5RNTA

X-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray analysis of cubic crystals of the complex formed between ribonuclease T1 and guanosine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
total genus 21
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5rntA00
3A5EA 3DGYA 2F5MA 1RLSA 2KF3A 1X1UA 3D4AA 1AQZA 1I8VA 3AGOA 1JBRA 1I2EA 4BIRA 1TRPA 7RNTA 1UCKA 1BNEA 3HOHA 4HAAA 3DH2A 1BRSA 1RDSA 1BRJA 1UCJA 1YVSA 1T2HA 1GMPA 4RNTA 3D5GA 1BIRA 1BNSA 2GSPA 1GMQA 1GSPA 1RGFA 1JBSA 1BVIA 1R4YA 1RMSA 3BIRA 3D5IA 3WHOA 1RCLA 1RGLA 1I2FA 1I3FA 1BSCA 1RTUA 3AHWA 1HZ1A 3KCHA 5BIRA 1BRGA 1Q9EA 1B2UA 1BSBA 1FYSA 2SARA 1LOVA 4GHOA 1LOWA 1BRKA 3Q3FA 1GOYA 1ZGXA 1BANA 1FZUA 1RGGA 1C54A 9RNTA 1B2SA 1PYLA 4GSPA 1B2ZA 1I0VA 1JBTA 1FUTA 1AY7A 1CH0A 1T2IA 3SYUA 1RN4A 7GSPA 1BRHA 5HOHA 1FUSA 1GOVA 1BNGA 1BSDA 1MGRA 2RBIA 3WR2A 1FW7A 1YNVX 2BIRA 2F56A 3RNTA 1LNIA 1BSAA 1TRQA 1BNRA 1BGSA 2RNTA 5GSPA 3AGNA 1RN1A 1UCIA 1X1WA 1DE3A 1IYYA 1GMRA 1B20A 1BNFA 1RNTA 1B2MA 3URPA 1I2GA 1UCLA 1BOXA 1MGWA 1X1XA 1B21A 1I3IA 1BNJA 6RNTA 3GSPA 1BSEA 6GSPA 1LRAA 1GOUA 1I70A 2ZA4A 2AADA 2KF6A 4BU4A 2HOHA 1RGKA 2KAAA 1YGWA 4HOHA 1BUJA 1RSNA 1HYFA 5BU4A 1BRIA 3BU4A 2F4YA 1BU4A 1DETA 4J5KA 1B3SA 1BAOA 2BU4A 4J5GA 1B27A 2AAEA 1LOYA 1RCKA 1RGEA 1B2XA 1I0XA 2F5WA 2KF4A 1RHLA 1SARA 1TTOA 1X1YA 1PY3A 5RNTA 1RGAA 8RNTA 1BRNL 2KF5A 1A2PA 1G02A 3AHSA 2C4BA 1RGHA 1RGCA 1BNIA 1RNBA
chains in the Genus database with same CATH superfamily
3CCJ3 3DGLA 2GU3A 1O7NB 1IK3A 3EC9A 2CX1A 1Q40B 1W01A 1RKYA 2CFWA 2QGUA 1EUIC 3DGNA 3DXOA 3AGOA 1AVKA 2XEPA 4STDA 5G1LA 5AYSC 1O7PB 3KIIA 4N6MA 1YJN3 4LEHA 4N6TA 1LOXA 5EVHA 3CME3 3OV4A 3MKIA 1CYVA 4J8TA 1O7WB 3WA3A 3JUMA 3BLZA 1RDSA 2B1XB 3GZXB 1GMPA 3K5TA 3U1WA 2CFGA 1DYUA 5KP1A 3TDGA 2GSPA 1W5ZA 2IUKA 3L0RA 2CWVA 3NQZA 4HM1B 4XDWA 1IQ8A 3ZG0A 5M18A 5D82A 4MJDA 3D3LA 1YVBI 1K734 1GSPA 1OGXA 4FMBA 3MG1A 4HM8B 1D6UA 3NBJA 2D1WA 1JBSA 1BVIA 1R4YA 1RMSA 3BIRA 3PZWA 4LZIA 3S29A 1RTUA 2BO9B 1I3FA 3WHOA 1WMPA 2GXFA 1VZZA 2QA43 1BRGA 3LYGA 4KFEA 1BSBA 3LH4A 4HM6B 2W56B 1HKXA 1QVF2 1IVVA 1FGTA 1ROAA 3NBBA 3Q3FA 1A2KA 2JDIH 3OW22 2BMQB 4KVHA 1ZGXA 2W6JH 1N8R4 3B4OA 3CPOA 2OTJ3 1RGGA 4EV2A 3V92A 4GSPA 1QVG2 2WO0A 2GEXA 3JUQA 4G1MB 4HZ9B 2QEX3 2Z76A 1AY7A 1CYUA 1T2IA 2IUJA 3X3YA 1K8A4 3SYUA 1OUNA 1VQK3 2W9QA 7GSPA 1JKGB 3GZBA 1DMNA 1FUSA 1GOVA 1U5OA 4RNYA 2CW9A 1FW7A 1YJ93 2ZHXB 2MC8A 2BMOB 1S5AA 3NHXA 3MWZA 4BL3A 1NB5I 2CG1A 2BT3A 3LTBA 3EBTA 1EKMA 1BGSA 2QIYA 1Q42A 1QJGA 4JRFA 3B8LA 3NM2A 5AI1A 3AGNA 1RN1A 3N9HA 3EJVA 3NUVA 4BTYA 3CCR3 3G8ZA 1DE3A 3JVCA 4RNZA 1GMRA 3NM7A 3RGRA 1S723 3GRDA 1YHQ3 5CF2A 5BXQA 1SQWA 3FZWA 3LTAA 3WOFB 1I2GA 1BOXA 2H0GA 2XFSA 3EBYA 4FMAA 2I9WA 5IG5A 3F40A 4K90B 3RDEA 1VQN3 4DKIA 1AV4A 1IU7A 3LTDA 1GOUA 1N9EA 1I70A 4R80A 4WFOA 1OF5A 4X2HA 1IT7A 2AADA 1OCVA 2HOHA 5HGRA 5AEWB 3NXJA 1SPUA 1BUJA 4GL6A 3F9SA 2E2UA 1W00A 3FG1A 1GD4A 3K9MC 1AR0A 1BU4A 3G6E3 1DETA 1SIIA 2D42A 3HI7A 1A2VA 1M1XB 2K54A 3H3HA 1HU9A 2F98A 1W2ZA 2YFJB 4XDVA 1WMOA 4ZM8A 4N3VA 1I0XA 2F5WA 3U97A 2HMJB 1EA2A 1JRQA 1STDA 2IY2A 1TUHA 1F8NA 1TTOA 3FCSB 1PY3A 3CCM3 1JN5A 1N5HA 1UUGB 2FGTA 2KXGA 3B4PA 3SOYA 3FG4A 2L4VA 2KF5A 1UW1A 3AMOB 1VQM3 1RGCA 1RNBA 2F99A 2F5MA 1TJDA 5DRVA 1RLSA 1KSIA 2KF3A 1NO3A 1Q7Y4 3DGOA 1IVWA 1X1UA 4MEIA 1AQZA 1O7MB 2CG0A 4J9AA 5JPUA 5DREA 3WOEB 4BIRA 5M19A 1TRPA 3EHCA 5AIGA 1ROVA 1NNVA 1VQ63 4H61A 1JJ22 3HOHA 2ML5A 3NV0A 1J2BA 2OWPA 1JB5A 4U13A 3S5CA 5AIFA 4RNTA 3G713 3HIIA 3MG2A 3FG3A 2BMRB 1DMMA 1E97A 4EV5A 3J7Yd 3CCE3 1YI23 4R1KA 2FNQA 4N6LA 1YJW3 1RGFA 4QWTA 2W9PA 1UUVB 3D5IA 4R4KA 1RGLA 1I2FA 3KCHA 1BSCA 4I4KA 3AHWA 1YGEA 3SXXA 4HM0B 4EW5A 5IG4A 1Q9EA 1B2UA 1LVNA 3HK4A 3PGBA 1LOVA 4R9LA 3ECFA 5AEUB 4GHOA 1LOWA 4EYCA 1BRKA 1GOYA 2HMNB 2UUGC 3UL5A 1JB4A 4EXRA 1ISKA 2RFRA 1PU4A 2P05A 3Q1CA 1FZUA 1B2SA 2XF3A 3DM8A 3IMAB 1JBTA 2PZVA 4EC6A 3X40A 5CF1A 2OCTA 1GS3A 4AKYA 5I97A 1RN4A 4HM2B 1Q40A 3KN4A 4WP5A 4IPBA 5HOHA 1AVLA 1UI8A 1MGRA 2RBIA 4XBXA 4JF8A 3X41A 3SOAA 3DMCA 3CCS3 4Q53A 4WYKB 3EE1A 3I0YA 3RNTA 3EN8A 1N8QA 1IYYA 1TRQA 2Q07A 1T5YA 1SJWA 4MMYB 3JUOA 5GSPA 2XRXB 1KWIA 3VGNA 1D6YA 2H0IA 5CK6A 2C11A 1RNTA 1B2MA 1WMNA 3URPA 1IVUA 2XH9A 3AMOA 3GZYB 2ZL8A 4HKVB 1I3IA 4K61A 1BNJA 1Y4KA 4BTWA 6RNTA 3Q2PA 3CCQ3 1JZOA 3IPTA 1LRAA 1NU3A 3G4S3 2P0XA 1RRLA 1D6ZA 1OACA 1MNLA 1OHOA 1QAKA 1OH0A 2K0MA 4FCMA 3V98A 4BU4A 3D9RA 2JQ5A 2KAAA 5FGOA 3K0ZA 1VQL3 3SVAA 1RN7A 1LQGC 2CKFB 4OK0A 1YIJ3 4MMZB 4RBNA 1EG9B 1G96A 2F4YA 4GB5A 3F14A 1ULJB 3PCSA 4RZMA 4J5KA 2XGLA 4J5GA 1BAOA 3JUPA 2W2CA 3OXAA 3CCL3 3QRDA 1T3BA 3CCV3 1B27A 5AIIA 3MPHA 3WMDA 3T0UA 4AEQA 4CPKA 4N6UA 1VQP3 1M904 3FF0A 1VQ73 1SARA 3OWUA 1VQ53 1FGOA 1X1YA 1GY6A 1WQLB 5CXOA 3T8UA 2CH9A 1G0TA 3B7CA 3X3ZA 3WA2X 1QMAA 4NREA 2YX9A 1U8CB 2ML6A 4ORLA 4XM4A 1V58A 1SIHA 3X42A 3DGYA 5D83A 1NDOB 1QALA 3F8HA 1K9M4 3D4AA 5LC7A 1ASKA 3H51A 3LMLA 1NB3I 1JBRA 3M8CA 7RNTA 5IG0A 2CX0A 4O8SA 1W7CA 2OQEA 1BNEA 1R4CA 2R41A 3EF8A 4HAAA 1BRSA 1UGIA 3F7XA 1BRJA 1UUWB 4FCJA 1T2HA 2OOVC 3MYTA 4L8PA 3WDGB 1DVDA 3D5GA 2IA7A 2J8XB 3FF2A 1GY7A 1RJOA 4K1VA 3T8NA 1W6YA 1TIJA 1BNSA 4FR9A 2GU1A 3BNCA 3UJMA 1JV2B 2FXTA 2IYJA 2XFTA 3IJEB 2R4IA 1IVXA 1FGQA 1NWWA 1IV7A 1OHPA 4CDLA 1TFKA 5AIHA 3ZFZA 4BTXA 3PYJA 4HM4B 4O02B 3UNLA 1KD14 4LSOA 5A0OB 5IG3A 1FYSA 2SARA 2XGNA 4K1UA 3WODG 1O7HB 3HX8A 4PEJA 3CC23 2WOFA 1EQKA 1UI7A 2UGIA 1JN5B 4ILFA 4H3UA 4R9KA 5ELUA 1ULIB 1PYLA 1N9JA 1C7HA 3ALAA 2V1LA 2E2VA 3CNXA 4HBRA 1RRHA 4WWUC 2OTL3 1BNGA 3G16A 2B24B 2E2TA 1BSDA 1K28A 2GBXB 2WGQA 3CCU3 3X3XA 1VQQA 3I553 2BIRA 2F56A 3OWSA 1LNIA 4EBGA 1BSAA 1MWSA 2C10A 3O8YA 2STDA 2YFLB 2Y73A 3K7CA 1QAFA 1M9GA 1UCIA 1IV9A 3EQQB 1E3RA 3GZRA 4MMXB 3FGYA 4KT3B 1LXEA 1B20A 1BNFA 3N8BA 1GD3A 1W02A 1WNHA 1STFI 2HMMB 4HM3B 3VSYA 1V74A 2XR8B 4KFFA 3K63A 3DGMA 1JZDA 5AYRB 1BSEA 2CWUA 2YFIB 4HVNA 3DUKA 1Q814 2A15A 3JUNA 4O3VA 5G2GA 5EQLA 3PCRA 3KE7A 4N6NB 3I563 4OVMA 2KF6A 1UGHI 2SBLA 3OWYA 1RGKA 2HMKB 1V57A 1YGWA 2K3DA 5BVBA 1RSNA 3LTCA 1JKGA 5BU4A 4CJNA 1OHSA 3CD63 3Q90A 1BRIA 2H0HA 3MHEA 3G0KA 1LQMB 5TGNA 2O3OA 1IQXA 1JB2A 2AAEA 5EEOA 1N5PA 1RCKA 2KF4A 3BB9A 3F7SA 1FA3A 2CC3A 2RGQA 1L5GB 1FGRA 2LQVA 1M1K4 5D81A 3RGAA 1VQ83 1ZS7A 4I5QA 2O9UX 1US1A 1W6GA 4KFDA 4OUQA 5KP4A 5RNTA 1LNHA 3A76A 3CU3A 3GAXA 3DZLA 4L8OA 1A2PA 3S28A 4TX4A 3AHSA 3LT9A 4XB5A 1RGHA 3BU4A 3NQYA 3A5EA 4HYZA 3KKGA 4NHFA 1JNQA 1W4NA 6STDA 3HZPA 5IENA 5JBSA 3EB8A 1I8VA 1MWUA 2WOHA 2KRTA 3FH1A 3MSOA 1CEWI 1OF5B 5FW5A 3E99A 3LZAA 1I2EA 2LYXA 1TP6A 3KZTA 5IW9A 1IDPA 1TU5A 1UCKA 5ELJA 3BNEA 3DH2A 1YVSA 1UCJA 2XSHB 2XSOB 3N54B 1CQSA 3KSED 1BIRA 3CC73 2MF7A 1TFOA 1WTHA 3KFQC 2F86B 2UX0A 1KQS2 1A67A 4BL2A 1GMQA 2OQEC 1Q824 4IIAA 1VQ93 1BUQA 4CCVA 4N6V0 4IT7A 1YIT3 1RCLA 2L1SA 2GBWB 3PS8A 3MG3A 3STDA 1HZ1A 5BIRA 2P09A 3OX9A 3S27A 1E3VA 4FMDA 4AKZA 5IEPA 2BNGA 1Q864 2CIUA 3SLUA 2BHMA 1Q7HA 2W0QA 1BANA 1C54A 1ZO2A 9RNTA 1EEJA 3CXC2 1OGZA 4HM5B 2CHCA 1B2ZA 2Z77A 1I0VA 5KP3A 1FUTA 5IERA 2W03A 1CH0A 4FMCA 1GYBA 2M7OA 1OPYA 4O2HA 8CHOA 2RSXA 5IF6A 1BRHA 2CK3H 4XBYA 4XBTA 1DVCA 3WR2A 1NJI4 1YNVX 3KSPA 1FGMA 2CWTA 2OOVA 1DMQA 1ZX2A 3NX0A 1BNRA 2P38A 3DY5A 4LYLB 1MWTA 2RNTA 3LT8A 3LXUX 3NV0B 3ROBA 2HMOB 1W6CA 3V99A 2Z7AA 2RCDA 1X1WA 4NPBA 5LC6A 1KC84 2IMJA 3NBRA 1Z1SA 3PXMA 3ER7A 1UCLA 2W56A 1MGWA 1X1XA 3VF1A 4HJLB 1B21A 4HZBB 2HMLB 3BNDA 5G1KA 3FKAA 3GSPA 4HM7B 6GSPA 4L7KA 1IQYA 5JPPA 2PNCA 3EX9A 4LMIA 2ZA4A 2Z6BA 2INXA 3S67A 3CC43 1O7GB 3BNBA 5IEOA 3D79A 4HOHA 5CLKA 2CFLA 1VQO3 1HYFA 3FLJA 4X2OA 4WHAA 3GWRA 5M1AA 2WGOA 3UB1A 4WYKA 1B3SA 2BU4A 2CFKA 2GEYA 2P0MA 3F8XA 4FCZA 3SEDA 2ZDJA 3LOYA 3EN1B 1VQ43 1IT8A 1LOYA 3CNMA 1B2XA 1MWRA 1RGEA 3CPW2 1A90A 3FSDA 7STDA 4N6OB 3SX1A 1RHLA 4KZ1A 3HIGA 4LGQA 3CMA3 1FUWA 1W2B2 1K41A 2Y74A 1PFPA 1RGAA 5STDA 1MOLA 2W04A 3QK9A 3ZG5A 2KCDA 8RNTA 1BRNL 1UDII 3UL6A 1G02A 2C4BA 2CFDA 1GY5A 1BNIA
chains in the Genus database with same CATH topology
3A5EA 3DGYA 2F5MA 1RLSA 2KF3A 1X1UA 3D4AA 1AQZA 1I8VA 3AGOA 1JBRA 1I2EA 4BIRA 1TRPA 7RNTA 1UCKA 1BNEA 3HOHA 4HAAA 3DH2A 1BRSA 1RDSA 1BRJA 1UCJA 1YVSA 1T2HA 1GMPA 4RNTA 3D5GA 1BIRA 1BNSA 2GSPA 1GMQA 1GSPA 1RGFA 1JBSA 1BVIA 1R4YA 1RMSA 3BIRA 3D5IA 3WHOA 1RCLA 1RGLA 1I2FA 1I3FA 1BSCA 1RTUA 3AHWA 1HZ1A 3KCHA 5BIRA 1BRGA 1Q9EA 1B2UA 1BSBA 1FYSA 2SARA 1LOVA 4GHOA 1LOWA 1BRKA 3Q3FA 1GOYA 1ZGXA 1BANA 1FZUA 1RGGA 1C54A 9RNTA 1B2SA 1PYLA 4GSPA 1B2ZA 1I0VA 1JBTA 1FUTA 1AY7A 1CH0A 1T2IA 3SYUA 1RN4A 7GSPA 1BRHA 5HOHA 1FUSA 1GOVA 1BNGA 1BSDA 1MGRA 2RBIA 3WR2A 1FW7A 1YNVX 2BIRA 2F56A 3RNTA 1LNIA 1BSAA 1TRQA 1BNRA 1BGSA 2RNTA 5GSPA 3AGNA 1RN1A 1UCIA 1X1WA 1DE3A 1IYYA 1GMRA 1B20A 1BNFA 1RNTA 1B2MA 3URPA 1I2GA 1UCLA 1BOXA 1MGWA 1X1XA 1B21A 1I3IA 1BNJA 6RNTA 3GSPA 1BSEA 6GSPA 1LRAA 1GOUA 1I70A 2ZA4A 2AADA 2KF6A 4BU4A 2HOHA 1RGKA 2KAAA 1YGWA 4HOHA 1BUJA 1RSNA 1HYFA 5BU4A 1BRIA 3BU4A 2F4YA 1BU4A 1DETA 4J5KA 1B3SA 1BAOA 2BU4A 4J5GA 1B27A 2AAEA 1LOYA 1RCKA 1RGEA 1B2XA 1I0XA 2F5WA 2KF4A 1RHLA 1SARA 1TTOA 1X1YA 1PY3A 5RNTA 1RGAA 8RNTA 1BRNL 2KF5A 1A2PA 1G02A 3AHSA 2C4BA 1RGHA 1RGCA 1BNIA 1RNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A5E A;  3DGY A;  2F5M A;  1RLS A;  2KF3 A;  1X1U A;  3D4A A;  1AQZ A;  1I8V A;  3AGO A;  1JBR A;  1I2E A;  4BIR A;  1TRP A;  7RNT A;  1UCK A;  1BNE A;  3HOH A;  4HAA A;  3DH2 A;  1BRS A;  1RDS A;  1BRJ A;  1UCJ A;  1YVS A;  1T2H A;  1GMP A;  4RNT A;  3D5G A;  1BIR A;  1BNS A;  2GSP A;  1GMQ A;  1GSP A;  1RGF A;  1JBS A;  1BVI A;  1R4Y A;  1RMS A;  3BIR A;  3D5I A;  3WHO A;  1RCL A;  1RGL A;  1I2F A;  1I3F A;  1BSC A;  1RTU A;  3AHW A;  1HZ1 A;  3KCH A;  5BIR A;  1BRG A;  1Q9E A;  1B2U A;  1BSB A;  1FYS A;  2SAR A;  1LOV A;  4GHO A;  1LOW A;  1BRK A;  3Q3F A;  1GOY A;  1ZGX A;  1BAN A;  1FZU A;  1RGG A;  1C54 A;  9RNT A;  1B2S A;  1PYL A;  4GSP A;  1B2Z A;  1I0V A;  1JBT A;  1FUT A;  1AY7 A;  1CH0 A;  1T2I A;  3SYU A;  1RN4 A;  7GSP A;  1BRH A;  5HOH A;  1FUS A;  1GOV A;  1BNG A;  1BSD A;  1MGR A;  2RBI A;  3WR2 A;  1FW7 A;  1YNV X;  2BIR A;  2F56 A;  3RNT A;  1LNI A;  1BSA A;  1TRQ A;  1BNR A;  1BGS A;  2RNT A;  5GSP A;  3AGN A;  1RN1 A;  1UCI A;  1X1W A;  1DE3 A;  1IYY A;  1GMR A;  1B20 A;  1BNF A;  1RNT A;  1B2M A;  3URP A;  1I2G A;  1UCL A;  1BOX A;  1MGW A;  1X1X A;  1B21 A;  1I3I A;  1BNJ A;  6RNT A;  3GSP A;  1BSE A;  6GSP A;  1LRA A;  1GOU A;  1I70 A;  2ZA4 A;  2AAD A;  2KF6 A;  4BU4 A;  2HOH A;  1RGK A;  2KAA A;  1YGW A;  4HOH A;  1BUJ A;  1RSN A;  1HYF A;  5BU4 A;  1BRI A;  3BU4 A;  2F4Y A;  1BU4 A;  1DET A;  4J5K A;  1B3S A;  1BAO A;  2BU4 A;  4J5G A;  1B27 A;  2AAE A;  1LOY A;  1RCK A;  1RGE A;  1B2X A;  1I0X A;  2F5W A;  2KF4 A;  1RHL A;  1SAR A;  1TTO A;  1X1Y A;  1PY3 A;  5RNT A;  1RGA A;  8RNT A;  1BRN L;  2KF5 A;  1A2P A;  1G02 A;  3AHS A;  2C4B A;  1RGH A;  1RGC A;  1BNI A;  1RNB A; 
#chains in the Genus database with same CATH topology
 3CCJ 3;  3DGL A;  2GU3 A;  1O7N B;  1IK3 A;  3EC9 A;  2CX1 A;  1Q40 B;  1W01 A;  1RKY A;  2CFW A;  2QGU A;  1EUI C;  3DGN A;  3DXO A;  3AGO A;  1AVK A;  2XEP A;  4STD A;  5G1L A;  5AYS C;  1O7P B;  3KII A;  4N6M A;  1YJN 3;  4LEH A;  4N6T A;  1LOX A;  5EVH A;  3CME 3;  3OV4 A;  3MKI A;  1CYV A;  4J8T A;  1O7W B;  3WA3 A;  3JUM A;  3BLZ A;  1RDS A;  2B1X B;  3GZX B;  1GMP A;  3K5T A;  3U1W A;  2CFG A;  1DYU A;  5KP1 A;  3TDG A;  2GSP A;  1W5Z A;  2IUK A;  3L0R A;  2CWV A;  3NQZ A;  4HM1 B;  4XDW A;  1IQ8 A;  3ZG0 A;  5M18 A;  5D82 A;  4MJD A;  3D3L A;  1YVB I;  1K73 4;  1GSP A;  1OGX A;  4FMB A;  3MG1 A;  4HM8 B;  1D6U A;  3NBJ A;  2D1W A;  1JBS A;  1BVI A;  1R4Y A;  1RMS A;  3BIR A;  3PZW A;  4LZI A;  3S29 A;  1RTU A;  2BO9 B;  1I3F A;  3WHO A;  1WMP A;  2GXF A;  1VZZ A;  2QA4 3;  1BRG A;  3LYG A;  4KFE A;  1BSB A;  3LH4 A;  4HM6 B;  2W56 B;  1HKX A;  1QVF 2;  1IVV A;  1FGT A;  1ROA A;  3NBB A;  3Q3F A;  1A2K A;  2JDI H;  3OW2 2;  2BMQ B;  4KVH A;  1ZGX A;  2W6J H;  1N8R 4;  3B4O A;  3CPO A;  2OTJ 3;  1RGG A;  4EV2 A;  3V92 A;  4GSP A;  1QVG 2;  2WO0 A;  2GEX A;  3JUQ A;  4G1M B;  4HZ9 B;  2QEX 3;  2Z76 A;  1AY7 A;  1CYU A;  1T2I A;  2IUJ A;  3X3Y A;  1K8A 4;  3SYU A;  1OUN A;  1VQK 3;  2W9Q A;  7GSP A;  1JKG B;  3GZB A;  1DMN A;  1FUS A;  1GOV A;  1U5O A;  4RNY A;  2CW9 A;  1FW7 A;  1YJ9 3;  2ZHX B;  2MC8 A;  2BMO B;  1S5A A;  3NHX A;  3MWZ A;  4BL3 A;  1NB5 I;  2CG1 A;  2BT3 A;  3LTB A;  3EBT A;  1EKM A;  1BGS A;  2QIY A;  1Q42 A;  1QJG A;  4JRF A;  3B8L A;  3NM2 A;  5AI1 A;  3AGN A;  1RN1 A;  3N9H A;  3EJV A;  3NUV A;  4BTY A;  3CCR 3;  3G8Z A;  1DE3 A;  3JVC A;  4RNZ A;  1GMR A;  3NM7 A;  3RGR A;  1S72 3;  3GRD A;  1YHQ 3;  5CF2 A;  5BXQ A;  1SQW A;  3FZW A;  3LTA A;  3WOF B;  1I2G A;  1BOX A;  2H0G A;  2XFS A;  3EBY A;  4FMA A;  2I9W A;  5IG5 A;  3F40 A;  4K90 B;  3RDE A;  1VQN 3;  4DKI A;  1AV4 A;  1IU7 A;  3LTD A;  1GOU A;  1N9E A;  1I70 A;  4R80 A;  4WFO A;  1OF5 A;  4X2H A;  1IT7 A;  2AAD A;  1OCV A;  2HOH A;  5HGR A;  5AEW B;  3NXJ A;  1SPU A;  1BUJ A;  4GL6 A;  3F9S A;  2E2U A;  1W00 A;  3FG1 A;  1GD4 A;  3K9M C;  1AR0 A;  1BU4 A;  3G6E 3;  1DET A;  1SII A;  2D42 A;  3HI7 A;  1A2V A;  1M1X B;  2K54 A;  3H3H A;  1HU9 A;  2F98 A;  1W2Z A;  2YFJ B;  4XDV A;  1WMO A;  4ZM8 A;  4N3V A;  1I0X A;  2F5W A;  3U97 A;  2HMJ B;  1EA2 A;  1JRQ A;  1STD A;  2IY2 A;  1TUH A;  1F8N A;  1TTO A;  3FCS B;  1PY3 A;  3CCM 3;  1JN5 A;  1N5H A;  1UUG B;  2FGT A;  2KXG A;  3B4P A;  3SOY A;  3FG4 A;  2L4V A;  2KF5 A;  1UW1 A;  3AMO B;  1VQM 3;  1RGC A;  1RNB A;  2F99 A;  2F5M A;  1TJD A;  5DRV A;  1RLS A;  1KSI A;  2KF3 A;  1NO3 A;  1Q7Y 4;  3DGO A;  1IVW A;  1X1U A;  4MEI A;  1AQZ A;  1O7M B;  2CG0 A;  4J9A A;  5JPU A;  5DRE A;  3WOE B;  4BIR A;  5M19 A;  1TRP A;  3EHC A;  5AIG A;  1ROV A;  1NNV A;  1VQ6 3;  4H61 A;  1JJ2 2;  3HOH A;  2ML5 A;  3NV0 A;  1J2B A;  2OWP A;  1JB5 A;  4U13 A;  3S5C A;  5AIF A;  4RNT A;  3G71 3;  3HII A;  3MG2 A;  3FG3 A;  2BMR B;  1DMM A;  1E97 A;  4EV5 A;  3J7Y d;  3CCE 3;  1YI2 3;  4R1K A;  2FNQ A;  4N6L A;  1YJW 3;  1RGF A;  4QWT A;  2W9P A;  1UUV B;  3D5I A;  4R4K A;  1RGL A;  1I2F A;  3KCH A;  1BSC A;  4I4K A;  3AHW A;  1YGE A;  3SXX A;  4HM0 B;  4EW5 A;  5IG4 A;  1Q9E A;  1B2U A;  1LVN A;  3HK4 A;  3PGB A;  1LOV A;  4R9L A;  3ECF A;  5AEU B;  4GHO A;  1LOW A;  4EYC A;  1BRK A;  1GOY A;  2HMN B;  2UUG C;  3UL5 A;  1JB4 A;  4EXR A;  1ISK A;  2RFR A;  1PU4 A;  2P05 A;  3Q1C A;  1FZU A;  1B2S A;  2XF3 A;  3DM8 A;  3IMA B;  1JBT A;  2PZV A;  4EC6 A;  3X40 A;  5CF1 A;  2OCT A;  1GS3 A;  4AKY A;  5I97 A;  1RN4 A;  4HM2 B;  1Q40 A;  3KN4 A;  4WP5 A;  4IPB A;  5HOH A;  1AVL A;  1UI8 A;  1MGR A;  2RBI A;  4XBX A;  4JF8 A;  3X41 A;  3SOA A;  3DMC A;  3CCS 3;  4Q53 A;  4WYK B;  3EE1 A;  3I0Y A;  3RNT A;  3EN8 A;  1N8Q A;  1IYY A;  1TRQ A;  2Q07 A;  1T5Y A;  1SJW A;  4MMY B;  3JUO A;  5GSP A;  2XRX B;  1KWI A;  3VGN A;  1D6Y A;  2H0I A;  5CK6 A;  2C11 A;  1RNT A;  1B2M A;  1WMN A;  3URP A;  1IVU A;  2XH9 A;  3AMO A;  3GZY B;  2ZL8 A;  4HKV B;  1I3I A;  4K61 A;  1BNJ A;  1Y4K A;  4BTW A;  6RNT A;  3Q2P A;  3CCQ 3;  1JZO A;  3IPT A;  1LRA A;  1NU3 A;  3G4S 3;  2P0X A;  1RRL A;  1D6Z A;  1OAC A;  1MNL A;  1OHO A;  1QAK A;  1OH0 A;  2K0M A;  4FCM A;  3V98 A;  4BU4 A;  3D9R A;  2JQ5 A;  2KAA A;  5FGO A;  3K0Z A;  1VQL 3;  3SVA A;  1RN7 A;  1LQG C;  2CKF B;  4OK0 A;  1YIJ 3;  4MMZ B;  4RBN A;  1EG9 B;  1G96 A;  2F4Y A;  4GB5 A;  3F14 A;  1ULJ B;  3PCS A;  4RZM A;  4J5K A;  2XGL A;  4J5G A;  1BAO A;  3JUP A;  2W2C A;  3OXA A;  3CCL 3;  3QRD A;  1T3B A;  3CCV 3;  1B27 A;  5AII A;  3MPH A;  3WMD A;  3T0U A;  4AEQ A;  4CPK A;  4N6U A;  1VQP 3;  1M90 4;  3FF0 A;  1VQ7 3;  1SAR A;  3OWU A;  1VQ5 3;  1FGO A;  1X1Y A;  1GY6 A;  1WQL B;  5CXO A;  3T8U A;  2CH9 A;  1G0T A;  3B7C A;  3X3Z A;  3WA2 X;  1QMA A;  4NRE A;  2YX9 A;  1U8C B;  2ML6 A;  4ORL A;  4XM4 A;  1V58 A;  1SIH A;  3X42 A;  3DGY A;  5D83 A;  1NDO B;  1QAL A;  3F8H A;  1K9M 4;  3D4A A;  5LC7 A;  1ASK A;  3H51 A;  3LML A;  1NB3 I;  1JBR A;  3M8C A;  7RNT A;  5IG0 A;  2CX0 A;  4O8S A;  1W7C A;  2OQE A;  1BNE A;  1R4C A;  2R41 A;  3EF8 A;  4HAA A;  1BRS A;  1UGI A;  3F7X A;  1BRJ A;  1UUW B;  4FCJ A;  1T2H A;  2OOV C;  3MYT A;  4L8P A;  3WDG B;  1DVD A;  3D5G A;  2IA7 A;  2J8X B;  3FF2 A;  1GY7 A;  1RJO A;  4K1V A;  3T8N A;  1W6Y A;  1TIJ A;  1BNS A;  4FR9 A;  2GU1 A;  3BNC A;  3UJM A;  1JV2 B;  2FXT A;  2IYJ A;  2XFT A;  3IJE B;  2R4I A;  1IVX A;  1FGQ A;  1NWW A;  1IV7 A;  1OHP A;  4CDL A;  1TFK A;  5AIH A;  3ZFZ A;  4BTX A;  3PYJ A;  4HM4 B;  4O02 B;  3UNL A;  1KD1 4;  4LSO A;  5A0O B;  5IG3 A;  1FYS A;  2SAR A;  2XGN A;  4K1U A;  3WOD G;  1O7H B;  3HX8 A;  4PEJ A;  3CC2 3;  2WOF A;  1EQK A;  1UI7 A;  2UGI A;  1JN5 B;  4ILF A;  4H3U A;  4R9K A;  5ELU A;  1ULI B;  1PYL A;  1N9J A;  1C7H A;  3ALA A;  2V1L A;  2E2V A;  3CNX A;  4HBR A;  1RRH A;  4WWU C;  2OTL 3;  1BNG A;  3G16 A;  2B24 B;  2E2T A;  1BSD A;  1K28 A;  2GBX B;  2WGQ A;  3CCU 3;  3X3X A;  1VQQ A;  3I55 3;  2BIR A;  2F56 A;  3OWS A;  1LNI A;  4EBG A;  1BSA A;  1MWS A;  2C10 A;  3O8Y A;  2STD A;  2YFL B;  2Y73 A;  3K7C A;  1QAF A;  1M9G A;  1UCI A;  1IV9 A;  3EQQ B;  1E3R A;  3GZR A;  4MMX B;  3FGY A;  4KT3 B;  1LXE A;  1B20 A;  1BNF A;  3N8B A;  1GD3 A;  1W02 A;  1WNH A;  1STF I;  2HMM B;  4HM3 B;  3VSY A;  1V74 A;  2XR8 B;  4KFF A;  3K63 A;  3DGM A;  1JZD A;  5AYR B;  1BSE A;  2CWU A;  2YFI B;  4HVN A;  3DUK A;  1Q81 4;  2A15 A;  3JUN A;  4O3V A;  5G2G A;  5EQL A;  3PCR A;  3KE7 A;  4N6N B;  3I56 3;  4OVM A;  2KF6 A;  1UGH I;  2SBL A;  3OWY A;  1RGK A;  2HMK B;  1V57 A;  1YGW A;  2K3D A;  5BVB A;  1RSN A;  3LTC A;  1JKG A;  5BU4 A;  4CJN A;  1OHS A;  3CD6 3;  3Q90 A;  1BRI A;  2H0H A;  3MHE A;  3G0K A;  1LQM B;  5TGN A;  2O3O A;  1IQX A;  1JB2 A;  2AAE A;  5EEO A;  1N5P A;  1RCK A;  2KF4 A;  3BB9 A;  3F7S A;  1FA3 A;  2CC3 A;  2RGQ A;  1L5G B;  1FGR A;  2LQV A;  1M1K 4;  5D81 A;  3RGA A;  1VQ8 3;  1ZS7 A;  4I5Q A;  2O9U X;  1US1 A;  1W6G A;  4KFD A;  4OUQ A;  5KP4 A;  5RNT A;  1LNH A;  3A76 A;  3CU3 A;  3GAX A;  3DZL A;  4L8O A;  1A2P A;  3S28 A;  4TX4 A;  3AHS A;  3LT9 A;  4XB5 A;  1RGH A;  3BU4 A;  3NQY A;  3A5E A;  4HYZ A;  3KKG A;  4NHF A;  1JNQ A;  1W4N A;  6STD A;  3HZP A;  5IEN A;  5JBS A;  3EB8 A;  1I8V A;  1MWU A;  2WOH A;  2KRT A;  3FH1 A;  3MSO A;  1CEW I;  1OF5 B;  5FW5 A;  3E99 A;  3LZA A;  1I2E A;  2LYX A;  1TP6 A;  3KZT A;  5IW9 A;  1IDP A;  1TU5 A;  1UCK A;  5ELJ A;  3BNE A;  3DH2 A;  1YVS A;  1UCJ A;  2XSH B;  2XSO B;  3N54 B;  1CQS A;  3KSE D;  1BIR A;  3CC7 3;  2MF7 A;  1TFO A;  1WTH A;  3KFQ C;  2F86 B;  2UX0 A;  1KQS 2;  1A67 A;  4BL2 A;  1GMQ A;  2OQE C;  1Q82 4;  4IIA A;  1VQ9 3;  1BUQ A;  4CCV A;  4N6V 0;  4IT7 A;  1YIT 3;  1RCL A;  2L1S A;  2GBW B;  3PS8 A;  3MG3 A;  3STD A;  1HZ1 A;  5BIR A;  2P09 A;  3OX9 A;  3S27 A;  1E3V A;  4FMD A;  4AKZ A;  5IEP A;  2BNG A;  1Q86 4;  2CIU A;  3SLU A;  2BHM A;  1Q7H A;  2W0Q A;  1BAN A;  1C54 A;  1ZO2 A;  9RNT A;  1EEJ A;  3CXC 2;  1OGZ A;  4HM5 B;  2CHC A;  1B2Z A;  2Z77 A;  1I0V A;  5KP3 A;  1FUT A;  5IER A;  2W03 A;  1CH0 A;  4FMC A;  1GYB A;  2M7O A;  1OPY A;  4O2H A;  8CHO A;  2RSX A;  5IF6 A;  1BRH A;  2CK3 H;  4XBY A;  4XBT A;  1DVC A;  3WR2 A;  1NJI 4;  1YNV X;  3KSP A;  1FGM A;  2CWT A;  2OOV A;  1DMQ A;  1ZX2 A;  3NX0 A;  1BNR A;  2P38 A;  3DY5 A;  4LYL B;  1MWT A;  2RNT A;  3LT8 A;  3LXU X;  3NV0 B;  3ROB A;  2HMO B;  1W6C A;  3V99 A;  2Z7A A;  2RCD A;  1X1W A;  4NPB A;  5LC6 A;  1KC8 4;  2IMJ A;  3NBR A;  1Z1S A;  3PXM A;  3ER7 A;  1UCL A;  2W56 A;  1MGW A;  1X1X A;  3VF1 A;  4HJL B;  1B21 A;  4HZB B;  2HML B;  3BND A;  5G1K A;  3FKA A;  3GSP A;  4HM7 B;  6GSP A;  4L7K A;  1IQY A;  5JPP A;  2PNC A;  3EX9 A;  4LMI A;  2ZA4 A;  2Z6B A;  2INX A;  3S67 A;  3CC4 3;  1O7G B;  3BNB A;  5IEO A;  3D79 A;  4HOH A;  5CLK A;  2CFL A;  1VQO 3;  1HYF A;  3FLJ A;  4X2O A;  4WHA A;  3GWR A;  5M1A A;  2WGO A;  3UB1 A;  4WYK A;  1B3S A;  2BU4 A;  2CFK A;  2GEY A;  2P0M A;  3F8X A;  4FCZ A;  3SED A;  2ZDJ A;  3LOY A;  3EN1 B;  1VQ4 3;  1IT8 A;  1LOY A;  3CNM A;  1B2X A;  1MWR A;  1RGE A;  3CPW 2;  1A90 A;  3FSD A;  7STD A;  4N6O B;  3SX1 A;  1RHL A;  4KZ1 A;  3HIG A;  4LGQ A;  3CMA 3;  1FUW A;  1W2B 2;  1K41 A;  2Y74 A;  1PFP A;  1RGA A;  5STD A;  1MOL A;  2W04 A;  3QK9 A;  3ZG5 A;  2KCD A;  8RNT A;  1BRN L;  1UDI I;  3UL6 A;  1G02 A;  2C4B A;  2CFD A;  1GY5 A;  1BNI A; 
#chains in the Genus database with same CATH homology
 3A5E A;  3DGY A;  2F5M A;  1RLS A;  2KF3 A;  1X1U A;  3D4A A;  1AQZ A;  1I8V A;  3AGO A;  1JBR A;  1I2E A;  4BIR A;  1TRP A;  7RNT A;  1UCK A;  1BNE A;  3HOH A;  4HAA A;  3DH2 A;  1BRS A;  1RDS A;  1BRJ A;  1UCJ A;  1YVS A;  1T2H A;  1GMP A;  4RNT A;  3D5G A;  1BIR A;  1BNS A;  2GSP A;  1GMQ A;  1GSP A;  1RGF A;  1JBS A;  1BVI A;  1R4Y A;  1RMS A;  3BIR A;  3D5I A;  3WHO A;  1RCL A;  1RGL A;  1I2F A;  1I3F A;  1BSC A;  1RTU A;  3AHW A;  1HZ1 A;  3KCH A;  5BIR A;  1BRG A;  1Q9E A;  1B2U A;  1BSB A;  1FYS A;  2SAR A;  1LOV A;  4GHO A;  1LOW A;  1BRK A;  3Q3F A;  1GOY A;  1ZGX A;  1BAN A;  1FZU A;  1RGG A;  1C54 A;  9RNT A;  1B2S A;  1PYL A;  4GSP A;  1B2Z A;  1I0V A;  1JBT A;  1FUT A;  1AY7 A;  1CH0 A;  1T2I A;  3SYU A;  1RN4 A;  7GSP A;  1BRH A;  5HOH A;  1FUS A;  1GOV A;  1BNG A;  1BSD A;  1MGR A;  2RBI A;  3WR2 A;  1FW7 A;  1YNV X;  2BIR A;  2F56 A;  3RNT A;  1LNI A;  1BSA A;  1TRQ A;  1BNR A;  1BGS A;  2RNT A;  5GSP A;  3AGN A;  1RN1 A;  1UCI A;  1X1W A;  1DE3 A;  1IYY A;  1GMR A;  1B20 A;  1BNF A;  1RNT A;  1B2M A;  3URP A;  1I2G A;  1UCL A;  1BOX A;  1MGW A;  1X1X A;  1B21 A;  1I3I A;  1BNJ A;  6RNT A;  3GSP A;  1BSE A;  6GSP A;  1LRA A;  1GOU A;  1I70 A;  2ZA4 A;  2AAD A;  2KF6 A;  4BU4 A;  2HOH A;  1RGK A;  2KAA A;  1YGW A;  4HOH A;  1BUJ A;  1RSN A;  1HYF A;  5BU4 A;  1BRI A;  3BU4 A;  2F4Y A;  1BU4 A;  1DET A;  4J5K A;  1B3S A;  1BAO A;  2BU4 A;  4J5G A;  1B27 A;  2AAE A;  1LOY A;  1RCK A;  1RGE A;  1B2X A;  1I0X A;  2F5W A;  2KF4 A;  1RHL A;  1SAR A;  1TTO A;  1X1Y A;  1PY3 A;  5RNT A;  1RGA A;  8RNT A;  1BRN L;  2KF5 A;  1A2P A;  1G02 A;  3AHS A;  2C4B A;  1RGH A;  1RGC A;  1BNI A;  1RNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...