5RNTA

X-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(endoribonuclease)
molecule keywords RIBONUCLEASE T1
publication title X-ray analysis of cubic crystals of the complex formed between ribonuclease T1 and guanosine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 21
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5rntA00
1LNIA 1AY7A 1BRJA 1X1XA 1RGKA 1RSNA 3GSPA 9RNTA 1X1YA 1RMSA 1ZGXA 1RGLA 3D4AA 4BIRA 1Q9EA 1MGRA 1A2PA 1I8VA 1LRAA 2KF4A 1X1WA 2BIRA 5RNTA 2HOHA 4J5GA 1GMQA 1BANA 1RDSA 1BNGA 1RGEA 1FW7A 1UCIA 1YVSA 3Q3FA 1LOWA 5BIRA 6RNTA 2KF3A 1BOXA 2AAEA 1I0XA 1C54A 1RNTA 1HYFA 1BUJA 3WHOA 1RGGA 1PY3A 2F4YA 3A5EA 4HAAA 1I70A 1UCJA 7GSPA 1T2IA 1I2EA 1B2SA 1X1UA 1RNBA 1GMRA 1DETA 1JBSA 3DH2A 1RN1A 1BRKA 1T2HA 4J5KA 1G02A 1BSBA 1B27A 1I2GA 1IYYA 3D5IA 1TTOA 1BSCA 8RNTA 2F5WA 4RNTA 1R4YA 1B21A 1BRSA 1I3IA 1BSDA 1GSPA 1RLSA 1BNJA 1TRPA 1FYSA 1I2FA 2BU4A 4BU4A 1HZ1A 1MGWA 2AADA 1GMPA 1RTUA 2KAAA 1BNEA 1CH0A 1B2XA 2KF5A 2C4BA 1BNRA 4GSPA 2SARA 5GSPA 1RGAA 3AGOA 1JBTA 1GOUA 1RGHA 1JBRA 1BRHA 1GOYA 1RGFA 1B2MA 2ZA4A 3D5GA 1BU4A 7RNTA 1I3FA 1LOYA 1I0VA 3WR2A 3HOHA 2F56A 3URPA 1BAOA 1BVIA 1PYLA 3AGNA 1BNIA 1BGSA 5BU4A 1B20A 1BSEA 2RBIA 1B2ZA 1B2UA 1BRNL 1FUSA 1LOVA 1BSAA 1FZUA 1RCLA 1BRGA 3BU4A 1RGCA 1FUTA 2F5MA 4HOHA 4GHOA 5HOHA 3BIRA 2GSPA 1RHLA 1RCKA 1BRIA 1TRQA 1GOVA 1YNVX 6GSPA 2KF6A 1AQZA 1SARA 1B3SA 1DE3A 1UCLA 1UCKA 3DGYA 3AHSA 1YGWA 3SYUA 1BNSA 3AHWA 3RNTA 2RNTA 1RN4A 1BNFA 3KCHA 1BIRA
chains in the Genus database with same CATH superfamily
1LNHA 1LNIA 4XBTA 2O9UX 1VQ93 1EQKA 1YVBI 3BB9A 2IUJA 3LTAA 1YHQ3 1RMSA 2BT3A 3F14A 4K1VA 1KD14 1YGEA 1QAFA 2A15A 3AMOB 2F86B 1F8NA 1Q9EA 3BNCA 3M8CA 1NB3I 2WO0A 3LMLA 3HX8A 3ER7A 1UGIA 1N8R4 2BIRA 1RJOA 1WTHA 1GD4A 4TX4A 5AIHA 4J5GA 5KP3A 1AVLA 3G6E3 2UGIA 5M1AA 3SOYA 4IT7A 1JKGB 4FR9A 2XF3A 1OF5B 3F9SA 3F40A 1CYUA 2Z77A 3X3ZA 4RBNA 1VQ83 4MMXB 2K54A 1FUWA 3EHCA 1MNLA 1A2VA 5BIRA 2KF3A 1O7WB 1QAKA 1W01A 2Z7AA 1I0XA 1TU5A 3JUPA 1FGQA 1STFI 1IVWA 1RGGA 1PY3A 2C10A 1N9EA 5AIFA 2CFKA 3F8HA 2BMQB 5LC6A 1I2EA 1M1XB 1JBSA 1RN7A 1U5OA 3DGLA 1BRKA 1T2HA 3NBBA 3B4PA 3FG3A 3NQYA 1W2B2 1G02A 4L8OA 4N6NB 4MMZB 1BSBA 1IV7A 2YFLB 4R4KA 3EE1A 1K8A4 2CH9A 3FCSB 3TDGA 4GL6A 2CFLA 4HM6B 3MPHA 4EBGA 1YJ93 4DKIA 3IMAB 5AEWB 4ILFA 1I3IA 1RLSA 2FNQA 3KZTA 3UNLA 2OTJ3 1TRPA 1JZDA 3VGNA 5AI1A 1TFOA 3DGNA 1W02A 2BU4A 1HZ1A 3RGRA 4CPKA 4R9LA 1EUIC 2P05A 5I97A 5CXOA 1G0TA 1B2XA 1IVXA 3DGOA 4AEQA 2HMJB 4GSPA 5GSPA 5IEPA 1S723 1DMQA 3X41A 1RGHA 1KC84 3DM8A 1MOLA 1RGFA 5ELJA 1B2MA 4WYKA 3SOAA 3SVAA 1NO3A 3D5GA 1BU4A 1EG9B 3EN8A 3B4OA 5IERA 3LOYA 3O8YA 3MWZA 2HMLB 1D6YA 2HMMB 1OH0A 1OUNA 3D3LA 3ZG0A 1PYLA 3AGNA 2KRTA 1M904 3G713 4O3VA 3FG4A 1NDOB 3EF8A 3G16A 1BNIA 4XBYA 1QVG2 5IF6A 2LQVA 3FH1A 1JZOA 2OQEC 3CCS3 3GZRA 2ZHXB 2IMJA 4MEIA 4RNZA 1LOVA 2I9WA 1BSAA 1WMOA 3EBYA 4RNYA 5JPUA 4O02B 4HM5B 1RCLA 4KFDA 4XDVA 3JUNA 2Y74A 2CW9A 4HZBB 2O3OA 3G0KA 1YJW3 2QA43 4GHOA 3GWRA 1IQ8A 3BIRA 3PYJA 1RRLA 1K734 3GZBA 1KSIA 1YNVX 1JRQA 2KXGA 2ML5A 2W2CA 3MYTA 4PEJA 1DMNA 3UB1A 1UCKA 4O2HA 1BUQA 1YGWA 4NPBA 3AHWA 1Z1SA 3RNTA 4LSOA 4LGQA 1RN4A 3HZPA 4N3VA 3DY5A 1BNFA 3FSDA 1SPUA 2CX0A 2RSXA 1AY7A 3VF1A 1RGKA 4KT3B 2L1SA 3UL6A 5IENA 3NBRA 1TUHA 4BIRA 1Q7Y4 3VSYA 1SIIA 1OHOA 3LT8A 4CJNA 3KIIA 5D82A 2Q07A 1MGRA 1CQSA 2D42A 1JN5A 5CF2A 1LRAA 2OOVA 3UJMA 1VQO3 3HK4A 4R9KA 1STDA 1UDII 2HOHA 3NM7A 1Q40B 3NQZA 1ROAA 4ORLA 3HIGA 3OWUA 5FGOA 3X40A 1EEJA 1BANA 1UUWB 3EQQB 2P0XA 2XR8B 3E99A 4N6TA 3JUQA 5IG3A 2M7OA 1ZS7A 1W6CA 1LXEA 3DGMA 3F8XA 3WMDA 4G1MB 3MSOA 2HMNB 3A5EA 3CC43 3GAXA 1O7GB 3EB8A 2H0GA 4HAAA 1RKYA 7GSPA 4I4KA 2IY2A 5TGNA 1QVF2 4CCVA 1B2SA 1VQQA 1DETA 1W6GA 2E2UA 3CCQ3 1VQP3 3CPOA 1W6YA 1M9GA 3CXC2 4J5KA 1O7PB 1GYBA 2BHMA 1W5ZA 3KFQC 4KFEA 4L8PA 4HBRA 4N6UA 1IQYA 1TTOA 2F5WA 1LVNA 4RNTA 1DYUA 2OCTA 1R4YA 1JNQA 3FGYA 3WODG 1N8QA 3SXXA 1I2FA 4WFOA 4BU4A 1K28A 4AKYA 2YFIB 3JUMA 2W9QA 1GS3A 1GMPA 2KAAA 1BNEA 1PFPA 1CH0A 2KF5A 4IPBA 3ROBA 1AV4A 5A0OB 1M1K4 3AGOA 1GOUA 2RFRA 3NV0B 3UL5A 1IT7A 1BRHA 1TFKA 1VQN3 2CIUA 1VQM3 3D9RA 1EA2A 3Q90A 1VQ63 4O8SA 2Z6BA 4HJLB 3ZFZA 4L7KA 3EX9A 7RNTA 1I0VA 3Q2PA 1YIJ3 3HOHA 4N6LA 2YFJB 2F56A 4NREA 1E97A 5DRVA 1UGHI 4KVHA 1AR0A 3CU3A 1VZZA 1UUGB 1BVIA 2XRXB 3H51A 2B24B 5CLKA 1MWUA 4LZIA 3FG1A 4J9AA 5EVHA 4BL3A 1OHSA 3V98A 2MC8A 5BU4A 1B20A 2GEXA 4FCMA 1CYVA 3S67A 1FUSA 3GRDA 4KZ1A 3KSED 5IW9A 4LEHA 3DZLA 3T8NA 2CWVA 3N54B 5M19A 1BRGA 1NNVA 3BU4A 4R80A 1YI23 2IUKA 3FKAA 3LYGA 1WMNA 4WHAA 4FMBA 2RCDA 1RCKA 4X2HA 1GY7A 3S5CA 6GSPA 3NM2A 4LMIA 4H61A 3U1WA 4FMCA 1TP6A 2BO9B 1DE3A 3DGYA 1VQL3 3K63A 2ZL8A 2RNTA 2W56B 1LQMB 3GZXB 3CCE3 3DUKA 3HIIA 1W00A 3F7SA 1BRJA 2QIYA 4FMDA 1RSNA 1FGMA 3GSPA 2K0MA 9RNTA 4CDLA 1PU4A 3Q1CA 3NHXA 2HMOB 3T8UA 3MHEA 3AMOA 4HM4B 2W6JH 3I553 3B8LA 2SBLA 5D81A 5EQLA 5JBSA 1A2PA 2YX9A 1I8VA 1FGOA 3PCRA 3IPTA 1X1WA 1W2ZA 1QJGA 3CD63 1UI7A 1D6UA 4OUQA 2OTL3 5IG4A 3CNMA 3I0YA 1GMQA 1SQWA 3OV4A 1RDSA 1BNGA 1OF5A 1RGEA 1UCIA 1WNHA 2IA7A 3LH4A 4HM3B 1W4NA 2P09A 4JRFA 3Q3FA 3LTBA 1LOWA 2R41A 6RNTA 4ZM8A 3NBJA 1C54A 5EEOA 4XM4A 1HYFA 1VQ53 3PXMA 1JB4A 4MMYB 1A90A 2XH9A 3KKGA 1L5GB 1ZX2A 2F4YA 3K5TA 4XBXA 1I70A 1Y4KA 2L4VA 3CC73 2D1WA 2BMRB 1VQ43 3LZAA 1GMRA 2GBXB 1K9M4 3CMA3 2ZDJA 1RN1A 4EYCA 4OK0A 3K7CA 3MG2A 4RZMA 4GB5A 1B27A 3EBTA 1IYYA 4BL2A 2XEPA 3D5IA 1JB2A 2CWTA 8RNTA 2J8XB 3S28A 3IJEB 1B21A 1BSDA 3DXOA 5D83A 5JPPA 1ISKA 4HM1B 1MGWA 3KN4A 3WOFB 1VQK3 2AADA 1YIT3 3PGBA 3KSPA 4WWUC 1BNRA 3MG3A 5KP1A 1RGAA 3F7XA 2UUGC 3G4S3 1JBTA 3RDEA 1ULIB 1UUVB 4BTYA 4WYKB 1Q42A 1GOYA 2WOHA 1JBRA 1DVCA 1US1A 2ZA4A 4XDWA 1OCVA 1UI8A 4X2OA 1I3FA 1Q7HA 1VQ73 2CWUA 3WR2A 1NWWA 1JB5A 3OWSA 3URPA 3OX9A 5BXQA 3LT9A 1FA3A 1BAOA 1A67A 2E2VA 5CF1A 4FCJA 4XB5A 3J7Yd 1ZO2A 1MWSA 3QRDA 3I563 1U8CB 4HVNA 1GY5A 4LYLB 1IK3A 1BSEA 1SIHA 3X3YA 1B2UA 3KE7A 1SJWA 3K0ZA 1V58A 5AYSC 3LTDA 1J2BA 1FZUA 2CG1A 2FGTA 4K1UA 1UW1A 3NX0A 4HOHA 4K61A 1C7HA 3FLJA 5HOHA 1O7MB 2KCDA 1T5YA 2XGNA 2PNCA 2C11A 2OOVC 1FGRA 2E2TA 3FF0A 3EJVA 4HYZA 3RGAA 2XSOB 2KF6A 4N6OB 1DVDA 1SARA 3OXAA 3CCJ3 1OHPA 4STDA 1KWIA 1B3SA 1ULJB 3BNEA 4EV2A 4HM0B 1UCLA 4U13A 2P0MA 1N9JA 1A2KA 2WOFA 4JF8A 3SYUA 3ZG5A 5IEOA 2R4IA 3CCV3 3JUOA 1WMPA 2OQEA 1E3VA 2JQ5A 2CFDA 1X1XA 5AYRB 3OWYA 3BNDA 2STDA 1X1YA 2XSHB 3S27A 3N9HA 1K41A 3CCL3 3X3XA 1ZGXA 2CX1A 1RGLA 2WGOA 3D4AA 3FF2A 3LTCA 3QK9A 4HM2B 5AIIA 2Z76A 4WP5A 5IG0A 3V92A 1IQXA 1JV2B 3PS8A 5BVBA 1V74A 2CK3H 1JN5B 4N6V0 3DMCA 3PZWA 5IG5A 3S29A 3BNBA 1DMMA 2KF4A 5STDA 2RGQA 5RNTA 2FXTA 1QALA 2WGQA 4BTXA 1OACA 5LC7A 1Q40A 1N5HA 1OGZA 2CC3A 3A76A 5G1LA 2BMOB 2Y73A 1YJN3 1MWRA 1HKXA 4FMAA 3H3HA 3WDGB 1FW7A 1YVSA 2K3DA 4OVMA 3STDA 4IIAA 3N8BA 5FW5A 2GEYA 7STDA 1N5PA 3LXUX 1BOXA 2AAEA 5G2GA 3NUVA 2IYJA 2F99A 1RNTA 3MG1A 4FCZA 8CHOA 1BUJA 1T3BA 1V57A 3WHOA 2ML6A 3HI7A 4R1KA 2W9PA 1WQLB 1O7NB 2B1XB 2BNGA 1UCJA 2GU1A 1ASKA 2XFTA 1T2IA 2HMKB 5KP4A 1X1UA 1RNBA 3DH2A 1CEWI 4NHFA 1JJ22 2CFWA 4QWTA 2GBWB 3GZYB 2MF7A 3ECFA 4K90B 1I2GA 1BSCA 4I5QA 4N6MA 1NB5I 2W04A 3B7CA 1MWTA 4HM7B 2CG0A 1TJDA 1JKGA 2V1LA 2W03A 3U97A 1Q814 1BRSA 1GSPA 3BLZA 1LOXA 2GU3A 1BNJA 4HM8B 1FYSA 1IV9A 1QMAA 2P38A 4HZ9B 5CK6A 3WOEB 1LQGC 3PCSA 3CNXA 3NXJA 3EN1B 3WA3A 5AIGA 4EV5A 1TIJA 1RTUA 5G1KA 2C4BA 3FZWA 2SARA 3OW22 2CHCA 3EC9A 2UX0A 2LYXA 3NV0A 4Q53A 3CCR3 4BTWA 4MJDA 3SX1A 1G96A 3V99A 3CME3 2QEX3 3MKIA 1IDPA 2OWPA 1LOYA 4J8TA 3WA2X 1EKMA 2H0IA 1HU9A 1S5AA 3CPW2 2CFGA 3T0UA 5AEUB 1NU3A 3SLUA 1FGTA 2XFSA 1Q824 1O7HB 1W7CA 5HGRA 3CCU3 1BGSA 2INXA 3X42A 5M18A 1IVUA 3D79A 2RBIA 1B2ZA 1AVKA 5DREA 2GXFA 1KQS2 1GY6A 1BRNL 2JDIH 1Q864 1OPYA 5ELUA 3G8ZA 1NJI4 3SEDA 6STDA 4EW5A 1E3RA 1ROVA 1D6ZA 1FUTA 1OGXA 1RGCA 2F5MA 4H3UA 3CCM3 3ALAA 1R4CA 2F98A 2GSPA 1RHLA 1IU7A 3CC23 1BRIA 1TRQA 1GOVA 1IVVA 1GD3A 2QGUA 3K9MC 3L0RA 4KFFA 1AQZA 2CKFB 2H0HA 2XGLA 4HKVB 2PZVA 4EXRA 3AHSA 1IT8A 1BNSA 3JVCA 4EC6A 2W0QA 1RRHA 3KCHA 2W56A 1BIRA 4AKZA
chains in the Genus database with same CATH topology
1LNIA 1AY7A 1BRJA 1X1XA 1RGKA 1RSNA 3GSPA 9RNTA 1X1YA 1RMSA 1ZGXA 1RGLA 3D4AA 4BIRA 1Q9EA 1MGRA 1A2PA 1I8VA 1LRAA 2KF4A 1X1WA 2BIRA 5RNTA 2HOHA 4J5GA 1GMQA 1BANA 1RDSA 1BNGA 1RGEA 1FW7A 1UCIA 1YVSA 3Q3FA 1LOWA 5BIRA 6RNTA 2KF3A 1BOXA 2AAEA 1I0XA 1C54A 1RNTA 1HYFA 1BUJA 3WHOA 1RGGA 1PY3A 2F4YA 3A5EA 4HAAA 1I70A 1UCJA 7GSPA 1T2IA 1I2EA 1B2SA 1X1UA 1RNBA 1GMRA 1DETA 1JBSA 3DH2A 1RN1A 1BRKA 1T2HA 4J5KA 1G02A 1BSBA 1B27A 1I2GA 1IYYA 3D5IA 1TTOA 1BSCA 8RNTA 2F5WA 4RNTA 1R4YA 1B21A 1BRSA 1I3IA 1BSDA 1GSPA 1RLSA 1BNJA 1TRPA 1FYSA 1I2FA 2BU4A 4BU4A 1HZ1A 1MGWA 2AADA 1GMPA 1RTUA 2KAAA 1BNEA 1CH0A 1B2XA 2KF5A 2C4BA 1BNRA 4GSPA 2SARA 5GSPA 1RGAA 3AGOA 1JBTA 1GOUA 1RGHA 1JBRA 1BRHA 1GOYA 1RGFA 1B2MA 2ZA4A 3D5GA 1BU4A 7RNTA 1I3FA 1LOYA 1I0VA 3WR2A 3HOHA 2F56A 3URPA 1BAOA 1BVIA 1PYLA 3AGNA 1BNIA 1BGSA 5BU4A 1B20A 1BSEA 2RBIA 1B2ZA 1B2UA 1BRNL 1FUSA 1LOVA 1BSAA 1FZUA 1RCLA 1BRGA 3BU4A 1RGCA 1FUTA 2F5MA 4HOHA 4GHOA 5HOHA 3BIRA 2GSPA 1RHLA 1RCKA 1BRIA 1TRQA 1GOVA 1YNVX 6GSPA 2KF6A 1AQZA 1SARA 1B3SA 1DE3A 1UCLA 1UCKA 3DGYA 3AHSA 1YGWA 3SYUA 1BNSA 3AHWA 3RNTA 2RNTA 1RN4A 1BNFA 3KCHA 1BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LNI A;  1AY7 A;  1BRJ A;  1X1X A;  1RGK A;  1RSN A;  3GSP A;  9RNT A;  1X1Y A;  1RMS A;  1ZGX A;  1RGL A;  3D4A A;  4BIR A;  1Q9E A;  1MGR A;  1A2P A;  1I8V A;  1LRA A;  2KF4 A;  1X1W A;  2BIR A;  5RNT A;  2HOH A;  4J5G A;  1GMQ A;  1BAN A;  1RDS A;  1BNG A;  1RGE A;  1FW7 A;  1UCI A;  1YVS A;  3Q3F A;  1LOW A;  5BIR A;  6RNT A;  2KF3 A;  1BOX A;  2AAE A;  1I0X A;  1C54 A;  1RNT A;  1HYF A;  1BUJ A;  3WHO A;  1RGG A;  1PY3 A;  2F4Y A;  3A5E A;  4HAA A;  1I70 A;  1UCJ A;  7GSP A;  1T2I A;  1I2E A;  1B2S A;  1X1U A;  1RNB A;  1GMR A;  1DET A;  1JBS A;  3DH2 A;  1RN1 A;  1BRK A;  1T2H A;  4J5K A;  1G02 A;  1BSB A;  1B27 A;  1I2G A;  1IYY A;  3D5I A;  1TTO A;  1BSC A;  8RNT A;  2F5W A;  4RNT A;  1R4Y A;  1B21 A;  1BRS A;  1I3I A;  1BSD A;  1GSP A;  1RLS A;  1BNJ A;  1TRP A;  1FYS A;  1I2F A;  2BU4 A;  4BU4 A;  1HZ1 A;  1MGW A;  2AAD A;  1GMP A;  1RTU A;  2KAA A;  1BNE A;  1CH0 A;  1B2X A;  2KF5 A;  2C4B A;  1BNR A;  4GSP A;  2SAR A;  5GSP A;  1RGA A;  3AGO A;  1JBT A;  1GOU A;  1RGH A;  1JBR A;  1BRH A;  1GOY A;  1RGF A;  1B2M A;  2ZA4 A;  3D5G A;  1BU4 A;  7RNT A;  1I3F A;  1LOY A;  1I0V A;  3WR2 A;  3HOH A;  2F56 A;  3URP A;  1BAO A;  1BVI A;  1PYL A;  3AGN A;  1BNI A;  1BGS A;  5BU4 A;  1B20 A;  1BSE A;  2RBI A;  1B2Z A;  1B2U A;  1BRN L;  1FUS A;  1LOV A;  1BSA A;  1FZU A;  1RCL A;  1BRG A;  3BU4 A;  1RGC A;  1FUT A;  2F5M A;  4HOH A;  4GHO A;  5HOH A;  3BIR A;  2GSP A;  1RHL A;  1RCK A;  1BRI A;  1TRQ A;  1GOV A;  1YNV X;  6GSP A;  2KF6 A;  1AQZ A;  1SAR A;  1B3S A;  1DE3 A;  1UCL A;  1UCK A;  3DGY A;  3AHS A;  1YGW A;  3SYU A;  1BNS A;  3AHW A;  3RNT A;  2RNT A;  1RN4 A;  1BNF A;  3KCH A;  1BIR A; 
#chains in the Genus database with same CATH topology
 1LNH A;  1LNI A;  4XBT A;  2O9U X;  1VQ9 3;  1EQK A;  1YVB I;  3BB9 A;  2IUJ A;  3LTA A;  1YHQ 3;  1RMS A;  2BT3 A;  3F14 A;  4K1V A;  1KD1 4;  1YGE A;  1QAF A;  2A15 A;  3AMO B;  2F86 B;  1F8N A;  1Q9E A;  3BNC A;  3M8C A;  1NB3 I;  2WO0 A;  3LML A;  3HX8 A;  3ER7 A;  1UGI A;  1N8R 4;  2BIR A;  1RJO A;  1WTH A;  1GD4 A;  4TX4 A;  5AIH A;  4J5G A;  5KP3 A;  1AVL A;  3G6E 3;  2UGI A;  5M1A A;  3SOY A;  4IT7 A;  1JKG B;  4FR9 A;  2XF3 A;  1OF5 B;  3F9S A;  3F40 A;  1CYU A;  2Z77 A;  3X3Z A;  4RBN A;  1VQ8 3;  4MMX B;  2K54 A;  1FUW A;  3EHC A;  1MNL A;  1A2V A;  5BIR A;  2KF3 A;  1O7W B;  1QAK A;  1W01 A;  2Z7A A;  1I0X A;  1TU5 A;  3JUP A;  1FGQ A;  1STF I;  1IVW A;  1RGG A;  1PY3 A;  2C10 A;  1N9E A;  5AIF A;  2CFK A;  3F8H A;  2BMQ B;  5LC6 A;  1I2E A;  1M1X B;  1JBS A;  1RN7 A;  1U5O A;  3DGL A;  1BRK A;  1T2H A;  3NBB A;  3B4P A;  3FG3 A;  3NQY A;  1W2B 2;  1G02 A;  4L8O A;  4N6N B;  4MMZ B;  1BSB A;  1IV7 A;  2YFL B;  4R4K A;  3EE1 A;  1K8A 4;  2CH9 A;  3FCS B;  3TDG A;  4GL6 A;  2CFL A;  4HM6 B;  3MPH A;  4EBG A;  1YJ9 3;  4DKI A;  3IMA B;  5AEW B;  4ILF A;  1I3I A;  1RLS A;  2FNQ A;  3KZT A;  3UNL A;  2OTJ 3;  1TRP A;  1JZD A;  3VGN A;  5AI1 A;  1TFO A;  3DGN A;  1W02 A;  2BU4 A;  1HZ1 A;  3RGR A;  4CPK A;  4R9L A;  1EUI C;  2P05 A;  5I97 A;  5CXO A;  1G0T A;  1B2X A;  1IVX A;  3DGO A;  4AEQ A;  2HMJ B;  4GSP A;  5GSP A;  5IEP A;  1S72 3;  1DMQ A;  3X41 A;  1RGH A;  1KC8 4;  3DM8 A;  1MOL A;  1RGF A;  5ELJ A;  1B2M A;  4WYK A;  3SOA A;  3SVA A;  1NO3 A;  3D5G A;  1BU4 A;  1EG9 B;  3EN8 A;  3B4O A;  5IER A;  3LOY A;  3O8Y A;  3MWZ A;  2HML B;  1D6Y A;  2HMM B;  1OH0 A;  1OUN A;  3D3L A;  3ZG0 A;  1PYL A;  3AGN A;  2KRT A;  1M90 4;  3G71 3;  4O3V A;  3FG4 A;  1NDO B;  3EF8 A;  3G16 A;  1BNI A;  4XBY A;  1QVG 2;  5IF6 A;  2LQV A;  3FH1 A;  1JZO A;  2OQE C;  3CCS 3;  3GZR A;  2ZHX B;  2IMJ A;  4MEI A;  4RNZ A;  1LOV A;  2I9W A;  1BSA A;  1WMO A;  3EBY A;  4RNY A;  5JPU A;  4O02 B;  4HM5 B;  1RCL A;  4KFD A;  4XDV A;  3JUN A;  2Y74 A;  2CW9 A;  4HZB B;  2O3O A;  3G0K A;  1YJW 3;  2QA4 3;  4GHO A;  3GWR A;  1IQ8 A;  3BIR A;  3PYJ A;  1RRL A;  1K73 4;  3GZB A;  1KSI A;  1YNV X;  1JRQ A;  2KXG A;  2ML5 A;  2W2C A;  3MYT A;  4PEJ A;  1DMN A;  3UB1 A;  1UCK A;  4O2H A;  1BUQ A;  1YGW A;  4NPB A;  3AHW A;  1Z1S A;  3RNT A;  4LSO A;  4LGQ A;  1RN4 A;  3HZP A;  4N3V A;  3DY5 A;  1BNF A;  3FSD A;  1SPU A;  2CX0 A;  2RSX A;  1AY7 A;  3VF1 A;  1RGK A;  4KT3 B;  2L1S A;  3UL6 A;  5IEN A;  3NBR A;  1TUH A;  4BIR A;  1Q7Y 4;  3VSY A;  1SII A;  1OHO A;  3LT8 A;  4CJN A;  3KII A;  5D82 A;  2Q07 A;  1MGR A;  1CQS A;  2D42 A;  1JN5 A;  5CF2 A;  1LRA A;  2OOV A;  3UJM A;  1VQO 3;  3HK4 A;  4R9K A;  1STD A;  1UDI I;  2HOH A;  3NM7 A;  1Q40 B;  3NQZ A;  1ROA A;  4ORL A;  3HIG A;  3OWU A;  5FGO A;  3X40 A;  1EEJ A;  1BAN A;  1UUW B;  3EQQ B;  2P0X A;  2XR8 B;  3E99 A;  4N6T A;  3JUQ A;  5IG3 A;  2M7O A;  1ZS7 A;  1W6C A;  1LXE A;  3DGM A;  3F8X A;  3WMD A;  4G1M B;  3MSO A;  2HMN B;  3A5E A;  3CC4 3;  3GAX A;  1O7G B;  3EB8 A;  2H0G A;  4HAA A;  1RKY A;  7GSP A;  4I4K A;  2IY2 A;  5TGN A;  1QVF 2;  4CCV A;  1B2S A;  1VQQ A;  1DET A;  1W6G A;  2E2U A;  3CCQ 3;  1VQP 3;  3CPO A;  1W6Y A;  1M9G A;  3CXC 2;  4J5K A;  1O7P B;  1GYB A;  2BHM A;  1W5Z A;  3KFQ C;  4KFE A;  4L8P A;  4HBR A;  4N6U A;  1IQY A;  1TTO A;  2F5W A;  1LVN A;  4RNT A;  1DYU A;  2OCT A;  1R4Y A;  1JNQ A;  3FGY A;  3WOD G;  1N8Q A;  3SXX A;  1I2F A;  4WFO A;  4BU4 A;  1K28 A;  4AKY A;  2YFI B;  3JUM A;  2W9Q A;  1GS3 A;  1GMP A;  2KAA A;  1BNE A;  1PFP A;  1CH0 A;  2KF5 A;  4IPB A;  3ROB A;  1AV4 A;  5A0O B;  1M1K 4;  3AGO A;  1GOU A;  2RFR A;  3NV0 B;  3UL5 A;  1IT7 A;  1BRH A;  1TFK A;  1VQN 3;  2CIU A;  1VQM 3;  3D9R A;  1EA2 A;  3Q90 A;  1VQ6 3;  4O8S A;  2Z6B A;  4HJL B;  3ZFZ A;  4L7K A;  3EX9 A;  7RNT A;  1I0V A;  3Q2P A;  1YIJ 3;  3HOH A;  4N6L A;  2YFJ B;  2F56 A;  4NRE A;  1E97 A;  5DRV A;  1UGH I;  4KVH A;  1AR0 A;  3CU3 A;  1VZZ A;  1UUG B;  1BVI A;  2XRX B;  3H51 A;  2B24 B;  5CLK A;  1MWU A;  4LZI A;  3FG1 A;  4J9A A;  5EVH A;  4BL3 A;  1OHS A;  3V98 A;  2MC8 A;  5BU4 A;  1B20 A;  2GEX A;  4FCM A;  1CYV A;  3S67 A;  1FUS A;  3GRD A;  4KZ1 A;  3KSE D;  5IW9 A;  4LEH A;  3DZL A;  3T8N A;  2CWV A;  3N54 B;  5M19 A;  1BRG A;  1NNV A;  3BU4 A;  4R80 A;  1YI2 3;  2IUK A;  3FKA A;  3LYG A;  1WMN A;  4WHA A;  4FMB A;  2RCD A;  1RCK A;  4X2H A;  1GY7 A;  3S5C A;  6GSP A;  3NM2 A;  4LMI A;  4H61 A;  3U1W A;  4FMC A;  1TP6 A;  2BO9 B;  1DE3 A;  3DGY A;  1VQL 3;  3K63 A;  2ZL8 A;  2RNT A;  2W56 B;  1LQM B;  3GZX B;  3CCE 3;  3DUK A;  3HII A;  1W00 A;  3F7S A;  1BRJ A;  2QIY A;  4FMD A;  1RSN A;  1FGM A;  3GSP A;  2K0M A;  9RNT A;  4CDL A;  1PU4 A;  3Q1C A;  3NHX A;  2HMO B;  3T8U A;  3MHE A;  3AMO A;  4HM4 B;  2W6J H;  3I55 3;  3B8L A;  2SBL A;  5D81 A;  5EQL A;  5JBS A;  1A2P A;  2YX9 A;  1I8V A;  1FGO A;  3PCR A;  3IPT A;  1X1W A;  1W2Z A;  1QJG A;  3CD6 3;  1UI7 A;  1D6U A;  4OUQ A;  2OTL 3;  5IG4 A;  3CNM A;  3I0Y A;  1GMQ A;  1SQW A;  3OV4 A;  1RDS A;  1BNG A;  1OF5 A;  1RGE A;  1UCI A;  1WNH A;  2IA7 A;  3LH4 A;  4HM3 B;  1W4N A;  2P09 A;  4JRF A;  3Q3F A;  3LTB A;  1LOW A;  2R41 A;  6RNT A;  4ZM8 A;  3NBJ A;  1C54 A;  5EEO A;  4XM4 A;  1HYF A;  1VQ5 3;  3PXM A;  1JB4 A;  4MMY B;  1A90 A;  2XH9 A;  3KKG A;  1L5G B;  1ZX2 A;  2F4Y A;  3K5T A;  4XBX A;  1I70 A;  1Y4K A;  2L4V A;  3CC7 3;  2D1W A;  2BMR B;  1VQ4 3;  3LZA A;  1GMR A;  2GBX B;  1K9M 4;  3CMA 3;  2ZDJ A;  1RN1 A;  4EYC A;  4OK0 A;  3K7C A;  3MG2 A;  4RZM A;  4GB5 A;  1B27 A;  3EBT A;  1IYY A;  4BL2 A;  2XEP A;  3D5I A;  1JB2 A;  2CWT A;  8RNT A;  2J8X B;  3S28 A;  3IJE B;  1B21 A;  1BSD A;  3DXO A;  5D83 A;  5JPP A;  1ISK A;  4HM1 B;  1MGW A;  3KN4 A;  3WOF B;  1VQK 3;  2AAD A;  1YIT 3;  3PGB A;  3KSP A;  4WWU C;  1BNR A;  3MG3 A;  5KP1 A;  1RGA A;  3F7X A;  2UUG C;  3G4S 3;  1JBT A;  3RDE A;  1ULI B;  1UUV B;  4BTY A;  4WYK B;  1Q42 A;  1GOY A;  2WOH A;  1JBR A;  1DVC A;  1US1 A;  2ZA4 A;  4XDW A;  1OCV A;  1UI8 A;  4X2O A;  1I3F A;  1Q7H A;  1VQ7 3;  2CWU A;  3WR2 A;  1NWW A;  1JB5 A;  3OWS A;  3URP A;  3OX9 A;  5BXQ A;  3LT9 A;  1FA3 A;  1BAO A;  1A67 A;  2E2V A;  5CF1 A;  4FCJ A;  4XB5 A;  3J7Y d;  1ZO2 A;  1MWS A;  3QRD A;  3I56 3;  1U8C B;  4HVN A;  1GY5 A;  4LYL B;  1IK3 A;  1BSE A;  1SIH A;  3X3Y A;  1B2U A;  3KE7 A;  1SJW A;  3K0Z A;  1V58 A;  5AYS C;  3LTD A;  1J2B A;  1FZU A;  2CG1 A;  2FGT A;  4K1U A;  1UW1 A;  3NX0 A;  4HOH A;  4K61 A;  1C7H A;  3FLJ A;  5HOH A;  1O7M B;  2KCD A;  1T5Y A;  2XGN A;  2PNC A;  2C11 A;  2OOV C;  1FGR A;  2E2T A;  3FF0 A;  3EJV A;  4HYZ A;  3RGA A;  2XSO B;  2KF6 A;  4N6O B;  1DVD A;  1SAR A;  3OXA A;  3CCJ 3;  1OHP A;  4STD A;  1KWI A;  1B3S A;  1ULJ B;  3BNE A;  4EV2 A;  4HM0 B;  1UCL A;  4U13 A;  2P0M A;  1N9J A;  1A2K A;  2WOF A;  4JF8 A;  3SYU A;  3ZG5 A;  5IEO A;  2R4I A;  3CCV 3;  3JUO A;  1WMP A;  2OQE A;  1E3V A;  2JQ5 A;  2CFD A;  1X1X A;  5AYR B;  3OWY A;  3BND A;  2STD A;  1X1Y A;  2XSH B;  3S27 A;  3N9H A;  1K41 A;  3CCL 3;  3X3X A;  1ZGX A;  2CX1 A;  1RGL A;  2WGO A;  3D4A A;  3FF2 A;  3LTC A;  3QK9 A;  4HM2 B;  5AII A;  2Z76 A;  4WP5 A;  5IG0 A;  3V92 A;  1IQX A;  1JV2 B;  3PS8 A;  5BVB A;  1V74 A;  2CK3 H;  1JN5 B;  4N6V 0;  3DMC A;  3PZW A;  5IG5 A;  3S29 A;  3BNB A;  1DMM A;  2KF4 A;  5STD A;  2RGQ A;  5RNT A;  2FXT A;  1QAL A;  2WGQ A;  4BTX A;  1OAC A;  5LC7 A;  1Q40 A;  1N5H A;  1OGZ A;  2CC3 A;  3A76 A;  5G1L A;  2BMO B;  2Y73 A;  1YJN 3;  1MWR A;  1HKX A;  4FMA A;  3H3H A;  3WDG B;  1FW7 A;  1YVS A;  2K3D A;  4OVM A;  3STD A;  4IIA A;  3N8B A;  5FW5 A;  2GEY A;  7STD A;  1N5P A;  3LXU X;  1BOX A;  2AAE A;  5G2G A;  3NUV A;  2IYJ A;  2F99 A;  1RNT A;  3MG1 A;  4FCZ A;  8CHO A;  1BUJ A;  1T3B A;  1V57 A;  3WHO A;  2ML6 A;  3HI7 A;  4R1K A;  2W9P A;  1WQL B;  1O7N B;  2B1X B;  2BNG A;  1UCJ A;  2GU1 A;  1ASK A;  2XFT A;  1T2I A;  2HMK B;  5KP4 A;  1X1U A;  1RNB A;  3DH2 A;  1CEW I;  4NHF A;  1JJ2 2;  2CFW A;  4QWT A;  2GBW B;  3GZY B;  2MF7 A;  3ECF A;  4K90 B;  1I2G A;  1BSC A;  4I5Q A;  4N6M A;  1NB5 I;  2W04 A;  3B7C A;  1MWT A;  4HM7 B;  2CG0 A;  1TJD A;  1JKG A;  2V1L A;  2W03 A;  3U97 A;  1Q81 4;  1BRS A;  1GSP A;  3BLZ A;  1LOX A;  2GU3 A;  1BNJ A;  4HM8 B;  1FYS A;  1IV9 A;  1QMA A;  2P38 A;  4HZ9 B;  5CK6 A;  3WOE B;  1LQG C;  3PCS A;  3CNX A;  3NXJ A;  3EN1 B;  3WA3 A;  5AIG A;  4EV5 A;  1TIJ A;  1RTU A;  5G1K A;  2C4B A;  3FZW A;  2SAR A;  3OW2 2;  2CHC A;  3EC9 A;  2UX0 A;  2LYX A;  3NV0 A;  4Q53 A;  3CCR 3;  4BTW A;  4MJD A;  3SX1 A;  1G96 A;  3V99 A;  3CME 3;  2QEX 3;  3MKI A;  1IDP A;  2OWP A;  1LOY A;  4J8T A;  3WA2 X;  1EKM A;  2H0I A;  1HU9 A;  1S5A A;  3CPW 2;  2CFG A;  3T0U A;  5AEU B;  1NU3 A;  3SLU A;  1FGT A;  2XFS A;  1Q82 4;  1O7H B;  1W7C A;  5HGR A;  3CCU 3;  1BGS A;  2INX A;  3X42 A;  5M18 A;  1IVU A;  3D79 A;  2RBI A;  1B2Z A;  1AVK A;  5DRE A;  2GXF A;  1KQS 2;  1GY6 A;  1BRN L;  2JDI H;  1Q86 4;  1OPY A;  5ELU A;  3G8Z A;  1NJI 4;  3SED A;  6STD A;  4EW5 A;  1E3R A;  1ROV A;  1D6Z A;  1FUT A;  1OGX A;  1RGC A;  2F5M A;  4H3U A;  3CCM 3;  3ALA A;  1R4C A;  2F98 A;  2GSP A;  1RHL A;  1IU7 A;  3CC2 3;  1BRI A;  1TRQ A;  1GOV A;  1IVV A;  1GD3 A;  2QGU A;  3K9M C;  3L0R A;  4KFF A;  1AQZ A;  2CKF B;  2H0H A;  2XGL A;  4HKV B;  2PZV A;  4EXR A;  3AHS A;  1IT8 A;  1BNS A;  3JVC A;  4EC6 A;  2W0Q A;  1RRH A;  3KCH A;  2W56 A;  1BIR A;  4AKZ A; 
#chains in the Genus database with same CATH homology
 1LNI A;  1AY7 A;  1BRJ A;  1X1X A;  1RGK A;  1RSN A;  3GSP A;  9RNT A;  1X1Y A;  1RMS A;  1ZGX A;  1RGL A;  3D4A A;  4BIR A;  1Q9E A;  1MGR A;  1A2P A;  1I8V A;  1LRA A;  2KF4 A;  1X1W A;  2BIR A;  5RNT A;  2HOH A;  4J5G A;  1GMQ A;  1BAN A;  1RDS A;  1BNG A;  1RGE A;  1FW7 A;  1UCI A;  1YVS A;  3Q3F A;  1LOW A;  5BIR A;  6RNT A;  2KF3 A;  1BOX A;  2AAE A;  1I0X A;  1C54 A;  1RNT A;  1HYF A;  1BUJ A;  3WHO A;  1RGG A;  1PY3 A;  2F4Y A;  3A5E A;  4HAA A;  1I70 A;  1UCJ A;  7GSP A;  1T2I A;  1I2E A;  1B2S A;  1X1U A;  1RNB A;  1GMR A;  1DET A;  1JBS A;  3DH2 A;  1RN1 A;  1BRK A;  1T2H A;  4J5K A;  1G02 A;  1BSB A;  1B27 A;  1I2G A;  1IYY A;  3D5I A;  1TTO A;  1BSC A;  8RNT A;  2F5W A;  4RNT A;  1R4Y A;  1B21 A;  1BRS A;  1I3I A;  1BSD A;  1GSP A;  1RLS A;  1BNJ A;  1TRP A;  1FYS A;  1I2F A;  2BU4 A;  4BU4 A;  1HZ1 A;  1MGW A;  2AAD A;  1GMP A;  1RTU A;  2KAA A;  1BNE A;  1CH0 A;  1B2X A;  2KF5 A;  2C4B A;  1BNR A;  4GSP A;  2SAR A;  5GSP A;  1RGA A;  3AGO A;  1JBT A;  1GOU A;  1RGH A;  1JBR A;  1BRH A;  1GOY A;  1RGF A;  1B2M A;  2ZA4 A;  3D5G A;  1BU4 A;  7RNT A;  1I3F A;  1LOY A;  1I0V A;  3WR2 A;  3HOH A;  2F56 A;  3URP A;  1BAO A;  1BVI A;  1PYL A;  3AGN A;  1BNI A;  1BGS A;  5BU4 A;  1B20 A;  1BSE A;  2RBI A;  1B2Z A;  1B2U A;  1BRN L;  1FUS A;  1LOV A;  1BSA A;  1FZU A;  1RCL A;  1BRG A;  3BU4 A;  1RGC A;  1FUT A;  2F5M A;  4HOH A;  4GHO A;  5HOH A;  3BIR A;  2GSP A;  1RHL A;  1RCK A;  1BRI A;  1TRQ A;  1GOV A;  1YNV X;  6GSP A;  2KF6 A;  1AQZ A;  1SAR A;  1B3S A;  1DE3 A;  1UCL A;  1UCK A;  3DGY A;  3AHS A;  1YGW A;  3SYU A;  1BNS A;  3AHW A;  3RNT A;  2RNT A;  1RN4 A;  1BNF A;  3KCH A;  1BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...