5RNTA

X-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title X-ray analysis of cubic crystals of the complex formed between ribonuclease T1 and guanosine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 21
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5rntA00
1I0XA 1AQZA 1HZ1A 1RMSA 1BOXA 1RGKA 3A5EA 1RN4A 1C54A 1RGCA 1B20A 3Q3FA 5HOHA 1BSCA 1BSDA 1B3SA 3AHSA 1GOUA 1I70A 1B21A 1RSNA 1BNJA 1RGGA 1IYYA 3AHWA 3AGOA 1RCKA 3BU4A 2C4BA 6RNTA 1B2UA 1RDSA 9RNTA 3D5IA 1MGWA 5GSPA 3HOHA 1YVSA 1HYFA 1PY3A 1B2XA 1JBRA 1BGSA 1X1UA 1SARA 5RNTA 1X1YA 1UCIA 1RGAA 2AADA 5BU4A 1DETA 1GSPA 1UCKA 1LOYA 2GSPA 1BSAA 1T2IA 1LOVA 3BIRA 3DGYA 1GMRA 2F4YA 1A2PA 1AY7A 1RGFA 1RNTA 3SYUA 7RNTA 1BRHA 1JBTA 1G02A 1I2GA 7GSPA 1LNIA 4GSPA 1GOVA 1ZGXA 2HOHA 1BAOA 3GSPA 1R4YA 1B2ZA 1RNBA 1BRSA 3D5GA 1BVIA 2F56A 1GMPA 1I0VA 2KF6A 2RBIA 1LRAA 1CH0A 3WHOA 1BNFA 1TRQA 1RCLA 1BRJA 1UCLA 1I2FA 1RN1A 1RTUA 3URPA 1FUTA 4J5GA 3AGNA 5BIRA 1PYLA 1GMQA 1LOWA 2RNTA 3D4AA 1I3FA 6GSPA 4J5KA 1MGRA 1RLSA 1I2EA 1B27A 2BIRA 4HOHA 1YGWA 1BUJA 8RNTA 1BNEA 1YNVX 2KF3A 1B2SA 1BRKA 1TTOA 1BNGA 1I8VA 1BANA 3RNTA 1BSEA 1B2MA 1BRNL 2F5WA 1RGHA 1GOYA 1BIRA 1X1XA 2KF4A 1BU4A 1X1WA 1BRIA 1BNRA 1BNSA 1BSBA 1TRPA 1FZUA 1I3IA 2SARA 4RNTA 4BU4A 1JBSA 1UCJA 4BIRA 1DE3A 1FYSA 2BU4A 1BRGA 2ZA4A 2F5MA 2AAEA 1RHLA 3KCHA 1BNIA 1FW7A 1RGLA 2KF5A 3DH2A 1FUSA 1Q9EA 1T2HA 1RGEA 4HAAA 3WR2A 4GHOA 2KAAA
chains in the Genus database with same CATH superfamily
2LYXA 2XFSA 2OTJ3 3CPOA 3B4PA 1HZ1A 1G96A 1MOLA 4I5QA 2IUJA 4BL2A 1NU3A 1YJN3 1ZO2A 1IDPA 4FCJA 1YGEA 3DUKA 1UI8A 1C54A 3T8NA 3UB1A 3B7CA 3FF2A 1FGQA 1GYBA 1WMOA 1BSCA 2F99A 3FG3A 4O3VA 1J2BA 1EQKA 1VZZA 3K9MC 4WWUC 2WO0A 3UL5A 4CDLA 1RGGA 1VQO3 1IYYA 1OHPA 1GY5A 1M1K4 2CIUA 3BU4A 1QALA 2GEYA 1RDSA 1DVDA 1K8A4 9RNTA 4FMCA 2HMKB 4HM6B 1RN7A 1TP6A 3KE7A 1FGTA 4R1KA 4I4KA 5DREA 1QMAA 1K41A 1UI7A 5IF6A 3Q1CA 3CD63 1SJWA 4MEIA 1BGSA 4LZIA 3PXMA 1LXEA 2BMOB 3T8UA 1VQK3 2BMQB 5ELUA 3EE1A 1RGAA 2IA7A 3KSED 3ECFA 4U13A 4X2OA 3UNLA 4CJNA 2KRTA 3BIRA 3HIGA 3DGYA 4HZ9B 4N6OB 1RGFA 1RNTA 1E3RA 2XSOB 3G0KA 4HM4B 5G1LA 3SYUA 3CC73 2A15A 1O7MB 1A2VA 1JN5B 1G02A 2RCDA 3EBYA 1AVKA 3D3LA 1LNIA 3LTCA 5IEOA 2W56B 3LTBA 3BNDA 4LGQA 3E99A 1AVLA 5FGOA 4OVMA 1B2ZA 5AIIA 2QEX3 1SIHA 4HM8B 1RNBA 1SPUA 3X41A 2CFGA 4HM5B 1D6UA 3FGYA 4RBNA 3K5TA 2CKFB 3KZTA 4LEHA 5IG0A 1NO3A 4N6LA 4BTXA 4EV5A 1ASKA 5AEUB 1O7GB 1YJ93 1L5GB 1IVWA 2F98A 1CH0A 2I9WA 3NM7A 3WHOA 3B4OA 3JUPA 1NJI4 1GY7A 1IVXA 1I2FA 2XSHB 1RTUA 4RNYA 4MJDA 4HM3B 5BXQA 3CC23 1UUWB 3WA2X 2P38A 3CC43 3H51A 3MHEA 4OK0A 5IENA 4JRFA 5FW5A 5JBSA 1I3FA 1IVUA 1WMPA 4J5KA 2MC8A 1I2EA 1KC84 1B27A 2BIRA 1ULIB 3MG3A 4TX4A 5AI1A 1D6ZA 8RNTA 2F86B 1BNEA 1CEWI 5ELJA 2OOVA 5BVBA 3FZWA 1K28A 4WYKB 1BRKA 2RGQA 3S28A 4EV2A 1BNGA 3F40A 2IUKA 3DM8A 4KZ1A 1BRNL 3DZLA 1RGHA 1X1XA 1BU4A 3GRDA 2H0GA 5AIFA 2K0MA 5AIGA 1TRPA 4J8TA 4RNTA 4STDA 1EEJA 3LOYA 3S27A 3X3YA 2XFTA 4ORLA 1U5OA 3ROBA 4FMAA 2CFLA 2FGTA 2JQ5A 3B8LA 3J7Yd 2Z7AA 5EEOA 5JPUA 4HBRA 1D6YA 2W9QA 2XGLA 3DH2A 3GZRA 4N3VA 4NPBA 5CLKA 5EQLA 1YIT3 3N8BA 1VQ63 4H3UA 1Q864 1T2HA 4HAAA 4KT3B 3WR2A 5KP4A 2KAAA 2QGUA 1I0XA 2KXGA 3NM2A 4LMIA 1UUGB 1AQZA 1O7NB 1IV9A 1JN5A 4PEJA 4EC6A 4EW5A 1BOXA 3FH1A 2ZL8A 1A90A 1EA2A 3HI7A 3Q3FA 3CCV3 1ZX2A 2WOFA 3NV0B 4FR9A 2CK3H 3BNBA 3AHSA 3MPHA 3NXJA 1JJ22 1FUWA 1C7HA 1A2KA 3AHWA 3GZYB 1NB5I 3PS8A 5G2GA 3NX0A 2R4IA 1MWUA 3DGOA 2O9UX 1VQQA 2UX0A 3SOYA 4HKVB 3D5IA 1JNQA 2H0HA 1MGWA 1IQYA 3JVCA 4RNZA 3RDEA 3V92A 5M18A 2UUGC 5I97A 1GD3A 1W2B2 1YVSA 1PY3A 1AR0A 5AEWB 2W2CA 1OPYA 4IT7A 4EYCA 2YX9A 1EKMA 1JZDA 4K90B 1SARA 4N6MA 1PU4A 4O2HA 2BNGA 2XGNA 1GSPA 1N9EA 1UCKA 1LOYA 5AYRB 2XH9A 1BSAA 1LOVA 1Y4KA 5AIHA 1A2PA 4WYKA 4HVNA 1CQSA 1JBTA 1I2GA 3LT8A 3V99A 3FCSB 3NQZA 3CCE3 1IV7A 1GOVA 1OF5B 3OX9A 3NQYA 2Y73A 2HOHA 1BAOA 3HIIA 4MMZB 4QWTA 4XM4A 1RJOA 2STDA 1OACA 3EN8A 3PCRA 3LTAA 1Q40B 1BRSA 3FG1A 3UJMA 1OGXA 1E3VA 3D5GA 1BVIA 1QAFA 1UUVB 1RRHA 2F56A 2RSXA 3FF0A 3LZAA 4O02B 4O8SA 5D83A 1GMPA 1T3BA 4N6TA 3TDGA 2P09A 3I553 2RFRA 1IT7A 3KIIA 3MG1A 4HM1B 1BNFA 4AEQA 2J8XB 2FXTA 2WOHA 4L8PA 2JDIH 2CG1A 3HZPA 2BHMA 1F8NA 2GEXA 3AGNA 4XDVA 2WGQA 5BIRA 3ER7A 1JKGA 1Z1SA 2KCDA 1NNVA 1N5HA 1OUNA 1UDII 3D4AA 3U1WA 1K734 6GSPA 2ZDJA 1MGRA 1RLSA 3PGBA 3FG4A 1JB4A 2L1SA 5LC6A 1FA3A 1W02A 2WGOA 2YFLB 1IQXA 1YNVX 1W6CA 4N6V0 3S67A 3NBRA 3VGNA 4KFFA 2KF3A 3ZFZA 3LXUX 1TTOA 3PYJA 3G713 4OUQA 2CH9A 2ML6A 1I8VA 3BB9A 1B2MA 4N6UA 4CCVA 2E2UA 1DMNA 2K3DA 1BIRA 4H61A 2W03A 1OGZA 5D82A 1GD4A 3EB8A 1BNSA 1BSBA 1FZUA 1I3IA 1UCJA 4BIRA 1W6YA 1FYSA 3G16A 3M8CA 2OQEA 1BRGA 5M1AA 2ZA4A 1FGRA 2F5MA 2AAEA 3F8HA 3MKIA 1WTHA 3OXAA 5CK6A 3X3ZA 2OWPA 3CCJ3 3AMOB 3KCHA 1RGLA 4WHAA 3WODG 2CWTA 4KFEA 5TGNA 4RZMA 1Q9EA 3FSDA 1Q42A 2R41A 1NWWA 5IG3A 5DRVA 1S5AA 1RGEA 3EHCA 3CU3A 1ROAA 1RKYA 2P0XA 1MWRA 3CNMA 4J9AA 1RGKA 1WMNA 1EUIC 1OF5A 2CFWA 5HOHA 1KQS2 4IPBA 1BSDA 1JV2B 3N54B 1RSNA 3D9RA 3I563 3GZXB 3Q90A 5STDA 3ALAA 1RCKA 2INXA 2W9PA 2C4BA 1QAKA 2W0QA 3F9SA 2Z77A 3DY5A 3U97A 3CPW2 2QA43 1M1XB 1MNLA 1TUHA 4WP5A 5EVHA 3CCR3 2BO9B 3HOHA 1STDA 1VQM3 3OV4A 3SXXA 2P05A 1STFI 3EBTA 2IMJA 3K63A 2C11A 1VQL3 2XF3A 3DGNA 3F14A 3BNEA 3LTDA 1VQ83 1TFOA 1X1YA 1HKXA 1UCIA 1HU9A 1U8CB 2D1WA 2ML5A 4IIAA 1YIJ3 4HJLB 5IERA 5BU4A 2GXFA 3Q2PA 4CPKA 8CHOA 3K0ZA 1ISKA 2OTL3 2CWVA 2W56A 1V58A 4R80A 1DMQA 1A67A 4XBXA 3T0UA 3V98A 4Q53A 3LMLA 1JB5A 3BLZA 1M904 2Y74A 1TU5A 1OHSA 3IJEB 3N9HA 1N8R4 5D81A 2M7OA 1VQ43 3PZWA 3FKAA 2FNQA 3X40A 3VF1A 7GSPA 2W6JH 3JUNA 1ZGXA 3ZG5A 1NDOB 4XBYA 1UW1A 3MSOA 1MWSA 1N9JA 2H0IA 2Q07A 1YVBI 1O7WB 2B1XB 4K1UA 2GBWB 1US1A 2ZHXB 3MWZA 3IMAB 1RRLA 3SLUA 1OH0A 1ROVA 3SEDA 5LC7A 1IVVA 1BRJA 1UCLA 1LQGC 1BUQA 1DMMA 1QVF2 1RN1A 1FUTA 4J5GA 5KP3A 1JB2A 3SVAA 1AV4A 3CCL3 3CMA3 3KSPA 3CCQ3 1PYLA 3GWRA 3GAXA 1GMQA 3NUVA 3X3XA 4HZBB 5AYSC 4K61A 3G8ZA 3JUQA 3LYGA 4G1MB 3HX8A 2PNCA 3WMDA 5KP1A 3KFQC 1W2ZA 1W4NA 1VQN3 2YFJB 4HOHA 1YGWA 1FGMA 1BUJA 3F7XA 1UGIA 3KN4A 1JZOA 1KSIA 2OQEC 5CXOA 4R9LA 4FMDA 3EN1B 1B2SA 1WNHA 3OW22 4ZM8A 1YI23 2B24B 1BANA 1CYVA 1BSEA 1JRQA 1MWTA 1UGHI 2F5WA 1VQ53 4MMXB 2KF4A 1X1WA 4AKZA 1Q7HA 1DVCA 1BNRA 1K9M4 2SARA 1LVNA 1JBSA 3EJVA 2CC3A 1EG9B 2OOVC 2BU4A 3RGAA 4FMBA 1W5ZA 1IT8A 3DGLA 4L8OA 5G1KA 4EXRA 4LYLB 1OHOA 3EX9A 4HM2B 1N5PA 1S723 1FW7A 1BNIA 4HYZA 1V74A 2D42A 4BTWA 1IU7A 3NV0A 2LQVA 3DXOA 2XRXB 3H3HA 3GZBA 4XB5A 3QRDA 4GHOA 5IG4A 3BNCA 4MMYB 1V57A 3CNXA 4BL3A 1SIIA 3MG2A 1RMSA 3G4S3 4ILFA 2CG0A 3A5EA 1RN4A 1RGCA 1B20A 4HM0B 4L7KA 1B3SA 1GOUA 1I70A 1B21A 3JUMA 1BNJA 1DYUA 2IYJA 4WFOA 4KVHA 3CCM3 3AGOA 3I0YA 1Q7Y4 3S5CA 6STDA 1ZS7A 5CF1A 6RNTA 1B2UA 4K1VA 2MF7A 3EQQB 5GSPA 1TJDA 3D79A 3NBBA 2E2TA 1HYFA 5IEPA 2XR8B 2YFIB 1LOXA 2SBLA 3VSYA 1B2XA 2W04A 3HK4A 1JBRA 3NHXA 1R4CA 1X1UA 5RNTA 3STDA 4NHFA 2UGIA 3KKGA 5M19A 1VQP3 2AADA 3S29A 1KD14 1OCVA 1DETA 3SOAA 1NB3I 2GSPA 4XDWA 2IY2A 1T2IA 3WDGB 1GMRA 2F4YA 2GU1A 3QK9A 3MYTA 1AY7A 7RNTA 1Q40A 3IPTA 2HMLB 1BRHA 3A76A 4KFDA 5A0OB 2HMOB 2XEPA 3PCSA 1GS3A 3LH4A 4X2HA 2QIYA 4BTYA 3CCS3 4GSPA 3CCU3 1Q824 3GSPA 1R4YA 5IG5A 2CX0A 2CX1A 1TIJA 3G6E3 1I0VA 2KF6A 4XBTA 2BT3A 3CME3 2CW9A 2RBIA 3NBJA 1VQ73 3X42A 1LRAA 2PZVA 4EBGA 1FGOA 1LNHA 2CWUA 1TRQA 7STDA 1RCLA 1LQMB 2Z76A 1O7PB 1IK3A 1W7CA 2OCTA 3EC9A 2HMJB 3URPA 4HM7B 3ZG0A 1Q814 4R9KA 3L0RA 1E97A 4NREA 1LOWA 3UL6A 2RNTA 1WQLB 3DMCA 4DKIA 2GU3A 3WOEB 2GBXB 1YHQ3 3LT9A 1W00A 1GY6A 1N8QA 3RGRA 3WOFB 5JPPA 4GB5A 2C10A 2L4VA 1KWIA 1O7HB 2CFKA 2V1LA 3F7SA 3FLJA 3SX1A 2E2VA 3OWUA 1YJW3 1M9GA 1ULJB 4AKYA 1G0TA 2BMRB 1QJGA 2HMNB 2O3OA 1JKGB 3JUOA 1IQ8A 3CXC2 3RNTA 1CYUA 1PFPA 4JF8A 1GOYA 3AMOA 1T5YA 1QVG2 2CHCA 4N6NB 1BRIA 2K54A 3O8YA 4BU4A 1W01A 2P0MA 3K7CA 5CF2A 4GL6A 1DE3A 2Z6BA 3DGMA 1SQWA 1RHLA 1W6GA 4LSOA 1TFKA 2KF5A 3F8XA 1FUSA 3OWYA 1VQ93 2CFDA 4R4KA 5HGRA 3WA3A 3EF8A 2HMMB 4FCZA 3OWSA 5IW9A 4FCMA
chains in the Genus database with same CATH topology
1I0XA 1AQZA 1HZ1A 1RMSA 1BOXA 1RGKA 3A5EA 1RN4A 1C54A 1RGCA 1B20A 3Q3FA 5HOHA 1BSCA 1BSDA 1B3SA 3AHSA 1GOUA 1I70A 1B21A 1RSNA 1BNJA 1RGGA 1IYYA 3AHWA 3AGOA 1RCKA 3BU4A 2C4BA 6RNTA 1B2UA 1RDSA 9RNTA 3D5IA 1MGWA 5GSPA 3HOHA 1YVSA 1HYFA 1PY3A 1B2XA 1JBRA 1BGSA 1X1UA 1SARA 5RNTA 1X1YA 1UCIA 1RGAA 2AADA 5BU4A 1DETA 1GSPA 1UCKA 1LOYA 2GSPA 1BSAA 1T2IA 1LOVA 3BIRA 3DGYA 1GMRA 2F4YA 1A2PA 1AY7A 1RGFA 1RNTA 3SYUA 7RNTA 1BRHA 1JBTA 1G02A 1I2GA 7GSPA 1LNIA 4GSPA 1GOVA 1ZGXA 2HOHA 1BAOA 3GSPA 1R4YA 1B2ZA 1RNBA 1BRSA 3D5GA 1BVIA 2F56A 1GMPA 1I0VA 2KF6A 2RBIA 1LRAA 1CH0A 3WHOA 1BNFA 1TRQA 1RCLA 1BRJA 1UCLA 1I2FA 1RN1A 1RTUA 3URPA 1FUTA 4J5GA 3AGNA 5BIRA 1PYLA 1GMQA 1LOWA 2RNTA 3D4AA 1I3FA 6GSPA 4J5KA 1MGRA 1RLSA 1I2EA 1B27A 2BIRA 4HOHA 1YGWA 1BUJA 8RNTA 1BNEA 1YNVX 2KF3A 1B2SA 1BRKA 1TTOA 1BNGA 1I8VA 1BANA 3RNTA 1BSEA 1B2MA 1BRNL 2F5WA 1RGHA 1GOYA 1BIRA 1X1XA 2KF4A 1BU4A 1X1WA 1BRIA 1BNRA 1BNSA 1BSBA 1TRPA 1FZUA 1I3IA 2SARA 4RNTA 4BU4A 1JBSA 1UCJA 4BIRA 1DE3A 1FYSA 2BU4A 1BRGA 2ZA4A 2F5MA 2AAEA 1RHLA 3KCHA 1BNIA 1FW7A 1RGLA 2KF5A 3DH2A 1FUSA 1Q9EA 1T2HA 1RGEA 4HAAA 3WR2A 4GHOA 2KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I0X A;  1AQZ A;  1HZ1 A;  1RMS A;  1BOX A;  1RGK A;  3A5E A;  1RN4 A;  1C54 A;  1RGC A;  1B20 A;  3Q3F A;  5HOH A;  1BSC A;  1BSD A;  1B3S A;  3AHS A;  1GOU A;  1I70 A;  1B21 A;  1RSN A;  1BNJ A;  1RGG A;  1IYY A;  3AHW A;  3AGO A;  1RCK A;  3BU4 A;  2C4B A;  6RNT A;  1B2U A;  1RDS A;  9RNT A;  3D5I A;  1MGW A;  5GSP A;  3HOH A;  1YVS A;  1HYF A;  1PY3 A;  1B2X A;  1JBR A;  1BGS A;  1X1U A;  1SAR A;  5RNT A;  1X1Y A;  1UCI A;  1RGA A;  2AAD A;  5BU4 A;  1DET A;  1GSP A;  1UCK A;  1LOY A;  2GSP A;  1BSA A;  1T2I A;  1LOV A;  3BIR A;  3DGY A;  1GMR A;  2F4Y A;  1A2P A;  1AY7 A;  1RGF A;  1RNT A;  3SYU A;  7RNT A;  1BRH A;  1JBT A;  1G02 A;  1I2G A;  7GSP A;  1LNI A;  4GSP A;  1GOV A;  1ZGX A;  2HOH A;  1BAO A;  3GSP A;  1R4Y A;  1B2Z A;  1RNB A;  1BRS A;  3D5G A;  1BVI A;  2F56 A;  1GMP A;  1I0V A;  2KF6 A;  2RBI A;  1LRA A;  1CH0 A;  3WHO A;  1BNF A;  1TRQ A;  1RCL A;  1BRJ A;  1UCL A;  1I2F A;  1RN1 A;  1RTU A;  3URP A;  1FUT A;  4J5G A;  3AGN A;  5BIR A;  1PYL A;  1GMQ A;  1LOW A;  2RNT A;  3D4A A;  1I3F A;  6GSP A;  4J5K A;  1MGR A;  1RLS A;  1I2E A;  1B27 A;  2BIR A;  4HOH A;  1YGW A;  1BUJ A;  8RNT A;  1BNE A;  1YNV X;  2KF3 A;  1B2S A;  1BRK A;  1TTO A;  1BNG A;  1I8V A;  1BAN A;  3RNT A;  1BSE A;  1B2M A;  1BRN L;  2F5W A;  1RGH A;  1GOY A;  1BIR A;  1X1X A;  2KF4 A;  1BU4 A;  1X1W A;  1BRI A;  1BNR A;  1BNS A;  1BSB A;  1TRP A;  1FZU A;  1I3I A;  2SAR A;  4RNT A;  4BU4 A;  1JBS A;  1UCJ A;  4BIR A;  1DE3 A;  1FYS A;  2BU4 A;  1BRG A;  2ZA4 A;  2F5M A;  2AAE A;  1RHL A;  3KCH A;  1BNI A;  1FW7 A;  1RGL A;  2KF5 A;  3DH2 A;  1FUS A;  1Q9E A;  1T2H A;  1RGE A;  4HAA A;  3WR2 A;  4GHO A;  2KAA A; 
#chains in the Genus database with same CATH topology
 2LYX A;  2XFS A;  2OTJ 3;  3CPO A;  3B4P A;  1HZ1 A;  1G96 A;  1MOL A;  4I5Q A;  2IUJ A;  4BL2 A;  1NU3 A;  1YJN 3;  1ZO2 A;  1IDP A;  4FCJ A;  1YGE A;  3DUK A;  1UI8 A;  1C54 A;  3T8N A;  3UB1 A;  3B7C A;  3FF2 A;  1FGQ A;  1GYB A;  1WMO A;  1BSC A;  2F99 A;  3FG3 A;  4O3V A;  1J2B A;  1EQK A;  1VZZ A;  3K9M C;  4WWU C;  2WO0 A;  3UL5 A;  4CDL A;  1RGG A;  1VQO 3;  1IYY A;  1OHP A;  1GY5 A;  1M1K 4;  2CIU A;  3BU4 A;  1QAL A;  2GEY A;  1RDS A;  1DVD A;  1K8A 4;  9RNT A;  4FMC A;  2HMK B;  4HM6 B;  1RN7 A;  1TP6 A;  3KE7 A;  1FGT A;  4R1K A;  4I4K A;  5DRE A;  1QMA A;  1K41 A;  1UI7 A;  5IF6 A;  3Q1C A;  3CD6 3;  1SJW A;  4MEI A;  1BGS A;  4LZI A;  3PXM A;  1LXE A;  2BMO B;  3T8U A;  1VQK 3;  2BMQ B;  5ELU A;  3EE1 A;  1RGA A;  2IA7 A;  3KSE D;  3ECF A;  4U13 A;  4X2O A;  3UNL A;  4CJN A;  2KRT A;  3BIR A;  3HIG A;  3DGY A;  4HZ9 B;  4N6O B;  1RGF A;  1RNT A;  1E3R A;  2XSO B;  3G0K A;  4HM4 B;  5G1L A;  3SYU A;  3CC7 3;  2A15 A;  1O7M B;  1A2V A;  1JN5 B;  1G02 A;  2RCD A;  3EBY A;  1AVK A;  3D3L A;  1LNI A;  3LTC A;  5IEO A;  2W56 B;  3LTB A;  3BND A;  4LGQ A;  3E99 A;  1AVL A;  5FGO A;  4OVM A;  1B2Z A;  5AII A;  2QEX 3;  1SIH A;  4HM8 B;  1RNB A;  1SPU A;  3X41 A;  2CFG A;  4HM5 B;  1D6U A;  3FGY A;  4RBN A;  3K5T A;  2CKF B;  3KZT A;  4LEH A;  5IG0 A;  1NO3 A;  4N6L A;  4BTX A;  4EV5 A;  1ASK A;  5AEU B;  1O7G B;  1YJ9 3;  1L5G B;  1IVW A;  2F98 A;  1CH0 A;  2I9W A;  3NM7 A;  3WHO A;  3B4O A;  3JUP A;  1NJI 4;  1GY7 A;  1IVX A;  1I2F A;  2XSH B;  1RTU A;  4RNY A;  4MJD A;  4HM3 B;  5BXQ A;  3CC2 3;  1UUW B;  3WA2 X;  2P38 A;  3CC4 3;  3H51 A;  3MHE A;  4OK0 A;  5IEN A;  4JRF A;  5FW5 A;  5JBS A;  1I3F A;  1IVU A;  1WMP A;  4J5K A;  2MC8 A;  1I2E A;  1KC8 4;  1B27 A;  2BIR A;  1ULI B;  3MG3 A;  4TX4 A;  5AI1 A;  1D6Z A;  8RNT A;  2F86 B;  1BNE A;  1CEW I;  5ELJ A;  2OOV A;  5BVB A;  3FZW A;  1K28 A;  4WYK B;  1BRK A;  2RGQ A;  3S28 A;  4EV2 A;  1BNG A;  3F40 A;  2IUK A;  3DM8 A;  4KZ1 A;  1BRN L;  3DZL A;  1RGH A;  1X1X A;  1BU4 A;  3GRD A;  2H0G A;  5AIF A;  2K0M A;  5AIG A;  1TRP A;  4J8T A;  4RNT A;  4STD A;  1EEJ A;  3LOY A;  3S27 A;  3X3Y A;  2XFT A;  4ORL A;  1U5O A;  3ROB A;  4FMA A;  2CFL A;  2FGT A;  2JQ5 A;  3B8L A;  3J7Y d;  2Z7A A;  5EEO A;  5JPU A;  4HBR A;  1D6Y A;  2W9Q A;  2XGL A;  3DH2 A;  3GZR A;  4N3V A;  4NPB A;  5CLK A;  5EQL A;  1YIT 3;  3N8B A;  1VQ6 3;  4H3U A;  1Q86 4;  1T2H A;  4HAA A;  4KT3 B;  3WR2 A;  5KP4 A;  2KAA A;  2QGU A;  1I0X A;  2KXG A;  3NM2 A;  4LMI A;  1UUG B;  1AQZ A;  1O7N B;  1IV9 A;  1JN5 A;  4PEJ A;  4EC6 A;  4EW5 A;  1BOX A;  3FH1 A;  2ZL8 A;  1A90 A;  1EA2 A;  3HI7 A;  3Q3F A;  3CCV 3;  1ZX2 A;  2WOF A;  3NV0 B;  4FR9 A;  2CK3 H;  3BNB A;  3AHS A;  3MPH A;  3NXJ A;  1JJ2 2;  1FUW A;  1C7H A;  1A2K A;  3AHW A;  3GZY B;  1NB5 I;  3PS8 A;  5G2G A;  3NX0 A;  2R4I A;  1MWU A;  3DGO A;  2O9U X;  1VQQ A;  2UX0 A;  3SOY A;  4HKV B;  3D5I A;  1JNQ A;  2H0H A;  1MGW A;  1IQY A;  3JVC A;  4RNZ A;  3RDE A;  3V92 A;  5M18 A;  2UUG C;  5I97 A;  1GD3 A;  1W2B 2;  1YVS A;  1PY3 A;  1AR0 A;  5AEW B;  2W2C A;  1OPY A;  4IT7 A;  4EYC A;  2YX9 A;  1EKM A;  1JZD A;  4K90 B;  1SAR A;  4N6M A;  1PU4 A;  4O2H A;  2BNG A;  2XGN A;  1GSP A;  1N9E A;  1UCK A;  1LOY A;  5AYR B;  2XH9 A;  1BSA A;  1LOV A;  1Y4K A;  5AIH A;  1A2P A;  4WYK A;  4HVN A;  1CQS A;  1JBT A;  1I2G A;  3LT8 A;  3V99 A;  3FCS B;  3NQZ A;  3CCE 3;  1IV7 A;  1GOV A;  1OF5 B;  3OX9 A;  3NQY A;  2Y73 A;  2HOH A;  1BAO A;  3HII A;  4MMZ B;  4QWT A;  4XM4 A;  1RJO A;  2STD A;  1OAC A;  3EN8 A;  3PCR A;  3LTA A;  1Q40 B;  1BRS A;  3FG1 A;  3UJM A;  1OGX A;  1E3V A;  3D5G A;  1BVI A;  1QAF A;  1UUV B;  1RRH A;  2F56 A;  2RSX A;  3FF0 A;  3LZA A;  4O02 B;  4O8S A;  5D83 A;  1GMP A;  1T3B A;  4N6T A;  3TDG A;  2P09 A;  3I55 3;  2RFR A;  1IT7 A;  3KII A;  3MG1 A;  4HM1 B;  1BNF A;  4AEQ A;  2J8X B;  2FXT A;  2WOH A;  4L8P A;  2JDI H;  2CG1 A;  3HZP A;  2BHM A;  1F8N A;  2GEX A;  3AGN A;  4XDV A;  2WGQ A;  5BIR A;  3ER7 A;  1JKG A;  1Z1S A;  2KCD A;  1NNV A;  1N5H A;  1OUN A;  1UDI I;  3D4A A;  3U1W A;  1K73 4;  6GSP A;  2ZDJ A;  1MGR A;  1RLS A;  3PGB A;  3FG4 A;  1JB4 A;  2L1S A;  5LC6 A;  1FA3 A;  1W02 A;  2WGO A;  2YFL B;  1IQX A;  1YNV X;  1W6C A;  4N6V 0;  3S67 A;  3NBR A;  3VGN A;  4KFF A;  2KF3 A;  3ZFZ A;  3LXU X;  1TTO A;  3PYJ A;  3G71 3;  4OUQ A;  2CH9 A;  2ML6 A;  1I8V A;  3BB9 A;  1B2M A;  4N6U A;  4CCV A;  2E2U A;  1DMN A;  2K3D A;  1BIR A;  4H61 A;  2W03 A;  1OGZ A;  5D82 A;  1GD4 A;  3EB8 A;  1BNS A;  1BSB A;  1FZU A;  1I3I A;  1UCJ A;  4BIR A;  1W6Y A;  1FYS A;  3G16 A;  3M8C A;  2OQE A;  1BRG A;  5M1A A;  2ZA4 A;  1FGR A;  2F5M A;  2AAE A;  3F8H A;  3MKI A;  1WTH A;  3OXA A;  5CK6 A;  3X3Z A;  2OWP A;  3CCJ 3;  3AMO B;  3KCH A;  1RGL A;  4WHA A;  3WOD G;  2CWT A;  4KFE A;  5TGN A;  4RZM A;  1Q9E A;  3FSD A;  1Q42 A;  2R41 A;  1NWW A;  5IG3 A;  5DRV A;  1S5A A;  1RGE A;  3EHC A;  3CU3 A;  1ROA A;  1RKY A;  2P0X A;  1MWR A;  3CNM A;  4J9A A;  1RGK A;  1WMN A;  1EUI C;  1OF5 A;  2CFW A;  5HOH A;  1KQS 2;  4IPB A;  1BSD A;  1JV2 B;  3N54 B;  1RSN A;  3D9R A;  3I56 3;  3GZX B;  3Q90 A;  5STD A;  3ALA A;  1RCK A;  2INX A;  2W9P A;  2C4B A;  1QAK A;  2W0Q A;  3F9S A;  2Z77 A;  3DY5 A;  3U97 A;  3CPW 2;  2QA4 3;  1M1X B;  1MNL A;  1TUH A;  4WP5 A;  5EVH A;  3CCR 3;  2BO9 B;  3HOH A;  1STD A;  1VQM 3;  3OV4 A;  3SXX A;  2P05 A;  1STF I;  3EBT A;  2IMJ A;  3K63 A;  2C11 A;  1VQL 3;  2XF3 A;  3DGN A;  3F14 A;  3BNE A;  3LTD A;  1VQ8 3;  1TFO A;  1X1Y A;  1HKX A;  1UCI A;  1HU9 A;  1U8C B;  2D1W A;  2ML5 A;  4IIA A;  1YIJ 3;  4HJL B;  5IER A;  5BU4 A;  2GXF A;  3Q2P A;  4CPK A;  8CHO A;  3K0Z A;  1ISK A;  2OTL 3;  2CWV A;  2W56 A;  1V58 A;  4R80 A;  1DMQ A;  1A67 A;  4XBX A;  3T0U A;  3V98 A;  4Q53 A;  3LML A;  1JB5 A;  3BLZ A;  1M90 4;  2Y74 A;  1TU5 A;  1OHS A;  3IJE B;  3N9H A;  1N8R 4;  5D81 A;  2M7O A;  1VQ4 3;  3PZW A;  3FKA A;  2FNQ A;  3X40 A;  3VF1 A;  7GSP A;  2W6J H;  3JUN A;  1ZGX A;  3ZG5 A;  1NDO B;  4XBY A;  1UW1 A;  3MSO A;  1MWS A;  1N9J A;  2H0I A;  2Q07 A;  1YVB I;  1O7W B;  2B1X B;  4K1U A;  2GBW B;  1US1 A;  2ZHX B;  3MWZ A;  3IMA B;  1RRL A;  3SLU A;  1OH0 A;  1ROV A;  3SED A;  5LC7 A;  1IVV A;  1BRJ A;  1UCL A;  1LQG C;  1BUQ A;  1DMM A;  1QVF 2;  1RN1 A;  1FUT A;  4J5G A;  5KP3 A;  1JB2 A;  3SVA A;  1AV4 A;  3CCL 3;  3CMA 3;  3KSP A;  3CCQ 3;  1PYL A;  3GWR A;  3GAX A;  1GMQ A;  3NUV A;  3X3X A;  4HZB B;  5AYS C;  4K61 A;  3G8Z A;  3JUQ A;  3LYG A;  4G1M B;  3HX8 A;  2PNC A;  3WMD A;  5KP1 A;  3KFQ C;  1W2Z A;  1W4N A;  1VQN 3;  2YFJ B;  4HOH A;  1YGW A;  1FGM A;  1BUJ A;  3F7X A;  1UGI A;  3KN4 A;  1JZO A;  1KSI A;  2OQE C;  5CXO A;  4R9L A;  4FMD A;  3EN1 B;  1B2S A;  1WNH A;  3OW2 2;  4ZM8 A;  1YI2 3;  2B24 B;  1BAN A;  1CYV A;  1BSE A;  1JRQ A;  1MWT A;  1UGH I;  2F5W A;  1VQ5 3;  4MMX B;  2KF4 A;  1X1W A;  4AKZ A;  1Q7H A;  1DVC A;  1BNR A;  1K9M 4;  2SAR A;  1LVN A;  1JBS A;  3EJV A;  2CC3 A;  1EG9 B;  2OOV C;  2BU4 A;  3RGA A;  4FMB A;  1W5Z A;  1IT8 A;  3DGL A;  4L8O A;  5G1K A;  4EXR A;  4LYL B;  1OHO A;  3EX9 A;  4HM2 B;  1N5P A;  1S72 3;  1FW7 A;  1BNI A;  4HYZ A;  1V74 A;  2D42 A;  4BTW A;  1IU7 A;  3NV0 A;  2LQV A;  3DXO A;  2XRX B;  3H3H A;  3GZB A;  4XB5 A;  3QRD A;  4GHO A;  5IG4 A;  3BNC A;  4MMY B;  1V57 A;  3CNX A;  4BL3 A;  1SII A;  3MG2 A;  1RMS A;  3G4S 3;  4ILF A;  2CG0 A;  3A5E A;  1RN4 A;  1RGC A;  1B20 A;  4HM0 B;  4L7K A;  1B3S A;  1GOU A;  1I70 A;  1B21 A;  3JUM A;  1BNJ A;  1DYU A;  2IYJ A;  4WFO A;  4KVH A;  3CCM 3;  3AGO A;  3I0Y A;  1Q7Y 4;  3S5C A;  6STD A;  1ZS7 A;  5CF1 A;  6RNT A;  1B2U A;  4K1V A;  2MF7 A;  3EQQ B;  5GSP A;  1TJD A;  3D79 A;  3NBB A;  2E2T A;  1HYF A;  5IEP A;  2XR8 B;  2YFI B;  1LOX A;  2SBL A;  3VSY A;  1B2X A;  2W04 A;  3HK4 A;  1JBR A;  3NHX A;  1R4C A;  1X1U A;  5RNT A;  3STD A;  4NHF A;  2UGI A;  3KKG A;  5M19 A;  1VQP 3;  2AAD A;  3S29 A;  1KD1 4;  1OCV A;  1DET A;  3SOA A;  1NB3 I;  2GSP A;  4XDW A;  2IY2 A;  1T2I A;  3WDG B;  1GMR A;  2F4Y A;  2GU1 A;  3QK9 A;  3MYT A;  1AY7 A;  7RNT A;  1Q40 A;  3IPT A;  2HML B;  1BRH A;  3A76 A;  4KFD A;  5A0O B;  2HMO B;  2XEP A;  3PCS A;  1GS3 A;  3LH4 A;  4X2H A;  2QIY A;  4BTY A;  3CCS 3;  4GSP A;  3CCU 3;  1Q82 4;  3GSP A;  1R4Y A;  5IG5 A;  2CX0 A;  2CX1 A;  1TIJ A;  3G6E 3;  1I0V A;  2KF6 A;  4XBT A;  2BT3 A;  3CME 3;  2CW9 A;  2RBI A;  3NBJ A;  1VQ7 3;  3X42 A;  1LRA A;  2PZV A;  4EBG A;  1FGO A;  1LNH A;  2CWU A;  1TRQ A;  7STD A;  1RCL A;  1LQM B;  2Z76 A;  1O7P B;  1IK3 A;  1W7C A;  2OCT A;  3EC9 A;  2HMJ B;  3URP A;  4HM7 B;  3ZG0 A;  1Q81 4;  4R9K A;  3L0R A;  1E97 A;  4NRE A;  1LOW A;  3UL6 A;  2RNT A;  1WQL B;  3DMC A;  4DKI A;  2GU3 A;  3WOE B;  2GBX B;  1YHQ 3;  3LT9 A;  1W00 A;  1GY6 A;  1N8Q A;  3RGR A;  3WOF B;  5JPP A;  4GB5 A;  2C10 A;  2L4V A;  1KWI A;  1O7H B;  2CFK A;  2V1L A;  3F7S A;  3FLJ A;  3SX1 A;  2E2V A;  3OWU A;  1YJW 3;  1M9G A;  1ULJ B;  4AKY A;  1G0T A;  2BMR B;  1QJG A;  2HMN B;  2O3O A;  1JKG B;  3JUO A;  1IQ8 A;  3CXC 2;  3RNT A;  1CYU A;  1PFP A;  4JF8 A;  1GOY A;  3AMO A;  1T5Y A;  1QVG 2;  2CHC A;  4N6N B;  1BRI A;  2K54 A;  3O8Y A;  4BU4 A;  1W01 A;  2P0M A;  3K7C A;  5CF2 A;  4GL6 A;  1DE3 A;  2Z6B A;  3DGM A;  1SQW A;  1RHL A;  1W6G A;  4LSO A;  1TFK A;  2KF5 A;  3F8X A;  1FUS A;  3OWY A;  1VQ9 3;  2CFD A;  4R4K A;  5HGR A;  3WA3 A;  3EF8 A;  2HMM B;  4FCZ A;  3OWS A;  5IW9 A;  4FCM A; 
#chains in the Genus database with same CATH homology
 1I0X A;  1AQZ A;  1HZ1 A;  1RMS A;  1BOX A;  1RGK A;  3A5E A;  1RN4 A;  1C54 A;  1RGC A;  1B20 A;  3Q3F A;  5HOH A;  1BSC A;  1BSD A;  1B3S A;  3AHS A;  1GOU A;  1I70 A;  1B21 A;  1RSN A;  1BNJ A;  1RGG A;  1IYY A;  3AHW A;  3AGO A;  1RCK A;  3BU4 A;  2C4B A;  6RNT A;  1B2U A;  1RDS A;  9RNT A;  3D5I A;  1MGW A;  5GSP A;  3HOH A;  1YVS A;  1HYF A;  1PY3 A;  1B2X A;  1JBR A;  1BGS A;  1X1U A;  1SAR A;  5RNT A;  1X1Y A;  1UCI A;  1RGA A;  2AAD A;  5BU4 A;  1DET A;  1GSP A;  1UCK A;  1LOY A;  2GSP A;  1BSA A;  1T2I A;  1LOV A;  3BIR A;  3DGY A;  1GMR A;  2F4Y A;  1A2P A;  1AY7 A;  1RGF A;  1RNT A;  3SYU A;  7RNT A;  1BRH A;  1JBT A;  1G02 A;  1I2G A;  7GSP A;  1LNI A;  4GSP A;  1GOV A;  1ZGX A;  2HOH A;  1BAO A;  3GSP A;  1R4Y A;  1B2Z A;  1RNB A;  1BRS A;  3D5G A;  1BVI A;  2F56 A;  1GMP A;  1I0V A;  2KF6 A;  2RBI A;  1LRA A;  1CH0 A;  3WHO A;  1BNF A;  1TRQ A;  1RCL A;  1BRJ A;  1UCL A;  1I2F A;  1RN1 A;  1RTU A;  3URP A;  1FUT A;  4J5G A;  3AGN A;  5BIR A;  1PYL A;  1GMQ A;  1LOW A;  2RNT A;  3D4A A;  1I3F A;  6GSP A;  4J5K A;  1MGR A;  1RLS A;  1I2E A;  1B27 A;  2BIR A;  4HOH A;  1YGW A;  1BUJ A;  8RNT A;  1BNE A;  1YNV X;  2KF3 A;  1B2S A;  1BRK A;  1TTO A;  1BNG A;  1I8V A;  1BAN A;  3RNT A;  1BSE A;  1B2M A;  1BRN L;  2F5W A;  1RGH A;  1GOY A;  1BIR A;  1X1X A;  2KF4 A;  1BU4 A;  1X1W A;  1BRI A;  1BNR A;  1BNS A;  1BSB A;  1TRP A;  1FZU A;  1I3I A;  2SAR A;  4RNT A;  4BU4 A;  1JBS A;  1UCJ A;  4BIR A;  1DE3 A;  1FYS A;  2BU4 A;  1BRG A;  2ZA4 A;  2F5M A;  2AAE A;  1RHL A;  3KCH A;  1BNI A;  1FW7 A;  1RGL A;  2KF5 A;  3DH2 A;  1FUS A;  1Q9E A;  1T2H A;  1RGE A;  4HAA A;  3WR2 A;  4GHO A;  2KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...