1Q40B

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
186
Chain Sequence
SRNLATNFIANYLKLWDANRSELMILYQNESQFSMQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARMAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEVDGSASRYHSGPKHKRIPLSKKSFDRTFVVIPGSMIVASDTLLIRPYTSDFPWKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
total genus 42
structure length 186
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40B00
4R1KA 1GS3A 3OWUA 5IERA 3DXOA 4XBXA 2B24B 2YFJB 3OWYA 1OPYA 2HMKB 5IG4A 1Q42A 3H51A 3GRDA 1A2KA 3JUQA 3NM2A 1EA2A 1O7HB 1TUHA 1ULJB 4HM2B 3OXAA 4XDVA 5CK6A 3IPTA 5JPPA 3EJVA 3H3HA 3B7CA 3KZTA 1E3RA 4HKVB 4IIAA 2HMLB 2HMJB 8CHOA 4HM3B 3UNLA 3EN1B 5AEWB 4R9LA 3CPOA 1OUNA 2W2CA 3GZRA 1W02A 2RGQA 1O7WB 4HM7B 5CXOA 1QMAA 3LYGA 1ISKA 3FLJA 4GB5A 1OHSA 2Z76A 2YFIB 3MG3A 1OHPA 5TGNA 5AIIA 3T8NA 1DMNA 3RGAA 3KSPA 3F40A 3EBYA 3M8CA 1IDPA 1Q40A 3G0KA 5AEUB 3FZWA 2BNGA 1OCVA 2K54A 2UX0A 3EC9A 2RFRA 3VGNA 5IG3A 1BUQA 3E99A 4HM8B 1ZO2A 3K7CA 4KVHA 3HK4A 3CNXA 4HM1B 1GY6A 1GY5A 2QIYA 3EHCA 1AR0A 2BMOB 3NBRA 3MSOA 7STDA 5D82A 4HZBB 2OWPA 2CKFB 2HMMB 3DMCA 3ROBA 2R4IA 2BMQB 3RGRA 4XBTA 2INXA 5IEPA 4STDA 5AI1A 1W00A 2A15A 4LEHA 4Q53A 1O7MB 3LZAA 2F99A 1ZX2A 1GY7A 1Q40B 2RCDA 3FH1A 1GYBA 4XB5A 2JQ5A 3B8LA 2GXFA 1HKXA 3STDA 1STDA 3A76A 3JUNA 1JB5A 4X2OA 5CF2A 6STDA 1QJGA 1K41A 3EN8A 5AIFA 5IG0A 2BMRB 3D9RA 4HM6B 4J8TA 3JUMA 1NDOB 4LMIA 4WP5A 3VSYA 5BVBA 2IMJA 1E97A 3OWSA 3KKGA 2GEXA 2STDA 1SJWA 2F98A 1CQSA 3F8HA 4H3UA 4L8OA 4L8PA 1JB4A 4HM0B 5G2GA 3NXJA 5KP1A 5AIHA 4HZ9B 4MJDA 1U5OA 1O7NB 1TP6A 2PZVA 1WQLB 2Z7AA 4HM5B 3F7SA 2GBWB 2HMOB 3NUVA 3ECFA 4RZMA 4ORLA 4XDWA 3S5CA 4K1VA 4CDLA 3DUKA 3OV4A 5IEOA 3FGYA 4L7KA 4U13A 5D81A 4HM4B 5KP4A 2XR8B 3B4OA 3MKIA 2B1XB 1ASKA 3F14A 1JKGA 3GWRA 1OGZA 5STDA 3MG2A 1W6YA 3FKAA 2YFLB 4FCJA 3T8UA 2I9WA 3BLZA 1VZZA 5DRVA 1NWWA 1O7PB 3CU3A 1OGXA 4PEJA 1OHOA 2GBXB 2F86B 2XRXB 3SOAA 1DMQA 4I4KA 3HZPA 3SOYA 2CHCA 3FF0A 1UUVB 3NHXA 1EG9B 1JN5B 3F7XA 3MHEA 3FF2A 3DM8A 1UUWB 1Z1SA 4X2HA 1JKGB 3MYTA 3F9SA 3JUPA 3GZXB 1E3VA 3EX9A 4OUQA 4WYKA 5FW5A 5DREA 3CNMA 3B4PA 4N3VA 3G16A 3NV0B 5IF6A 3JUOA 5IG5A 2XSHB 3G8ZA 4WWUC 4FCMA 1NU3A 5EVHA 5D83A 1OF5A 3EBTA 3I0YA 2HMNB 5JPUA 3EQQB 5CF1A 1O7GB 3NV0A 2QGUA 3ER7A 1JN5A 4J9AA 4K1UA 5KP3A 3UJMA 1DMMA 1JB2A 3F8XA 1OF5B 3GZBA 3MG1A 1OH0A 3GZYB 1C7HA 4LGQA 3KE7A 5IENA 3OX9A 1W01A 2Z77A 2GEYA 4WYKB 1S5AA 1ULIB 3BB9A 3DZLA 5CLKA 3EF8A 5BXQA 3K0ZA 4HJLB 3FSDA 4HVNA 4OVMA 3HX8A 4XBYA 5AIGA 3SEDA 3WMDA 4XM4A 3Q90A 2XSOB 4R9KA 5HGRA
chains in the Genus database with same CATH superfamily
3DGLA 4EYCA 1GS3A 1SQWA 3DGYA 3OWYA 2W6JH 3H51A 3GRDA 1AQZA 1EA2A 1O7HB 4HM2B 1BSEA 3IPTA 4LZIA 1I70A 3RDEA 3KZTA 4IIAA 1MWRA 3S27A 8CHOA 2M7OA 1UCIA 1IV9A 3WOEB 2JDIH 3SLUA 3UNLA 1A90A 4CJNA 3CPOA 2CIUA 2RGQA 2J8XB 3SVAA 1TFOA 3TDGA 3I553 4GB5A 5TGNA 4BU4A 1UGHI 5AIIA 1BU4A 1DMNA 3X42A 5M18A 3CCM3 3EBYA 3M8CA 2K0MA 1BNIA 1GOVA 2P09A 1TTOA 3FZWA 3CD63 3AMOA 1BNEA 5AYRB 2KCDA 1YIJ3 2V1LA 2RNTA 3NQYA 3S28A 1ZO2A 3UL5A 3CNXA 1GY5A 2QIYA 3EHCA 1AR0A 1RRHA 3ZG5A 4HZBB 2OWPA 1RLSA 1US1A 3LH4A 3O8YA 1VQQA 1BANA 1YVSA 2D42A 4STDA 4KT3B 4LEHA 1BRHA 1GY7A 1Q40B 3PZWA 2FXTA 1RKYA 1BSAA 1RN1A 3A76A 1JB5A 1RGGA 6STDA 1QJGA 4MEIA 1K734 1G96A 3UB1A 1IQYA 4HM6B 4J8TA 1NDOB 5BVBA 1IYYA 2Q07A 3IJEB 2LYXA 3MWZA 4H3UA 1CQSA 2RSXA 2W03A 1BRSA 2OQEC 1NNVA 1DETA 3GAXA 5G2GA 1YHQ3 1BIRA 3DH2A 1B2XA 2LQVA 2XH9A 3G713 1Q814 3CCR3 1BRJA 2PZVA 1WQLB 2SARA 1N5PA 2Z7AA 3D79A 3F7SA 3NUVA 4RZMA 5I97A 1GSPA 4L7KA 5KP4A 3CCL3 3MKIA 1ASKA 1NO3A 1JZOA 5BIRA 3A5EA 1I0XA 2CK3H 1X1XA 2IUKA 3T8UA 1LQMB 1VQ63 5DRVA 1Q7HA 1BNSA 3PGBA 4PEJA 4I5QA 1VQ43 1RSNA 2XRXB 3NBBA 2Z6BA 4KZ1A 3U1WA 3SOYA 1DVCA 1I8VA 1LVNA 2CHCA 2ML6A 2ZL8A 3FF0A 4KFFA 4LSOA 3F7XA 2CG1A 2BT3A 3VF1A 1AVLA 1IK3A 3DM8A 1UUWB 3CXC2 1RGFA 1JKGB 3MYTA 3F9SA 3JUPA 4FCZA 4R4KA 2PNCA 3SYUA 1SPUA 7GSPA 3KIIA 1D6ZA 1NB3I 5FGOA 4HYZA 3G16A 3JUOA 4BTXA 1PU4A 1NU3A 1BRNL 1RN4A 1B21A 5D83A 5G1LA 1KD14 4BL2A 2E2UA 1FGRA 5JPUA 2W56B 1VQK3 2XFSA 5CF1A 4K1UA 1BSBA 1JN5A 4J9AA 3UJMA 4RNYA 1A67A 3AGNA 1WMOA 3LTAA 2XFTA 1JBSA 4LGQA 4RNTA 2AAEA 4WHAA 3NBJA 2Z77A 2BHMA 1B3SA 4WFOA 1N5HA 1S5AA 2P0XA 3PCRA 5CLKA 3EF8A 4HVNA 4XBYA 3DGOA 2GU3A 4NPBA 3PS8A 1RCLA 1W7CA 5IW9A 1UCJA 3DY5A 2GU1A 1GMPA 5HGRA 5ELJA 3PCSA 4RBNA 1JJ22 3DXOA 4XBXA 2B24B 4MMYB 1Q42A 2OQEA 3NM2A 1ULJB 3OXAA 3BIRA 3B7CA 1E3RA 3Q3FA 1BNJA 1IV7A 2HMLB 1SIHA 4HM3B 3X3YA 1GMQA 4FR9A 4DKIA 3LOYA 1N8R4 5CXOA 1VQ93 1O7WB 4HM7B 1VQO3 3AMOB 3LYGA 3MG3A 2YFIB 1V57A 1JNQA 1OHPA 2WGOA 4EV5A 1Q824 2R41A 1X1UA 3F40A 3CCJ3 1GOYA 3N9HA 5GSPA 1FGMA 2BNGA 2F5MA 4ILFA 1FZUA 2K54A 4EXRA 2RFRA 1BNRA 3E99A 4KVHA 4N6UA 1J2BA 1N9JA 1MWTA 1IU7A 1RGKA 1GD4A 1RNBA 3MSOA 1WMPA 1C54A 2R4IA 2BMQB 3GSPA 4N6OB 1LNIA 2INXA 3U97A 1MNLA 5AI1A 1W00A 1TFKA 2WOHA 2A15A 5G1KA 1UI8A 4Q53A 2RCDA 3G4S3 3FG4A 1AV4A 1B2SA 1QAFA 1CYVA 1F8NA 5BU4A 1UGIA 1TU5A 1JBTA 1K41A 1JRQA 2WO0A 1EUIC 1MWSA 2BMRB 1UUGB 4WP5A 1N8QA 1RN7A 1W5ZA 4L8OA 3KKGA 2CFGA 2STDA 2KF4A 3F8HA 3CC23 1KQS2 1D6YA 1I2GA 2CFDA 1IT7A 3FG1A 3NXJA 2MF7A 5LC7A 3LXUX 1A2PA 1TP6A 2C4BA 2H0GA 4HM5B 5CK6A 3S67A 2HMOB 4XDWA 2KXGA 2ZA4A 3ECFA 1B20A 1G02A 1T5YA 4ORLA 4CDLA 3G6E3 1BRGA 5D81A 4U13A 1G0TA 4HM4B 1HZ1A 3K5TA 1LNHA 1W6CA 4BIRA 1OGZA 1FUTA 3MG2A 5STDA 6GSPA 4K90B 1QVG2 2I9WA 2HOHA 1VZZA 2KF3A 2ML5A 3UL6A 1DVDA 1W4NA 1OGXA 1B2MA 3NX0A 2MC8A 1DMQA 1ROAA 1LOWA 1T2IA 4GL6A 2W04A 1Z1SA 1VQL3 3N8BA 1E3VA 3EX9A 1CEWI 1WMNA 3QRDA 1BRIA 4WYKA 4FMBA 2RBIA 1K28A 2E2VA 2W56A 3B4PA 4N3VA 5IF6A 2P05A 3BNCA 3CME3 3S29A 1UCLA 1BNGA 3EBTA 4O02B 3MPHA 1L5GB 1X1WA 3PXMA 1O7GB 2XEPA 2QGUA 5KP3A 1DMMA 2CWUA 1OF5B 2F4YA 3GZBA 1Q864 1LOVA 1OH0A 3WHOA 2OCTA 5IENA 3OX9A 1W01A 3CC73 2GEYA 1ULIB 3BB9A 3DZLA 3L0RA 1IVWA 4J5KA 3K0ZA 3SEDA 1KC84 5AIGA 1WNHA 5LC6A 4EBGA 3BNDA 5AIHA 1K8A4 1ZS7A 3OWUA 5IERA 2QA43 3V98A 1YJW3 1GMRA 2YFJB 1OPYA 1IQXA 1LOXA 2HMKB 4IT7A 1V58A 5IG4A 1I3IA 2YX9A 3HOHA 5JPPA 3ZFZA 3HIIA 4QWTA 7RNTA 3CCE3 3DGMA 2CW9A 2HMJB 1IVUA 3LT9A 4HAAA 2IY2A 3EN1B 1MGRA 1PFPA 5AEWB 1OUNA 2W2CA 3BNEA 1W02A 2W0QA 1RGLA 4O2HA 1OHSA 4FMCA 1FGOA 3RGAA 3KSPA 3KFQC 4CCVA 1IDPA 1Q40A 1FUSA 3G0KA 1BOXA 5AEUB 3WODG 3EC9A 3LTCA 4NREA 1IVVA 3VGNA 1BUQA 4HM8B 1MGWA 3K7CA 3BNBA 1GY6A 1VQP3 1YJN3 1EKMA 3CC43 4AKZA 3NBRA 2ZHXB 3ALAA 3Q2PA 3DMCA 4ZM8A 4JRFA 1KWIA 4XBTA 5IEPA 2WOFA 1MWUA 2UGIA 1YI23 5EVHA 1ZX2A 4XB5A 1HKXA 3FG3A 1T2HA 3CPW2 3JUNA 4X2OA 5CF2A 5AIFA 3CCQ3 1YGEA 3BU4A 3D9RA 3JUMA 4LMIA 2XGNA 3VSYA 3X3ZA 1ISKA 1CYUA 4L8PA 2GEXA 1VQ53 1SJWA 2XGLA 3AGOA 4R80A 1JB4A 1BSDA 1HYFA 1JV2B 1RGEA 5KP1A 2O9UX 4MJDA 1U5OA 1RMSA 3EB8A 3T0UA 1R4YA 2KF6A 2GBWB 2OOVC 3IMAB 2Y74A 3DUKA 3OV4A 5IEOA 1FYSA 3FGYA 1RRLA 3KN4A 3B4OA 1FGQA 3F14A 1JKGA 2D1WA 2W9QA 1BAOA 3FKAA 3LT8A 4FCJA 1RTUA 1PYLA 4GHOA 1I2EA 3BLZA 1WTHA 1NWWA 2F5WA 3CU3A 1OHOA 2CWVA 5AYSC 2GBXB 1N9EA 1NJI4 3CCS3 4I4KA 3HZPA 3FCSB 1W6GA 3CCV3 2CFKA 3NHXA 1JN5B 5HOHA 3CMA3 3FF2A 4X2HA 1NB5I 4FMDA 1B27A 5M1AA 1Q9EA 1RGAA 4O8SA 1M9GA 1YJ93 2BIRA 2KRTA 1AY7A 5DREA 1SIIA 1QALA 3LTDA 2XSHB 3G8ZA 2FNQA 4JF8A 4N6TA 1OF5A 2CFWA 1FW7A 4AKYA 3I0YA 2HMNB 3EQQB 2CX0A 3KCHA 3NV0A 4N6NB 2KAAA 1B2ZA 1KSIA 4KFEA 2CG0A 2BO9B 4G1MB 3URPA 1RJOA 1T3BA 3AHSA 3GZYB 5ELUA 3KE7A 1RHLA 1M1XB 1BVIA 4N6LA 1GOUA 1R4CA 4OVMA 1S723 2WGQA 4RNZA 3WR2A 2CH9A 4H61A 4R9KA 1QAKA 3RNTA 3SXXA 1BGSA 4R1KA 3K9MC 1ROVA 2FGTA 4AEQA 1SARA 1CH0A 3X3XA 1M904 1A2KA 2F56A 3JUQA 4XDVA 1TUHA 1AVKA 3CCU3 3EJVA 3H3HA 4HKVB 3HIGA 2H0IA 2IUJA 3D4AA 1UCKA 3D5IA 2AADA 1HU9A 4HBRA 4R9LA 3X40A 4LYLB 3GZRA 1VQ83 1QMAA 3FLJA 1IQ8A 2CX1A 2Z76A 1LOYA 3N54B 2IA7A 3T8NA 1QVF2 3QK9A 1UI7A 5RNTA 1D6UA 1X1YA 3AHWA 2CWTA 2P38A 3V92A 1OCVA 2L1SA 2UX0A 3ZG0A 5IG3A 1GD3A 2CC3A 1ZGXA 1FA3A 2ZDJA 3HK4A 4HM1B 7STDA 6RNTA 2BMOB 3OW22 5D82A 1UDII 2CKFB 2HMMB 3ROBA 3WOFB 3LMLA 3RGRA 5A0OB 8RNTA 3DGNA 1VQN3 4IPBA 1YGWA 3X41A 1M1K4 1BNFA 1IT8A 1O7MB 3LZAA 2F99A 5EQLA 1EQKA 1TRPA 3FH1A 1GYBA 1RDSA 2JQ5A 3B8LA 2GXFA 3STDA 3KSED 1BSCA 1LRAA 1STDA 1PY3A 5IG0A 3EN8A 5EEOA 3EE1A 1B2UA 1K9M4 1TJDA 1OACA 2IMJA 1E97A 3OWSA 1JZDA 1I2FA 2F98A 2W9PA 4HM0B 3Q1CA 3D5GA 4EC6A 4HZ9B 1IVXA 3V99A 1V74A 1O7NB 3I563 2GSPA 2H0HA 1Y4KA 3S5CA 1BRKA 4K1VA 4FMAA 3K63A 1FUWA 2XR8B 4N6V0 2CFLA 4CPKA 2B1XB 1MOLA 3NQZA 1YVBI 1YIT3 3GWRA 4KFDA 1W6YA 2YFLB 4GSPA 2OOVA 2XF3A 1W2ZA 1W2B2 2OTL3 1I3FA 1O7PB 2E2TA 4BL3A 2K3DA 4BTYA 2F86B 4TX4A 3SOAA 1I0VA 2C10A 2O3OA 1YNVX 4O3VA 1UUVB 3WDGB 1FGTA 1EG9B 2P0MA 1TRQA 3MHEA 3JVCA 2Y73A 5M19A 4OUQA 3GZXB 1RGHA 2SBLA 3WA2X 3LTBA 1DE3A 5FW5A 3HI7A 1RGCA 3NM7A 3CNMA 1VQM3 1VQ73 3NV0B 1STFI 1Q7Y4 5IG5A 2OTJ3 1LXEA 4HOHA 4WWUC 4FCMA 1LQGC 9RNTA 3PYJA 1U8CB 2QEX3 1RNTA 4N6MA 2KF5A 2BU4A 1UW1A 3ER7A 4MMXB 2C11A 1DYUA 1JB2A 4J5GA 3F8XA 4MMZB 4EW5A 3MG1A 1RCKA 4OK0A 3WA3A 1C7HA 1JBRA 4K61A 1EEJA 4EV2A 4WYKB 3D3LA 5BXQA 1BUJA 4HJLB 3J7Yd 3FSDA 2IYJA 3HX8A 1A2VA 3WMDA 5JBSA 4XM4A 3SX1A 4BTWA 2L4VA 1TIJA 2UUGC 3Q90A 2XSOB 4NHFA
chains in the Genus database with same CATH topology
3DGLA 4EYCA 1GS3A 1SQWA 3OWYA 2W6JH 3H51A 3GRDA 1EA2A 1O7HB 4HM2B 3IPTA 4LZIA 3RDEA 3KZTA 4IIAA 3S27A 8CHOA 2M7OA 1IV9A 3WOEB 2JDIH 3SLUA 3UNLA 1A90A 3CPOA 2CIUA 2RGQA 3SVAA 1TFOA 3TDGA 3I553 4GB5A 5TGNA 5AIIA 1DMNA 3CCM3 3EBYA 3M8CA 2K0MA 2P09A 3FZWA 3CD63 3AMOA 5AYRB 2KCDA 1YIJ3 2V1LA 3NQYA 3S28A 1ZO2A 3UL5A 3CNXA 1GY5A 2QIYA 3EHCA 1AR0A 1RRHA 4HZBB 2OWPA 1US1A 3LH4A 3O8YA 2D42A 4STDA 4LEHA 1GY7A 1Q40B 3PZWA 2FXTA 1RKYA 3A76A 1JB5A 6STDA 1QJGA 4MEIA 1K734 1G96A 3UB1A 1IQYA 4HM6B 4J8TA 1NDOB 5BVBA 2Q07A 3IJEB 2LYXA 3MWZA 4H3UA 1CQSA 2RSXA 2W03A 2OQEC 3GAXA 5G2GA 1YHQ3 2LQVA 3G713 2XH9A 1Q814 3CCR3 2PZVA 1WQLB 2Z7AA 1N5PA 3F7SA 4RZMA 5I97A 3NUVA 4L7KA 5KP4A 3CCL3 3MKIA 1ASKA 1NO3A 2CK3H 2IUKA 3T8UA 1VQ63 5DRVA 3PGBA 4PEJA 1VQ43 2XRXB 3NBBA 2Z6BA 4KZ1A 3U1WA 3SOYA 1DVCA 2CHCA 1LVNA 2ML6A 2ZL8A 3FF0A 4KFFA 4LSOA 2CG1A 3F7XA 3VF1A 2BT3A 1IK3A 1AVLA 3DM8A 1UUWB 3CXC2 1JKGB 3MYTA 3F9SA 3JUPA 4FCZA 4R4KA 2PNCA 1SPUA 3KIIA 1D6ZA 1NB3I 5FGOA 4HYZA 3G16A 3JUOA 4BTXA 1PU4A 1NU3A 5D83A 1KD14 2E2UA 1FGRA 5JPUA 2W56B 2XFSA 5CF1A 4K1UA 4J9AA 1JN5A 3UJMA 4RNYA 1A67A 3LTAA 1WMOA 2XFTA 4LGQA 4WHAA 3NBJA 2Z77A 2BHMA 4WFOA 1N5HA 1S5AA 2P0XA 3PCRA 5CLKA 3EF8A 4HVNA 4XBYA 3DGOA 2GU3A 3PS8A 1W7CA 5IW9A 3DY5A 2GU1A 5HGRA 5ELJA 3PCSA 4RBNA 1JJ22 3DXOA 4XBXA 2B24B 4MMYB 1Q42A 2OQEA 3NM2A 1ULJB 3OXAA 3B7CA 1E3RA 1VQK3 1IV7A 2HMLB 1SIHA 4HM3B 3X3YA 4FR9A 3LOYA 1N8R4 5CXOA 1VQ93 1O7WB 4HM7B 1VQO3 3AMOB 3LYGA 3MG3A 2YFIB 1Q824 1JNQA 1OHPA 2WGOA 4EV5A 3F40A 3CCJ3 3N9HA 1FGMA 2BNGA 2K54A 4EXRA 2RFRA 3E99A 4KVHA 4N6UA 1J2BA 1N9JA 1IU7A 1GD4A 3MSOA 1WMPA 2R4IA 2BMQB 4N6OB 2INXA 3U97A 1MNLA 5AI1A 1W00A 1TFKA 2WOHA 2A15A 1UI8A 4Q53A 2RCDA 3G4S3 3FG4A 1AV4A 1QAFA 1CYVA 1F8NA 1TU5A 1K41A 1JRQA 2WO0A 2BMRB 4WP5A 1N8QA 1RN7A 1W5ZA 4L8OA 3KKGA 2CFGA 2STDA 3F8HA 3CC23 1KQS2 1D6YA 2CFDA 3FG1A 1IT7A 3NXJA 2MF7A 5LC7A 3LXUX 1TP6A 3X42A 4HM5B 5CK6A 3S67A 2HMOB 4XDWA 2KXGA 3ECFA 4ORLA 1T5YA 4CDLA 3G6E3 5D81A 4U13A 4HM4B 3K5TA 1LNHA 1W6CA 1OGZA 5STDA 3MG2A 4K90B 1QVG2 2I9WA 1VZZA 2ML5A 3UL6A 1DVDA 1W4NA 1OGXA 3NX0A 2MC8A 1DMQA 1ROAA 4GL6A 2W04A 1Z1SA 1VQL3 3N8BA 1E3VA 3EX9A 1CEWI 1WMNA 3QRDA 4WYKA 4FMBA 1K28A 2E2VA 2W56A 3B4PA 4N3VA 5IF6A 2P05A 3BNCA 3CME3 3S29A 3EBTA 4O02B 3MPHA 1L5GB 3PXMA 1O7GB 2XEPA 2QGUA 5KP3A 1DMMA 2CWUA 1OF5B 3GZBA 1Q864 1OH0A 2OCTA 5IENA 3OX9A 1W01A 3CC73 2GEYA 1ULIB 3BB9A 3DZLA 3L0RA 1IVWA 3K0ZA 3SEDA 1KC84 5AIGA 1WNHA 5LC6A 4EBGA 3BNDA 5AIHA 1K8A4 3OWUA 5IERA 2QA43 3V98A 1YJW3 2YFJB 1OPYA 1IQXA 1LOXA 2HMKB 4IT7A 5IG4A 2YX9A 5JPPA 3HIIA 4QWTA 3CCE3 3DGMA 2CW9A 2HMJB 1IVUA 3LT9A 3EN1B 5AEWB 1PFPA 1OUNA 2W2CA 3BNEA 1W02A 2W0QA 4O2HA 1OHSA 4FMCA 1FGOA 3RGAA 3KSPA 3KFQC 4CCVA 1IDPA 1Q40A 3G0KA 5AEUB 3WODG 3EC9A 3LTCA 4NREA 1IVVA 3VGNA 1BUQA 4HM8B 3K7CA 3BNBA 1GY6A 1VQP3 1YJN3 1EKMA 3CC43 4AKZA 3NBRA 3ALAA 3Q2PA 3DMCA 4ZM8A 4JRFA 1KWIA 4XBTA 5IEPA 2WOFA 1YI23 5EVHA 1ZX2A 4XB5A 1HKXA 3FG3A 3CPW2 3JUNA 4X2OA 5CF2A 5AIFA 3CCQ3 1YGEA 3D9RA 3JUMA 4LMIA 2XGNA 3VSYA 3X3ZA 1ISKA 1CYUA 4L8PA 2GEXA 1VQ53 1SJWA 2XGLA 4R80A 1JB4A 5KP1A 1JV2B 2O9UX 4MJDA 1U5OA 3EB8A 3T0UA 2GBWB 2OOVC 3IMAB 2Y74A 3DUKA 3OV4A 5IEOA 3FGYA 1RRLA 3KN4A 3B4OA 1FGQA 3F14A 1JKGA 2D1WA 2W9QA 3LT8A 3FKAA 4FCJA 3BLZA 1WTHA 1NWWA 3CU3A 1OHOA 2CWVA 5AYSC 2GBXB 1N9EA 1NJI4 3CCS3 4I4KA 3HZPA 3FCSB 1W6GA 3CCV3 2CFKA 3NHXA 1JN5B 3CMA3 3FF2A 4X2HA 1NB5I 4FMDA 4O8SA 1M9GA 1YJ93 2KRTA 5DREA 1SIIA 1QALA 3LTDA 2XSHB 3G8ZA 2FNQA 4JF8A 4N6TA 1OF5A 2CFWA 4AKYA 3I0YA 2HMNB 3EQQB 3NV0A 4N6NB 1KSIA 4KFEA 2CG0A 2BO9B 4G1MB 1RJOA 3GZYB 5ELUA 3KE7A 1M1XB 4N6LA 1R4CA 4OVMA 1S723 2WGQA 4RNZA 2CH9A 4H61A 4R9KA 1QAKA 3SXXA 4R1KA 3K9MC 1ROVA 2FGTA 4AEQA 3X3XA 1M904 1A2KA 3JUQA 4XDVA 1TUHA 1AVKA 3CCU3 3EJVA 3H3HA 4HKVB 3HIGA 2IUJA 1HU9A 4HBRA 4R9LA 3X40A 3GZRA 1VQ83 1QMAA 3FLJA 1IQ8A 2Z76A 3N54B 2IA7A 3T8NA 1QVF2 3QK9A 1UI7A 1D6UA 2CWTA 2P38A 3V92A 1OCVA 2UX0A 5IG3A 1GD3A 2CC3A 1FA3A 2ZDJA 3HK4A 4HM1B 7STDA 2BMOB 3OW22 5D82A 2CKFB 2HMMB 3ROBA 3WOFB 3LMLA 3RGRA 5A0OB 1VQN3 3DGNA 4IPBA 3X41A 1M1K4 1O7MB 1IT8A 1EQKA 3LZAA 2F99A 5EQLA 3FH1A 1GYBA 2JQ5A 3B8LA 2GXFA 3STDA 3KSED 1STDA 5IG0A 3EN8A 5EEOA 3EE1A 1K9M4 1OACA 2IMJA 1E97A 3OWSA 2F98A 2W9PA 4HM0B 3Q1CA 4EC6A 4HZ9B 1IVXA 3V99A 1V74A 1O7NB 3I563 1Y4KA 3S5CA 4K1VA 4FMAA 3K63A 1FUWA 2XR8B 4N6V0 2CFLA 1MOLA 2B1XB 3NQZA 1YVBI 1YIT3 3GWRA 4KFDA 1W6YA 2YFLB 2OOVA 2XF3A 1W2ZA 1W2B2 2OTL3 1O7PB 2E2TA 4BTYA 2F86B 4TX4A 3SOAA 2C10A 2O3OA 4O3VA 1UUVB 3WDGB 1FGTA 1EG9B 2P0MA 3MHEA 3JVCA 2Y73A 4OUQA 3GZXB 2SBLA 3WA2X 3LTBA 5FW5A 3HI7A 3NM7A 3CNMA 1VQM3 1VQ73 3NV0B 1STFI 1Q7Y4 5IG5A 2OTJ3 1LXEA 4WWUC 4FCMA 3PYJA 1U8CB 2QEX3 4N6MA 1UW1A 3ER7A 4MMXB 2C11A 1DYUA 1JB2A 4MMZB 3F8XA 3MG1A 4OK0A 3WA3A 1C7HA 4K61A 4EV2A 4WYKB 3D3LA 5BXQA 4HJLB 3J7Yd 3FSDA 3HX8A 1A2VA 3WMDA 5JBSA 4XM4A 3SX1A 4BTWA 2L4VA 1TIJA 3Q90A 2XSOB 4NHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1K A;  1GS3 A;  3OWU A;  5IER A;  3DXO A;  4XBX A;  2B24 B;  2YFJ B;  3OWY A;  1OPY A;  2HMK B;  5IG4 A;  1Q42 A;  3H51 A;  3GRD A;  1A2K A;  3JUQ A;  3NM2 A;  1EA2 A;  1O7H B;  1TUH A;  1ULJ B;  4HM2 B;  3OXA A;  4XDV A;  5CK6 A;  3IPT A;  5JPP A;  3EJV A;  3H3H A;  3B7C A;  3KZT A;  1E3R A;  4HKV B;  4IIA A;  2HML B;  2HMJ B;  8CHO A;  4HM3 B;  3UNL A;  3EN1 B;  5AEW B;  4R9L A;  3CPO A;  1OUN A;  2W2C A;  3GZR A;  1W02 A;  2RGQ A;  1O7W B;  4HM7 B;  5CXO A;  1QMA A;  3LYG A;  1ISK A;  3FLJ A;  4GB5 A;  1OHS A;  2Z76 A;  2YFI B;  3MG3 A;  1OHP A;  5TGN A;  5AII A;  3T8N A;  1DMN A;  3RGA A;  3KSP A;  3F40 A;  3EBY A;  3M8C A;  1IDP A;  1Q40 A;  3G0K A;  5AEU B;  3FZW A;  2BNG A;  1OCV A;  2K54 A;  2UX0 A;  3EC9 A;  2RFR A;  3VGN A;  5IG3 A;  1BUQ A;  3E99 A;  4HM8 B;  1ZO2 A;  3K7C A;  4KVH A;  3HK4 A;  3CNX A;  4HM1 B;  1GY6 A;  1GY5 A;  2QIY A;  3EHC A;  1AR0 A;  2BMO B;  3NBR A;  3MSO A;  7STD A;  5D82 A;  4HZB B;  2OWP A;  2CKF B;  2HMM B;  3DMC A;  3ROB A;  2R4I A;  2BMQ B;  3RGR A;  4XBT A;  2INX A;  5IEP A;  4STD A;  5AI1 A;  1W00 A;  2A15 A;  4LEH A;  4Q53 A;  1O7M B;  3LZA A;  2F99 A;  1ZX2 A;  1GY7 A;  1Q40 B;  2RCD A;  3FH1 A;  1GYB A;  4XB5 A;  2JQ5 A;  3B8L A;  2GXF A;  1HKX A;  3STD A;  1STD A;  3A76 A;  3JUN A;  1JB5 A;  4X2O A;  5CF2 A;  6STD A;  1QJG A;  1K41 A;  3EN8 A;  5AIF A;  5IG0 A;  2BMR B;  3D9R A;  4HM6 B;  4J8T A;  3JUM A;  1NDO B;  4LMI A;  4WP5 A;  3VSY A;  5BVB A;  2IMJ A;  1E97 A;  3OWS A;  3KKG A;  2GEX A;  2STD A;  1SJW A;  2F98 A;  1CQS A;  3F8H A;  4H3U A;  4L8O A;  4L8P A;  1JB4 A;  4HM0 B;  5G2G A;  3NXJ A;  5KP1 A;  5AIH A;  4HZ9 B;  4MJD A;  1U5O A;  1O7N B;  1TP6 A;  2PZV A;  1WQL B;  2Z7A A;  4HM5 B;  3F7S A;  2GBW B;  2HMO B;  3NUV A;  3ECF A;  4RZM A;  4ORL A;  4XDW A;  3S5C A;  4K1V A;  4CDL A;  3DUK A;  3OV4 A;  5IEO A;  3FGY A;  4L7K A;  4U13 A;  5D81 A;  4HM4 B;  5KP4 A;  2XR8 B;  3B4O A;  3MKI A;  2B1X B;  1ASK A;  3F14 A;  1JKG A;  3GWR A;  1OGZ A;  5STD A;  3MG2 A;  1W6Y A;  3FKA A;  2YFL B;  4FCJ A;  3T8U A;  2I9W A;  3BLZ A;  1VZZ A;  5DRV A;  1NWW A;  1O7P B;  3CU3 A;  1OGX A;  4PEJ A;  1OHO A;  2GBX B;  2F86 B;  2XRX B;  3SOA A;  1DMQ A;  4I4K A;  3HZP A;  3SOY A;  2CHC A;  3FF0 A;  1UUV B;  3NHX A;  1EG9 B;  1JN5 B;  3F7X A;  3MHE A;  3FF2 A;  3DM8 A;  1UUW B;  1Z1S A;  4X2H A;  1JKG B;  3MYT A;  3F9S A;  3JUP A;  3GZX B;  1E3V A;  3EX9 A;  4OUQ A;  4WYK A;  5FW5 A;  5DRE A;  3CNM A;  3B4P A;  4N3V A;  3G16 A;  3NV0 B;  5IF6 A;  3JUO A;  5IG5 A;  2XSH B;  3G8Z A;  4WWU C;  4FCM A;  1NU3 A;  5EVH A;  5D83 A;  1OF5 A;  3EBT A;  3I0Y A;  2HMN B;  5JPU A;  3EQQ B;  5CF1 A;  1O7G B;  3NV0 A;  2QGU A;  3ER7 A;  1JN5 A;  4J9A A;  4K1U A;  5KP3 A;  3UJM A;  1DMM A;  1JB2 A;  3F8X A;  1OF5 B;  3GZB A;  3MG1 A;  1OH0 A;  3GZY B;  1C7H A;  4LGQ A;  3KE7 A;  5IEN A;  3OX9 A;  1W01 A;  2Z77 A;  2GEY A;  4WYK B;  1S5A A;  1ULI B;  3BB9 A;  3DZL A;  5CLK A;  3EF8 A;  5BXQ A;  3K0Z A;  4HJL B;  3FSD A;  4HVN A;  4OVM A;  3HX8 A;  4XBY A;  5AIG A;  3SED A;  3WMD A;  4XM4 A;  3Q90 A;  2XSO B;  4R9K A;  5HGR A; 
#chains in the Genus database with same CATH topology
 3DGL A;  4EYC A;  1GS3 A;  1SQW A;  3DGY A;  3OWY A;  2W6J H;  3H51 A;  3GRD A;  1AQZ A;  1EA2 A;  1O7H B;  4HM2 B;  1BSE A;  3IPT A;  4LZI A;  1I70 A;  3RDE A;  3KZT A;  4IIA A;  1MWR A;  3S27 A;  8CHO A;  2M7O A;  1UCI A;  1IV9 A;  3WOE B;  2JDI H;  3SLU A;  3UNL A;  1A90 A;  4CJN A;  3CPO A;  2CIU A;  2RGQ A;  2J8X B;  3SVA A;  1TFO A;  3TDG A;  3I55 3;  4GB5 A;  5TGN A;  4BU4 A;  1UGH I;  5AII A;  1BU4 A;  1DMN A;  3X42 A;  5M18 A;  3CCM 3;  3EBY A;  3M8C A;  2K0M A;  1BNI A;  1GOV A;  2P09 A;  1TTO A;  3FZW A;  3CD6 3;  3AMO A;  1BNE A;  5AYR B;  2KCD A;  1YIJ 3;  2V1L A;  2RNT A;  3NQY A;  3S28 A;  1ZO2 A;  3UL5 A;  3CNX A;  1GY5 A;  2QIY A;  3EHC A;  1AR0 A;  1RRH A;  3ZG5 A;  4HZB B;  2OWP A;  1RLS A;  1US1 A;  3LH4 A;  3O8Y A;  1VQQ A;  1BAN A;  1YVS A;  2D42 A;  4STD A;  4KT3 B;  4LEH A;  1BRH A;  1GY7 A;  1Q40 B;  3PZW A;  2FXT A;  1RKY A;  1BSA A;  1RN1 A;  3A76 A;  1JB5 A;  1RGG A;  6STD A;  1QJG A;  4MEI A;  1K73 4;  1G96 A;  3UB1 A;  1IQY A;  4HM6 B;  4J8T A;  1NDO B;  5BVB A;  1IYY A;  2Q07 A;  3IJE B;  2LYX A;  3MWZ A;  4H3U A;  1CQS A;  2RSX A;  2W03 A;  1BRS A;  2OQE C;  1NNV A;  1DET A;  3GAX A;  5G2G A;  1YHQ 3;  1BIR A;  3DH2 A;  1B2X A;  2LQV A;  2XH9 A;  3G71 3;  1Q81 4;  3CCR 3;  1BRJ A;  2PZV A;  1WQL B;  2SAR A;  1N5P A;  2Z7A A;  3D79 A;  3F7S A;  3NUV A;  4RZM A;  5I97 A;  1GSP A;  4L7K A;  5KP4 A;  3CCL 3;  3MKI A;  1ASK A;  1NO3 A;  1JZO A;  5BIR A;  3A5E A;  1I0X A;  2CK3 H;  1X1X A;  2IUK A;  3T8U A;  1LQM B;  1VQ6 3;  5DRV A;  1Q7H A;  1BNS A;  3PGB A;  4PEJ A;  4I5Q A;  1VQ4 3;  1RSN A;  2XRX B;  3NBB A;  2Z6B A;  4KZ1 A;  3U1W A;  3SOY A;  1DVC A;  1I8V A;  1LVN A;  2CHC A;  2ML6 A;  2ZL8 A;  3FF0 A;  4KFF A;  4LSO A;  3F7X A;  2CG1 A;  2BT3 A;  3VF1 A;  1AVL A;  1IK3 A;  3DM8 A;  1UUW B;  3CXC 2;  1RGF A;  1JKG B;  3MYT A;  3F9S A;  3JUP A;  4FCZ A;  4R4K A;  2PNC A;  3SYU A;  1SPU A;  7GSP A;  3KII A;  1D6Z A;  1NB3 I;  5FGO A;  4HYZ A;  3G16 A;  3JUO A;  4BTX A;  1PU4 A;  1NU3 A;  1BRN L;  1RN4 A;  1B21 A;  5D83 A;  5G1L A;  1KD1 4;  4BL2 A;  2E2U A;  1FGR A;  5JPU A;  2W56 B;  1VQK 3;  2XFS A;  5CF1 A;  4K1U A;  1BSB A;  1JN5 A;  4J9A A;  3UJM A;  4RNY A;  1A67 A;  3AGN A;  1WMO A;  3LTA A;  2XFT A;  1JBS A;  4LGQ A;  4RNT A;  2AAE A;  4WHA A;  3NBJ A;  2Z77 A;  2BHM A;  1B3S A;  4WFO A;  1N5H A;  1S5A A;  2P0X A;  3PCR A;  5CLK A;  3EF8 A;  4HVN A;  4XBY A;  3DGO A;  2GU3 A;  4NPB A;  3PS8 A;  1RCL A;  1W7C A;  5IW9 A;  1UCJ A;  3DY5 A;  2GU1 A;  1GMP A;  5HGR A;  5ELJ A;  3PCS A;  4RBN A;  1JJ2 2;  3DXO A;  4XBX A;  2B24 B;  4MMY B;  1Q42 A;  2OQE A;  3NM2 A;  1ULJ B;  3OXA A;  3BIR A;  3B7C A;  1E3R A;  3Q3F A;  1BNJ A;  1IV7 A;  2HML B;  1SIH A;  4HM3 B;  3X3Y A;  1GMQ A;  4FR9 A;  4DKI A;  3LOY A;  1N8R 4;  5CXO A;  1VQ9 3;  1O7W B;  4HM7 B;  1VQO 3;  3AMO B;  3LYG A;  3MG3 A;  2YFI B;  1V57 A;  1JNQ A;  1OHP A;  2WGO A;  4EV5 A;  1Q82 4;  2R41 A;  1X1U A;  3F40 A;  3CCJ 3;  1GOY A;  3N9H A;  5GSP A;  1FGM A;  2BNG A;  2F5M A;  4ILF A;  1FZU A;  2K54 A;  4EXR A;  2RFR A;  1BNR A;  3E99 A;  4KVH A;  4N6U A;  1J2B A;  1N9J A;  1MWT A;  1IU7 A;  1RGK A;  1GD4 A;  1RNB A;  3MSO A;  1WMP A;  1C54 A;  2R4I A;  2BMQ B;  3GSP A;  4N6O B;  1LNI A;  2INX A;  3U97 A;  1MNL A;  5AI1 A;  1W00 A;  1TFK A;  2WOH A;  2A15 A;  5G1K A;  1UI8 A;  4Q53 A;  2RCD A;  3G4S 3;  3FG4 A;  1AV4 A;  1B2S A;  1QAF A;  1CYV A;  1F8N A;  5BU4 A;  1UGI A;  1TU5 A;  1JBT A;  1K41 A;  1JRQ A;  2WO0 A;  1EUI C;  1MWS A;  2BMR B;  1UUG B;  4WP5 A;  1N8Q A;  1RN7 A;  1W5Z A;  4L8O A;  3KKG A;  2CFG A;  2STD A;  2KF4 A;  3F8H A;  3CC2 3;  1KQS 2;  1D6Y A;  1I2G A;  2CFD A;  1IT7 A;  3FG1 A;  3NXJ A;  2MF7 A;  5LC7 A;  3LXU X;  1A2P A;  1TP6 A;  2C4B A;  2H0G A;  4HM5 B;  5CK6 A;  3S67 A;  2HMO B;  4XDW A;  2KXG A;  2ZA4 A;  3ECF A;  1B20 A;  1G02 A;  1T5Y A;  4ORL A;  4CDL A;  3G6E 3;  1BRG A;  5D81 A;  4U13 A;  1G0T A;  4HM4 B;  1HZ1 A;  3K5T A;  1LNH A;  1W6C A;  4BIR A;  1OGZ A;  1FUT A;  3MG2 A;  5STD A;  6GSP A;  4K90 B;  1QVG 2;  2I9W A;  2HOH A;  1VZZ A;  2KF3 A;  2ML5 A;  3UL6 A;  1DVD A;  1W4N A;  1OGX A;  1B2M A;  3NX0 A;  2MC8 A;  1DMQ A;  1ROA A;  1LOW A;  1T2I A;  4GL6 A;  2W04 A;  1Z1S A;  1VQL 3;  3N8B A;  1E3V A;  3EX9 A;  1CEW I;  1WMN A;  3QRD A;  1BRI A;  4WYK A;  4FMB A;  2RBI A;  1K28 A;  2E2V A;  2W56 A;  3B4P A;  4N3V A;  5IF6 A;  2P05 A;  3BNC A;  3CME 3;  3S29 A;  1UCL A;  1BNG A;  3EBT A;  4O02 B;  3MPH A;  1L5G B;  1X1W A;  3PXM A;  1O7G B;  2XEP A;  2QGU A;  5KP3 A;  1DMM A;  2CWU A;  1OF5 B;  2F4Y A;  3GZB A;  1Q86 4;  1LOV A;  1OH0 A;  3WHO A;  2OCT A;  5IEN A;  3OX9 A;  1W01 A;  3CC7 3;  2GEY A;  1ULI B;  3BB9 A;  3DZL A;  3L0R A;  1IVW A;  4J5K A;  3K0Z A;  3SED A;  1KC8 4;  5AIG A;  1WNH A;  5LC6 A;  4EBG A;  3BND A;  5AIH A;  1K8A 4;  1ZS7 A;  3OWU A;  5IER A;  2QA4 3;  3V98 A;  1YJW 3;  1GMR A;  2YFJ B;  1OPY A;  1IQX A;  1LOX A;  2HMK B;  4IT7 A;  1V58 A;  5IG4 A;  1I3I A;  2YX9 A;  3HOH A;  5JPP A;  3ZFZ A;  3HII A;  4QWT A;  7RNT A;  3CCE 3;  3DGM A;  2CW9 A;  2HMJ B;  1IVU A;  3LT9 A;  4HAA A;  2IY2 A;  3EN1 B;  1MGR A;  1PFP A;  5AEW B;  1OUN A;  2W2C A;  3BNE A;  1W02 A;  2W0Q A;  1RGL A;  4O2H A;  1OHS A;  4FMC A;  1FGO A;  3RGA A;  3KSP A;  3KFQ C;  4CCV A;  1IDP A;  1Q40 A;  1FUS A;  3G0K A;  1BOX A;  5AEU B;  3WOD G;  3EC9 A;  3LTC A;  4NRE A;  1IVV A;  3VGN A;  1BUQ A;  4HM8 B;  1MGW A;  3K7C A;  3BNB A;  1GY6 A;  1VQP 3;  1YJN 3;  1EKM A;  3CC4 3;  4AKZ A;  3NBR A;  2ZHX B;  3ALA A;  3Q2P A;  3DMC A;  4ZM8 A;  4JRF A;  1KWI A;  4XBT A;  5IEP A;  2WOF A;  1MWU A;  2UGI A;  1YI2 3;  5EVH A;  1ZX2 A;  4XB5 A;  1HKX A;  3FG3 A;  1T2H A;  3CPW 2;  3JUN A;  4X2O A;  5CF2 A;  5AIF A;  3CCQ 3;  1YGE A;  3BU4 A;  3D9R A;  3JUM A;  4LMI A;  2XGN A;  3VSY A;  3X3Z A;  1ISK A;  1CYU A;  4L8P A;  2GEX A;  1VQ5 3;  1SJW A;  2XGL A;  3AGO A;  4R80 A;  1JB4 A;  1BSD A;  1HYF A;  1JV2 B;  1RGE A;  5KP1 A;  2O9U X;  4MJD A;  1U5O A;  1RMS A;  3EB8 A;  3T0U A;  1R4Y A;  2KF6 A;  2GBW B;  2OOV C;  3IMA B;  2Y74 A;  3DUK A;  3OV4 A;  5IEO A;  1FYS A;  3FGY A;  1RRL A;  3KN4 A;  3B4O A;  1FGQ A;  3F14 A;  1JKG A;  2D1W A;  2W9Q A;  1BAO A;  3FKA A;  3LT8 A;  4FCJ A;  1RTU A;  1PYL A;  4GHO A;  1I2E A;  3BLZ A;  1WTH A;  1NWW A;  2F5W A;  3CU3 A;  1OHO A;  2CWV A;  5AYS C;  2GBX B;  1N9E A;  1NJI 4;  3CCS 3;  4I4K A;  3HZP A;  3FCS B;  1W6G A;  3CCV 3;  2CFK A;  3NHX A;  1JN5 B;  5HOH A;  3CMA 3;  3FF2 A;  4X2H A;  1NB5 I;  4FMD A;  1B27 A;  5M1A A;  1Q9E A;  1RGA A;  4O8S A;  1M9G A;  1YJ9 3;  2BIR A;  2KRT A;  1AY7 A;  5DRE A;  1SII A;  1QAL A;  3LTD A;  2XSH B;  3G8Z A;  2FNQ A;  4JF8 A;  4N6T A;  1OF5 A;  2CFW A;  1FW7 A;  4AKY A;  3I0Y A;  2HMN B;  3EQQ B;  2CX0 A;  3KCH A;  3NV0 A;  4N6N B;  2KAA A;  1B2Z A;  1KSI A;  4KFE A;  2CG0 A;  2BO9 B;  4G1M B;  3URP A;  1RJO A;  1T3B A;  3AHS A;  3GZY B;  5ELU A;  3KE7 A;  1RHL A;  1M1X B;  1BVI A;  4N6L A;  1GOU A;  1R4C A;  4OVM A;  1S72 3;  2WGQ A;  4RNZ A;  3WR2 A;  2CH9 A;  4H61 A;  4R9K A;  1QAK A;  3RNT A;  3SXX A;  1BGS A;  4R1K A;  3K9M C;  1ROV A;  2FGT A;  4AEQ A;  1SAR A;  1CH0 A;  3X3X A;  1M90 4;  1A2K A;  2F56 A;  3JUQ A;  4XDV A;  1TUH A;  1AVK A;  3CCU 3;  3EJV A;  3H3H A;  4HKV B;  3HIG A;  2H0I A;  2IUJ A;  3D4A A;  1UCK A;  3D5I A;  2AAD A;  1HU9 A;  4HBR A;  4R9L A;  3X40 A;  4LYL B;  3GZR A;  1VQ8 3;  1QMA A;  3FLJ A;  1IQ8 A;  2CX1 A;  2Z76 A;  1LOY A;  3N54 B;  2IA7 A;  3T8N A;  1QVF 2;  3QK9 A;  1UI7 A;  5RNT A;  1D6U A;  1X1Y A;  3AHW A;  2CWT A;  2P38 A;  3V92 A;  1OCV A;  2L1S A;  2UX0 A;  3ZG0 A;  5IG3 A;  1GD3 A;  2CC3 A;  1ZGX A;  1FA3 A;  2ZDJ A;  3HK4 A;  4HM1 B;  7STD A;  6RNT A;  2BMO B;  3OW2 2;  5D82 A;  1UDI I;  2CKF B;  2HMM B;  3ROB A;  3WOF B;  3LML A;  3RGR A;  5A0O B;  8RNT A;  3DGN A;  1VQN 3;  4IPB A;  1YGW A;  3X41 A;  1M1K 4;  1BNF A;  1IT8 A;  1O7M B;  3LZA A;  2F99 A;  5EQL A;  1EQK A;  1TRP A;  3FH1 A;  1GYB A;  1RDS A;  2JQ5 A;  3B8L A;  2GXF A;  3STD A;  3KSE D;  1BSC A;  1LRA A;  1STD A;  1PY3 A;  5IG0 A;  3EN8 A;  5EEO A;  3EE1 A;  1B2U A;  1K9M 4;  1TJD A;  1OAC A;  2IMJ A;  1E97 A;  3OWS A;  1JZD A;  1I2F A;  2F98 A;  2W9P A;  4HM0 B;  3Q1C A;  3D5G A;  4EC6 A;  4HZ9 B;  1IVX A;  3V99 A;  1V74 A;  1O7N B;  3I56 3;  2GSP A;  2H0H A;  1Y4K A;  3S5C A;  1BRK A;  4K1V A;  4FMA A;  3K63 A;  1FUW A;  2XR8 B;  4N6V 0;  2CFL A;  4CPK A;  2B1X B;  1MOL A;  3NQZ A;  1YVB I;  1YIT 3;  3GWR A;  4KFD A;  1W6Y A;  2YFL B;  4GSP A;  2OOV A;  2XF3 A;  1W2Z A;  1W2B 2;  2OTL 3;  1I3F A;  1O7P B;  2E2T A;  4BL3 A;  2K3D A;  4BTY A;  2F86 B;  4TX4 A;  3SOA A;  1I0V A;  2C10 A;  2O3O A;  1YNV X;  4O3V A;  1UUV B;  3WDG B;  1FGT A;  1EG9 B;  2P0M A;  1TRQ A;  3MHE A;  3JVC A;  2Y73 A;  5M19 A;  4OUQ A;  3GZX B;  1RGH A;  2SBL A;  3WA2 X;  3LTB A;  1DE3 A;  5FW5 A;  3HI7 A;  1RGC A;  3NM7 A;  3CNM A;  1VQM 3;  1VQ7 3;  3NV0 B;  1STF I;  1Q7Y 4;  5IG5 A;  2OTJ 3;  1LXE A;  4HOH A;  4WWU C;  4FCM A;  1LQG C;  9RNT A;  3PYJ A;  1U8C B;  2QEX 3;  1RNT A;  4N6M A;  2KF5 A;  2BU4 A;  1UW1 A;  3ER7 A;  4MMX B;  2C11 A;  1DYU A;  1JB2 A;  4J5G A;  3F8X A;  4MMZ B;  4EW5 A;  3MG1 A;  1RCK A;  4OK0 A;  3WA3 A;  1C7H A;  1JBR A;  4K61 A;  1EEJ A;  4EV2 A;  4WYK B;  3D3L A;  5BXQ A;  1BUJ A;  4HJL B;  3J7Y d;  3FSD A;  2IYJ A;  3HX8 A;  1A2V A;  3WMD A;  5JBS A;  4XM4 A;  3SX1 A;  4BTW A;  2L4V A;  1TIJ A;  2UUG C;  3Q90 A;  2XSO B;  4NHF A; 
#chains in the Genus database with same CATH homology
 3DGL A;  4EYC A;  1GS3 A;  1SQW A;  3OWY A;  2W6J H;  3H51 A;  3GRD A;  1EA2 A;  1O7H B;  4HM2 B;  3IPT A;  4LZI A;  3RDE A;  3KZT A;  4IIA A;  3S27 A;  8CHO A;  2M7O A;  1IV9 A;  3WOE B;  2JDI H;  3SLU A;  3UNL A;  1A90 A;  3CPO A;  2CIU A;  2RGQ A;  3SVA A;  1TFO A;  3TDG A;  3I55 3;  4GB5 A;  5TGN A;  5AII A;  1DMN A;  3CCM 3;  3EBY A;  3M8C A;  2K0M A;  2P09 A;  3FZW A;  3CD6 3;  3AMO A;  5AYR B;  2KCD A;  1YIJ 3;  2V1L A;  3NQY A;  3S28 A;  1ZO2 A;  3UL5 A;  3CNX A;  1GY5 A;  2QIY A;  3EHC A;  1AR0 A;  1RRH A;  4HZB B;  2OWP A;  1US1 A;  3LH4 A;  3O8Y A;  2D42 A;  4STD A;  4LEH A;  1GY7 A;  1Q40 B;  3PZW A;  2FXT A;  1RKY A;  3A76 A;  1JB5 A;  6STD A;  1QJG A;  4MEI A;  1K73 4;  1G96 A;  3UB1 A;  1IQY A;  4HM6 B;  4J8T A;  1NDO B;  5BVB A;  2Q07 A;  3IJE B;  2LYX A;  3MWZ A;  4H3U A;  1CQS A;  2RSX A;  2W03 A;  2OQE C;  3GAX A;  5G2G A;  1YHQ 3;  2LQV A;  3G71 3;  2XH9 A;  1Q81 4;  3CCR 3;  2PZV A;  1WQL B;  2Z7A A;  1N5P A;  3F7S A;  4RZM A;  5I97 A;  3NUV A;  4L7K A;  5KP4 A;  3CCL 3;  3MKI A;  1ASK A;  1NO3 A;  2CK3 H;  2IUK A;  3T8U A;  1VQ6 3;  5DRV A;  3PGB A;  4PEJ A;  1VQ4 3;  2XRX B;  3NBB A;  2Z6B A;  4KZ1 A;  3U1W A;  3SOY A;  1DVC A;  2CHC A;  1LVN A;  2ML6 A;  2ZL8 A;  3FF0 A;  4KFF A;  4LSO A;  2CG1 A;  3F7X A;  3VF1 A;  2BT3 A;  1IK3 A;  1AVL A;  3DM8 A;  1UUW B;  3CXC 2;  1JKG B;  3MYT A;  3F9S A;  3JUP A;  4FCZ A;  4R4K A;  2PNC A;  1SPU A;  3KII A;  1D6Z A;  1NB3 I;  5FGO A;  4HYZ A;  3G16 A;  3JUO A;  4BTX A;  1PU4 A;  1NU3 A;  5D83 A;  1KD1 4;  2E2U A;  1FGR A;  5JPU A;  2W56 B;  2XFS A;  5CF1 A;  4K1U A;  4J9A A;  1JN5 A;  3UJM A;  4RNY A;  1A67 A;  3LTA A;  1WMO A;  2XFT A;  4LGQ A;  4WHA A;  3NBJ A;  2Z77 A;  2BHM A;  4WFO A;  1N5H A;  1S5A A;  2P0X A;  3PCR A;  5CLK A;  3EF8 A;  4HVN A;  4XBY A;  3DGO A;  2GU3 A;  3PS8 A;  1W7C A;  5IW9 A;  3DY5 A;  2GU1 A;  5HGR A;  5ELJ A;  3PCS A;  4RBN A;  1JJ2 2;  3DXO A;  4XBX A;  2B24 B;  4MMY B;  1Q42 A;  2OQE A;  3NM2 A;  1ULJ B;  3OXA A;  3B7C A;  1E3R A;  1VQK 3;  1IV7 A;  2HML B;  1SIH A;  4HM3 B;  3X3Y A;  4FR9 A;  3LOY A;  1N8R 4;  5CXO A;  1VQ9 3;  1O7W B;  4HM7 B;  1VQO 3;  3AMO B;  3LYG A;  3MG3 A;  2YFI B;  1Q82 4;  1JNQ A;  1OHP A;  2WGO A;  4EV5 A;  3F40 A;  3CCJ 3;  3N9H A;  1FGM A;  2BNG A;  2K54 A;  4EXR A;  2RFR A;  3E99 A;  4KVH A;  4N6U A;  1J2B A;  1N9J A;  1IU7 A;  1GD4 A;  3MSO A;  1WMP A;  2R4I A;  2BMQ B;  4N6O B;  2INX A;  3U97 A;  1MNL A;  5AI1 A;  1W00 A;  1TFK A;  2WOH A;  2A15 A;  1UI8 A;  4Q53 A;  2RCD A;  3G4S 3;  3FG4 A;  1AV4 A;  1QAF A;  1CYV A;  1F8N A;  1TU5 A;  1K41 A;  1JRQ A;  2WO0 A;  2BMR B;  4WP5 A;  1N8Q A;  1RN7 A;  1W5Z A;  4L8O A;  3KKG A;  2CFG A;  2STD A;  3F8H A;  3CC2 3;  1KQS 2;  1D6Y A;  2CFD A;  3FG1 A;  1IT7 A;  3NXJ A;  2MF7 A;  5LC7 A;  3LXU X;  1TP6 A;  3X42 A;  4HM5 B;  5CK6 A;  3S67 A;  2HMO B;  4XDW A;  2KXG A;  3ECF A;  4ORL A;  1T5Y A;  4CDL A;  3G6E 3;  5D81 A;  4U13 A;  4HM4 B;  3K5T A;  1LNH A;  1W6C A;  1OGZ A;  5STD A;  3MG2 A;  4K90 B;  1QVG 2;  2I9W A;  1VZZ A;  2ML5 A;  3UL6 A;  1DVD A;  1W4N A;  1OGX A;  3NX0 A;  2MC8 A;  1DMQ A;  1ROA A;  4GL6 A;  2W04 A;  1Z1S A;  1VQL 3;  3N8B A;  1E3V A;  3EX9 A;  1CEW I;  1WMN A;  3QRD A;  4WYK A;  4FMB A;  1K28 A;  2E2V A;  2W56 A;  3B4P A;  4N3V A;  5IF6 A;  2P05 A;  3BNC A;  3CME 3;  3S29 A;  3EBT A;  4O02 B;  3MPH A;  1L5G B;  3PXM A;  1O7G B;  2XEP A;  2QGU A;  5KP3 A;  1DMM A;  2CWU A;  1OF5 B;  3GZB A;  1Q86 4;  1OH0 A;  2OCT A;  5IEN A;  3OX9 A;  1W01 A;  3CC7 3;  2GEY A;  1ULI B;  3BB9 A;  3DZL A;  3L0R A;  1IVW A;  3K0Z A;  3SED A;  1KC8 4;  5AIG A;  1WNH A;  5LC6 A;  4EBG A;  3BND A;  5AIH A;  1K8A 4;  3OWU A;  5IER A;  2QA4 3;  3V98 A;  1YJW 3;  2YFJ B;  1OPY A;  1IQX A;  1LOX A;  2HMK B;  4IT7 A;  5IG4 A;  2YX9 A;  5JPP A;  3HII A;  4QWT A;  3CCE 3;  3DGM A;  2CW9 A;  2HMJ B;  1IVU A;  3LT9 A;  3EN1 B;  5AEW B;  1PFP A;  1OUN A;  2W2C A;  3BNE A;  1W02 A;  2W0Q A;  4O2H A;  1OHS A;  4FMC A;  1FGO A;  3RGA A;  3KSP A;  3KFQ C;  4CCV A;  1IDP A;  1Q40 A;  3G0K A;  5AEU B;  3WOD G;  3EC9 A;  3LTC A;  4NRE A;  1IVV A;  3VGN A;  1BUQ A;  4HM8 B;  3K7C A;  3BNB A;  1GY6 A;  1VQP 3;  1YJN 3;  1EKM A;  3CC4 3;  4AKZ A;  3NBR A;  3ALA A;  3Q2P A;  3DMC A;  4ZM8 A;  4JRF A;  1KWI A;  4XBT A;  5IEP A;  2WOF A;  1YI2 3;  5EVH A;  1ZX2 A;  4XB5 A;  1HKX A;  3FG3 A;  3CPW 2;  3JUN A;  4X2O A;  5CF2 A;  5AIF A;  3CCQ 3;  1YGE A;  3D9R A;  3JUM A;  4LMI A;  2XGN A;  3VSY A;  3X3Z A;  1ISK A;  1CYU A;  4L8P A;  2GEX A;  1VQ5 3;  1SJW A;  2XGL A;  4R80 A;  1JB4 A;  5KP1 A;  1JV2 B;  2O9U X;  4MJD A;  1U5O A;  3EB8 A;  3T0U A;  2GBW B;  2OOV C;  3IMA B;  2Y74 A;  3DUK A;  3OV4 A;  5IEO A;  3FGY A;  1RRL A;  3KN4 A;  3B4O A;  1FGQ A;  3F14 A;  1JKG A;  2D1W A;  2W9Q A;  3LT8 A;  3FKA A;  4FCJ A;  3BLZ A;  1WTH A;  1NWW A;  3CU3 A;  1OHO A;  2CWV A;  5AYS C;  2GBX B;  1N9E A;  1NJI 4;  3CCS 3;  4I4K A;  3HZP A;  3FCS B;  1W6G A;  3CCV 3;  2CFK A;  3NHX A;  1JN5 B;  3CMA 3;  3FF2 A;  4X2H A;  1NB5 I;  4FMD A;  4O8S A;  1M9G A;  1YJ9 3;  2KRT A;  5DRE A;  1SII A;  1QAL A;  3LTD A;  2XSH B;  3G8Z A;  2FNQ A;  4JF8 A;  4N6T A;  1OF5 A;  2CFW A;  4AKY A;  3I0Y A;  2HMN B;  3EQQ B;  3NV0 A;  4N6N B;  1KSI A;  4KFE A;  2CG0 A;  2BO9 B;  4G1M B;  1RJO A;  3GZY B;  5ELU A;  3KE7 A;  1M1X B;  4N6L A;  1R4C A;  4OVM A;  1S72 3;  2WGQ A;  4RNZ A;  2CH9 A;  4H61 A;  4R9K A;  1QAK A;  3SXX A;  4R1K A;  3K9M C;  1ROV A;  2FGT A;  4AEQ A;  3X3X A;  1M90 4;  1A2K A;  3JUQ A;  4XDV A;  1TUH A;  1AVK A;  3CCU 3;  3EJV A;  3H3H A;  4HKV B;  3HIG A;  2IUJ A;  1HU9 A;  4HBR A;  4R9L A;  3X40 A;  3GZR A;  1VQ8 3;  1QMA A;  3FLJ A;  1IQ8 A;  2Z76 A;  3N54 B;  2IA7 A;  3T8N A;  1QVF 2;  3QK9 A;  1UI7 A;  1D6U A;  2CWT A;  2P38 A;  3V92 A;  1OCV A;  2UX0 A;  5IG3 A;  1GD3 A;  2CC3 A;  1FA3 A;  2ZDJ A;  3HK4 A;  4HM1 B;  7STD A;  2BMO B;  3OW2 2;  5D82 A;  2CKF B;  2HMM B;  3ROB A;  3WOF B;  3LML A;  3RGR A;  5A0O B;  1VQN 3;  3DGN A;  4IPB A;  3X41 A;  1M1K 4;  1O7M B;  1IT8 A;  1EQK A;  3LZA A;  2F99 A;  5EQL A;  3FH1 A;  1GYB A;  2JQ5 A;  3B8L A;  2GXF A;  3STD A;  3KSE D;  1STD A;  5IG0 A;  3EN8 A;  5EEO A;  3EE1 A;  1K9M 4;  1OAC A;  2IMJ A;  1E97 A;  3OWS A;  2F98 A;  2W9P A;  4HM0 B;  3Q1C A;  4EC6 A;  4HZ9 B;  1IVX A;  3V99 A;  1V74 A;  1O7N B;  3I56 3;  1Y4K A;  3S5C A;  4K1V A;  4FMA A;  3K63 A;  1FUW A;  2XR8 B;  4N6V 0;  2CFL A;  1MOL A;  2B1X B;  3NQZ A;  1YVB I;  1YIT 3;  3GWR A;  4KFD A;  1W6Y A;  2YFL B;  2OOV A;  2XF3 A;  1W2Z A;  1W2B 2;  2OTL 3;  1O7P B;  2E2T A;  4BTY A;  2F86 B;  4TX4 A;  3SOA A;  2C10 A;  2O3O A;  4O3V A;  1UUV B;  3WDG B;  1FGT A;  1EG9 B;  2P0M A;  3MHE A;  3JVC A;  2Y73 A;  4OUQ A;  3GZX B;  2SBL A;  3WA2 X;  3LTB A;  5FW5 A;  3HI7 A;  3NM7 A;  3CNM A;  1VQM 3;  1VQ7 3;  3NV0 B;  1STF I;  1Q7Y 4;  5IG5 A;  2OTJ 3;  1LXE A;  4WWU C;  4FCM A;  3PYJ A;  1U8C B;  2QEX 3;  4N6M A;  1UW1 A;  3ER7 A;  4MMX B;  2C11 A;  1DYU A;  1JB2 A;  4MMZ B;  3F8X A;  3MG1 A;  4OK0 A;  3WA3 A;  1C7H A;  4K61 A;  4EV2 A;  4WYK B;  3D3L A;  5BXQ A;  4HJL B;  3J7Y d;  3FSD A;  3HX8 A;  1A2V A;  3WMD A;  5JBS A;  4XM4 A;  3SX1 A;  4BTW A;  2L4V A;  1TIJ A;  3Q90 A;  2XSO B;  4NHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...