6B A;  3EBY A;  1VQO 3;  4X2O A;  1W01 A;  5AYR B;  1I2G A;  1Q81 4;  2KXG A;  1NU3 A;  3KSP A;  2ZL8 A;  3Q90 A;  2P0M A;  1OHP A;  1C7H A;  2FXT A;  2YFL B;  1EG9 B;  1MNL A;  3Q2P A;  5BVB A;  3WOD G;  4RBN A;  1BNF A;  4EW5 A;  2XGL A;  1O7G B;  1UCK A;  3A5E A;  3DMC A;  4BIR A;  1U8C B;  2OQE A;  2C11 A;  4WP5 A;  3UL5 A;  1R4C A;  3CD6 3;  1IK3 A;  4FCZ A;  1UCI A;  4K90 B;  1O7W B;  1ROA A;  1KD1 4;  3CC4 3;  1IU7 A;  1DE3 A;  1EKM A;  3UJM A;  1BNJ A;  2RCD A;  1I3I A;  4CPK A;  2CWU A;  1FYS A;  1GS3 A;  3D5G A;  3UB1 A;  1FZU A;  3DGN A;  4STD A;  1N9J A;  1FW7 A;  4HAA A;  1I2E A;  1PYL A;  1W00 A;  1WQL B;  1RN7 A;  2M7O A;  1RRH A;  1CEW I;  1YVB I;  3K0Z A;  4EV5 A;  3KE7 A;  1JRQ A;  5IER A;  1O7M B;  1KSI A;  2SAR A;  3LZA A;  5KP3 A;  1OCV A;  4JRF A;  4XB5 A;  1V57 A;  5IG5 A;  3Q1C A;  1UUW B;  4O8S A;  3SOY A;  2LYX A;  1OAC A;  4R9K A;  4N6M A;  3KSE D;  1T2H A;  3CCM 3;  3G4S 3;  4K61 A;  2CC3 A;  1D6Z A;  3KN4 A;  3CCE 3;  1QVG 2;  1WTH A;  1BSB A;  3PS8 A;  3CCL 3;  5IG4 A;  3MG1 A;  1K41 A;  4HOH A;  1VQ5 3;  5GSP A;  1B20 A;  2R41 A;  4GSP A;  3K63 A;  1CYV A;  3SED A;  1RGF A;  1D6Y A;  3RDE A;  1IDP A;  2I9W A;  1MOL A;  1LNH A;  1JBT A;  4N6N B;  3VGN A;  5STD A;  3S67 A;  2GBX B;  3OWU A;  1M9G A;  1X1U A;  1M1X B;  3HOH A;  2FGT A;  3K5T A;  3H51 A;  5D83 A;  3EF8 A;  4FMB A;  2WGQ A;  1IVU A;  1A67 A;  2BMR B;  1A2K A;  1YJW 3;  1OH0 A;  2HMO B;  2GEY A;  2CFG A;  2KF4 A;  1RN1 A;  2KCD A;  2JDI H;  3D4A A;  2H0H A;  3FKA A;  4N6O B;  3CPW 2;  1UI7 A;  1BAN A;  5EVH A;  2F99 A;  1LNI A;  2ZHX B;  1YJ9 3;  1JBS A;  1RN4 A;  3LH4 A;  4BL2 A;  4WWU C;  3H3H A;  1MWS A;  3EX9 A;  2Y74 A;  3EN8 A;  1R4Y A;  3SLU A;  1STD A;  3LTA A;  5CXO A;  2YX9 A;  4G1M B;  3G16 A;  3NX0 A;  4O02 B;  3X40 A;  7STD A;  3CC2 3;  2Z76 A;  3QK9 A;  4MJD A;  3G6E 3;  1N8R 4;  1RHL A;  4J8T A;  1BNG A;  3N9H A;  1BNS A;  2CFD A;  2CFK A;  2H0G A;  1NB3 I;  2K0M A;  4NPB A;  3UL6 A;  3J7Y d;  3DZL A;  1AVK A;  1IV7 A;  4ZM8 A;  5A0O B;  1KWI A;  2GXF A;  4LMI A;  1J2B A;  1TRP A;  2HMM B;  1YIT 3;  1OPY A;  3MG2 A;  3CCS 3;  3BND A;  4EYC A;  2B24 B;  5KP4 A;  1IQX A;  4L7K A;  4EXR A;  3LTB A;  3B4P A;  1WMP A;  2D1W A;  2CWV A;  4FCM A;  1IT8 A;  3NBR A;  3EE1 A;  1I3F A;  2CX0 A;  3AGO A;  1A2V A;  3F9S A;  1EQK A;  1YVS A;  3N54 B;  3EHC A;  4Q53 A;  1BRG A;  3OW2 2;  3FG1 A;  2W9Q A;  1IVX A;  1TUH A;  2GEX A;  1GOV A;  3BLZ A;  3G0K A;  4RNZ A;  1QJG A;  6STD A;  3GZX B;  2KF5 A;  5HGR A;  4HZ9 B;  1EEJ A;  2CIU A;  1S5A A;  2BO9 B;  1LOX A;  2HMJ B;  1AV4 A;  1JV2 B;  3GSP A;  2E2V A;  3HK4 A;  3BNB A;  4HM1 B;  1IVV A;  1HU9 A;  1AQZ A;  2GU3 A;  1VQM 3;  3NV0 A;  3CCQ 3;  3BNC A;  1B2U A;  2Z7A A;  4LYL B;  2INX A;  2WOF A;  3OWS A;  4NRE A;  3S29 A;  3FSD A;  2IYJ A;  1DMM A;  3GRD A;  3HX8 A;  1C54 A;  1W7C A;  4NHF A;  3D9R A;  1E3R A;  2P05 A;  3EB8 A;  1VQ4 3;  1RCL A;  3WA2 X;  1CQS A;  2H0I A;  3N8B A;  3CNM A;  3DY5 A;  2E2T A;  3PCS A;  4L8O A;  3WR2 A;  2XH9 A;  1YI2 3;  3FCS B;  3ALA A;  2O9U X;  1BRI A;  1Q40 A;  1IT7 A;  1A2P A;  1ZS7 A;  3CNX A;  3NBJ A;  2V1L A;  3SVA A;  4I5Q A;  3T8N A;  1RGE A;  1RKY A;  4TX4 A;  1K28 A;  1HZ1 A;  5BIR A;  3WA3 A;  3HII A;  2BU4 A;  2Q07 A;  5IW9 A;  3G8Z A;  2YFI B;  3LML A;  3LTC A;  2KF3 A;  2HOH A;  1X1X A;  1OHO A;  4HM5 B;  3NM2 A;  5I97 A;  1GYB A;  3FG3 A;  3JVC A;  1RDS A;  2F86 B;  3K9M C;  3ER7 A;  4U13 A;  2W03 A;  2IY2 A;  2CG0 A;  4FCJ A;  1BSA A;  1TU5 A;  3KII A;  1FUS A;  5IF6 A;  2OCT A;  1OGZ A;  3SXX A;  1VQ9 3;  3LT9 A;  3MYT A;  1RMS A;  3F8X A;  2RGQ A;  1V58 A;  3I0Y A;  3NUV A;  4KFF A;  2SBL A;  5LC7 A;  5FW5 A;  3URP A;  8RNT A;  1JBR A;  1G96 A;  1GY5 A;  3S5C A;  1LOV A;  1O7P B;  1RNB A;  4DKI A;  3BU4 A;  1GMP A;  2MF7 A;  1YGE A;  2KRT A;  3DGL A;  4BTY A;  2QA4 3;  1M1K 4;  3EN1 B;  3KZT A;  1ROV A;  3JUQ A;  3DM8 A;  3CXC 2;  1BNE A;  2HMK B;  1AR0 A;  3EJV A;  4MEI A;  1Q82 4;  1A90 A;  1BAO A;  4K1U A;  2BMO B;  2W2C A;  1B3S A;  3EC9 A;  5M1A A;  2WO0 A;  8CHO A;  3SYU A;  1GMQ A;  1MGW A;  3KFQ C;  9RNT A;  3AHS A;  3CCV 3;  1N8Q A;  1W6G A;  5HOH A;  3HZP A;  3FLJ A;  4HM8 B;  3PZW A;  3D79 A;  2F56 A;  5IEN A;  2IA7 A;  4OUQ A;  1W4N A;  3RGR A;  1BU4 A;  4KT3 B;  3ROB A;  5AI1 A;  1BOX A;  3IJE B;  3M8C A;  2GU1 A;  4KFD A;  3U1W A;  3NV0 B;  1UCJ A;  2CKF B;  3EBT A;  1WMO A;  3T8U A;  3UNL A;  4EC6 A;  1FGM A;  3ZFZ A;  4ILF A;  1BNR A;  1JN5 A;  3D5I A;  1SAR A;  3LXU X;  3MSO A;  5CLK A;  3RGA A;  4EBG A;  5BXQ A;  1BRN L;  1EUI C;  1JKG A;  1DVD A;  5CF1 A;  1RGH A;  4O2H A;  4CCV A;  3B7C A;  3NQZ A;  5G1K A;  5EQL A;  1B2M A;  1GY6 A;  3OV4 A;  5ELU A;  1MWU A;  2BHM A;  1UI8 A;  2KAA A;  4XM4 A;  3X3Z A;  1TFK A;  3X3X A;  1O7H B;  2AAE A;  4FMC A;  1TJD A;  1VZZ A;  4MMZ B;  1BUJ A;  1IVW A;  4N3V A;  1Q40 B;  3KCH A;  5TGN A;  2QGU A;  1JZO A;  1TP6 A;  4HM7 B;  1ASK A;  3AMO A;  3OWY A;  5DRV A;  3GWR A;  1MGR A;  2P09 A;  2CX1 A;  2XRX B;  4MMX B;  2Z77 A;  4N6L A;  1QMA A;  2WOH A;  4FMD A;  1W6Y A;  3V99 A;  1OGX A;  1I0V A;  1MWT A;  1FUW A;  2RNT A;  3SOA A;  1K9M 4;  3VSY A;  5IEP A;  4GL6 A;  2L4V A;  2ZA4 A;  4HBR A;  1SJW A;  1B2X A;  1QAL A;  2AAD A;  4BL3 A;  2BIR A;  2OWP A;  3IMA B;  3B8L A;  1SQW A;  1DET A;  2BMQ B;  2O3O A;  4RNT A;  1LXE A;  4BTW A;  1GD4 A;  5JPU A;  5AEU B;  4N6U A;  2FNQ A;  4BU4 A;  2OTL 3;  3FF2 A;  4LEH A;  1JB5 A;  4CDL A;  5M19 A;  2GSP A;  1HYF A;  2W04 A;  4RZM A;  2JQ5 A;  1Q86 4;  3MHE A;  5AYS C;  3FGY A;  2CWT A;  1RCK A;  1BSD A;  1SPU A;  3CCR 3;  1KQS 2;  2CH9 A;  2UGI A;  1STF I;  2IUK A;  3HIG A;  3S27 A;  1QVF 2;  1BRH A;  1CH0 A;  1T2I A;  1OF5 A;  4XBX A;  1FGQ A;  4O3V A;  1NJI 4;  1EA2 A;  1X1W A;  1G0T A;  6GSP A;  1PU4 A;  3TDG A;  5AEW B;  4N6V 0;  1NWW A;  3FF0 A;  3IPT A;  5IG0 A;  4AKZ A;  1YHQ 3;  2XGN A;  1LRA A;  2STD A;  2ML5 A;  4XDV A;  4JF8 A;  3EQQ B;  1BRK A;  1I0X A;  3CCJ 3;  3LTD A;  4HM0 B;  1V74 A;  4MMY B;  3D3L A;  4FMA A;  2K3D A;  2E2U A;  5D82 A;  3U97 A;  1GSP A;  2CFL A;  5AIG A;  4PEJ A;  2W56 A;  5IEO A;  1W2B 2;  3V92 A;  3LOY A;  1E97 A;  1BIR A;  1JN5 B;  1JB2 A;  1RGL A;  3LYG A;  3QRD A;  3BB9 A;  3L0R A;  1VQP 3;  5G2G A;  4OK0 A;  3CPO A;  4HZB B;  1KC8 4;  1IV9 A;  2MC8 A;  3SX1 A;  1JKG B;  2OOV C;  1Q9E A;  4KFE A;  3VF1 A;  4EV2 A;  4J5K A;  1QAK A;  4J9A A;  2ZDJ A;  2W9P A;  1MWR A;  1RGA A;  1UUG B;  1U5O A;  1BGS A;  1E3V A;  1NNV A;  1T3B A;  3BNE A;  3AHW A;  1S72 3;  3X42 A;  2QEX 3;  1BUQ A;  5BU4 A;  1ZGX A;  4KZ1 A;  4R4K A;  2XEP A;  2KF6 A;  1N9E A;  4GHO A;  3NHX A;  1B2Z A;  2RBI A;  2W0Q A;  2WGO A;  3AMO B;  2UUG C;  3FH1 A;  4AEQ A;  1IYY A;  1W5Z A;  3NQY A;  2CK3 H;  4J5G A;  3WOF B;  1X1Y A;  3DH2 A;  1PY3 A;  2HMN B;  3MWZ A;  4RNY A;  1LOY A;  3WHO A;  1BNI A;  1N5P A;  2P38 A;  2YFJ B;  5G1L A;  1RGK A;  1FGT A;  1SII A;  1B2S A;  2OTJ 3;  1UGH I;  3F14 A;  4R9L A;  1M90 4;  3AGN A;  2F4Y A;  3ZG0 A;  3DGM A;  1RRL A;  4QWT A;  4IPB A;  1QAF A;  3B4O A;  3X3Y A;  2QIY A;  1FUT A;  1G02 A;  1RLS A;  3WOE B;  5JBS A;  1UUV B;  1D6U A;  2CW9 A;  4LGQ A;  1TIJ A;  5CK6 A;  4HYZ A;  1W2Z A;  1DVC A;  3DXO A;  4LSO A;  3DUK A;  7GSP A;  1I70 A;  1VQN 3;  1JZD A;  3NBB A;  2R4I A;  2CFW A;  1VQK 3;  3T0U A;  2CHC A;  3GZB A;  4WYK A;  4XBY A;  1K8A 4;  3FZW A;  3GZY B;  1ULI B;  1ULJ B;  3F7S A;  4X2H A;  2PZV A;  1YIJ 3;  1GMR A;  3F8H A;  3MKI A;  1OF5 B;  1HKX A;  2W56 B;  1BRS A;  2W6J H;  4HKV B;  3OX9 A;  1DMQ A;  2RSX A;  3Q3F A;  1YNV X;  4XBT A;  1RGG A;  2XFS A;  4OVM A;  1Y4K A;  2K54 A;  2LQV A;  1VQL 3;  2XF3 A;  3RNT A;  1LVN A;  3GAX A;  1FA3 A;  1VQ7 3;  1FGR A;  3NM7 A;  2BT3 A;  1B27 A;  5DRE A;  2B1X B;  3WDG B;  5LC6 A;  2OOV A;  1VQ8 3;  2F5W A;  1I2F A;  1LQG C;  1PFP A;  3ECF A;  4K1V A;  1TFO A;  1UGI A;  1AY7 A;  2C4B A;  2J8X B; 
#chains in the Genus database with same CATH homology
 3F7X A;  4WFO A;  3DGO A;  3CC7 3;  1JJ2 2;  1Q7Y 4;  3X41 A;  3I55 3;  1RJO A;  1OHS A;  1US1 A;  4HJL B;  4HM2 B;  3OXA A;  4WHA A;  4HM3 B;  2UX0 A;  5IG3 A;  1VQ6 3;  3LT8 A;  5KP1 A;  2IUJ A;  2C10 A;  3PXM A;  4H61 A;  4AKY A;  3CCU 3;  4IIA A;  5FGO A;  2GBW B;  2RFR A;  5ELJ A;  1GD3 A;  3PGB A;  4N6T A;  3GZR A;  3E99 A;  1IQY A;  3CME 3;  1NO3 A;  5D81 A;  3HI7 A;  3CMA 3;  1Q42 A;  1L5G B;  3STD A;  4KVH A;  1CYU A;  1WMN A;  1GY7 A;  5AIF A;  2OQE C;  3G71 3;  5AII A;  2F98 A;  2ML6 A;  4BTX A;  3KKG A;  3PCR A;  3WMD A;  3MPH A;  2XFT A;  3A76 A;  2XSO B;  4R80 A;  1ZO2 A;  3FG4 A;  3MG3 A;  2XR8 B;  3O8Y A;  2PNC A;  4HM4 B;  4R1K A;  4ORL A;  3I56 3;  3JUO A;  2CG1 A;  1NDO B;  3PYJ A;  5EEO A;  1ISK A;  1W02 A;  5CF2 A;  1UW1 A;  2BNG A;  1ZX2 A;  4H3U A;  2XSH B;  2HML B;  1YJN 3;  3NXJ A;  2IMJ A;  1T5Y A;  4I4K A;  4GB5 A;  4HVN A;  1AVL A;  1DMN A;  4XDW A;  3JUP A;  3JUN A;  3F40 A;  1W6C A;  1JNQ A;  1N5H A;  3CU3 A;  1NB5 I;  4L8P A;  1O7N B;  3S28 A;  1FGO A;  5AIH A;  4WYK B;  1Z1S A;  1IQ8 A;  1K73 4;  1SIH A;  1DYU A;  1OUN A;  2Y73 A;  3JUM A;  1F8N A;  4HM6 B;  1WNH A;  3K7C A;  3V98 A;  4FR9 A;  2P0X A;  2A15 A;  1JB4 A;  5JPP A;  4IT7 A;  4LZI A;  2D42 A;  2Z6B A;  3EBY A;  1VQO 3;  4X2O A;  1W01 A;  5AYR B;  1Q81 4;  2KXG A;  1NU3 A;  3KSP A;  2ZL8 A;  3Q90 A;  2P0M A;  1OHP A;  1C7H A;  2FXT A;  2YFL B;  1EG9 B;  1MNL A;  3Q2P A;  5BVB A;  3WOD G;  4RBN A;  2XGL A;  1O7G B;  3DMC A;  1U8C B;  2OQE A;  2C11 A;  4WP5 A;  3UL5 A;  1R4C A;  3CD6 3;  1IK3 A;  4FCZ A;  4K90 B;  1O7W B;  1ROA A;  1KD1 4;  3CC4 3;  1IU7 A;  1EKM A;  3UJM A;  2RCD A;  2CWU A;  1GS3 A;  3UB1 A;  3DGN A;  4STD A;  1N9J A;  1W00 A;  1WQL B;  1RN7 A;  2M7O A;  1RRH A;  1CEW I;  1YVB I;  3K0Z A;  4EV5 A;  3KE7 A;  1JRQ A;  5IER A;  1O7M B;  1KSI A;  3LZA A;  5KP3 A;  1OCV A;  4JRF A;  4XB5 A;  5IG5 A;  3Q1C A;  1UUW B;  4O8S A;  3SOY A;  2LYX A;  1OAC A;  4R9K A;  4N6M A;  3KSE D;  3CCM 3;  3G4S 3;  4K61 A;  2CC3 A;  1D6Z A;  3KN4 A;  3CCE 3;  1QVG 2;  1WTH A;  3PS8 A;  3CCL 3;  5IG4 A;  3MG1 A;  1K41 A;  1VQ5 3;  3K63 A;  1CYV A;  3SED A;  1D6Y A;  3RDE A;  1IDP A;  2I9W A;  1MOL A;  1LNH A;  4N6N B;  3VGN A;  5STD A;  3S67 A;  2GBX B;  3OWU A;  1M9G A;  1M1X B;  2FGT A;  3K5T A;  3H51 A;  5D83 A;  3EF8 A;  4FMB A;  2WGQ A;  1IVU A;  2BMR B;  1A2K A;  1OH0 A;  2HMO B;  2GEY A;  2CFG A;  3FKA A;  4N6O B;  2KCD A;  2JDI H;  3CPW 2;  1YJW 3;  1A67 A;  1UI7 A;  5EVH A;  2F99 A;  1YJ9 3;  3LH4 A;  4WWU C;  3H3H A;  3EX9 A;  2Y74 A;  3EN8 A;  3SLU A;  1STD A;  3LTA A;  5CXO A;  2YX9 A;  4G1M B;  3G16 A;  3NX0 A;  4O02 B;  3X40 A;  7STD A;  3CC2 3;  2Z76 A;  3QK9 A;  4MJD A;  3G6E 3;  1N8R 4;  4J8T A;  3N9H A;  2CFD A;  2CFK A;  1NB3 I;  2K0M A;  3UL6 A;  3J7Y d;  3DZL A;  1AVK A;  1IV7 A;  4ZM8 A;  5A0O B;  1KWI A;  2GXF A;  4LMI A;  1J2B A;  2HMM B;  1YIT 3;  1OPY A;  3MG2 A;  3CCS 3;  3BND A;  4EYC A;  2B24 B;  5KP4 A;  1IQX A;  4L7K A;  4EXR A;  3LTB A;  3B4P A;  1WMP A;  2D1W A;  2CWV A;  4FCM A;  1IT8 A;  3NBR A;  3EE1 A;  1A2V A;  3F9S A;  1EQK A;  3N54 B;  3EHC A;  4Q53 A;  3OW2 2;  3FG1 A;  2W9Q A;  1IVX A;  1TUH A;  2GEX A;  3BLZ A;  3G0K A;  4RNZ A;  1QJG A;  6STD A;  3GZX B;  5HGR A;  4HZ9 B;  2CIU A;  1S5A A;  2BO9 B;  1LOX A;  2HMJ B;  1AV4 A;  1JV2 B;  2E2V A;  3HK4 A;  3BNB A;  4HM1 B;  1IVV A;  1HU9 A;  2GU3 A;  1VQM 3;  3NV0 A;  3CCQ 3;  3BNC A;  2Z7A A;  2INX A;  2WOF A;  3OWS A;  4NRE A;  3S29 A;  3FSD A;  1DMM A;  3GRD A;  3HX8 A;  1W7C A;  4NHF A;  3D9R A;  1E3R A;  2P05 A;  3EB8 A;  1VQ4 3;  3WA2 X;  1CQS A;  3N8B A;  3CNM A;  3DY5 A;  2E2T A;  3PCS A;  4L8O A;  2XH9 A;  1YI2 3;  3FCS B;  3ALA A;  2O9U X;  1Q40 A;  1IT7 A;  3CNX A;  3NBJ A;  2V1L A;  3SVA A;  3T8N A;  1RKY A;  4TX4 A;  1K28 A;  3WA3 A;  3HII A;  2Q07 A;  5IW9 A;  3G8Z A;  2YFI B;  3LML A;  3LTC A;  4HM5 B;  1OHO A;  3NM2 A;  5I97 A;  1GYB A;  3FG3 A;  3JVC A;  2F86 B;  3K9M C;  3ER7 A;  4U13 A;  2W03 A;  2CG0 A;  4FCJ A;  1TU5 A;  3KII A;  5IF6 A;  2OCT A;  1OGZ A;  3SXX A;  1VQ9 3;  3LT9 A;  3MYT A;  3F8X A;  2RGQ A;  3I0Y A;  3NUV A;  5LC7 A;  4KFF A;  2SBL A;  5FW5 A;  1G96 A;  1GY5 A;  3S5C A;  1O7P B;  2MF7 A;  1YGE A;  2KRT A;  3DGL A;  4BTY A;  2QA4 3;  1M1K 4;  3EN1 B;  3KZT A;  1ROV A;  3JUQ A;  3DM8 A;  3CXC 2;  2HMK B;  1Q82 4;  1AR0 A;  3EJV A;  4MEI A;  1A90 A;  4K1U A;  2BMO B;  2W2C A;  3EC9 A;  2WO0 A;  8CHO A;  3KFQ C;  3CCV 3;  1N8Q A;  1W6G A;  3HZP A;  3FLJ A;  4HM8 B;  3PZW A;  5IEN A;  2IA7 A;  4OUQ A;  1W4N A;  3RGR A;  3ROB A;  5AI1 A;  3IJE B;  3M8C A;  2GU1 A;  4KFD A;  3U1W A;  3NV0 B;  3EBT A;  2CKF B;  3T8U A;  1WMO A;  3UNL A;  4EC6 A;  1FGM A;  1JN5 A;  3LXU X;  3MSO A;  5CLK A;  3RGA A;  4EBG A;  5BXQ A;  1JKG A;  1DVD A;  5CF1 A;  4O2H A;  4CCV A;  3B7C A;  3NQZ A;  5EQL A;  1GY6 A;  3OV4 A;  5ELU A;  2BHM A;  1UI8 A;  4XM4 A;  3X3Z A;  1TFK A;  3X3X A;  1O7H B;  4FMC A;  1VZZ A;  4MMZ B;  1IVW A;  4N3V A;  1Q40 B;  5TGN A;  2QGU A;  1TP6 A;  4HM7 B;  1ASK A;  3AMO A;  3OWY A;  5DRV A;  3GWR A;  2P09 A;  4N6L A;  2XRX B;  4MMX B;  2Z77 A;  1QMA A;  2WOH A;  4FMD A;  1W6Y A;  3V99 A;  1OGX A;  1FUW A;  1K9M 4;  3SOA A;  3VSY A;  5IEP A;  4GL6 A;  2L4V A;  4HBR A;  1SJW A;  1QAL A;  2OWP A;  3IMA B;  3B8L A;  1SQW A;  2BMQ B;  2O3O A;  1LXE A;  4BTW A;  1GD4 A;  5JPU A;  5AEU B;  4N6U A;  2FNQ A;  2OTL 3;  3FF2 A;  4LEH A;  1JB5 A;  4CDL A;  2W04 A;  4RZM A;  2JQ5 A;  1Q86 4;  3MHE A;  5AYS C;  3FGY A;  2CWT A;  1SPU A;  3CCR 3;  1KQS 2;  2CH9 A;  1STF I;  2IUK A;  3HIG A;  3S27 A;  1QVF 2;  1OF5 A;  4XBX A;  1FGQ A;  4O3V A;  1NJI 4;  1EA2 A;  1PU4 A;  3TDG A;  5AEW B;  4N6V 0;  1NWW A;  3FF0 A;  3IPT A;  5IG0 A;  4AKZ A;  1YHQ 3;  2XGN A;  2STD A;  2ML5 A;  4XDV A;  4JF8 A;  3EQQ B;  3CCJ 3;  3LTD A;  4HM0 B;  1V74 A;  4MMY B;  3D3L A;  4FMA A;  5D82 A;  2E2U A;  3U97 A;  2CFL A;  5AIG A;  4PEJ A;  2W56 A;  5IEO A;  1W2B 2;  3V92 A;  3LOY A;  1E97 A;  1JN5 B;  1JB2 A;  3QRD A;  3LYG A;  1VQP 3;  3BB9 A;  3L0R A;  5G2G A;  4OK0 A;  3CPO A;  4HZB B;  1KC8 4;  1IV9 A;  2MC8 A;  3SX1 A;  1JKG B;  2OOV C;  4KFE A;  3VF1 A;  4EV2 A;  1QAK A;  4J9A A;  2ZDJ A;  2W9P A;  1U5O A;  1E3V A;  3BNE A;  1S72 3;  3X42 A;  2QEX 3;  1BUQ A;  4KZ1 A;  4R4K A;  2XEP A;  1N9E A;  3NHX A;  2WGO A;  2W0Q A;  3AMO B;  3FH1 A;  4AEQ A;  1W5Z A;  3NQY A;  2CK3 H;  3WOF B;  2HMN B;  3MWZ A;  4RNY A;  1N5P A;  2P38 A;  2YFJ B;  1FGT A;  1SII A;  2OTJ 3;  3F14 A;  4R9L A;  1M90 4;  3DGM A;  1RRL A;  4QWT A;  4IPB A;  1QAF A;  3B4O A;  3X3Y A;  2QIY A;  3WOE B;  5JBS A;  1UUV B;  1D6U A;  2CW9 A;  4LGQ A;  1TIJ A;  5CK6 A;  4HYZ A;  1W2Z A;  1DVC A;  3DXO A;  4LSO A;  3DUK A;  1VQN 3;  3NBB A;  2R4I A;  2CFW A;  1VQK 3;  3T0U A;  2CHC A;  3GZB A;  4WYK A;  4XBY A;  1K8A 4;  3FZW A;  3GZY B;  1ULI B;  1ULJ B;  3F7S A;  4X2H A;  2PZV A;  1YIJ 3;  3F8H A;  3MKI A;  1OF5 B;  1HKX A;  2W6J H;  4HKV B;  3OX9 A;  1DMQ A;  2RSX A;  4XBT A;  4OVM A;  2XFS A;  1Y4K A;  2K54 A;  2LQV A;  1VQL 3;  2XF3 A;  1FA3 A;  1LVN A;  3GAX A;  1VQ7 3;  1FGR A;  3NM7 A;  2BT3 A;  5DRE A;  2B1X B;  3WDG B;  5LC6 A;  2OOV A;  1VQ8 3;  1PFP A;  3ECF A;  4K1V A;  1TFO A;  2W56 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...