1Q40B

Crystal structure of the c. albicans mtr2-mex67 m domain complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
205
structure length
186
Chain Sequence
b'SRNLATNFIANYLKLWDANRSELMILYQNESQFSMQVDSSHPHLIESGSTDFGYYLNNSRNLTRVSSIKARMAKLSIGQEQIYKSFQQLPKTRHDIIATPELFSMEVYKFPTLNGIMITLHGSFDEVAQPEVDGSASRYHSGPKHKRIPLSKKSFDRTFVVIPGSMIVASDTLLIRPYTSDFPWKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MRNA TRANSPORT REGULATOR Mtr2
molecule tags Translation
source organism Candida albicans
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
total genus 42
structure length 186
sequence length 205
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q40B00
4K1UA 3EQQB 2B1XB 4XBTA 1OGZA 4IIAA 3IPTA 3LZAA 4U13A 3GRDA 1JKGB 5CK6A 3ER7A 2F98A 4FCMA 5CLKA 3KE7A 1W01A 3MSOA 3HK4A 2IMJA 4X2OA 1E3VA 3BB9A 3G16A 1ULJB 1Z1SA 1OCVA 2BNGA 2Z76A 3EN1B 3OX9A 4HM3B 2YFLB 1UUWB 3EC9A 4J8TA 4L8OA 1WQLB 3STDA 5IENA 2RFRA 2Z7AA 3F8XA 1DMQA 3JUMA 2I9WA 4HJLB 3B4OA 4L7KA 5DRVA 1QJGA 2BMRB 3NHXA 2INXA 2K54A 3HZPA 4WYKA 1EG9B 4XB5A 3MG1A 2RCDA 2Z77A 1ASKA 1O7HB 4HM2B 2HMJB 3JUQA 3NV0B 8CHOA 1O7GB 3CU3A 5KP1A 5BXQA 2UX0A 3A76A 3EN8A 1GY7A 1A2KA 3H3HA 4XM4A 1JN5A 4L8PA 3H51A 5TGNA 4K1VA 3GZBA 4HVNA 4LMIA 4ORLA 4R1KA 3JUNA 4XDWA 2R4IA 5AIHA 3RGRA 3MYTA 2QGUA 3B4PA 3ECFA 3RGAA 3SOAA 2XSOB 3KZTA 2CHCA 3DM8A 5D83A 2F86B 3CPOA 4HM7B 4R9LA 4XDVA 5AI1A 3KSPA 3GWRA 3LYGA 3JUOA 5FW5A 3SEDA 5JPPA 1OH0A 3CNMA 1JB5A 1E3RA 2OWPA 5IG4A 1GYBA 1O7PB 3MHEA 3FH1A 3G0KA 4GB5A 3FF2A 3FLJA 3FZWA 3WMDA 3K0ZA 1NU3A 3MG2A 3OWSA 1STDA 2YFJB 3HX8A 1DMMA 4KVHA 4MJDA 4R9KA 1JB2A 3DMCA 3F7XA 3NUVA 5HGRA 1OPYA 3DUKA 2BMOB 1OHSA 3SOYA 3VSYA 2GBWB 5D81A 2RGQA 4HZ9B 4LGQA 3E99A 3MKIA 3EJVA 4HM5B 4OUQA 5KP4A 1AR0A 3VGNA 3GZXB 1K41A 3F9SA 2GXFA 3T8NA 2HMNB 3NXJA 1ISKA 3MG3A 3EHCA 5D82A 3FGYA 1ZX2A 1GS3A 4PEJA 4XBXA 1Q40B 2A15A 3K7CA 4CDLA 1W00A 1U5OA 3M8CA 5STDA 3NV0A 5IF6A 5JPUA 4HM1B 1JKGA 1SJWA 1W6YA 1OHOA 2HMKB 3OXAA 3OWYA 4Q53A 1O7WB 1IDPA 3D9RA 5IG0A 3UNLA 6STDA 1NDOB 1JN5B 5AEUB 3F7SA 3GZRA 4WP5A 3CNXA 4HKVB 2BMQB 1OF5A 1W02A 2GEXA 2QIYA 2W2CA 2HMMB 1UUVB 2XRXB 3BLZA 3EF8A 5EVHA 1C7HA 2GBXB 1ZO2A 2HMOB 3B7CA 3EBYA 4STDA 3B8LA 2XR8B 2XSHB 5IEOA 3FF0A 1O7NB 5G2GA 2PZVA 1GY5A 3FSDA 3OV4A 4WYKB 1TP6A 5IERA 3F40A 1VZZA 4I4KA 1GY6A 1OHPA 4X2HA 3JUPA 5IEPA 5DREA 3F8HA 1QMAA 2HMLB 1S5AA 1O7MB 2GEYA 4WWUC 1Q40A 5CXOA 4FCJA 1OUNA 3I0YA 3S5CA 3DZLA 5AEWB 5IG5A 1BUQA 1JB4A 5KP3A 1CQSA 4J9AA 3DXOA 3T8UA 2CKFB 5CF1A 1TUHA 1NWWA 2STDA 3F14A 4HM0B 4RZMA 5AIGA 3UJMA 3ROBA 5BVBA 3NBRA 1EA2A 3EBTA 3OWUA 7STDA 4XBYA 3NM2A 1OF5B 3GZYB 1ULIB 2B24B 2F99A 2JQ5A 3Q90A 4HM4B 4OVMA 1Q42A 3G8ZA 5IG3A 4N3VA 5CF2A 3EX9A 4HM8B 2YFIB 1E97A 5AIFA 1OGXA 1HKXA 4H3UA 3FKAA 4HZBB 3KKGA 5AIIA 4HM6B 4LEHA 1DMNA
chains in the Genus database with same CATH superfamily
1DVCA 3KIIA 3LTDA 3BNDA 3LZAA 1JNQA 5CK6A 1JKGB 3ALAA 2BT3A 2CG0A 1RGFA 1G96A 1X1YA 2XGLA 3UL6A 3MSOA 1E3VA 2RBIA 1FGQA 4LSOA 1RGAA 2P09A 1UUWB 3STDA 3Q1CA 2SBLA 3F8XA 5DRVA 3B4OA 1B2UA 3D3LA 2INXA 2K54A 2Z6BA 4XB5A 1EKMA 2BHMA 1ASKA 5ELUA 3KCHA 2HMJB 3DGLA 8CHOA 1WTHA 2LYXA 5BXQA 2F5MA 1GY7A 2W9QA 1VQ93 1BVIA 4L8PA 5TGNA 1YHQ3 4ORLA 4R80A 2XF3A 5AIHA 2R4IA 4EBGA 2QGUA 3NBJA 2XSOB 4MMZB 2P38A 2YX9A 2O9UX 1UGHI 1A67A 3JUOA 1B27A 1YIT3 3CNMA 5G1LA 1JB5A 1BRIA 1IYYA 1BGSA 2V1LA 4ZM8A 5FGOA 1A2PA 2H0HA 4KFDA 3CCR3 1STDA 1BSDA 1Y4KA 3HX8A 4KVHA 2OQEA 1JB2A 3BNBA 1TIJA 1VQ63 3CCM3 2OTL3 1IVUA 5D81A 1TJDA 2KRTA 3D5GA 5M1AA 4LGQA 3KSED 3WOFB 1BSCA 5RNTA 2Y73A 1FA3A 4FMCA 3LXUX 4OUQA 1Q7Y4 5KP4A 1AR0A 3HIIA 1RRHA 3Q2PA 4EW5A 1KC84 1K41A 3F9SA 2GXFA 3UB1A 3T8NA 2HMNB 3EHCA 1RN7A 1OACA 1LOWA 4IT7A 1M1K4 2ML5A 4N6V0 3SXXA 1U5OA 2CIUA 3X3ZA 2L1SA 3FG3A 1Q864 1BNJA 1MWRA 1W6YA 3OWYA 3WDGB 1WMOA 3WODG 5IG0A 1VQ53 1EEJA 1NDOB 2XEPA 5AEUB 3F7SA 3GZRA 3ZG0A 2CFDA 7RNTA 3T0UA 4U13A 2BMQB 2XRXB 5CF2A 1VQM3 1N9JA 2K3DA 2HMMB 4N6UA 1BNEA 5EVHA 4EXRA 2J8XB 1BRJA 4CPKA 1B21A 5IEOA 3FF0A 1VZZA 2KCDA 3MWZA 3PYJA 1GY6A 1OHPA 3JVCA 5IEPA 2FGTA 5DREA 4BU4A 1IK3A 4WWUC 5CXOA 1OUNA 3I0YA 2WGQA 1US1A 1IT8A 3DGOA 3NX0A 3CCS3 1W6GA 2XGNA 3LTAA 4J9AA 1RDSA 3T8UA 2OQEC 4BL2A 1W5ZA 1TFKA 1VQP3 5BIRA 2CWVA 1AVLA 2GU1A 3MPHA 5LC7A 3PS8A 4CJNA 1DETA 1OF5B 1Q824 1ULIB 2B24B 1R4CA 2IY2A 4GHOA 4HM4B 1YJN3 3CCL3 3PGBA 3EX9A 3OW22 3HOHA 1BRGA 4KZ1A 5AIFA 3LT9A 4H3UA 1HKXA 4N6LA 3LTBA 3J7Yd 3KKGA 1BU4A 1PU4A 1G0TA 1WMPA 2Y74A 3SX1A 1CYUA 1UW1A 1RMSA 4K61A 1LVNA 1LQGC 2F5WA 1G02A 2F98A 3WHOA 1AY7A 2RSXA 5AYSC 3KE7A 1W01A 3AMOB 2IUKA 3HK4A 2C10A 2L4VA 2CWUA 1ULJB 1YGEA 1MGRA 3BB9A 1Z1SA 1OCVA 2BNGA 2Z76A 3DGYA 4HM3B 3CC73 1B20A 1BANA 1WQLB 4KT3B 1IT7A 2Z7AA 1NJI4 5BU4A 1QJGA 3S29A 3HZPA 2QEX3 1BRNL 1RGGA 1N5PA 1BNGA 2Z77A 3X3XA 1O7HB 3NV0B 3K9MC 1O7GB 2KAAA 1TRQA 2CH9A 1DE3A 2FNQA 1A2KA 1MWTA 3H3HA 3VF1A 1GD3A 1VQ83 4R1KA 4HVNA 5KP3A 3K5TA 4XDWA 3RGRA 3CMA3 3RGAA 1IU7A 4NREA 3I563 2CHCA 3CC43 1C54A 3LTCA 2OOVC 4HM7B 3X40A 5FW5A 3KSPA 2KF3A 1JBSA 1BIRA 1FUTA 1GMRA 1LNIA 1X1WA 1X1UA 1E3RA 1FUSA 1DYUA 3SYUA 1O7PB 4EC6A 1LNHA 3FH1A 1RGKA 1TRPA 3FF2A 3NM7A 2GSPA 1W4NA 2W03A 1FGOA 3OWSA 3URPA 3ZFZA 4BTWA 1BRHA 1DMMA 2RNTA 3PZWA 1HU9A 2C4BA 2KXGA 1B2XA 3NUVA 1OPYA 1UCJA 1GOUA 2BIRA 1OHSA 2BMOB 2W0QA 3SOYA 3SVAA 4EV5A 4J5KA 2AADA 3E99A 1SARA 1TTOA 3D79A 4HM5B 4O02B 1MGWA 1U8CB 3VGNA 1I0XA 1YJW3 3N8BA 1FZUA 2P0MA 4EV2A 1BRKA 2A15A 1VQK3 1M9GA 3M8CA 1UCLA 4FMBA 1SQWA 5IF6A 3CD63 4Q53A 1SJWA 1OHOA 2JDIH 1VQN3 1BRSA 1IDPA 1IVVA 3G6E3 2E2VA 1FGRA 4WP5A 4HKVB 1NB3I 1OF5A 1Q7HA 2W2CA 5JPUA 1RLSA 1UUVB 3G713 4AKYA 1C7HA 1I3IA 2GBXB 2HMOB 3B7CA 1ROAA 3EBYA 2XR8B 2C11A 1RN4A 2ML6A 2CG1A 2GU3A 1RNBA 2PZVA 1GSPA 3OV4A 1IVWA 3F40A 1RGEA 4J5GA 1JJ22 4NHFA 2HMLB 2GEYA 1L5GB 6STDA 1Q40A 3LH4A 4G1MB 1LRAA 5A0OB 1EUIC 1RHLA 1K8A4 3LT8A 1CQSA 3DXOA 4K90B 2CKFB 1TUHA 2STDA 5LC6A 1EQKA 2F56A 1QVF2 4WHAA 1Q9EA 1RTUA 4O2HA 4XBYA 2XH9A 3G8ZA 1D6YA 4N3VA 4N6NB 1BSBA 4HM8B 2YFIB 2O3OA 1SPUA 1MWSA 1OGXA 2W6JH 2OTJ3 3HI7A 1QVG2 1IQ8A 2CC3A 4K1UA 3EQQB 2B1XB 2PNCA 4IIAA 3IPTA 2MC8A 2KF4A 4QWTA 5M19A 3ER7A 1FYSA 2W56A 3SLUA 1GOVA 4RNTA 5GSPA 3S27A 1K734 3OX9A 2YFLB 3DGNA 3EC9A 4HAAA 3DY5A 4J8TA 3NBBA 2CFKA 3QRDA 2WGOA 5IW9A 1DMQA 1YNVX 2CX1A 4HJLB 3WR2A 1F8NA 3NHXA 3U97A 1T3BA 1EG9B 3DH2A 1VQ43 2RCDA 1IV9A 1WNHA 1UCIA 3JUQA 1NB5I 3CCQ3 3CXC2 3A76A 2OCTA 3EN8A 3NQZA 4ILFA 2W9PA 1PYLA 9RNTA 4HOHA 3MYTA 3PCSA 1LOVA 3O8YA 3B4PA 3ECFA 3SOAA 1N8QA 1UI8A 3KZTA 5HOHA 1AVKA 1RRLA 5D83A 2KF5A 2F86B 2CFWA 3CPOA 1YVBI 1BOXA 3GWRA 3LYGA 1OH0A 4LYLB 5IG4A 1QALA 1UGIA 3MHEA 1SIHA 3G0KA 3X41A 1N8R4 4GB5A 1A90A 3FLJA 3FZWA 3WMDA 1AV4A 2Q07A 1NU3A 3MG2A 1NNVA 1T2IA 2XFSA 2YFJB 2XFTA 4R9KA 5AYRB 1VQQA 4O3VA 4RNZA 4FCZA 4AEQA 3F7XA 5HGRA 1FW7A 3DUKA 2SARA 4HZ9B 1PY3A 1MWUA 3EJVA 3GAXA 2IUJA 1QAKA 1RN1A 2M7OA 4FMDA 3U1WA 1BUJA 1GMQA 2ZA4A 3FGYA 1GS3A 1R4YA 5ELJA 3L0RA 1CYVA 2CFGA 1GMPA 4CDLA 1W00A 2CK3H 3HIGA 3BNCA 3NV0A 3CCJ3 1RGLA 2QA43 3KFQC 3OXAA 1LOXA 1O7WB 1MNLA 1T2HA 3D9RA 3BIRA 4JRFA 1M1XB 7GSPA 8RNTA 2ZL8A 2H0GA 1GOYA 3EE1A 3CNXA 1W7CA 2GEXA 3BLZA 3FG1A 5EEOA 1RKYA 1ZO2A 4STDA 3G16A 4N6MA 3CCU3 3KN4A 3X42A 1W6CA 2XSHB 1JZDA 1YJ93 1GY5A 1JV2B 3FSDA 4MMXB 1TP6A 1UCKA 2KF6A 4OK0A 4WFOA 3UL5A 1VQO3 4MMYB 1S5AA 1KWIA 2WO0A 3IMAB 5G1KA 3S5CA 3DZLA 2W56B 3A5EA 4LZIA 3F14A 4JF8A 5AIGA 4HM0B 3UJMA 4N6OB 1UI7A 2ZDJA 4BTXA 2CWTA 3D5IA 1EA2A 3EBTA 3OWUA 7STDA 1DVDA 3NM2A 2BU4A 3GZYB 1W2B2 1A2VA 3Q90A 5IG3A 4HYZA 2D1WA 5JBSA 3CCV3 1VQ73 1IV7A 1BNRA 1T5YA 1BNIA 2W04A 3D4AA 2FXTA 1E97A 4HBRA 3FKAA 4HZBB 4HM6B 3ZG5A 1S723 4LEHA 1DMNA 4X2OA 1WMNA 3DGMA 4XBTA 1OGZA 1RNTA 4GSPA 4H61A 1BNSA 3FG4A 2UGIA 3FCSB 3GRDA 1ZS7A 3LMLA 1N5HA 1JZOA 4FCMA 1I70A 4R4KA 5CLKA 1FGTA 3V98A 2IMJA 4BIRA 1FGMA 3EB8A 3N54B 3V99A 3EN1B 1KSIA 1N9EA 4L8OA 4BTYA 1BSEA 5IENA 2RFRA 3V92A 3JUMA 2I9WA 4L7KA 5I97A 1UDII 3AHSA 2BMRB 4WYKA 3PXMA 3MG1A 1J2BA 1LXEA 2MF7A 4HM2B 1GD4A 3CU3A 5KP1A 2UX0A 1YIJ3 2CX0A 1YVSA 6RNTA 3PCRA 4XM4A 1D6ZA 1JN5A 1I2FA 1JRQA 2BO9B 3H51A 3GZBA 1YGWA 2WOHA 4K1VA 4LMIA 1LQMB 3JUNA 4N6TA 4TX4A 4FR9A 1SIIA 1IVXA 1W2ZA 3RDEA 3CC23 1RGCA 1B2MA 1K28A 1RCKA 4DKIA 3DM8A 3I553 2HOHA 5AI1A 3CME3 4R9LA 4XDVA 3SEDA 1B2SA 5JPPA 1YI23 1RSNA 3TDGA 3S28A 1TFOA 4RBNA 3BU4A 2OWPA 5EQLA 1I8VA 1BNFA 1GYBA 1I0VA 4CCVA 3K0ZA 1I2GA 1JBRA 3K63A 4MJDA 1V74A 1KD14 3DMCA 1MOLA 1ROVA 1BSAA 2E2UA 4BL3A 2CW9A 3VSYA 2F4YA 2GBWB 4AKZA 3N9HA 2RGQA 1X1XA 1AQZA 2WOFA 1I3FA 3MKIA 3NQYA 1B3SA 4FMAA 3GZXB 3WOEB 1HZ1A 4NPBA 3NXJA 1ISKA 3MG3A 5D82A 1ZX2A 1V57A 2P05A 3AGNA 4PEJA 4XBXA 1D6UA 1Q40B 3K7CA 5STDA 4HM1B 1JKGA 2E2TA 2UUGC 2HMKB 3IJEB 3GSPA 4I5QA 2LQVA 3UNLA 2P0XA 3AGOA 1JN5B 1PFPA 1QAFA 3AHWA 1IQYA 3X3YA 3AMOA 1NO3A 2ZHXB 4EYCA 4GL6A 1W02A 3QK9A 2QIYA 3LOYA 3EF8A 2R41A 1STFI 4RNYA 1V58A 4IPBA 3WA3A 3B8LA 4KFEA 1CEWI 6GSPA 1O7NB 4MEIA 4O8SA 5G2GA 1K9M4 4WYKB 1IQXA 1UUGB 1I2EA 2AAEA 4I4KA 3CPW2 1Q814 4X2HA 1LOYA 3JUPA 1M904 3F8HA 1QMAA 2K0MA 5AIIA 1O7MB 3RNTA 5IERA 1FUWA 5IG5A 4FCJA 3S67A 5M18A 5AEWB 1BUQA 1JB4A 5CF1A 3CCE3 1CH0A 3WA2X 1NWWA 2D42A 4RZMA 5BVBA 3ROBA 3G4S3 1KQS2 3NBRA 2CFLA 1RJOA 2H0IA 2IYJA 2F99A 4OVMA 2JQ5A 4KFFA 3Q3FA 1Q42A 1BAOA 1TU5A 1VQL3 1JBTA 1B2ZA 1RGHA 3BNEA 2OOVA 1RCLA 1ZGXA 1HYFA 2IA7A
chains in the Genus database with same CATH topology
1DVCA 3KIIA 3LTDA 3BNDA 3LZAA 1JNQA 5CK6A 1JKGB 3ALAA 2BT3A 2CG0A 1G96A 2XGLA 3UL6A 3MSOA 1E3VA 1FGQA 4LSOA 2P09A 1UUWB 3STDA 3Q1CA 2SBLA 3F8XA 5DRVA 3B4OA 3D3LA 2INXA 2K54A 2Z6BA 4XB5A 1EKMA 2BHMA 1ASKA 5ELUA 2HMJB 3DGLA 8CHOA 1WTHA 2LYXA 5BXQA 1GY7A 2W9QA 1VQ93 4L8PA 5TGNA 1YHQ3 4ORLA 4R80A 2XF3A 5AIHA 2R4IA 4EBGA 2QGUA 3NBJA 2XSOB 4MMZB 2P38A 2YX9A 2O9UX 1A67A 3JUOA 1YIT3 3CNMA 1JB5A 2V1LA 4ZM8A 5FGOA 4KFDA 3CCR3 1STDA 1Y4KA 3HX8A 4KVHA 2OQEA 1JB2A 3BNBA 1TIJA 1VQ63 3CCM3 2OTL3 1IVUA 5D81A 2KRTA 4LGQA 3KSED 3WOFB 2Y73A 1FA3A 4FMCA 3LXUX 4OUQA 1Q7Y4 5KP4A 1AR0A 3HIIA 1RRHA 3Q2PA 1KC84 1K41A 3F9SA 2GXFA 3UB1A 3T8NA 2HMNB 3EHCA 1RN7A 1OACA 4IT7A 1M1K4 2ML5A 4N6V0 3SXXA 1U5OA 2CIUA 3X3ZA 3FG3A 1Q864 3OWYA 1W6YA 3WDGB 1WMOA 3WODG 5IG0A 1VQ53 1NDOB 2XEPA 5AEUB 3F7SA 3GZRA 2CFDA 3T0UA 4U13A 2XRXB 2BMQB 5CF2A 1VQM3 1N9JA 2HMMB 4N6UA 5EVHA 4EXRA 5IEOA 3FF0A 1VZZA 2KCDA 3MWZA 3PYJA 1GY6A 1OHPA 3JVCA 5IEPA 2FGTA 5DREA 1IK3A 4WWUC 5CXOA 1OUNA 3I0YA 2WGQA 1US1A 1IT8A 3DGOA 3NX0A 3CCS3 1W6GA 2XGNA 3LTAA 4J9AA 3T8UA 2OQEC 1W5ZA 1TFKA 1VQP3 2CWVA 1AVLA 2GU1A 3MPHA 5LC7A 3PS8A 1Q824 1OF5B 1ULIB 2B24B 1R4CA 4HM4B 1YJN3 3CCL3 3PGBA 3EX9A 3OW22 4KZ1A 5AIFA 3LT9A 4H3UA 1HKXA 4N6LA 3LTBA 3J7Yd 3KKGA 1PU4A 1WMPA 2Y74A 3SX1A 1CYUA 1UW1A 4K61A 1LVNA 2F98A 5AYSC 2RSXA 3KE7A 1W01A 3AMOB 2IUKA 3HK4A 2C10A 2L4VA 2CWUA 1ULJB 1YGEA 3BB9A 3G16A 1Z1SA 1OCVA 2BNGA 2Z76A 4HM3B 3CC73 1WQLB 1IT7A 2Z7AA 1NJI4 1QJGA 3S29A 3HZPA 2QEX3 1N5PA 2Z77A 3X3XA 1O7HB 3NV0B 3K9MC 1O7GB 2CH9A 2FNQA 1A2KA 3H3HA 3VF1A 1GD3A 1VQ83 4R1KA 4HVNA 5KP3A 3K5TA 4XDWA 3RGRA 3CMA3 3RGAA 1IU7A 4NREA 3I563 2CHCA 3CC43 3LTCA 2OOVC 4HM7B 3X40A 5FW5A 3KSPA 1E3RA 4EC6A 1DYUA 1O7PB 1LNHA 3FH1A 3FF2A 3NM7A 1W4NA 2W03A 1FGOA 3OWSA 4BTWA 1DMMA 3PZWA 1HU9A 3NUVA 2KXGA 1OPYA 2BMOB 2W0QA 1OHSA 3SOYA 3SVAA 4EV5A 3E99A 4HM5B 4O02B 1U8CB 3VGNA 1YJW3 3N8BA 2P0MA 4EV2A 2A15A 1VQK3 1M9GA 3M8CA 4FMBA 1SQWA 5IF6A 4Q53A 1SJWA 1OHOA 2JDIH 1VQN3 1IDPA 1IVVA 3G6E3 2E2VA 1FGRA 4WP5A 4HKVB 1NB3I 1OF5A 2W2CA 5JPUA 3G713 1UUVB 4AKYA 1C7HA 2GBXB 2HMOB 3B7CA 1ROAA 3EBYA 2XR8B 2C11A 2ML6A 2CG1A 2GU3A 2PZVA 3OV4A 1IVWA 3F40A 1JJ22 4NHFA 2HMLB 2GEYA 1L5GB 6STDA 1Q40A 3LH4A 4G1MB 5A0OB 1K8A4 3LT8A 1CQSA 3DXOA 4K90B 2CKFB 1TUHA 2STDA 5LC6A 1EQKA 1QVF2 4WHAA 4O2HA 4XBYA 2XH9A 3G8ZA 1D6YA 4N3VA 4N6NB 4HM8B 2YFIB 2O3OA 1SPUA 1OGXA 2W6JH 2OTJ3 3HI7A 1QVG2 1IQ8A 2CC3A 4K1UA 3EQQB 2B1XB 2PNCA 4IIAA 3IPTA 2MC8A 4QWTA 3ER7A 2W56A 3SLUA 3S27A 1K734 3OX9A 2YFLB 3DGNA 3EC9A 4J8TA 3DY5A 3NBBA 2CFKA 3QRDA 2WGOA 5IW9A 1DMQA 4HJLB 1F8NA 3NHXA 3U97A 1EG9B 1VQ43 2RCDA 1IV9A 1WNHA 3JUQA 1NB5I 3CCQ3 3CXC2 3A76A 2OCTA 3EN8A 3NQZA 2W9PA 3MYTA 3PCSA 3O8YA 3B4PA 3ECFA 3SOAA 1N8QA 1UI8A 3KZTA 1AVKA 1RRLA 5D83A 2F86B 2CFWA 3CPOA 1YVBI 3GWRA 3LYGA 1OH0A 5IG4A 1QALA 3MHEA 1SIHA 3G0KA 3X41A 1N8R4 4GB5A 1A90A 3FLJA 3FZWA 3WMDA 1AV4A 2Q07A 1NU3A 3MG2A 5AYRB 2XFSA 2YFJB 4R9KA 2XFTA 4O3VA 4RNZA 4FCZA 4AEQA 3F7XA 5HGRA 3DUKA 4HZ9B 3EJVA 3GAXA 2IUJA 1QAKA 2M7OA 4FMDA 3U1WA 3FGYA 1GS3A 5ELJA 3L0RA 1CYVA 2CFGA 4CDLA 1W00A 2CK3H 3HIGA 3BNCA 3NV0A 3CCJ3 2QA43 3KFQC 3OXAA 1LOXA 1O7WB 1MNLA 3D9RA 4JRFA 1M1XB 2ZL8A 3EE1A 3CNXA 1W7CA 2GEXA 3BLZA 3FG1A 5EEOA 1RKYA 1ZO2A 4STDA 4N6MA 3CCU3 3KN4A 3X42A 1W6CA 2XSHB 1YJ93 1GY5A 1JV2B 3FSDA 4MMXB 1TP6A 4OK0A 3UL5A 4WFOA 1VQO3 4MMYB 1S5AA 1KWIA 2WO0A 3IMAB 3S5CA 3DZLA 2W56B 4LZIA 3F14A 4JF8A 5AIGA 4HM0B 3UJMA 4N6OB 1UI7A 2ZDJA 4BTXA 2CWTA 1DVDA 1EA2A 3EBTA 3OWUA 7STDA 3NM2A 1W2B2 3GZYB 1A2VA 3Q90A 5IG3A 4HYZA 2D1WA 5JBSA 3CCV3 1VQ73 1IV7A 1T5YA 2W04A 2FXTA 1E97A 4HBRA 3FKAA 4HZBB 4HM6B 1S723 4LEHA 1DMNA 4X2OA 1WMNA 3DGMA 4XBTA 1OGZA 4H61A 3LMLA 3FG4A 3FCSB 3GRDA 1N5HA 4FCMA 4R4KA 5CLKA 1FGTA 3V98A 2IMJA 1FGMA 3EB8A 3N54B 3V99A 3EN1B 1KSIA 1N9EA 4L8OA 4BTYA 5IENA 2RFRA 3V92A 3JUMA 2I9WA 4L7KA 5I97A 2BMRB 4WYKA 3PXMA 3MG1A 1J2BA 1LXEA 2MF7A 4HM2B 1GD4A 3CU3A 5KP1A 2UX0A 1YIJ3 3PCRA 4XM4A 1JN5A 1D6ZA 1JRQA 2BO9B 3H51A 4K1VA 3GZBA 4LMIA 2WOHA 4N6TA 4TX4A 3JUNA 4FR9A 1SIIA 1IVXA 1W2ZA 3RDEA 3CC23 1K28A 3I553 3DM8A 5AI1A 3CME3 4R9LA 4XDVA 3SEDA 5JPPA 1YI23 3CD63 3TDGA 3S28A 1TFOA 4RBNA 2OWPA 5EQLA 1GYBA 4CCVA 3K0ZA 3K63A 4MJDA 1V74A 1KD14 3DMCA 1MOLA 1ROVA 2E2UA 2CW9A 3VSYA 2GBWB 4AKZA 3N9HA 2RGQA 2WOFA 3MKIA 3NQYA 4FMAA 3GZXB 3WOEB 3NXJA 1ISKA 3MG3A 5D82A 1ZX2A 4PEJA 2P05A 4XBXA 1D6UA 1Q40B 3K7CA 5STDA 4HM1B 1JKGA 2E2TA 3IJEB 2HMKB 3UNLA 2LQVA 2P0XA 1JN5B 1PFPA 1QAFA 3X3YA 1IQYA 3AMOA 1NO3A 4EYCA 4GL6A 1W02A 3QK9A 2QIYA 3LOYA 3EF8A 1STFI 4RNYA 4IPBA 3WA3A 3B8LA 4KFEA 1CEWI 1O7NB 4MEIA 4O8SA 5G2GA 1K9M4 4WYKB 1IQXA 4I4KA 3CPW2 1Q814 4X2HA 3JUPA 1M904 3F8HA 1QMAA 2K0MA 5AIIA 1O7MB 5IERA 1FUWA 5IG5A 4FCJA 3S67A 5AEWB 1BUQA 1JB4A 5CF1A 3CCE3 3WA2X 1NWWA 2D42A 4RZMA 5BVBA 3ROBA 3G4S3 1KQS2 3NBRA 2CFLA 1RJOA 2F99A 4OVMA 2JQ5A 4KFFA 1Q42A 1TU5A 1VQL3 3BNEA 2OOVA 2IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1U A;  3EQQ B;  2B1X B;  4XBT A;  1OGZ A;  4IIA A;  3IPT A;  3LZA A;  4U13 A;  3GRD A;  1JKG B;  5CK6 A;  3ER7 A;  2F98 A;  4FCM A;  5CLK A;  3KE7 A;  1W01 A;  3MSO A;  3HK4 A;  2IMJ A;  4X2O A;  1E3V A;  3BB9 A;  3G16 A;  1ULJ B;  1Z1S A;  1OCV A;  2BNG A;  2Z76 A;  3EN1 B;  3OX9 A;  4HM3 B;  2YFL B;  1UUW B;  3EC9 A;  4J8T A;  4L8O A;  1WQL B;  3STD A;  5IEN A;  2RFR A;  2Z7A A;  3F8X A;  1DMQ A;  3JUM A;  2I9W A;  4HJL B;  3B4O A;  4L7K A;  5DRV A;  1QJG A;  2BMR B;  3NHX A;  2INX A;  2K54 A;  3HZP A;  4WYK A;  1EG9 B;  4XB5 A;  3MG1 A;  2RCD A;  2Z77 A;  1ASK A;  1O7H B;  4HM2 B;  2HMJ B;  3JUQ A;  3NV0 B;  8CHO A;  1O7G B;  3CU3 A;  5KP1 A;  5BXQ A;  2UX0 A;  3A76 A;  3EN8 A;  1GY7 A;  1A2K A;  3H3H A;  4XM4 A;  1JN5 A;  4L8P A;  3H51 A;  5TGN A;  4K1V A;  3GZB A;  4HVN A;  4LMI A;  4ORL A;  4R1K A;  3JUN A;  4XDW A;  2R4I A;  5AIH A;  3RGR A;  3MYT A;  2QGU A;  3B4P A;  3ECF A;  3RGA A;  3SOA A;  2XSO B;  3KZT A;  2CHC A;  3DM8 A;  5D83 A;  2F86 B;  3CPO A;  4HM7 B;  4R9L A;  4XDV A;  5AI1 A;  3KSP A;  3GWR A;  3LYG A;  3JUO A;  5FW5 A;  3SED A;  5JPP A;  1OH0 A;  3CNM A;  1JB5 A;  1E3R A;  2OWP A;  5IG4 A;  1GYB A;  1O7P B;  3MHE A;  3FH1 A;  3G0K A;  4GB5 A;  3FF2 A;  3FLJ A;  3FZW A;  3WMD A;  3K0Z A;  1NU3 A;  3MG2 A;  3OWS A;  1STD A;  2YFJ B;  3HX8 A;  1DMM A;  4KVH A;  4MJD A;  4R9K A;  1JB2 A;  3DMC A;  3F7X A;  3NUV A;  5HGR A;  1OPY A;  3DUK A;  2BMO B;  1OHS A;  3SOY A;  3VSY A;  2GBW B;  5D81 A;  2RGQ A;  4HZ9 B;  4LGQ A;  3E99 A;  3MKI A;  3EJV A;  4HM5 B;  4OUQ A;  5KP4 A;  1AR0 A;  3VGN A;  3GZX B;  1K41 A;  3F9S A;  2GXF A;  3T8N A;  2HMN B;  3NXJ A;  1ISK A;  3MG3 A;  3EHC A;  5D82 A;  3FGY A;  1ZX2 A;  1GS3 A;  4PEJ A;  4XBX A;  1Q40 B;  2A15 A;  3K7C A;  4CDL A;  1W00 A;  1U5O A;  3M8C A;  5STD A;  3NV0 A;  5IF6 A;  5JPU A;  4HM1 B;  1JKG A;  1SJW A;  1W6Y A;  1OHO A;  2HMK B;  3OXA A;  3OWY A;  4Q53 A;  1O7W B;  1IDP A;  3D9R A;  5IG0 A;  3UNL A;  6STD A;  1NDO B;  1JN5 B;  5AEU B;  3F7S A;  3GZR A;  4WP5 A;  3CNX A;  4HKV B;  2BMQ B;  1OF5 A;  1W02 A;  2GEX A;  2QIY A;  2W2C A;  2HMM B;  1UUV B;  2XRX B;  3BLZ A;  3EF8 A;  5EVH A;  1C7H A;  2GBX B;  1ZO2 A;  2HMO B;  3B7C A;  3EBY A;  4STD A;  3B8L A;  2XR8 B;  2XSH B;  5IEO A;  3FF0 A;  1O7N B;  5G2G A;  2PZV A;  1GY5 A;  3FSD A;  3OV4 A;  4WYK B;  1TP6 A;  5IER A;  3F40 A;  1VZZ A;  4I4K A;  1GY6 A;  1OHP A;  4X2H A;  3JUP A;  5IEP A;  5DRE A;  3F8H A;  1QMA A;  2HML B;  1S5A A;  1O7M B;  2GEY A;  4WWU C;  1Q40 A;  5CXO A;  4FCJ A;  1OUN A;  3I0Y A;  3S5C A;  3DZL A;  5AEW B;  5IG5 A;  1BUQ A;  1JB4 A;  5KP3 A;  1CQS A;  4J9A A;  3DXO A;  3T8U A;  2CKF B;  5CF1 A;  1TUH A;  1NWW A;  2STD A;  3F14 A;  4HM0 B;  4RZM A;  5AIG A;  3UJM A;  3ROB A;  5BVB A;  3NBR A;  1EA2 A;  3EBT A;  3OWU A;  7STD A;  4XBY A;  3NM2 A;  1OF5 B;  3GZY B;  1ULI B;  2B24 B;  2F99 A;  2JQ5 A;  3Q90 A;  4HM4 B;  4OVM A;  1Q42 A;  3G8Z A;  5IG3 A;  4N3V A;  5CF2 A;  3EX9 A;  4HM8 B;  2YFI B;  1E97 A;  5AIF A;  1OGX A;  1HKX A;  4H3U A;  3FKA A;  4HZB B;  3KKG A;  5AII A;  4HM6 B;  4LEH A;  1DMN A; 
#chains in the Genus database with same CATH topology
 1DVC A;  3KII A;  3LTD A;  3BND A;  3LZA A;  1JNQ A;  5CK6 A;  1JKG B;  3ALA A;  2BT3 A;  2CG0 A;  1RGF A;  1G96 A;  1X1Y A;  2XGL A;  3UL6 A;  3MSO A;  1E3V A;  2RBI A;  1FGQ A;  4LSO A;  1RGA A;  2P09 A;  1UUW B;  3STD A;  3Q1C A;  2SBL A;  3F8X A;  5DRV A;  3B4O A;  1B2U A;  3D3L A;  2INX A;  2K54 A;  2Z6B A;  4XB5 A;  1EKM A;  2BHM A;  1ASK A;  5ELU A;  3KCH A;  2HMJ B;  3DGL A;  8CHO A;  1WTH A;  2LYX A;  5BXQ A;  2F5M A;  1GY7 A;  2W9Q A;  1VQ9 3;  1BVI A;  4L8P A;  5TGN A;  1YHQ 3;  4ORL A;  4R80 A;  2XF3 A;  5AIH A;  2R4I A;  4EBG A;  2QGU A;  3NBJ A;  2XSO B;  4MMZ B;  2P38 A;  2YX9 A;  2O9U X;  1UGH I;  1A67 A;  3JUO A;  1B27 A;  1YIT 3;  3CNM A;  5G1L A;  1JB5 A;  1BRI A;  1IYY A;  1BGS A;  2V1L A;  4ZM8 A;  5FGO A;  1A2P A;  2H0H A;  4KFD A;  3CCR 3;  1STD A;  1BSD A;  1Y4K A;  3HX8 A;  4KVH A;  2OQE A;  1JB2 A;  3BNB A;  1TIJ A;  1VQ6 3;  3CCM 3;  2OTL 3;  1IVU A;  5D81 A;  1TJD A;  2KRT A;  3D5G A;  5M1A A;  4LGQ A;  3KSE D;  3WOF B;  1BSC A;  5RNT A;  2Y73 A;  1FA3 A;  4FMC A;  3LXU X;  4OUQ A;  1Q7Y 4;  5KP4 A;  1AR0 A;  3HII A;  1RRH A;  3Q2P A;  4EW5 A;  1KC8 4;  1K41 A;  3F9S A;  2GXF A;  3UB1 A;  3T8N A;  2HMN B;  3EHC A;  1RN7 A;  1OAC A;  1LOW A;  4IT7 A;  1M1K 4;  2ML5 A;  4N6V 0;  3SXX A;  1U5O A;  2CIU A;  3X3Z A;  2L1S A;  3FG3 A;  1Q86 4;  1BNJ A;  1MWR A;  1W6Y A;  3OWY A;  3WDG B;  1WMO A;  3WOD G;  5IG0 A;  1VQ5 3;  1EEJ A;  1NDO B;  2XEP A;  5AEU B;  3F7S A;  3GZR A;  3ZG0 A;  2CFD A;  7RNT A;  3T0U A;  4U13 A;  2BMQ B;  2XRX B;  5CF2 A;  1VQM 3;  1N9J A;  2K3D A;  2HMM B;  4N6U A;  1BNE A;  5EVH A;  4EXR A;  2J8X B;  1BRJ A;  4CPK A;  1B21 A;  5IEO A;  3FF0 A;  1VZZ A;  2KCD A;  3MWZ A;  3PYJ A;  1GY6 A;  1OHP A;  3JVC A;  5IEP A;  2FGT A;  5DRE A;  4BU4 A;  1IK3 A;  4WWU C;  5CXO A;  1OUN A;  3I0Y A;  2WGQ A;  1US1 A;  1IT8 A;  3DGO A;  3NX0 A;  3CCS 3;  1W6G A;  2XGN A;  3LTA A;  4J9A A;  1RDS A;  3T8U A;  2OQE C;  4BL2 A;  1W5Z A;  1TFK A;  1VQP 3;  5BIR A;  2CWV A;  1AVL A;  2GU1 A;  3MPH A;  5LC7 A;  3PS8 A;  4CJN A;  1DET A;  1OF5 B;  1Q82 4;  1ULI B;  2B24 B;  1R4C A;  2IY2 A;  4GHO A;  4HM4 B;  1YJN 3;  3CCL 3;  3PGB A;  3EX9 A;  3OW2 2;  3HOH A;  1BRG A;  4KZ1 A;  5AIF A;  3LT9 A;  4H3U A;  1HKX A;  4N6L A;  3LTB A;  3J7Y d;  3KKG A;  1BU4 A;  1PU4 A;  1G0T A;  1WMP A;  2Y74 A;  3SX1 A;  1CYU A;  1UW1 A;  1RMS A;  4K61 A;  1LVN A;  1LQG C;  2F5W A;  1G02 A;  2F98 A;  3WHO A;  1AY7 A;  2RSX A;  5AYS C;  3KE7 A;  1W01 A;  3AMO B;  2IUK A;  3HK4 A;  2C10 A;  2L4V A;  2CWU A;  1ULJ B;  1YGE A;  1MGR A;  3BB9 A;  1Z1S A;  1OCV A;  2BNG A;  2Z76 A;  3DGY A;  4HM3 B;  3CC7 3;  1B20 A;  1BAN A;  1WQL B;  4KT3 B;  1IT7 A;  2Z7A A;  1NJI 4;  5BU4 A;  1QJG A;  3S29 A;  3HZP A;  2QEX 3;  1BRN L;  1RGG A;  1N5P A;  1BNG A;  2Z77 A;  3X3X A;  1O7H B;  3NV0 B;  3K9M C;  1O7G B;  2KAA A;  1TRQ A;  2CH9 A;  1DE3 A;  2FNQ A;  1A2K A;  1MWT A;  3H3H A;  3VF1 A;  1GD3 A;  1VQ8 3;  4R1K A;  4HVN A;  5KP3 A;  3K5T A;  4XDW A;  3RGR A;  3CMA 3;  3RGA A;  1IU7 A;  4NRE A;  3I56 3;  2CHC A;  3CC4 3;  1C54 A;  3LTC A;  2OOV C;  4HM7 B;  3X40 A;  5FW5 A;  3KSP A;  2KF3 A;  1JBS A;  1BIR A;  1FUT A;  1GMR A;  1LNI A;  1X1W A;  1X1U A;  1E3R A;  1FUS A;  1DYU A;  3SYU A;  1O7P B;  4EC6 A;  1LNH A;  3FH1 A;  1RGK A;  1TRP A;  3FF2 A;  3NM7 A;  2GSP A;  1W4N A;  2W03 A;  1FGO A;  3OWS A;  3URP A;  3ZFZ A;  4BTW A;  1BRH A;  1DMM A;  2RNT A;  3PZW A;  1HU9 A;  2C4B A;  2KXG A;  1B2X A;  3NUV A;  1OPY A;  1UCJ A;  1GOU A;  2BIR A;  1OHS A;  2BMO B;  2W0Q A;  3SOY A;  3SVA A;  4EV5 A;  4J5K A;  2AAD A;  3E99 A;  1SAR A;  1TTO A;  3D79 A;  4HM5 B;  4O02 B;  1MGW A;  1U8C B;  3VGN A;  1I0X A;  1YJW 3;  3N8B A;  1FZU A;  2P0M A;  4EV2 A;  1BRK A;  2A15 A;  1VQK 3;  1M9G A;  3M8C A;  1UCL A;  4FMB A;  1SQW A;  5IF6 A;  3CD6 3;  4Q53 A;  1SJW A;  1OHO A;  2JDI H;  1VQN 3;  1BRS A;  1IDP A;  1IVV A;  3G6E 3;  2E2V A;  1FGR A;  4WP5 A;  4HKV B;  1NB3 I;  1OF5 A;  1Q7H A;  2W2C A;  5JPU A;  1RLS A;  1UUV B;  3G71 3;  4AKY A;  1C7H A;  1I3I A;  2GBX B;  2HMO B;  3B7C A;  1ROA A;  3EBY A;  2XR8 B;  2C11 A;  1RN4 A;  2ML6 A;  2CG1 A;  2GU3 A;  1RNB A;  2PZV A;  1GSP A;  3OV4 A;  1IVW A;  3F40 A;  1RGE A;  4J5G A;  1JJ2 2;  4NHF A;  2HML B;  2GEY A;  1L5G B;  6STD A;  1Q40 A;  3LH4 A;  4G1M B;  1LRA A;  5A0O B;  1EUI C;  1RHL A;  1K8A 4;  3LT8 A;  1CQS A;  3DXO A;  4K90 B;  2CKF B;  1TUH A;  2STD A;  5LC6 A;  1EQK A;  2F56 A;  1QVF 2;  4WHA A;  1Q9E A;  1RTU A;  4O2H A;  4XBY A;  2XH9 A;  3G8Z A;  1D6Y A;  4N3V A;  4N6N B;  1BSB A;  4HM8 B;  2YFI B;  2O3O A;  1SPU A;  1MWS A;  1OGX A;  2W6J H;  2OTJ 3;  3HI7 A;  1QVG 2;  1IQ8 A;  2CC3 A;  4K1U A;  3EQQ B;  2B1X B;  2PNC A;  4IIA A;  3IPT A;  2MC8 A;  2KF4 A;  4QWT A;  5M19 A;  3ER7 A;  1FYS A;  2W56 A;  3SLU A;  1GOV A;  4RNT A;  5GSP A;  3S27 A;  1K73 4;  3OX9 A;  2YFL B;  3DGN A;  3EC9 A;  4HAA A;  3DY5 A;  4J8T A;  3NBB A;  2CFK A;  3QRD A;  2WGO A;  5IW9 A;  1DMQ A;  1YNV X;  2CX1 A;  4HJL B;  3WR2 A;  1F8N A;  3NHX A;  3U97 A;  1T3B A;  1EG9 B;  3DH2 A;  1VQ4 3;  2RCD A;  1IV9 A;  1WNH A;  1UCI A;  3JUQ A;  1NB5 I;  3CCQ 3;  3CXC 2;  3A76 A;  2OCT A;  3EN8 A;  3NQZ A;  4ILF A;  2W9P A;  1PYL A;  9RNT A;  4HOH A;  3MYT A;  3PCS A;  1LOV A;  3O8Y A;  3B4P A;  3ECF A;  3SOA A;  1N8Q A;  1UI8 A;  3KZT A;  5HOH A;  1AVK A;  1RRL A;  5D83 A;  2KF5 A;  2F86 B;  2CFW A;  3CPO A;  1YVB I;  1BOX A;  3GWR A;  3LYG A;  1OH0 A;  4LYL B;  5IG4 A;  1QAL A;  1UGI A;  3MHE A;  1SIH A;  3G0K A;  3X41 A;  1N8R 4;  4GB5 A;  1A90 A;  3FLJ A;  3FZW A;  3WMD A;  1AV4 A;  2Q07 A;  1NU3 A;  3MG2 A;  1NNV A;  1T2I A;  2XFS A;  2YFJ B;  2XFT A;  4R9K A;  5AYR B;  1VQQ A;  4O3V A;  4RNZ A;  4FCZ A;  4AEQ A;  3F7X A;  5HGR A;  1FW7 A;  3DUK A;  2SAR A;  4HZ9 B;  1PY3 A;  1MWU A;  3EJV A;  3GAX A;  2IUJ A;  1QAK A;  1RN1 A;  2M7O A;  4FMD A;  3U1W A;  1BUJ A;  1GMQ A;  2ZA4 A;  3FGY A;  1GS3 A;  1R4Y A;  5ELJ A;  3L0R A;  1CYV A;  2CFG A;  1GMP A;  4CDL A;  1W00 A;  2CK3 H;  3HIG A;  3BNC A;  3NV0 A;  3CCJ 3;  1RGL A;  2QA4 3;  3KFQ C;  3OXA A;  1LOX A;  1O7W B;  1MNL A;  1T2H A;  3D9R A;  3BIR A;  4JRF A;  1M1X B;  7GSP A;  8RNT A;  2ZL8 A;  2H0G A;  1GOY A;  3EE1 A;  3CNX A;  1W7C A;  2GEX A;  3BLZ A;  3FG1 A;  5EEO A;  1RKY A;  1ZO2 A;  4STD A;  3G16 A;  4N6M A;  3CCU 3;  3KN4 A;  3X42 A;  1W6C A;  2XSH B;  1JZD A;  1YJ9 3;  1GY5 A;  1JV2 B;  3FSD A;  4MMX B;  1TP6 A;  1UCK A;  2KF6 A;  4OK0 A;  4WFO A;  3UL5 A;  1VQO 3;  4MMY B;  1S5A A;  1KWI A;  2WO0 A;  3IMA B;  5G1K A;  3S5C A;  3DZL A;  2W56 B;  3A5E A;  4LZI A;  3F14 A;  4JF8 A;  5AIG A;  4HM0 B;  3UJM A;  4N6O B;  1UI7 A;  2ZDJ A;  4BTX A;  2CWT A;  3D5I A;  1EA2 A;  3EBT A;  3OWU A;  7STD A;  1DVD A;  3NM2 A;  2BU4 A;  3GZY B;  1W2B 2;  1A2V A;  3Q90 A;  5IG3 A;  4HYZ A;  2D1W A;  5JBS A;  3CCV 3;  1VQ7 3;  1IV7 A;  1BNR A;  1T5Y A;  1BNI A;  2W04 A;  3D4A A;  2FXT A;  1E97 A;  4HBR A;  3FKA A;  4HZB B;  4HM6 B;  3ZG5 A;  1S72 3;  4LEH A;  1DMN A;  4X2O A;  1WMN A;  3DGM A;  4XBT A;  1OGZ A;  1RNT A;  4GSP A;  4H61 A;  1BNS A;  3FG4 A;  2UGI A;  3FCS B;  3GRD A;  1ZS7 A;  3LML A;  1N5H A;  1JZO A;  4FCM A;  1I70 A;  4R4K A;  5CLK A;  1FGT A;  3V98 A;  2IMJ A;  4BIR A;  1FGM A;  3EB8 A;  3N54 B;  3V99 A;  3EN1 B;  1KSI A;  1N9E A;  4L8O A;  4BTY A;  1BSE A;  5IEN A;  2RFR A;  3V92 A;  3JUM A;  2I9W A;  4L7K A;  5I97 A;  1UDI I;  3AHS A;  2BMR B;  4WYK A;  3PXM A;  3MG1 A;  1J2B A;  1LXE A;  2MF7 A;  4HM2 B;  1GD4 A;  3CU3 A;  5KP1 A;  2UX0 A;  1YIJ 3;  2CX0 A;  1YVS A;  6RNT A;  3PCR A;  4XM4 A;  1D6Z A;  1JN5 A;  1I2F A;  1JRQ A;  2BO9 B;  3H51 A;  3GZB A;  1YGW A;  2WOH A;  4K1V A;  4LMI A;  1LQM B;  3JUN A;  4N6T A;  4TX4 A;  4FR9 A;  1SII A;  1IVX A;  1W2Z A;  3RDE A;  3CC2 3;  1RGC A;  1B2M A;  1K28 A;  1RCK A;  4DKI A;  3DM8 A;  3I55 3;  2HOH A;  5AI1 A;  3CME 3;  4R9L A;  4XDV A;  3SED A;  1B2S A;  5JPP A;  1YI2 3;  1RSN A;  3TDG A;  3S28 A;  1TFO A;  4RBN A;  3BU4 A;  2OWP A;  5EQL A;  1I8V A;  1BNF A;  1GYB A;  1I0V A;  4CCV A;  3K0Z A;  1I2G A;  1JBR A;  3K63 A;  4MJD A;  1V74 A;  1KD1 4;  3DMC A;  1MOL A;  1ROV A;  1BSA A;  2E2U A;  4BL3 A;  2CW9 A;  3VSY A;  2F4Y A;  2GBW B;  4AKZ A;  3N9H A;  2RGQ A;  1X1X A;  1AQZ A;  2WOF A;  1I3F A;  3MKI A;  3NQY A;  1B3S A;  4FMA A;  3GZX B;  3WOE B;  1HZ1 A;  4NPB A;  3NXJ A;  1ISK A;  3MG3 A;  5D82 A;  1ZX2 A;  1V57 A;  2P05 A;  3AGN A;  4PEJ A;  4XBX A;  1D6U A;  1Q40 B;  3K7C A;  5STD A;  4HM1 B;  1JKG A;  2E2T A;  2UUG C;  2HMK B;  3IJE B;  3GSP A;  4I5Q A;  2LQV A;  3UNL A;  2P0X A;  3AGO A;  1JN5 B;  1PFP A;  1QAF A;  3AHW A;  1IQY A;  3X3Y A;  3AMO A;  1NO3 A;  2ZHX B;  4EYC A;  4GL6 A;  1W02 A;  3QK9 A;  2QIY A;  3LOY A;  3EF8 A;  2R41 A;  1STF I;  4RNY A;  1V58 A;  4IPB A;  3WA3 A;  3B8L A;  4KFE A;  1CEW I;  6GSP A;  1O7N B;  4MEI A;  4O8S A;  5G2G A;  1K9M 4;  4WYK B;  1IQX A;  1UUG B;  1I2E A;  2AAE A;  4I4K A;  3CPW 2;  1Q81 4;  4X2H A;  1LOY A;  3JUP A;  1M90 4;  3F8H A;  1QMA A;  2K0M A;  5AII A;  1O7M B;  3RNT A;  5IER A;  1FUW A;  5IG5 A;  4FCJ A;  3S67 A;  5M18 A;  5AEW B;  1BUQ A;  1JB4 A;  5CF1 A;  3CCE 3;  1CH0 A;  3WA2 X;  1NWW A;  2D42 A;  4RZM A;  5BVB A;  3ROB A;  3G4S 3;  1KQS 2;  3NBR A;  2CFL A;  1RJO A;  2H0I A;  2IYJ A;  2F99 A;  4OVM A;  2JQ5 A;  4KFF A;  3Q3F A;  1Q42 A;  1BAO A;  1TU5 A;  1VQL 3;  1JBT A;  1B2Z A;  1RGH A;  3BNE A;  2OOV A;  1RCL A;  1ZGX A;  1HYF A;  2IA7 A; 
#chains in the Genus database with same CATH homology
 1DVC A;  3KII A;  3LTD A;  3BND A;  3LZA A;  1JNQ A;  5CK6 A;  1JKG B;  3ALA A;  2BT3 A;  2CG0 A;  1G96 A;  2XGL A;  3UL6 A;  3MSO A;  1E3V A;  1FGQ A;  4LSO A;  2P09 A;  1UUW B;  3STD A;  3Q1C A;  2SBL A;  3F8X A;  5DRV A;  3B4O A;  3D3L A;  2INX A;  2K54 A;  2Z6B A;  4XB5 A;  1EKM A;  2BHM A;  1ASK A;  5ELU A;  2HMJ B;  3DGL A;  8CHO A;  1WTH A;  2LYX A;  5BXQ A;  1GY7 A;  2W9Q A;  1VQ9 3;  4L8P A;  5TGN A;  1YHQ 3;  4ORL A;  4R80 A;  2XF3 A;  5AIH A;  2R4I A;  4EBG A;  2QGU A;  3NBJ A;  2XSO B;  4MMZ B;  2P38 A;  2YX9 A;  2O9U X;  1A67 A;  3JUO A;  1YIT 3;  3CNM A;  1JB5 A;  2V1L A;  4ZM8 A;  5FGO A;  4KFD A;  3CCR 3;  1STD A;  1Y4K A;  3HX8 A;  4KVH A;  2OQE A;  1JB2 A;  3BNB A;  1TIJ A;  1VQ6 3;  3CCM 3;  2OTL 3;  1IVU A;  5D81 A;  2KRT A;  4LGQ A;  3KSE D;  3WOF B;  2Y73 A;  1FA3 A;  4FMC A;  3LXU X;  4OUQ A;  1Q7Y 4;  5KP4 A;  1AR0 A;  3HII A;  1RRH A;  3Q2P A;  1KC8 4;  1K41 A;  3F9S A;  2GXF A;  3UB1 A;  3T8N A;  2HMN B;  3EHC A;  1RN7 A;  1OAC A;  4IT7 A;  1M1K 4;  2ML5 A;  4N6V 0;  3SXX A;  1U5O A;  2CIU A;  3X3Z A;  3FG3 A;  1Q86 4;  3OWY A;  1W6Y A;  3WDG B;  1WMO A;  3WOD G;  5IG0 A;  1VQ5 3;  1NDO B;  2XEP A;  5AEU B;  3F7S A;  3GZR A;  2CFD A;  3T0U A;  4U13 A;  2XRX B;  2BMQ B;  5CF2 A;  1VQM 3;  1N9J A;  2HMM B;  4N6U A;  5EVH A;  4EXR A;  5IEO A;  3FF0 A;  1VZZ A;  2KCD A;  3MWZ A;  3PYJ A;  1GY6 A;  1OHP A;  3JVC A;  5IEP A;  2FGT A;  5DRE A;  1IK3 A;  4WWU C;  5CXO A;  1OUN A;  3I0Y A;  2WGQ A;  1US1 A;  1IT8 A;  3DGO A;  3NX0 A;  3CCS 3;  1W6G A;  2XGN A;  3LTA A;  4J9A A;  3T8U A;  2OQE C;  1W5Z A;  1TFK A;  1VQP 3;  2CWV A;  1AVL A;  2GU1 A;  3MPH A;  5LC7 A;  3PS8 A;  1Q82 4;  1OF5 B;  1ULI B;  2B24 B;  1R4C A;  4HM4 B;  1YJN 3;  3CCL 3;  3PGB A;  3EX9 A;  3OW2 2;  4KZ1 A;  5AIF A;  3LT9 A;  4H3U A;  1HKX A;  4N6L A;  3LTB A;  3J7Y d;  3KKG A;  1PU4 A;  1WMP A;  2Y74 A;  3SX1 A;  1CYU A;  1UW1 A;  4K61 A;  1LVN A;  2F98 A;  5AYS C;  2RSX A;  3KE7 A;  1W01 A;  3AMO B;  2IUK A;  3HK4 A;  2C10 A;  2L4V A;  2CWU A;  1ULJ B;  1YGE A;  3BB9 A;  3G16 A;  1Z1S A;  1OCV A;  2BNG A;  2Z76 A;  4HM3 B;  3CC7 3;  1WQL B;  1IT7 A;  2Z7A A;  1NJI 4;  1QJG A;  3S29 A;  3HZP A;  2QEX 3;  1N5P A;  2Z77 A;  3X3X A;  1O7H B;  3NV0 B;  3K9M C;  1O7G B;  2CH9 A;  2FNQ A;  1A2K A;  3H3H A;  3VF1 A;  1GD3 A;  1VQ8 3;  4R1K A;  4HVN A;  5KP3 A;  3K5T A;  4XDW A;  3RGR A;  3CMA 3;  3RGA A;  1IU7 A;  4NRE A;  3I56 3;  2CHC A;  3CC4 3;  3LTC A;  2OOV C;  4HM7 B;  3X40 A;  5FW5 A;  3KSP A;  1E3R A;  4EC6 A;  1DYU A;  1O7P B;  1LNH A;  3FH1 A;  3FF2 A;  3NM7 A;  1W4N A;  2W03 A;  1FGO A;  3OWS A;  4BTW A;  1DMM A;  3PZW A;  1HU9 A;  3NUV A;  2KXG A;  1OPY A;  2BMO B;  2W0Q A;  1OHS A;  3SOY A;  3SVA A;  4EV5 A;  3E99 A;  4HM5 B;  4O02 B;  1U8C B;  3VGN A;  1YJW 3;  3N8B A;  2P0M A;  4EV2 A;  2A15 A;  1VQK 3;  1M9G A;  3M8C A;  4FMB A;  1SQW A;  5IF6 A;  4Q53 A;  1SJW A;  1OHO A;  2JDI H;  1VQN 3;  1IDP A;  1IVV A;  3G6E 3;  2E2V A;  1FGR A;  4WP5 A;  4HKV B;  1NB3 I;  1OF5 A;  2W2C A;  5JPU A;  3G71 3;  1UUV B;  4AKY A;  1C7H A;  2GBX B;  2HMO B;  3B7C A;  1ROA A;  3EBY A;  2XR8 B;  2C11 A;  2ML6 A;  2CG1 A;  2GU3 A;  2PZV A;  3OV4 A;  1IVW A;  3F40 A;  1JJ2 2;  4NHF A;  2HML B;  2GEY A;  1L5G B;  6STD A;  1Q40 A;  3LH4 A;  4G1M B;  5A0O B;  1K8A 4;  3LT8 A;  1CQS A;  3DXO A;  4K90 B;  2CKF B;  1TUH A;  2STD A;  5LC6 A;  1EQK A;  1QVF 2;  4WHA A;  4O2H A;  4XBY A;  2XH9 A;  3G8Z A;  1D6Y A;  4N3V A;  4N6N B;  4HM8 B;  2YFI B;  2O3O A;  1SPU A;  1OGX A;  2W6J H;  2OTJ 3;  3HI7 A;  1QVG 2;  1IQ8 A;  2CC3 A;  4K1U A;  3EQQ B;  2B1X B;  2PNC A;  4IIA A;  3IPT A;  2MC8 A;  4QWT A;  3ER7 A;  2W56 A;  3SLU A;  3S27 A;  1K73 4;  3OX9 A;  2YFL B;  3DGN A;  3EC9 A;  4J8T A;  3DY5 A;  3NBB A;  2CFK A;  3QRD A;  2WGO A;  5IW9 A;  1DMQ A;  4HJL B;  1F8N A;  3NHX A;  3U97 A;  1EG9 B;  1VQ4 3;  2RCD A;  1IV9 A;  1WNH A;  3JUQ A;  1NB5 I;  3CCQ 3;  3CXC 2;  3A76 A;  2OCT A;  3EN8 A;  3NQZ A;  2W9P A;  3MYT A;  3PCS A;  3O8Y A;  3B4P A;  3ECF A;  3SOA A;  1N8Q A;  1UI8 A;  3KZT A;  1AVK A;  1RRL A;  5D83 A;  2F86 B;  2CFW A;  3CPO A;  1YVB I;  3GWR A;  3LYG A;  1OH0 A;  5IG4 A;  1QAL A;  3MHE A;  1SIH A;  3G0K A;  3X41 A;  1N8R 4;  4GB5 A;  1A90 A;  3FLJ A;  3FZW A;  3WMD A;  1AV4 A;  2Q07 A;  1NU3 A;  3MG2 A;  5AYR B;  2XFS A;  2YFJ B;  4R9K A;  2XFT A;  4O3V A;  4RNZ A;  4FCZ A;  4AEQ A;  3F7X A;  5HGR A;  3DUK A;  4HZ9 B;  3EJV A;  3GAX A;  2IUJ A;  1QAK A;  2M7O A;  4FMD A;  3U1W A;  3FGY A;  1GS3 A;  5ELJ A;  3L0R A;  1CYV A;  2CFG A;  4CDL A;  1W00 A;  2CK3 H;  3HIG A;  3BNC A;  3NV0 A;  3CCJ 3;  2QA4 3;  3KFQ C;  3OXA A;  1LOX A;  1O7W B;  1MNL A;  3D9R A;  4JRF A;  1M1X B;  2ZL8 A;  3EE1 A;  3CNX A;  1W7C A;  2GEX A;  3BLZ A;  3FG1 A;  5EEO A;  1RKY A;  1ZO2 A;  4STD A;  4N6M A;  3CCU 3;  3KN4 A;  3X42 A;  1W6C A;  2XSH B;  1YJ9 3;  1GY5 A;  1JV2 B;  3FSD A;  4MMX B;  1TP6 A;  4OK0 A;  3UL5 A;  4WFO A;  1VQO 3;  4MMY B;  1S5A A;  1KWI A;  2WO0 A;  3IMA B;  3S5C A;  3DZL A;  2W56 B;  4LZI A;  3F14 A;  4JF8 A;  5AIG A;  4HM0 B;  3UJM A;  4N6O B;  1UI7 A;  2ZDJ A;  4BTX A;  2CWT A;  1DVD A;  1EA2 A;  3EBT A;  3OWU A;  7STD A;  3NM2 A;  1W2B 2;  3GZY B;  1A2V A;  3Q90 A;  5IG3 A;  4HYZ A;  2D1W A;  5JBS A;  3CCV 3;  1VQ7 3;  1IV7 A;  1T5Y A;  2W04 A;  2FXT A;  1E97 A;  4HBR A;  3FKA A;  4HZB B;  4HM6 B;  1S72 3;  4LEH A;  1DMN A;  4X2O A;  1WMN A;  3DGM A;  4XBT A;  1OGZ A;  4H61 A;  3LML A;  3FG4 A;  3FCS B;  3GRD A;  1N5H A;  4FCM A;  4R4K A;  5CLK A;  1FGT A;  3V98 A;  2IMJ A;  1FGM A;  3EB8 A;  3N54 B;  3V99 A;  3EN1 B;  1KSI A;  1N9E A;  4L8O A;  4BTY A;  5IEN A;  2RFR A;  3V92 A;  3JUM A;  2I9W A;  4L7K A;  5I97 A;  2BMR B;  4WYK A;  3PXM A;  3MG1 A;  1J2B A;  1LXE A;  2MF7 A;  4HM2 B;  1GD4 A;  3CU3 A;  5KP1 A;  2UX0 A;  1YIJ 3;  3PCR A;  4XM4 A;  1JN5 A;  1D6Z A;  1JRQ A;  2BO9 B;  3H51 A;  4K1V A;  3GZB A;  4LMI A;  2WOH A;  4N6T A;  4TX4 A;  3JUN A;  4FR9 A;  1SII A;  1IVX A;  1W2Z A;  3RDE A;  3CC2 3;  1K28 A;  3I55 3;  3DM8 A;  5AI1 A;  3CME 3;  4R9L A;  4XDV A;  3SED A;  5JPP A;  1YI2 3;  3CD6 3;  3TDG A;  3S28 A;  1TFO A;  4RBN A;  2OWP A;  5EQL A;  1GYB A;  4CCV A;  3K0Z A;  3K63 A;  4MJD A;  1V74 A;  1KD1 4;  3DMC A;  1MOL A;  1ROV A;  2E2U A;  2CW9 A;  3VSY A;  2GBW B;  4AKZ A;  3N9H A;  2RGQ A;  2WOF A;  3MKI A;  3NQY A;  4FMA A;  3GZX B;  3WOE B;  3NXJ A;  1ISK A;  3MG3 A;  5D82 A;  1ZX2 A;  4PEJ A;  2P05 A;  4XBX A;  1D6U A;  1Q40 B;  3K7C A;  5STD A;  4HM1 B;  1JKG A;  2E2T A;  3IJE B;  2HMK B;  3UNL A;  2LQV A;  2P0X A;  1JN5 B;  1PFP A;  1QAF A;  3X3Y A;  1IQY A;  3AMO A;  1NO3 A;  4EYC A;  4GL6 A;  1W02 A;  3QK9 A;  2QIY A;  3LOY A;  3EF8 A;  1STF I;  4RNY A;  4IPB A;  3WA3 A;  3B8L A;  4KFE A;  1CEW I;  1O7N B;  4MEI A;  4O8S A;  5G2G A;  1K9M 4;  4WYK B;  1IQX A;  4I4K A;  3CPW 2;  1Q81 4;  4X2H A;  3JUP A;  1M90 4;  3F8H A;  1QMA A;  2K0M A;  5AII A;  1O7M B;  5IER A;  1FUW A;  5IG5 A;  4FCJ A;  3S67 A;  5AEW B;  1BUQ A;  1JB4 A;  5CF1 A;  3CCE 3;  3WA2 X;  1NWW A;  2D42 A;  4RZM A;  5BVB A;  3ROB A;  3G4S 3;  1KQS 2;  3NBR A;  2CFL A;  1RJO A;  2F99 A;  4OVM A;  2JQ5 A;  4KFF A;  1Q42 A;  1TU5 A;  1VQL 3;  3BNE A;  2OOV A;  2IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...