5RNTA

X-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title X-ray analysis of cubic crystals of the complex formed between ribonuclease T1 and guanosine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 21
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5rntA00
4GSPA 1BSCA 1RLSA 1PY3A 3GSPA 1T2HA 1B2SA 1LOVA 1JBSA 1BGSA 1GSPA 1YNVX 1RGGA 3KCHA 1RCKA 4GHOA 2BIRA 1LOYA 1BRNL 1GMPA 1YGWA 6RNTA 1BRIA 1BSAA 3WHOA 1RGEA 1BNFA 1RNTA 1TTOA 2F4YA 3WR2A 6GSPA 2F56A 1LOWA 2KF3A 2BU4A 4BIRA 3D5IA 2KF4A 5RNTA 1BNGA 1UCJA 1R4YA 1RDSA 4RNTA 2RBIA 1B2XA 2KF6A 1BUJA 2KF5A 2AADA 1X1WA 7RNTA 1LRAA 4HAAA 1BRHA 3AHWA 1MGRA 1RGLA 3A5EA 1C54A 3URPA 1RNBA 1G02A 1IYYA 2HOHA 1BNJA 1HYFA 3HOHA 1BU4A 4BU4A 1BNRA 3AGNA 2AAEA 1RGHA 1B3SA 1TRQA 2KAAA 3BU4A 1RN4A 1BSDA 3D4AA 1BRKA 2ZA4A 1GMRA 2F5WA 3SYUA 1BRJA 1I70A 8RNTA 1I0XA 1T2IA 1X1YA 3DH2A 3AGOA 1UCKA 5BU4A 1FUSA 1B2MA 1LNIA 1BVIA 1RTUA 1I8VA 3AHSA 1RHLA 1UCLA 4J5GA 5HOHA 1B20A 1BSEA 1JBRA 1B2ZA 2RNTA 5GSPA 1ZGXA 2F5MA 1GOVA 4J5KA 1DETA 1MGWA 1BRGA 4HOHA 1RSNA 1GOUA 1I2EA 1RGKA 1B21A 3D5GA 1DE3A 1X1XA 3BIRA 1I3FA 3RNTA 1I2FA 1RGCA 1UCIA 1FUTA 1AY7A 1YVSA 1FYSA 7GSPA 1I3IA 1BNSA 1BNEA 1B27A 1RMSA 1AQZA 1HZ1A 1TRPA 2GSPA 1JBTA 1PYLA 1BNIA 1BOXA 1BSBA 1GOYA 1FZUA 1B2UA 1X1UA 1BRSA 1RGFA 1SARA 1CH0A 1I0VA 1FW7A 1I2GA 1BAOA 1Q9EA 1BANA 3Q3FA 1RN1A 1A2PA 1BIRA 1RCLA 1RGAA 1GMQA 3DGYA 2SARA 9RNTA 2C4BA 5BIRA
chains in the Genus database with same CATH superfamily
3LH4A 4GSPA 3EHCA 1BSCA 1PY3A 5LC6A 3CCJ3 1RRHA 2GBXB 3G4S3 1CQSA 3X3ZA 4TX4A 3EBYA 3EC9A 4CCVA 1E97A 3KKGA 1D6ZA 2BMRB 5AEUB 2GXFA 4KFFA 1K41A 1OHOA 3KCHA 1RCKA 2P0XA 1ROVA 3WA3A 1LOYA 1YIJ3 3NBRA 3CC23 1QVG2 1GMPA 1QJGA 1YGWA 4WHAA 3SEDA 6RNTA 5JPUA 1K9M4 3S29A 1N5PA 2HMOB 4WYKB 2W0QA 3GAXA 1OCVA 1TTOA 1NNVA 2F4YA 3JUNA 2IUKA 4K1UA 3NV0B 4O02B 3UL5A 2KF3A 1STDA 4EV2A 4BIRA 5M19A 1K8A4 2KF4A 3EX9A 5RNTA 1VQL3 1YI23 1FGOA 1UCJA 1S723 1DMNA 2E2VA 4HM1B 4MEIA 4MMXB 2XGNA 1EKMA 1RDSA 4ORLA 1IQ8A 1EA2A 3LTBA 1IDPA 4RNTA 2KF6A 2UGIA 3S5CA 1BUJA 1VQK3 2INXA 3DZLA 4HAAA 1BRHA 4H3UA 5ELUA 4NPBA 1JB5A 5AIHA 3L0RA 3HI7A 1RGLA 4GL6A 1C54A 3NBJA 2BHMA 1O7WB 1YJN3 4GB5A 2XSOB 3JVCA 1IYYA 1TUHA 1BNJA 4OUQA 3HOHA 3EN8A 1KD14 4BU4A 4R1KA 2AAEA 2W03A 1W6GA 2KAAA 4HZ9B 3OWYA 2H0GA 5DREA 4DKIA 2WGQA 1GS3A 5M18A 3D4AA 1Q40A 2XH9A 4X2HA 1OF5B 2IMJA 3QK9A 1GMRA 2CFKA 1US1A 3EF8A 1VQN3 3Q90A 1T2IA 1OHPA 4L8OA 1QMAA 2UUGC 2XEPA 2ZDJA 3SOYA 1VQ43 1EUIC 3CPW2 3KSPA 4NREA 5IERA 4O3VA 3GZXB 3H51A 1OHSA 5EVHA 1VQ93 4QWTA 3CCE3 2IUJA 2MC8A 1UGHI 5M1AA 2I9WA 3CME3 2XFTA 3CD63 1B20A 2M7OA 5GSPA 2BMQB 2E2UA 3K9MC 1DETA 1MGWA 1W00A 2K54A 1DE3A 2CC3A 3F9SA 1I2EA 3F14A 4OVMA 1I3FA 3X42A 2H0HA 1WTHA 1UUWB 3OV4A 3V98A 4U13A 1RRLA 1UUGB 1YVSA 2WGOA 4WWUC 3Q1CA 3WOFB 3NUVA 3X3YA 4O8SA 1AR0A 3LYGA 2H0IA 3BLZA 1ROAA 1VQQA 1BNEA 1E3RA 1UW1A 3J7Yd 1RMSA 1TIJA 1FGRA 1HZ1A 1STFI 3Q2PA 4R9KA 1BNIA 1BSBA 1KWIA 1VQ53 4HM4B 4EBGA 3KSED 3N8BA 1Q9EA 3CCU3 5G1LA 1BIRA 3DMCA 5IG3A 2QA43 2HMNB 3KN4A 2CK3H 1IV7A 1IT7A 1R4CA 1GMQA 1V74A 1W01A 5FGOA 4AKYA 5BVBA 4HYZA 9RNTA 4WYKA 2PNCA 2C4BA 5BIRA 2STDA 3CNMA 2ML5A 1RLSA 1T5YA 3RGAA 3K7CA 2BO9B 3GSPA 3IJEB 1T2HA 2QIYA 2W56A 3HK4A 4X2OA 3ER7A 1V58A 1L5GB 5D82A 1ULJB 4IPBA 3U1WA 1BGSA 1KQS2 3F8XA 1YNVX 1LVNA 1DYUA 1YJ93 4GHOA 1WMOA 3A76A 3GZYB 3BNCA 1BRIA 2RGQA 3MG1A 3WHOA 1E3VA 2ZHXB 1JRQA 3EBTA 2SBLA 5JPPA 3WR2A 1VQ73 1Q7Y4 5FW5A 3CXC2 5CF2A 2OOVA 3FKAA 1M904 2A15A 2W9PA 5D83A 1BNGA 3RDEA 3D9RA 2IY2A 4RNZA 2FXTA 3K63A 1OF5A 4XBYA 1CYUA 1FGTA 4K61A 2P0MA 3DGLA 4BL2A 3GWRA 2AADA 1VQ63 2CH9A 1JKGA 2XSHB 1EG9B 1MNLA 1U5OA 2IYJA 2F86B 2Z77A 3N9HA 4RZMA 3S27A 5A0OB 5CF1A 4KZ1A 1GD4A 1NB3I 4CPKA 4XBXA 5AIFA 1VQM3 3A5EA 3LT9A 3T8NA 1FUWA 3AMOB 1A2VA 3URPA 2D42A 1MWUA 1IVWA 4NHFA 1NB5I 2P05A 5CXOA 2Y74A 2O9UX 1AVKA 2OOVC 2CFWA 2HMJB 3BU4A 3PS8A 3ROBA 3WMDA 3NBBA 1W2ZA 3D3LA 3NQZA 3V92A 3ZG0A 3NXJA 2CHCA 3MG3A 5D81A 1IQYA 1TP6A 2ZA4A 3LTCA 3SYUA 1BRJA 1I70A 2W56B 3DGOA 3PXMA 5CLKA 1X1YA 3DH2A 4EC6A 2W2CA 3AGOA 2YFJB 3EB8A 5KP4A 5LC7A 5BU4A 1M9GA 1Q824 1B2MA 1LNIA 3EE1A 3MKIA 1BVIA 1CYVA 1NWWA 1RTUA 1IVUA 1NU3A 1I8VA 4FMAA 3U97A 1TU5A 3AHSA 1N5HA 2Y73A 3FGYA 1HKXA 1RHLA 3GZRA 5CK6A 1UCLA 4H61A 1WNHA 5HOHA 1A2KA 3EJVA 1BSEA 1GD3A 2QGUA 3B4OA 4HVNA 3T8UA 2F99A 1GOVA 1TFOA 2R4IA 4MMYB 1BRGA 4MJDA 3LTDA 1VQO3 1RKYA 1RGKA 1B21A 3SOAA 1X1XA 3FF0A 3X41A 3RNTA 1RGCA 3NM7A 1W02A 1UCIA 2CWVA 1FUTA 2RFRA 5IEOA 2GU1A 4HM2B 1J2BA 3LTAA 2HMKB 3QRDA 1D6UA 2LQVA 3G16A 1JKGB 1JN5B 3CU3A 5G1KA 1LOXA 1BNSA 5KP3A 1B27A 1AQZA 2GSPA 4CDLA 1JBTA 4BTXA 3WDGB 5STDA 3CCS3 3HX8A 4BTWA 1GOYA 1V57A 3PGBA 1X1UA 2K3DA 4MMZB 1QAKA 2HMLB 1CH0A 4N3VA 5AYSC 1IT8A 3Q3FA 1RN1A 3MHEA 1SIIA 3BNDA 1JNQA 1YIT3 3DGNA 1IQXA 1DMMA 4KFEA 2W04A 1VQP3 3DM8A 1Q814 4JF8A 4R80A 3H3HA 3TDGA 3CCM3 2C10A 3VSYA 3BNBA 1ZO2A 2J8XB 1JB4A 4PEJA 1B2SA 2CKFB 4LYLB 4LZIA 3F8HA 4AKZA 1O7HB 1GSPA 1FA3A 2BIRA 3KFQC 3SVAA 1LQGC 2CW9A 2WOFA 3STDA 3LT8A 4FMCA 3AMOA 1Z1SA 4ILFA 4HZBB 1BRNL 1RNTA 4KFDA 3FG1A 3I563 2CFGA 2F56A 5IW9A 5IG0A 3DXOA 3D5IA 3B8LA 3OWSA 4XDWA 1N9JA 3UB1A 1FGQA 3MG2A 1R4YA 1YGEA 1CEWI 3KZTA 4XBTA 4KT3B 2P09A 5IG5A 1B2XA 1OGXA 2KF5A 1X1WA 3FLJA 4FCZA 4N6NB 1JZDA 5IF6A 1JZOA 1D6YA 7RNTA 2P38A 2WO0A 2QEX3 1KSIA 1VQ83 3AHWA 1Y4KA 1MGRA 4HM7B 5AIIA 3PCSA 1WMNA 3D79A 3KIIA 3DUKA 1WQLB 2W6JH 1PFPA 3JUPA 2HOHA 3FF2A 1HYFA 1OGZA 4N6V0 1EEJA 1SQWA 4RBNA 3ZG5A 1BNRA 3AGNA 1DVDA 1B3SA 1TRQA 4RNYA 1RN4A 3FH1A 1W5ZA 1IVXA 2K0MA 2LYXA 2CX1A 4R9LA 1A67A 3FG4A 4K1VA 3OXAA 1QALA 3G0KA 2CG1A 1N9EA 5TGNA 1AV4A 1Q864 2CG0A 2O3OA 1S5AA 5IG4A 3MPHA 4FCJA 5EEOA 3NHXA 1JN5A 1FUSA 5EQLA 4IT7A 4Q53A 3KE7A 2OQEA 1GY6A 2C11A 2YX9A 5AYRB 2IA7A 3B7CA 4J5GA 3DGMA 3UNLA 1PU4A 2GU3A 2RNTA 1ZGXA 1NDOB 2Z7AA 2F5MA 4J5KA 3CNXA 3WA2X 1OUNA 4FCMA 1BUQA 1GOUA 3S28A 1O7NB 1W7CA 3D5GA 4HM5B 4AEQA 3BIRA 3O8YA 1C7HA 3ZFZA 1AY7A 2FGTA 3LXUX 3LMLA 1JB2A 1K734 5AEWB 1MWSA 4LSOA 4HKVB 4OK0A 1SPUA 2CWTA 5IENA 1TRPA 2B1XB 7STDA 2OQEC 1PYLA 2Q07A 5KP1A 2CIUA 3G713 3IPTA 1BRSA 1RGFA 1SARA 4FMDA 5HGRA 1I2GA 1BANA 1W6CA 4CJNA 1A2PA 1OACA 3B4PA 3ECFA 3MYTA 3NX0A 2CFLA 2XGLA 1WMPA 4IIAA 2WOHA 1NO3A 2JDIH 1Q42A 1YVBI 3VF1A 1K28A 3DGYA 1UDII 2SARA 2MF7A 2CFDA 3SLUA 3HIIA 4J8TA 1DMQA 3JUQA 1IV9A 3CC73 3V99A 2GBWB 3K5TA 2F98A 1TJDA 3F7SA 4R4KA 3CCL3 1O7MB 1OPYA 1G0TA 1W2B2 1LOVA 2B24B 2GEYA 1GY7A 4WFOA 3LOYA 1JBSA 5DRVA 2KCDA 5IEPA 2RCDA 3EN1B 4FR9A 3CCQ3 2OTL3 2RSXA 1RGGA 2FNQA 1OH0A 4HJLB 2CX0A 1G96A 3CCV3 2CWUA 5JBSA 2Z76A 1BSAA 2KXGA 1MOLA 1ASKA 1RGEA 3BB9A 3NM2A 1BNFA 4I5QA 6GSPA 2YFIB 4J9AA 3G8ZA 1EQKA 1LOWA 4EV5A 2BU4A 4BL3A 3FSDA 4L7KA 2Z6BA 1GY5A 4L8PA 3CC43 3SX1A 1W6YA 2RBIA 1UI7A 3WODG 1ZX2A 1T3BA 1IVVA 3WOEB 5BXQA 3NQYA 2HMMB 4HBRA 4WP5A 1LRAA 3G6E3 1U8CB 1JV2B 1TFKA 2BNGA 4STDA 4EYCA 3FCSB 3N54B 3HIGA 1G02A 1RNBA 1RN7A 3S67A 2L4VA 5AI1A 4EXRA 1LXEA 1BU4A 1IU7A 3IMAB 3K0ZA 1DVCA 1HU9A 1RGHA 2UX0A 1Q7HA 1SIHA 3FZWA 3OX9A 3F40A 4G1MB 4N6UA 3UJMA 1RJOA 1BSDA 1W4NA 4HM3B 3SXXA 1IK3A 1LNHA 2XFSA 2ZL8A 1BRKA 4XDVA 1UGIA 3X3XA 1YJW3 1UI8A 2F5WA 4XB5A 2E2TA 4HM0B 8CHOA 1ISKA 1M1XB 3DY5A 4BTYA 8RNTA 3BNEA 1I0XA 3M8CA 2L1SA 1UCKA 2YFLB 3PYJA 2BT3A 3I0YA 5I97A 5G2GA 1MWRA 1GYBA 4LMIA 2ML6A 2D1WA 4ZM8A 1ULIB 1AVLA 3HZPA 1O7PB 4FMBA 3ALAA 5ELJA 4N6LA 1QAFA 1NJI4 1JBRA 1B2ZA 2PZVA 2XRXB 1UUVB 3JUOA 4KVHA 1Q40B 2JQ5A 2XF3A 1RSNA 3GZBA 4HOHA 1M1K4 1A90A 4HM6B 4EW5A 3F7XA 1I2FA 2OWPA 3FG3A 3RGRA 3NV0A 4LGQA 1YHQ3 2OTJ3 3CPOA 4O2HA 1MWTA 1FYSA 7GSPA 1I3IA 2OCTA 3I553 2V1LA 3GRDA 3OWUA 3EQQB 1LQMB 4N6TA 3UL6A 4K90B 1FGMA 4N6OB 3MWZA 2XR8B 1BOXA 2BMOB 4JRFA 3MSOA 3PCRA 1FZUA 1F8NA 1B2UA 4HM8B 3CMA3 1FW7A 1ZS7A 1I0VA 1BAOA 3E99A 3T0UA 2GEXA 3VGNA 6STDA 1JJ22 2R41A 4I4KA 4LEHA 2KRTA 1O7GB 1RCLA 1RGAA 1QVF2 3CCR3 1SJWA 1N8QA 1KC84 3JUMA 3LZAA 3X40A 3OW22 4XM4A 2W9QA 3PZWA 4N6MA 5AIGA 1N8R4 1VZZA
chains in the Genus database with same CATH topology
4GSPA 1BSCA 1RLSA 1PY3A 3GSPA 1T2HA 1B2SA 1LOVA 1JBSA 1BGSA 1GSPA 1YNVX 1RGGA 3KCHA 1RCKA 4GHOA 2BIRA 1LOYA 1BRNL 1GMPA 1YGWA 6RNTA 1BRIA 1BSAA 3WHOA 1RGEA 1BNFA 1RNTA 1TTOA 2F4YA 3WR2A 6GSPA 2F56A 1LOWA 2KF3A 2BU4A 4BIRA 3D5IA 2KF4A 5RNTA 1BNGA 1UCJA 1R4YA 1RDSA 4RNTA 2RBIA 1B2XA 2KF6A 1BUJA 2KF5A 2AADA 1X1WA 7RNTA 1LRAA 4HAAA 1BRHA 3AHWA 1MGRA 1RGLA 3A5EA 1C54A 3URPA 1RNBA 1G02A 1IYYA 2HOHA 1BNJA 1HYFA 3HOHA 1BU4A 4BU4A 1BNRA 3AGNA 2AAEA 1RGHA 1B3SA 1TRQA 2KAAA 3BU4A 1RN4A 1BSDA 3D4AA 1BRKA 2ZA4A 1GMRA 2F5WA 3SYUA 1BRJA 1I70A 8RNTA 1I0XA 1T2IA 1X1YA 3DH2A 3AGOA 1UCKA 5BU4A 1FUSA 1B2MA 1LNIA 1BVIA 1RTUA 1I8VA 3AHSA 1RHLA 1UCLA 4J5GA 5HOHA 1B20A 1BSEA 1JBRA 1B2ZA 2RNTA 5GSPA 1ZGXA 2F5MA 1GOVA 4J5KA 1DETA 1MGWA 1BRGA 4HOHA 1RSNA 1GOUA 1I2EA 1RGKA 1B21A 3D5GA 1DE3A 1X1XA 3BIRA 1I3FA 3RNTA 1I2FA 1RGCA 1UCIA 1FUTA 1AY7A 1YVSA 1FYSA 7GSPA 1I3IA 1BNSA 1BNEA 1B27A 1RMSA 1AQZA 1HZ1A 1TRPA 2GSPA 1JBTA 1PYLA 1BNIA 1BOXA 1BSBA 1GOYA 1FZUA 1B2UA 1X1UA 1BRSA 1RGFA 1SARA 1CH0A 1I0VA 1FW7A 1I2GA 1BAOA 1Q9EA 1BANA 3Q3FA 1RN1A 1A2PA 1BIRA 1RCLA 1RGAA 1GMQA 3DGYA 2SARA 9RNTA 2C4BA 5BIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSP A;  1BSC A;  1RLS A;  1PY3 A;  3GSP A;  1T2H A;  1B2S A;  1LOV A;  1JBS A;  1BGS A;  1GSP A;  1YNV X;  1RGG A;  3KCH A;  1RCK A;  4GHO A;  2BIR A;  1LOY A;  1BRN L;  1GMP A;  1YGW A;  6RNT A;  1BRI A;  1BSA A;  3WHO A;  1RGE A;  1BNF A;  1RNT A;  1TTO A;  2F4Y A;  3WR2 A;  6GSP A;  2F56 A;  1LOW A;  2KF3 A;  2BU4 A;  4BIR A;  3D5I A;  2KF4 A;  5RNT A;  1BNG A;  1UCJ A;  1R4Y A;  1RDS A;  4RNT A;  2RBI A;  1B2X A;  2KF6 A;  1BUJ A;  2KF5 A;  2AAD A;  1X1W A;  7RNT A;  1LRA A;  4HAA A;  1BRH A;  3AHW A;  1MGR A;  1RGL A;  3A5E A;  1C54 A;  3URP A;  1RNB A;  1G02 A;  1IYY A;  2HOH A;  1BNJ A;  1HYF A;  3HOH A;  1BU4 A;  4BU4 A;  1BNR A;  3AGN A;  2AAE A;  1RGH A;  1B3S A;  1TRQ A;  2KAA A;  3BU4 A;  1RN4 A;  1BSD A;  3D4A A;  1BRK A;  2ZA4 A;  1GMR A;  2F5W A;  3SYU A;  1BRJ A;  1I70 A;  8RNT A;  1I0X A;  1T2I A;  1X1Y A;  3DH2 A;  3AGO A;  1UCK A;  5BU4 A;  1FUS A;  1B2M A;  1LNI A;  1BVI A;  1RTU A;  1I8V A;  3AHS A;  1RHL A;  1UCL A;  4J5G A;  5HOH A;  1B20 A;  1BSE A;  1JBR A;  1B2Z A;  2RNT A;  5GSP A;  1ZGX A;  2F5M A;  1GOV A;  4J5K A;  1DET A;  1MGW A;  1BRG A;  4HOH A;  1RSN A;  1GOU A;  1I2E A;  1RGK A;  1B21 A;  3D5G A;  1DE3 A;  1X1X A;  3BIR A;  1I3F A;  3RNT A;  1I2F A;  1RGC A;  1UCI A;  1FUT A;  1AY7 A;  1YVS A;  1FYS A;  7GSP A;  1I3I A;  1BNS A;  1BNE A;  1B27 A;  1RMS A;  1AQZ A;  1HZ1 A;  1TRP A;  2GSP A;  1JBT A;  1PYL A;  1BNI A;  1BOX A;  1BSB A;  1GOY A;  1FZU A;  1B2U A;  1X1U A;  1BRS A;  1RGF A;  1SAR A;  1CH0 A;  1I0V A;  1FW7 A;  1I2G A;  1BAO A;  1Q9E A;  1BAN A;  3Q3F A;  1RN1 A;  1A2P A;  1BIR A;  1RCL A;  1RGA A;  1GMQ A;  3DGY A;  2SAR A;  9RNT A;  2C4B A;  5BIR A; 
#chains in the Genus database with same CATH topology
 3LH4 A;  4GSP A;  3EHC A;  1BSC A;  1PY3 A;  5LC6 A;  3CCJ 3;  1RRH A;  2GBX B;  3G4S 3;  1CQS A;  3X3Z A;  4TX4 A;  3EBY A;  3EC9 A;  4CCV A;  1E97 A;  3KKG A;  1D6Z A;  2BMR B;  5AEU B;  2GXF A;  4KFF A;  1K41 A;  1OHO A;  3KCH A;  1RCK A;  2P0X A;  1ROV A;  3WA3 A;  1LOY A;  1YIJ 3;  3NBR A;  3CC2 3;  1QVG 2;  1GMP A;  1QJG A;  1YGW A;  4WHA A;  3SED A;  6RNT A;  5JPU A;  1K9M 4;  3S29 A;  1N5P A;  2HMO B;  4WYK B;  2W0Q A;  3GAX A;  1OCV A;  1TTO A;  1NNV A;  2F4Y A;  3JUN A;  2IUK A;  4K1U A;  3NV0 B;  4O02 B;  3UL5 A;  2KF3 A;  1STD A;  4EV2 A;  4BIR A;  5M19 A;  1K8A 4;  2KF4 A;  3EX9 A;  5RNT A;  1VQL 3;  1YI2 3;  1FGO A;  1UCJ A;  1S72 3;  1DMN A;  2E2V A;  4HM1 B;  4MEI A;  4MMX B;  2XGN A;  1EKM A;  1RDS A;  4ORL A;  1IQ8 A;  1EA2 A;  3LTB A;  1IDP A;  4RNT A;  2KF6 A;  2UGI A;  3S5C A;  1BUJ A;  1VQK 3;  2INX A;  3DZL A;  4HAA A;  1BRH A;  4H3U A;  5ELU A;  4NPB A;  1JB5 A;  5AIH A;  3L0R A;  3HI7 A;  1RGL A;  4GL6 A;  1C54 A;  3NBJ A;  2BHM A;  1O7W B;  1YJN 3;  4GB5 A;  2XSO B;  3JVC A;  1IYY A;  1TUH A;  1BNJ A;  4OUQ A;  3HOH A;  3EN8 A;  1KD1 4;  4BU4 A;  4R1K A;  2AAE A;  2W03 A;  1W6G A;  2KAA A;  4HZ9 B;  3OWY A;  2H0G A;  5DRE A;  4DKI A;  2WGQ A;  1GS3 A;  5M18 A;  3D4A A;  1Q40 A;  2XH9 A;  4X2H A;  1OF5 B;  2IMJ A;  3QK9 A;  1GMR A;  2CFK A;  1US1 A;  3EF8 A;  1VQN 3;  3Q90 A;  1T2I A;  1OHP A;  4L8O A;  1QMA A;  2UUG C;  2XEP A;  2ZDJ A;  3SOY A;  1VQ4 3;  1EUI C;  3CPW 2;  3KSP A;  4NRE A;  5IER A;  4O3V A;  3GZX B;  3H51 A;  1OHS A;  5EVH A;  1VQ9 3;  4QWT A;  3CCE 3;  2IUJ A;  2MC8 A;  1UGH I;  5M1A A;  2I9W A;  3CME 3;  2XFT A;  3CD6 3;  1B20 A;  2M7O A;  5GSP A;  2BMQ B;  2E2U A;  3K9M C;  1DET A;  1MGW A;  1W00 A;  2K54 A;  1DE3 A;  2CC3 A;  3F9S A;  1I2E A;  3F14 A;  4OVM A;  1I3F A;  3X42 A;  2H0H A;  1WTH A;  1UUW B;  3OV4 A;  3V98 A;  4U13 A;  1RRL A;  1UUG B;  1YVS A;  2WGO A;  4WWU C;  3Q1C A;  3WOF B;  3NUV A;  3X3Y A;  4O8S A;  1AR0 A;  3LYG A;  2H0I A;  3BLZ A;  1ROA A;  1VQQ A;  1BNE A;  1E3R A;  1UW1 A;  3J7Y d;  1RMS A;  1TIJ A;  1FGR A;  1HZ1 A;  1STF I;  3Q2P A;  4R9K A;  1BNI A;  1BSB A;  1KWI A;  1VQ5 3;  4HM4 B;  4EBG A;  3KSE D;  3N8B A;  1Q9E A;  3CCU 3;  5G1L A;  1BIR A;  3DMC A;  5IG3 A;  2QA4 3;  2HMN B;  3KN4 A;  2CK3 H;  1IV7 A;  1IT7 A;  1R4C A;  1GMQ A;  1V74 A;  1W01 A;  5FGO A;  4AKY A;  5BVB A;  4HYZ A;  9RNT A;  4WYK A;  2PNC A;  2C4B A;  5BIR A;  2STD A;  3CNM A;  2ML5 A;  1RLS A;  1T5Y A;  3RGA A;  3K7C A;  2BO9 B;  3GSP A;  3IJE B;  1T2H A;  2QIY A;  2W56 A;  3HK4 A;  4X2O A;  3ER7 A;  1V58 A;  1L5G B;  5D82 A;  1ULJ B;  4IPB A;  3U1W A;  1BGS A;  1KQS 2;  3F8X A;  1YNV X;  1LVN A;  1DYU A;  1YJ9 3;  4GHO A;  1WMO A;  3A76 A;  3GZY B;  3BNC A;  1BRI A;  2RGQ A;  3MG1 A;  3WHO A;  1E3V A;  2ZHX B;  1JRQ A;  3EBT A;  2SBL A;  5JPP A;  3WR2 A;  1VQ7 3;  1Q7Y 4;  5FW5 A;  3CXC 2;  5CF2 A;  2OOV A;  3FKA A;  1M90 4;  2A15 A;  2W9P A;  5D83 A;  1BNG A;  3RDE A;  3D9R A;  2IY2 A;  4RNZ A;  2FXT A;  3K63 A;  1OF5 A;  4XBY A;  1CYU A;  1FGT A;  4K61 A;  2P0M A;  3DGL A;  4BL2 A;  3GWR A;  2AAD A;  1VQ6 3;  2CH9 A;  1JKG A;  2XSH B;  1EG9 B;  1MNL A;  1U5O A;  2IYJ A;  2F86 B;  2Z77 A;  3N9H A;  4RZM A;  3S27 A;  5A0O B;  5CF1 A;  4KZ1 A;  1GD4 A;  1NB3 I;  4CPK A;  4XBX A;  5AIF A;  1VQM 3;  3A5E A;  3LT9 A;  3T8N A;  1FUW A;  3AMO B;  1A2V A;  3URP A;  2D42 A;  1MWU A;  1IVW A;  4NHF A;  1NB5 I;  2P05 A;  5CXO A;  2Y74 A;  2O9U X;  1AVK A;  2OOV C;  2CFW A;  2HMJ B;  3BU4 A;  3PS8 A;  3ROB A;  3WMD A;  3NBB A;  1W2Z A;  3D3L A;  3NQZ A;  3V92 A;  3ZG0 A;  3NXJ A;  2CHC A;  3MG3 A;  5D81 A;  1IQY A;  1TP6 A;  2ZA4 A;  3LTC A;  3SYU A;  1BRJ A;  1I70 A;  2W56 B;  3DGO A;  3PXM A;  5CLK A;  1X1Y A;  3DH2 A;  4EC6 A;  2W2C A;  3AGO A;  2YFJ B;  3EB8 A;  5KP4 A;  5LC7 A;  5BU4 A;  1M9G A;  1Q82 4;  1B2M A;  1LNI A;  3EE1 A;  3MKI A;  1BVI A;  1CYV A;  1NWW A;  1RTU A;  1IVU A;  1NU3 A;  1I8V A;  4FMA A;  3U97 A;  1TU5 A;  3AHS A;  1N5H A;  2Y73 A;  3FGY A;  1HKX A;  1RHL A;  3GZR A;  5CK6 A;  1UCL A;  4H61 A;  1WNH A;  5HOH A;  1A2K A;  3EJV A;  1BSE A;  1GD3 A;  2QGU A;  3B4O A;  4HVN A;  3T8U A;  2F99 A;  1GOV A;  1TFO A;  2R4I A;  4MMY B;  1BRG A;  4MJD A;  3LTD A;  1VQO 3;  1RKY A;  1RGK A;  1B21 A;  3SOA A;  1X1X A;  3FF0 A;  3X41 A;  3RNT A;  1RGC A;  3NM7 A;  1W02 A;  1UCI A;  2CWV A;  1FUT A;  2RFR A;  5IEO A;  2GU1 A;  4HM2 B;  1J2B A;  3LTA A;  2HMK B;  3QRD A;  1D6U A;  2LQV A;  3G16 A;  1JKG B;  1JN5 B;  3CU3 A;  5G1K A;  1LOX A;  1BNS A;  5KP3 A;  1B27 A;  1AQZ A;  2GSP A;  4CDL A;  1JBT A;  4BTX A;  3WDG B;  5STD A;  3CCS 3;  3HX8 A;  4BTW A;  1GOY A;  1V57 A;  3PGB A;  1X1U A;  2K3D A;  4MMZ B;  1QAK A;  2HML B;  1CH0 A;  4N3V A;  5AYS C;  1IT8 A;  3Q3F A;  1RN1 A;  3MHE A;  1SII A;  3BND A;  1JNQ A;  1YIT 3;  3DGN A;  1IQX A;  1DMM A;  4KFE A;  2W04 A;  1VQP 3;  3DM8 A;  1Q81 4;  4JF8 A;  4R80 A;  3H3H A;  3TDG A;  3CCM 3;  2C10 A;  3VSY A;  3BNB A;  1ZO2 A;  2J8X B;  1JB4 A;  4PEJ A;  1B2S A;  2CKF B;  4LYL B;  4LZI A;  3F8H A;  4AKZ A;  1O7H B;  1GSP A;  1FA3 A;  2BIR A;  3KFQ C;  3SVA A;  1LQG C;  2CW9 A;  2WOF A;  3STD A;  3LT8 A;  4FMC A;  3AMO A;  1Z1S A;  4ILF A;  4HZB B;  1BRN L;  1RNT A;  4KFD A;  3FG1 A;  3I56 3;  2CFG A;  2F56 A;  5IW9 A;  5IG0 A;  3DXO A;  3D5I A;  3B8L A;  3OWS A;  4XDW A;  1N9J A;  3UB1 A;  1FGQ A;  3MG2 A;  1R4Y A;  1YGE A;  1CEW I;  3KZT A;  4XBT A;  4KT3 B;  2P09 A;  5IG5 A;  1B2X A;  1OGX A;  2KF5 A;  1X1W A;  3FLJ A;  4FCZ A;  4N6N B;  1JZD A;  5IF6 A;  1JZO A;  1D6Y A;  7RNT A;  2P38 A;  2WO0 A;  2QEX 3;  1KSI A;  1VQ8 3;  3AHW A;  1Y4K A;  1MGR A;  4HM7 B;  5AII A;  3PCS A;  1WMN A;  3D79 A;  3KII A;  3DUK A;  1WQL B;  2W6J H;  1PFP A;  3JUP A;  2HOH A;  3FF2 A;  1HYF A;  1OGZ A;  4N6V 0;  1EEJ A;  1SQW A;  4RBN A;  3ZG5 A;  1BNR A;  3AGN A;  1DVD A;  1B3S A;  1TRQ A;  4RNY A;  1RN4 A;  3FH1 A;  1W5Z A;  1IVX A;  2K0M A;  2LYX A;  2CX1 A;  4R9L A;  1A67 A;  3FG4 A;  4K1V A;  3OXA A;  1QAL A;  3G0K A;  2CG1 A;  1N9E A;  5TGN A;  1AV4 A;  1Q86 4;  2CG0 A;  2O3O A;  1S5A A;  5IG4 A;  3MPH A;  4FCJ A;  5EEO A;  3NHX A;  1JN5 A;  1FUS A;  5EQL A;  4IT7 A;  4Q53 A;  3KE7 A;  2OQE A;  1GY6 A;  2C11 A;  2YX9 A;  5AYR B;  2IA7 A;  3B7C A;  4J5G A;  3DGM A;  3UNL A;  1PU4 A;  2GU3 A;  2RNT A;  1ZGX A;  1NDO B;  2Z7A A;  2F5M A;  4J5K A;  3CNX A;  3WA2 X;  1OUN A;  4FCM A;  1BUQ A;  1GOU A;  3S28 A;  1O7N B;  1W7C A;  3D5G A;  4HM5 B;  4AEQ A;  3BIR A;  3O8Y A;  1C7H A;  3ZFZ A;  1AY7 A;  2FGT A;  3LXU X;  3LML A;  1JB2 A;  1K73 4;  5AEW B;  1MWS A;  4LSO A;  4HKV B;  4OK0 A;  1SPU A;  2CWT A;  5IEN A;  1TRP A;  2B1X B;  7STD A;  2OQE C;  1PYL A;  2Q07 A;  5KP1 A;  2CIU A;  3G71 3;  3IPT A;  1BRS A;  1RGF A;  1SAR A;  4FMD A;  5HGR A;  1I2G A;  1BAN A;  1W6C A;  4CJN A;  1A2P A;  1OAC A;  3B4P A;  3ECF A;  3MYT A;  3NX0 A;  2CFL A;  2XGL A;  1WMP A;  4IIA A;  2WOH A;  1NO3 A;  2JDI H;  1Q42 A;  1YVB I;  3VF1 A;  1K28 A;  3DGY A;  1UDI I;  2SAR A;  2MF7 A;  2CFD A;  3SLU A;  3HII A;  4J8T A;  1DMQ A;  3JUQ A;  1IV9 A;  3CC7 3;  3V99 A;  2GBW B;  3K5T A;  2F98 A;  1TJD A;  3F7S A;  4R4K A;  3CCL 3;  1O7M B;  1OPY A;  1G0T A;  1W2B 2;  1LOV A;  2B24 B;  2GEY A;  1GY7 A;  4WFO A;  3LOY A;  1JBS A;  5DRV A;  2KCD A;  5IEP A;  2RCD A;  3EN1 B;  4FR9 A;  3CCQ 3;  2OTL 3;  2RSX A;  1RGG A;  2FNQ A;  1OH0 A;  4HJL B;  2CX0 A;  1G96 A;  3CCV 3;  2CWU A;  5JBS A;  2Z76 A;  1BSA A;  2KXG A;  1MOL A;  1ASK A;  1RGE A;  3BB9 A;  3NM2 A;  1BNF A;  4I5Q A;  6GSP A;  2YFI B;  4J9A A;  3G8Z A;  1EQK A;  1LOW A;  4EV5 A;  2BU4 A;  4BL3 A;  3FSD A;  4L7K A;  2Z6B A;  1GY5 A;  4L8P A;  3CC4 3;  3SX1 A;  1W6Y A;  2RBI A;  1UI7 A;  3WOD G;  1ZX2 A;  1T3B A;  1IVV A;  3WOE B;  5BXQ A;  3NQY A;  2HMM B;  4HBR A;  4WP5 A;  1LRA A;  3G6E 3;  1U8C B;  1JV2 B;  1TFK A;  2BNG A;  4STD A;  4EYC A;  3FCS B;  3N54 B;  3HIG A;  1G02 A;  1RNB A;  1RN7 A;  3S67 A;  2L4V A;  5AI1 A;  4EXR A;  1LXE A;  1BU4 A;  1IU7 A;  3IMA B;  3K0Z A;  1DVC A;  1HU9 A;  1RGH A;  2UX0 A;  1Q7H A;  1SIH A;  3FZW A;  3OX9 A;  3F40 A;  4G1M B;  4N6U A;  3UJM A;  1RJO A;  1BSD A;  1W4N A;  4HM3 B;  3SXX A;  1IK3 A;  1LNH A;  2XFS A;  2ZL8 A;  1BRK A;  4XDV A;  1UGI A;  3X3X A;  1YJW 3;  1UI8 A;  2F5W A;  4XB5 A;  2E2T A;  4HM0 B;  8CHO A;  1ISK A;  1M1X B;  3DY5 A;  4BTY A;  8RNT A;  3BNE A;  1I0X A;  3M8C A;  2L1S A;  1UCK A;  2YFL B;  3PYJ A;  2BT3 A;  3I0Y A;  5I97 A;  5G2G A;  1MWR A;  1GYB A;  4LMI A;  2ML6 A;  2D1W A;  4ZM8 A;  1ULI B;  1AVL A;  3HZP A;  1O7P B;  4FMB A;  3ALA A;  5ELJ A;  4N6L A;  1QAF A;  1NJI 4;  1JBR A;  1B2Z A;  2PZV A;  2XRX B;  1UUV B;  3JUO A;  4KVH A;  1Q40 B;  2JQ5 A;  2XF3 A;  1RSN A;  3GZB A;  4HOH A;  1M1K 4;  1A90 A;  4HM6 B;  4EW5 A;  3F7X A;  1I2F A;  2OWP A;  3FG3 A;  3RGR A;  3NV0 A;  4LGQ A;  1YHQ 3;  2OTJ 3;  3CPO A;  4O2H A;  1MWT A;  1FYS A;  7GSP A;  1I3I A;  2OCT A;  3I55 3;  2V1L A;  3GRD A;  3OWU A;  3EQQ B;  1LQM B;  4N6T A;  3UL6 A;  4K90 B;  1FGM A;  4N6O B;  3MWZ A;  2XR8 B;  1BOX A;  2BMO B;  4JRF A;  3MSO A;  3PCR A;  1FZU A;  1F8N A;  1B2U A;  4HM8 B;  3CMA 3;  1FW7 A;  1ZS7 A;  1I0V A;  1BAO A;  3E99 A;  3T0U A;  2GEX A;  3VGN A;  6STD A;  1JJ2 2;  2R41 A;  4I4K A;  4LEH A;  2KRT A;  1O7G B;  1RCL A;  1RGA A;  1QVF 2;  3CCR 3;  1SJW A;  1N8Q A;  1KC8 4;  3JUM A;  3LZA A;  3X40 A;  3OW2 2;  4XM4 A;  2W9Q A;  3PZW A;  4N6M A;  5AIG A;  1N8R 4;  1VZZ A; 
#chains in the Genus database with same CATH homology
 4GSP A;  1BSC A;  1RLS A;  1PY3 A;  3GSP A;  1T2H A;  1B2S A;  1LOV A;  1JBS A;  1BGS A;  1GSP A;  1YNV X;  1RGG A;  3KCH A;  1RCK A;  4GHO A;  2BIR A;  1LOY A;  1BRN L;  1GMP A;  1YGW A;  6RNT A;  1BRI A;  1BSA A;  3WHO A;  1RGE A;  1BNF A;  1RNT A;  1TTO A;  2F4Y A;  3WR2 A;  6GSP A;  2F56 A;  1LOW A;  2KF3 A;  2BU4 A;  4BIR A;  3D5I A;  2KF4 A;  5RNT A;  1BNG A;  1UCJ A;  1R4Y A;  1RDS A;  4RNT A;  2RBI A;  1B2X A;  2KF6 A;  1BUJ A;  2KF5 A;  2AAD A;  1X1W A;  7RNT A;  1LRA A;  4HAA A;  1BRH A;  3AHW A;  1MGR A;  1RGL A;  3A5E A;  1C54 A;  3URP A;  1RNB A;  1G02 A;  1IYY A;  2HOH A;  1BNJ A;  1HYF A;  3HOH A;  1BU4 A;  4BU4 A;  1BNR A;  3AGN A;  2AAE A;  1RGH A;  1B3S A;  1TRQ A;  2KAA A;  3BU4 A;  1RN4 A;  1BSD A;  3D4A A;  1BRK A;  2ZA4 A;  1GMR A;  2F5W A;  3SYU A;  1BRJ A;  1I70 A;  8RNT A;  1I0X A;  1T2I A;  1X1Y A;  3DH2 A;  3AGO A;  1UCK A;  5BU4 A;  1FUS A;  1B2M A;  1LNI A;  1BVI A;  1RTU A;  1I8V A;  3AHS A;  1RHL A;  1UCL A;  4J5G A;  5HOH A;  1B20 A;  1BSE A;  1JBR A;  1B2Z A;  2RNT A;  5GSP A;  1ZGX A;  2F5M A;  1GOV A;  4J5K A;  1DET A;  1MGW A;  1BRG A;  4HOH A;  1RSN A;  1GOU A;  1I2E A;  1RGK A;  1B21 A;  3D5G A;  1DE3 A;  1X1X A;  3BIR A;  1I3F A;  3RNT A;  1I2F A;  1RGC A;  1UCI A;  1FUT A;  1AY7 A;  1YVS A;  1FYS A;  7GSP A;  1I3I A;  1BNS A;  1BNE A;  1B27 A;  1RMS A;  1AQZ A;  1HZ1 A;  1TRP A;  2GSP A;  1JBT A;  1PYL A;  1BNI A;  1BOX A;  1BSB A;  1GOY A;  1FZU A;  1B2U A;  1X1U A;  1BRS A;  1RGF A;  1SAR A;  1CH0 A;  1I0V A;  1FW7 A;  1I2G A;  1BAO A;  1Q9E A;  1BAN A;  3Q3F A;  1RN1 A;  1A2P A;  1BIR A;  1RCL A;  1RGA A;  1GMQ A;  3DGY A;  2SAR A;  9RNT A;  2C4B A;  5BIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...