5RNTA

X-ray analysis of cubic crystals of the complex formed between ribonuclease t1 and guanosine-3',5'-bisphosphate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
104
structure length
104
Chain Sequence
b'ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title X-ray analysis of cubic crystals of the complex formed between ribonuclease T1 and guanosine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase(endoribonuclease)
total genus 21
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1991-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5rntA00
1BU4A 1HYFA 3AHWA 1B21A 1BRJA 5BIRA 1BVIA 2SARA 1FW7A 1GMRA 1MGWA 3RNTA 6RNTA 1TRPA 1BRIA 1RDSA 9RNTA 1BRHA 1UCLA 1RN4A 1B2UA 1PY3A 3D5IA 3URPA 1YVSA 1FUTA 1BNRA 1UCKA 4J5KA 3AHSA 5BU4A 1I3FA 1CH0A 1BSDA 1BSAA 8RNTA 4HOHA 1A2PA 2C4BA 1RGKA 2F5MA 1AY7A 1GMQA 1GOYA 2GSPA 1LNIA 1TRQA 1BNJA 2BIRA 2BU4A 3D4AA 1BNFA 1RGEA 2F4YA 1RCKA 1PYLA 1YNVX 2F5WA 1RSNA 5GSPA 1LRAA 1RN1A 1B2SA 5RNTA 2KF4A 1YGWA 1LOWA 1BSEA 1LOYA 1IYYA 1I3IA 1BNIA 1I2EA 1RCLA 1RGFA 1RGCA 2AAEA 1FYSA 1FZUA 1B2ZA 1R4YA 1RHLA 1RLSA 1MGRA 7RNTA 3BU4A 4HAAA 1JBRA 4BIRA 2HOHA 2ZA4A 1TTOA 1DETA 1X1YA 2RNTA 1BAOA 1I2GA 1HZ1A 3BIRA 3D5GA 1BANA 1DE3A 1GSPA 1I0XA 1SARA 1T2HA 1BRNL 1I2FA 1GOVA 3GSPA 1BSBA 1AQZA 1BGSA 1RTUA 1G02A 1RGHA 4BU4A 3WR2A 1I0VA 3WHOA 2AADA 1BSCA 2KF3A 3Q3FA 1B3SA 1UCIA 4RNTA 1UCJA 3A5EA 3HOHA 1JBTA 1C54A 1BNGA 4GSPA 1T2IA 1BOXA 2F56A 3DGYA 4GHOA 1JBSA 1BRKA 7GSPA 1RNBA 4J5GA 1LOVA 3DH2A 6GSPA 1RGAA 1FUSA 1GMPA 1X1WA 1I70A 2KF6A 1I8VA 3AGNA 1B20A 1B2MA 1RGGA 1BNSA 1BRSA 1X1UA 1BIRA 1BNEA 3AGOA 2KAAA 5HOHA 1RGLA 1GOUA 1RMSA 3SYUA 1ZGXA 3KCHA 1B2XA 2RBIA 1X1XA 1BUJA 1B27A 1RNTA 1Q9EA 1BRGA 2KF5A
chains in the Genus database with same CATH superfamily
3F7XA 4O3VA 2GU3A 3EN8A 1HYFA 2H0HA 3AHWA 1WMOA 4KZ1A 1BRJA 1LOXA 1GS3A 5DRVA 1GMRA 1FGTA 3LTDA 3RNTA 2HMJB 4HZ9B 1NB3I 1TRPA 2J8XB 1YI23 9RNTA 1BRHA 3D5IA 1RN4A 1G0TA 1KC84 3URPA 1NDOB 1U8CB 4LMIA 4MEIA 1QALA 3NBJA 1BNRA 1QMAA 1I3FA 2O9UX 1BSDA 1BSAA 1IQXA 3BNCA 4MJDA 5FGOA 1OGXA 2P0MA 5G1LA 3U1WA 1MWUA 1Q864 1RGKA 1AY7A 4N6NB 4I4KA 3EC9A 1JNQA 2GSPA 1TRQA 1WMNA 2Z77A 4L8PA 2F99A 2H0GA 1D6UA 4LSOA 4WP5A 2WO0A 1IT8A 1J2BA 1JN5B 1EUIC 1SIIA 1DYUA 3KKGA 1RN7A 2XF3A 3X42A 2WOFA 1MWRA 1EKMA 1RGEA 3CU3A 2C10A 3PCRA 3G4S3 1PYLA 5CK6A 4RNZA 1ZX2A 1B2SA 1O7NB 2HMLB 1Q824 1AV4A 2KRTA 3K63A 2BO9B 1LOYA 1BSEA 3G0KA 3B8LA 1I3IA 1I2EA 1UW1A 3DZLA 3PCSA 1KQS2 3ROBA 3M8CA 3VGNA 1U5OA 3AMOB 4XDWA 3TDGA 4AKYA 1R4YA 4EV5A 4LEHA 4N6LA 4BTWA 2ZDJA 5EQLA 5IG5A 3KZTA 1VZZA 4U13A 1W7CA 2IUJA 3B7CA 4N6OB 6STDA 1MGRA 2A15A 1W5ZA 3CMA3 1OHOA 1Q7HA 4FMCA 3NM2A 4HVNA 3NX0A 3BNEA 4HKVB 3GWRA 5D83A 4XB5A 1NU3A 5M19A 3CCR3 1IQYA 1QVF2 3QK9A 3EN1B 4N3VA 4EBGA 1N9EA 2D42A 3WODG 1ASKA 1DE3A 1SARA 2Z7AA 5EEOA 1IVXA 1I2FA 1DVCA 1JZOA 3MPHA 3RGRA 2WGOA 3IMAB 1BGSA 1G02A 1PFPA 2QIYA 2QA43 1VQO3 2GEYA 3BNBA 3L0RA 4H3UA 3PXMA 4LYLB 1MNLA 3PZWA 3WHOA 5IW9A 2AADA 1BSCA 1VQK3 3BNDA 3OW22 2ZL8A 2CFDA 1RRLA 3G6E3 3H51A 1Q814 1W01A 4CCVA 1FUWA 2HMKB 3HOHA 2W03A 3IJEB 3X3YA 5IEPA 4XBTA 3HK4A 1C54A 1BNGA 1M1XB 4WHAA 1T5YA 5JBSA 3CCQ3 3B4OA 1ZS7A 2F56A 4GHOA 3V98A 1BRKA 3FCSB 4R4KA 3CCM3 1JBSA 3N54B 3B4PA 3G16A 3D3LA 6GSPA 1FUSA 1GMPA 1X1WA 1PU4A 3K9MC 4HM6B 2KF6A 4K61A 4NHFA 4WYKA 1YIJ3 1BRSA 1NO3A 3CPW2 3EBTA 1YJN3 1Y4KA 1RGLA 5M18A 3FG1A 3DGLA 5JPPA 3OWSA 1IVVA 2RCDA 4FCZA 1D6ZA 3KIIA 4NREA 1CYUA 4HM1B 3ER7A 2RBIA 3UJMA 1YIT3 1N5HA 3N9HA 3OX9A 4HM8B 5AYRB 5BXQA 4QWTA 3LXUX 1O7MB 1GD3A 1UGIA 3EHCA 3FGYA 1BU4A 3FSDA 1LVNA 4XM4A 1GD4A 1UI7A 3DY5A 4IPBA 2XR8B 4HM2B 1MGWA 1GYBA 6RNTA 4NPBA 2W2CA 1V74A 1B2UA 1PY3A 1VQ63 1YJW3 1YVSA 3X41A 3LTBA 1FUTA 1GY6A 2XGNA 2CW9A 2XEPA 3EBYA 1W2ZA 3HI7A 4J5KA 1CH0A 4ZM8A 2KCDA 4HOHA 3S28A 2C4BA 3WDGB 1S5AA 1ULIB 1O7HB 2BT3A 4K90B 1E97A 1ULJB 1LNIA 3H3HA 3WOEB 2INXA 1W00A 3SXXA 1OF5A 1SPUA 3WA2X 2STDA 3S29A 2BU4A 3F14A 1ISKA 1RCKA 2M7OA 2GU1A 4LGQA 1N8QA 1YNVX 1YJ93 4FR9A 1RJOA 4FMBA 3KSED 5RNTA 2KF4A 1NJI4 1JB5A 1FGOA 1LOWA 3F9SA 1IYYA 1A2VA 3G8ZA 1RGCA 1BNIA 1CEWI 3NQZA 3NV0A 1FYSA 4KFEA 2CWTA 4EW5A 4MMYB 5IENA 2JQ5A 1RHLA 1K734 4HM5B 1RLSA 1OHSA 3DGOA 3ZG5A 3SOAA 1JB2A 4HAAA 1JBRA 2UX0A 4BIRA 2BNGA 2HOHA 3SEDA 4XDVA 5KP1A 1W4NA 3NXJA 1FGQA 2CWUA 4BTYA 5AIIA 3JUMA 2RFRA 3K0ZA 2RNTA 2V1LA 3CPOA 1AVKA 1GY7A 4RZMA 1IVWA 1I2GA 1K9M4 1IQ8A 3FZWA 1HZ1A 4FMDA 3BIRA 3V92A 2CWVA 1GSPA 1WNHA 2SBLA 1BRNL 3S27A 3T0UA 1HKXA 1BSBA 3EJVA 1ROVA 3FH1A 1JKGA 4KVHA 5AI1A 4AEQA 4HYZA 3WR2A 1FGRA 1I0VA 1IK3A 3VSYA 3LYGA 1UCIA 1VQ43 1TUHA 2W9PA 2XFTA 2XGLA 2OTL3 3EB8A 1EG9B 3KSPA 1MWTA 3N8BA 5STDA 1FA3A 1JV2B 2JDIH 1Z1SA 5EVHA 1OUNA 3CNXA 1OF5B 3HZPA 1BOXA 3A76A 3DGYA 3E99A 7GSPA 5IG0A 4RBNA 4J5GA 3DH2A 1NB5I 2CK3H 3F40A 2D1WA 4J8TA 3T8NA 1RGAA 7STDA 4N6V0 1OHPA 1VQ93 3EX9A 1I8VA 4I5QA 1EEJA 1RGGA 4R9LA 1VQ53 4BL3A 1CQSA 2Y74A 1VQ83 5IF6A 2KAAA 2W9QA 1K41A 1DMNA 5HOHA 4IIAA 4WWUC 5FW5A 3VF1A 3ALAA 3WA3A 4XBYA 3KCHA 3D79A 4WFOA 2OTJ3 1W02A 2CFKA 4O2HA 1BUJA 2UGIA 4HM3B 1TU5A 1STFI 4OUQA 1W6CA 1JB4A 2K0MA 2KF5A 2OQEC 2Q07A 2CG0A 4R1KA 5M1AA 5ELJA 2E2UA 1VQM3 2SARA 3LZAA 1FW7A 1QJGA 3S5CA 1AR0A 1G96A 3K7CA 5BVBA 1BRIA 2CIUA 1UCLA 4JF8A 1LQMB 4JRFA 1DMMA 1JKGB 2Z6BA 4OVMA 5LC7A 3Q2PA 3SLUA 4AKZA 2IYJA 4TX4A 5G2GA 2MF7A 1GOYA 2K3DA 1OPYA 2P38A 3IPTA 1Q42A 1DVDA 1O7GB 1UUVB 3HIGA 2IY2A 1GY5A 3D4AA 3K5TA 1BNFA 3FG4A 2CFGA 1TIJA 1IV9A 1V58A 1N8R4 5LC6A 2ML6A 2LQVA 2F5WA 1K28A 1D6YA 3DMCA 3HX8A 3CCV3 3GRDA 3OWYA 5GSPA 1EQKA 1RN1A 1F8NA 3MHEA 1YGWA 5AYSC 3GZRA 3CCL3 1LQGC 1TFOA 3UL6A 3T8UA 2CKFB 3CC73 1FGMA 2BMOB 3WMDA 4HJLB 2ZHXB 2OOVC 3HIIA 1RGFA 4N6MA 3UB1A 2AAEA 1FZUA 2L4VA 2XH9A 2IA7A 3CC43 1HU9A 1TJDA 4CDLA 8CHOA 2B24B 3PGBA 2C11A 3Q1CA 4EYCA 2I9WA 2PZVA 1UGHI 5AIFA 5G1KA 1YHQ3 4EC6A 5CLKA 2HMNB 3FLJA 3CNMA 2GBXB 3FF0A 3F8HA 2W56A 4HZBB 1T2HA 1OCVA 3RGAA 1GOVA 3GSPA 1AQZA 3SX1A 1IU7A 3BB9A 3JUOA 3CD63 1SIHA 1M9GA 1BUQA 4MMZB 3LMLA 3RDEA 4ILFA 3DXOA 4WYKB 2XFSA 3EE1A 3Q3FA 2KF3A 1B3SA 3X3ZA 1CYVA 1Q40A 1WQLB 3OV4A 4FCMA 4CJNA 4L8OA 2CG1A 3J7Yd 4K1UA 4H61A 1YGEA 2OCTA 3A5EA 4DKIA 5CF2A 1SJWA 1ROAA 4RNYA 1N9JA 4GSPA 1RNBA 2XRXB 2MC8A 3NBBA 1OGZA 3KFQC 2FGTA 3LTCA 3SVAA 4X2OA 3JVCA 3NBRA 4G1MB 2GEXA 1YVBI 2YFJB 4KFDA 3MG2A 1UI8A 1OACA 3AGNA 3V99A 2F98A 2FNQA 1LNHA 1BNSA 5TGNA 2OWPA 3LTAA 1X1UA 5AIHA 4BTXA 3ZG0A 3CCU3 1BIRA 3AGOA 2QEX3 4IT7A 2KXGA 1TFKA 4R9KA 1GOUA 2UUGC 1ZGXA 1B2XA 3BLZA 5ELUA 3KE7A 1X1XA 4FMAA 1B27A 1RNTA 1Q9EA 1BRGA 4STDA 5IERA 2H0IA 1VQ73 4FCJA 1B21A 5BIRA 1BVIA 3S67A 2W56B 4L7KA 5AEWB 2W6JH 4J9AA 1IT7A 1O7PB 1RDSA 2W04A 3GZBA 1IV7A 2YFIB 1LXEA 3UL5A 3CCJ3 1R4CA 2OQEA 1UCKA 1KSIA 3AHSA 1EA2A 2P05A 1MOLA 1T3BA 2XSOB 5D81A 5BU4A 1KD14 1QAFA 1UUGB 2W0QA 2Z76A 8RNTA 3NV0B 1A2PA 3O8YA 1VQQA 2F5MA 2GXFA 1IDPA 1QVG2 1AVLA 1GMQA 3F7SA 2CC3A 2BMRB 4HM4B 1BNJA 1Q40B 3X40A 3I563 2O3OA 1K8A4 2FXTA 2BIRA 3LT9A 3DUKA 5I97A 3DGNA 2F4YA 2E2TA 3GZYB 5IEOA 1US1A 1RSNA 1NNVA 3DM8A 5IG4A 1LRAA 2PNCA 1RRHA 1A67A 2CH9A 3STDA 2QGUA 5IG3A 3U97A 5KP4A 3ZFZA 3F8XA 2B1XB 1RCLA 5HGRA 3G713 1MWSA 1NWWA 5D82A 1VQL3 1UUWB 2F86B 3CCS3 2XSHB 1B2ZA 1QAKA 4KFFA 1Q7Y4 1M904 1VQN3 3FF2A 1E3RA 1W6GA 2BMQB 3FKAA 7RNTA 3PYJA 4HM7B 1L5GB 1VQP3 2CX0A 3BU4A 3JUNA 2OOVA 4CPKA 2ZA4A 3LH4A 1TTOA 1DETA 4N6TA 4KT3B 1X1YA 2CHCA 5DREA 3LOYA 2WGQA 2R4IA 3X3XA 5AEUB 4GB5A 1BAOA 1STDA 3CXC2 1S723 3NUVA 3ECFA 1W6YA 3LT8A 1O7WB 3D5GA 1BANA 1I0XA 2L1SA 3MG1A 3MG3A 1N5PA 1WMPA 3CME3 5A0OB 1IVUA 3NHXA 1A2KA 1RTUA 2K54A 2HMOB 1WTHA 1E3VA 3SOYA 1RGHA 3MSOA 1SQWA 2E2VA 2IUKA 3NQYA 1ZO2A 3MWZA 4K1VA 4BU4A 4BL2A 3EQQB 4X2HA 1UDII 3QRDA 3Q90A 4PEJA 4R80A 3JUPA 4N6UA 1V57A 1JZDA 2GBWB 3FG3A 2CX1A 4RNTA 3GZXB 1W2B2 3CCE3 2R41A 1JN5A 2IMJA 1UCJA 2LYXA 4GL6A 3WOFB 1JRQA 1TP6A 1JBTA 4EXRA 3EF8A 1T2IA 2ML5A 2YFLB 5AIGA 2P09A 4MMXB 3JUQA 2CFWA 1LOVA 2HMMB 5KP3A 4EV2A 3MKIA 4LZIA 4O02B 4Q53A 1I70A 4O8SA 5CXOA 2YX9A 1B20A 3AMOA 3I0YA 3UNLA 1M1K4 1B2MA 3PS8A 2P0XA 3NM7A 3MYTA 5JPUA 2Y73A 3OXAA 2RSXA 4HM0B 4OK0A 2BHMA 1BNEA 2WOHA 3CC23 2CFLA 3KN4A 3OWUA 3DGMA 3I553 4ORLA 1RMSA 3SYUA 4XBXA 3D9RA 2RGQA 1A90A 5CF1A 1KWIA 1JJ22 1DMQA 3GAXA 4HBRA 1OH0A 1C7HA 1RKYA
chains in the Genus database with same CATH topology
1BU4A 1HYFA 3AHWA 1B21A 1BRJA 5BIRA 1BVIA 2SARA 1FW7A 1GMRA 1MGWA 3RNTA 6RNTA 1TRPA 1BRIA 1RDSA 9RNTA 1BRHA 1UCLA 1RN4A 1B2UA 1PY3A 3D5IA 3URPA 1YVSA 1FUTA 1BNRA 1UCKA 4J5KA 3AHSA 5BU4A 1I3FA 1CH0A 1BSDA 1BSAA 8RNTA 4HOHA 1A2PA 2C4BA 1RGKA 2F5MA 1AY7A 1GMQA 1GOYA 2GSPA 1LNIA 1TRQA 1BNJA 2BIRA 2BU4A 3D4AA 1BNFA 1RGEA 2F4YA 1RCKA 1PYLA 1YNVX 2F5WA 1RSNA 5GSPA 1LRAA 1RN1A 1B2SA 5RNTA 2KF4A 1YGWA 1LOWA 1BSEA 1LOYA 1IYYA 1I3IA 1BNIA 1I2EA 1RCLA 1RGFA 1RGCA 2AAEA 1FYSA 1FZUA 1B2ZA 1R4YA 1RHLA 1RLSA 1MGRA 7RNTA 3BU4A 4HAAA 1JBRA 4BIRA 2HOHA 2ZA4A 1TTOA 1DETA 1X1YA 2RNTA 1BAOA 1I2GA 1HZ1A 3BIRA 3D5GA 1BANA 1DE3A 1GSPA 1I0XA 1SARA 1T2HA 1BRNL 1I2FA 1GOVA 3GSPA 1BSBA 1AQZA 1BGSA 1RTUA 1G02A 1RGHA 4BU4A 3WR2A 1I0VA 3WHOA 2AADA 1BSCA 2KF3A 3Q3FA 1B3SA 1UCIA 4RNTA 1UCJA 3A5EA 3HOHA 1JBTA 1C54A 1BNGA 4GSPA 1T2IA 1BOXA 2F56A 3DGYA 4GHOA 1JBSA 1BRKA 7GSPA 1RNBA 4J5GA 1LOVA 3DH2A 6GSPA 1RGAA 1FUSA 1GMPA 1X1WA 1I70A 2KF6A 1I8VA 3AGNA 1B20A 1B2MA 1RGGA 1BNSA 1BRSA 1X1UA 1BIRA 1BNEA 3AGOA 2KAAA 5HOHA 1RGLA 1GOUA 1RMSA 3SYUA 1ZGXA 3KCHA 1B2XA 2RBIA 1X1XA 1BUJA 1B27A 1RNTA 1Q9EA 1BRGA 2KF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BU4 A;  1HYF A;  3AHW A;  1B21 A;  1BRJ A;  5BIR A;  1BVI A;  2SAR A;  1FW7 A;  1GMR A;  1MGW A;  3RNT A;  6RNT A;  1TRP A;  1BRI A;  1RDS A;  9RNT A;  1BRH A;  1UCL A;  1RN4 A;  1B2U A;  1PY3 A;  3D5I A;  3URP A;  1YVS A;  1FUT A;  1BNR A;  1UCK A;  4J5K A;  3AHS A;  5BU4 A;  1I3F A;  1CH0 A;  1BSD A;  1BSA A;  8RNT A;  4HOH A;  1A2P A;  2C4B A;  1RGK A;  2F5M A;  1AY7 A;  1GMQ A;  1GOY A;  2GSP A;  1LNI A;  1TRQ A;  1BNJ A;  2BIR A;  2BU4 A;  3D4A A;  1BNF A;  1RGE A;  2F4Y A;  1RCK A;  1PYL A;  1YNV X;  2F5W A;  1RSN A;  5GSP A;  1LRA A;  1RN1 A;  1B2S A;  5RNT A;  2KF4 A;  1YGW A;  1LOW A;  1BSE A;  1LOY A;  1IYY A;  1I3I A;  1BNI A;  1I2E A;  1RCL A;  1RGF A;  1RGC A;  2AAE A;  1FYS A;  1FZU A;  1B2Z A;  1R4Y A;  1RHL A;  1RLS A;  1MGR A;  7RNT A;  3BU4 A;  4HAA A;  1JBR A;  4BIR A;  2HOH A;  2ZA4 A;  1TTO A;  1DET A;  1X1Y A;  2RNT A;  1BAO A;  1I2G A;  1HZ1 A;  3BIR A;  3D5G A;  1BAN A;  1DE3 A;  1GSP A;  1I0X A;  1SAR A;  1T2H A;  1BRN L;  1I2F A;  1GOV A;  3GSP A;  1BSB A;  1AQZ A;  1BGS A;  1RTU A;  1G02 A;  1RGH A;  4BU4 A;  3WR2 A;  1I0V A;  3WHO A;  2AAD A;  1BSC A;  2KF3 A;  3Q3F A;  1B3S A;  1UCI A;  4RNT A;  1UCJ A;  3A5E A;  3HOH A;  1JBT A;  1C54 A;  1BNG A;  4GSP A;  1T2I A;  1BOX A;  2F56 A;  3DGY A;  4GHO A;  1JBS A;  1BRK A;  7GSP A;  1RNB A;  4J5G A;  1LOV A;  3DH2 A;  6GSP A;  1RGA A;  1FUS A;  1GMP A;  1X1W A;  1I70 A;  2KF6 A;  1I8V A;  3AGN A;  1B20 A;  1B2M A;  1RGG A;  1BNS A;  1BRS A;  1X1U A;  1BIR A;  1BNE A;  3AGO A;  2KAA A;  5HOH A;  1RGL A;  1GOU A;  1RMS A;  3SYU A;  1ZGX A;  3KCH A;  1B2X A;  2RBI A;  1X1X A;  1BUJ A;  1B27 A;  1RNT A;  1Q9E A;  1BRG A;  2KF5 A; 
#chains in the Genus database with same CATH topology
 3F7X A;  4O3V A;  2GU3 A;  3EN8 A;  1HYF A;  2H0H A;  3AHW A;  1WMO A;  4KZ1 A;  1BRJ A;  1LOX A;  1GS3 A;  5DRV A;  1GMR A;  1FGT A;  3LTD A;  3RNT A;  2HMJ B;  4HZ9 B;  1NB3 I;  1TRP A;  2J8X B;  1YI2 3;  9RNT A;  1BRH A;  3D5I A;  1RN4 A;  1G0T A;  1KC8 4;  3URP A;  1NDO B;  1U8C B;  4LMI A;  4MEI A;  1QAL A;  3NBJ A;  1BNR A;  1QMA A;  1I3F A;  2O9U X;  1BSD A;  1BSA A;  1IQX A;  3BNC A;  4MJD A;  5FGO A;  1OGX A;  2P0M A;  5G1L A;  3U1W A;  1MWU A;  1Q86 4;  1RGK A;  1AY7 A;  4N6N B;  4I4K A;  3EC9 A;  1JNQ A;  2GSP A;  1TRQ A;  1WMN A;  2Z77 A;  4L8P A;  2F99 A;  2H0G A;  1D6U A;  4LSO A;  4WP5 A;  2WO0 A;  1IT8 A;  1J2B A;  1JN5 B;  1EUI C;  1SII A;  1DYU A;  3KKG A;  1RN7 A;  2XF3 A;  3X42 A;  2WOF A;  1MWR A;  1EKM A;  1RGE A;  3CU3 A;  2C10 A;  3PCR A;  3G4S 3;  1PYL A;  5CK6 A;  4RNZ A;  1ZX2 A;  1B2S A;  1O7N B;  2HML B;  1Q82 4;  1AV4 A;  2KRT A;  3K63 A;  2BO9 B;  1LOY A;  1BSE A;  3G0K A;  3B8L A;  1I3I A;  1I2E A;  1UW1 A;  3DZL A;  3PCS A;  1KQS 2;  3ROB A;  3M8C A;  3VGN A;  1U5O A;  3AMO B;  4XDW A;  3TDG A;  4AKY A;  1R4Y A;  4EV5 A;  4LEH A;  4N6L A;  4BTW A;  2ZDJ A;  5EQL A;  5IG5 A;  3KZT A;  1VZZ A;  4U13 A;  1W7C A;  2IUJ A;  3B7C A;  4N6O B;  6STD A;  1MGR A;  2A15 A;  1W5Z A;  3CMA 3;  1OHO A;  1Q7H A;  4FMC A;  3NM2 A;  4HVN A;  3NX0 A;  3BNE A;  4HKV B;  3GWR A;  5D83 A;  4XB5 A;  1NU3 A;  5M19 A;  3CCR 3;  1IQY A;  1QVF 2;  3QK9 A;  3EN1 B;  4N3V A;  4EBG A;  1N9E A;  2D42 A;  3WOD G;  1ASK A;  1DE3 A;  1SAR A;  2Z7A A;  5EEO A;  1IVX A;  1I2F A;  1DVC A;  1JZO A;  3MPH A;  3RGR A;  2WGO A;  3IMA B;  1BGS A;  1G02 A;  1PFP A;  2QIY A;  2QA4 3;  1VQO 3;  2GEY A;  3BNB A;  3L0R A;  4H3U A;  3PXM A;  4LYL B;  1MNL A;  3PZW A;  3WHO A;  5IW9 A;  2AAD A;  1BSC A;  1VQK 3;  3BND A;  3OW2 2;  2ZL8 A;  2CFD A;  1RRL A;  3G6E 3;  3H51 A;  1Q81 4;  1W01 A;  4CCV A;  1FUW A;  2HMK B;  3HOH A;  2W03 A;  3IJE B;  3X3Y A;  5IEP A;  4XBT A;  3HK4 A;  1C54 A;  1BNG A;  1M1X B;  4WHA A;  1T5Y A;  5JBS A;  3CCQ 3;  3B4O A;  1ZS7 A;  2F56 A;  4GHO A;  3V98 A;  1BRK A;  3FCS B;  4R4K A;  3CCM 3;  1JBS A;  3N54 B;  3B4P A;  3G16 A;  3D3L A;  6GSP A;  1FUS A;  1GMP A;  1X1W A;  1PU4 A;  3K9M C;  4HM6 B;  2KF6 A;  4K61 A;  4NHF A;  4WYK A;  1YIJ 3;  1BRS A;  1NO3 A;  3CPW 2;  3EBT A;  1YJN 3;  1Y4K A;  1RGL A;  5M18 A;  3FG1 A;  3DGL A;  5JPP A;  3OWS A;  1IVV A;  2RCD A;  4FCZ A;  1D6Z A;  3KII A;  4NRE A;  1CYU A;  4HM1 B;  3ER7 A;  2RBI A;  3UJM A;  1YIT 3;  1N5H A;  3N9H A;  3OX9 A;  4HM8 B;  5AYR B;  5BXQ A;  4QWT A;  3LXU X;  1O7M B;  1GD3 A;  1UGI A;  3EHC A;  3FGY A;  1BU4 A;  3FSD A;  1LVN A;  4XM4 A;  1GD4 A;  1UI7 A;  3DY5 A;  4IPB A;  2XR8 B;  4HM2 B;  1MGW A;  1GYB A;  6RNT A;  4NPB A;  2W2C A;  1V74 A;  1B2U A;  1PY3 A;  1VQ6 3;  1YJW 3;  1YVS A;  3X41 A;  3LTB A;  1FUT A;  1GY6 A;  2XGN A;  2CW9 A;  2XEP A;  3EBY A;  1W2Z A;  3HI7 A;  4J5K A;  1CH0 A;  4ZM8 A;  2KCD A;  4HOH A;  3S28 A;  2C4B A;  3WDG B;  1S5A A;  1ULI B;  1O7H B;  2BT3 A;  4K90 B;  1E97 A;  1ULJ B;  1LNI A;  3H3H A;  3WOE B;  2INX A;  1W00 A;  3SXX A;  1OF5 A;  1SPU A;  3WA2 X;  2STD A;  3S29 A;  2BU4 A;  3F14 A;  1ISK A;  1RCK A;  2M7O A;  2GU1 A;  4LGQ A;  1N8Q A;  1YNV X;  1YJ9 3;  4FR9 A;  1RJO A;  4FMB A;  3KSE D;  5RNT A;  2KF4 A;  1NJI 4;  1JB5 A;  1FGO A;  1LOW A;  3F9S A;  1IYY A;  1A2V A;  3G8Z A;  1RGC A;  1BNI A;  1CEW I;  3NQZ A;  3NV0 A;  1FYS A;  4KFE A;  2CWT A;  4EW5 A;  4MMY B;  5IEN A;  2JQ5 A;  1RHL A;  1K73 4;  4HM5 B;  1RLS A;  1OHS A;  3DGO A;  3ZG5 A;  3SOA A;  1JB2 A;  4HAA A;  1JBR A;  2UX0 A;  4BIR A;  2BNG A;  2HOH A;  3SED A;  4XDV A;  5KP1 A;  1W4N A;  3NXJ A;  1FGQ A;  2CWU A;  4BTY A;  5AII A;  3JUM A;  2RFR A;  3K0Z A;  2RNT A;  2V1L A;  3CPO A;  1AVK A;  1GY7 A;  4RZM A;  1IVW A;  1I2G A;  1K9M 4;  1IQ8 A;  3FZW A;  1HZ1 A;  4FMD A;  3BIR A;  3V92 A;  2CWV A;  1GSP A;  1WNH A;  2SBL A;  1BRN L;  3S27 A;  3T0U A;  1HKX A;  1BSB A;  3EJV A;  1ROV A;  3FH1 A;  1JKG A;  4KVH A;  5AI1 A;  4AEQ A;  4HYZ A;  3WR2 A;  1FGR A;  1I0V A;  1IK3 A;  3VSY A;  3LYG A;  1UCI A;  1VQ4 3;  1TUH A;  2W9P A;  2XFT A;  2XGL A;  2OTL 3;  3EB8 A;  1EG9 B;  3KSP A;  1MWT A;  3N8B A;  5STD A;  1FA3 A;  1JV2 B;  2JDI H;  1Z1S A;  5EVH A;  1OUN A;  3CNX A;  1OF5 B;  3HZP A;  1BOX A;  3A76 A;  3DGY A;  3E99 A;  7GSP A;  5IG0 A;  4RBN A;  4J5G A;  3DH2 A;  1NB5 I;  2CK3 H;  3F40 A;  2D1W A;  4J8T A;  3T8N A;  1RGA A;  7STD A;  4N6V 0;  1OHP A;  1VQ9 3;  3EX9 A;  1I8V A;  4I5Q A;  1EEJ A;  1RGG A;  4R9L A;  1VQ5 3;  4BL3 A;  1CQS A;  2Y74 A;  1VQ8 3;  5IF6 A;  2KAA A;  2W9Q A;  1K41 A;  1DMN A;  5HOH A;  4IIA A;  4WWU C;  5FW5 A;  3VF1 A;  3ALA A;  3WA3 A;  4XBY A;  3KCH A;  3D79 A;  4WFO A;  2OTJ 3;  1W02 A;  2CFK A;  4O2H A;  1BUJ A;  2UGI A;  4HM3 B;  1TU5 A;  1STF I;  4OUQ A;  1W6C A;  1JB4 A;  2K0M A;  2KF5 A;  2OQE C;  2Q07 A;  2CG0 A;  4R1K A;  5M1A A;  5ELJ A;  2E2U A;  1VQM 3;  2SAR A;  3LZA A;  1FW7 A;  1QJG A;  3S5C A;  1AR0 A;  1G96 A;  3K7C A;  5BVB A;  1BRI A;  2CIU A;  1UCL A;  4JF8 A;  1LQM B;  4JRF A;  1DMM A;  1JKG B;  2Z6B A;  4OVM A;  5LC7 A;  3Q2P A;  3SLU A;  4AKZ A;  2IYJ A;  4TX4 A;  5G2G A;  2MF7 A;  1GOY A;  2K3D A;  1OPY A;  2P38 A;  3IPT A;  1Q42 A;  1DVD A;  1O7G B;  1UUV B;  3HIG A;  2IY2 A;  1GY5 A;  3D4A A;  3K5T A;  1BNF A;  3FG4 A;  2CFG A;  1TIJ A;  1IV9 A;  1V58 A;  1N8R 4;  5LC6 A;  2ML6 A;  2LQV A;  2F5W A;  1K28 A;  1D6Y A;  3DMC A;  3HX8 A;  3CCV 3;  3GRD A;  3OWY A;  5GSP A;  1EQK A;  1RN1 A;  1F8N A;  3MHE A;  1YGW A;  5AYS C;  3GZR A;  3CCL 3;  1LQG C;  1TFO A;  3UL6 A;  3T8U A;  2CKF B;  3CC7 3;  1FGM A;  2BMO B;  3WMD A;  4HJL B;  2ZHX B;  2OOV C;  3HII A;  1RGF A;  4N6M A;  3UB1 A;  2AAE A;  1FZU A;  2L4V A;  2XH9 A;  2IA7 A;  3CC4 3;  1HU9 A;  1TJD A;  4CDL A;  8CHO A;  2B24 B;  3PGB A;  2C11 A;  3Q1C A;  4EYC A;  2I9W A;  2PZV A;  1UGH I;  5AIF A;  5G1K A;  1YHQ 3;  4EC6 A;  5CLK A;  2HMN B;  3FLJ A;  3CNM A;  2GBX B;  3FF0 A;  3F8H A;  2W56 A;  4HZB B;  1T2H A;  1OCV A;  3RGA A;  1GOV A;  3GSP A;  1AQZ A;  3SX1 A;  1IU7 A;  3BB9 A;  3JUO A;  3CD6 3;  1SIH A;  1M9G A;  1BUQ A;  4MMZ B;  3LML A;  3RDE A;  4ILF A;  3DXO A;  4WYK B;  2XFS A;  3EE1 A;  3Q3F A;  2KF3 A;  1B3S A;  3X3Z A;  1CYV A;  1Q40 A;  1WQL B;  3OV4 A;  4FCM A;  4CJN A;  4L8O A;  2CG1 A;  3J7Y d;  4K1U A;  4H61 A;  1YGE A;  2OCT A;  3A5E A;  4DKI A;  5CF2 A;  1SJW A;  1ROA A;  4RNY A;  1N9J A;  4GSP A;  1RNB A;  2XRX B;  2MC8 A;  3NBB A;  1OGZ A;  3KFQ C;  2FGT A;  3LTC A;  3SVA A;  4X2O A;  3JVC A;  3NBR A;  4G1M B;  2GEX A;  1YVB I;  2YFJ B;  4KFD A;  3MG2 A;  1UI8 A;  1OAC A;  3AGN A;  3V99 A;  2F98 A;  2FNQ A;  1LNH A;  1BNS A;  5TGN A;  2OWP A;  3LTA A;  1X1U A;  5AIH A;  4BTX A;  3ZG0 A;  3CCU 3;  1BIR A;  3AGO A;  2QEX 3;  4IT7 A;  2KXG A;  1TFK A;  4R9K A;  1GOU A;  2UUG C;  1ZGX A;  1B2X A;  3BLZ A;  5ELU A;  3KE7 A;  1X1X A;  4FMA A;  1B27 A;  1RNT A;  1Q9E A;  1BRG A;  4STD A;  5IER A;  2H0I A;  1VQ7 3;  4FCJ A;  1B21 A;  5BIR A;  1BVI A;  3S67 A;  2W56 B;  4L7K A;  5AEW B;  2W6J H;  4J9A A;  1IT7 A;  1O7P B;  1RDS A;  2W04 A;  3GZB A;  1IV7 A;  2YFI B;  1LXE A;  3UL5 A;  3CCJ 3;  1R4C A;  2OQE A;  1UCK A;  1KSI A;  3AHS A;  1EA2 A;  2P05 A;  1MOL A;  1T3B A;  2XSO B;  5D81 A;  5BU4 A;  1KD1 4;  1QAF A;  1UUG B;  2W0Q A;  2Z76 A;  8RNT A;  3NV0 B;  1A2P A;  3O8Y A;  1VQQ A;  2F5M A;  2GXF A;  1IDP A;  1QVG 2;  1AVL A;  1GMQ A;  3F7S A;  2CC3 A;  2BMR B;  4HM4 B;  1BNJ A;  1Q40 B;  3X40 A;  3I56 3;  2O3O A;  1K8A 4;  2FXT A;  2BIR A;  3LT9 A;  3DUK A;  5I97 A;  3DGN A;  2F4Y A;  2E2T A;  3GZY B;  5IEO A;  1US1 A;  1RSN A;  1NNV A;  3DM8 A;  5IG4 A;  1LRA A;  2PNC A;  1RRH A;  1A67 A;  2CH9 A;  3STD A;  2QGU A;  5IG3 A;  3U97 A;  5KP4 A;  3ZFZ A;  3F8X A;  2B1X B;  1RCL A;  5HGR A;  3G71 3;  1MWS A;  1NWW A;  5D82 A;  1VQL 3;  1UUW B;  2F86 B;  3CCS 3;  2XSH B;  1B2Z A;  1QAK A;  4KFF A;  1Q7Y 4;  1M90 4;  1VQN 3;  3FF2 A;  1E3R A;  1W6G A;  2BMQ B;  3FKA A;  7RNT A;  3PYJ A;  4HM7 B;  1L5G B;  1VQP 3;  2CX0 A;  3BU4 A;  3JUN A;  2OOV A;  4CPK A;  2ZA4 A;  3LH4 A;  1TTO A;  1DET A;  4N6T A;  4KT3 B;  1X1Y A;  2CHC A;  5DRE A;  3LOY A;  2WGQ A;  2R4I A;  3X3X A;  5AEU B;  4GB5 A;  1BAO A;  1STD A;  3CXC 2;  1S72 3;  3NUV A;  3ECF A;  1W6Y A;  3LT8 A;  1O7W B;  3D5G A;  1BAN A;  1I0X A;  2L1S A;  3MG1 A;  3MG3 A;  1N5P A;  1WMP A;  3CME 3;  5A0O B;  1IVU A;  3NHX A;  1A2K A;  1RTU A;  2K54 A;  2HMO B;  1WTH A;  1E3V A;  3SOY A;  1RGH A;  3MSO A;  1SQW A;  2E2V A;  2IUK A;  3NQY A;  1ZO2 A;  3MWZ A;  4K1V A;  4BU4 A;  4BL2 A;  3EQQ B;  4X2H A;  1UDI I;  3QRD A;  3Q90 A;  4PEJ A;  4R80 A;  3JUP A;  4N6U A;  1V57 A;  1JZD A;  2GBW B;  3FG3 A;  2CX1 A;  4RNT A;  3GZX B;  1W2B 2;  3CCE 3;  2R41 A;  1JN5 A;  2IMJ A;  1UCJ A;  2LYX A;  4GL6 A;  3WOF B;  1JRQ A;  1TP6 A;  1JBT A;  4EXR A;  3EF8 A;  1T2I A;  2ML5 A;  2YFL B;  5AIG A;  2P09 A;  4MMX B;  3JUQ A;  2CFW A;  1LOV A;  2HMM B;  5KP3 A;  4EV2 A;  3MKI A;  4LZI A;  4O02 B;  4Q53 A;  1I70 A;  4O8S A;  5CXO A;  2YX9 A;  1B20 A;  3AMO A;  3I0Y A;  3UNL A;  1M1K 4;  1B2M A;  3PS8 A;  2P0X A;  3NM7 A;  3MYT A;  5JPU A;  2Y73 A;  3OXA A;  2RSX A;  4HM0 B;  4OK0 A;  2BHM A;  1BNE A;  2WOH A;  3CC2 3;  2CFL A;  3KN4 A;  3OWU A;  3DGM A;  3I55 3;  4ORL A;  1RMS A;  3SYU A;  4XBX A;  3D9R A;  2RGQ A;  1A90 A;  5CF1 A;  1KWI A;  1JJ2 2;  1DMQ A;  3GAX A;  4HBR A;  1OH0 A;  1C7H A;  1RKY A; 
#chains in the Genus database with same CATH homology
 1BU4 A;  1HYF A;  3AHW A;  1B21 A;  1BRJ A;  5BIR A;  1BVI A;  2SAR A;  1FW7 A;  1GMR A;  1MGW A;  3RNT A;  6RNT A;  1TRP A;  1BRI A;  1RDS A;  9RNT A;  1BRH A;  1UCL A;  1RN4 A;  1B2U A;  1PY3 A;  3D5I A;  3URP A;  1YVS A;  1FUT A;  1BNR A;  1UCK A;  4J5K A;  3AHS A;  5BU4 A;  1I3F A;  1CH0 A;  1BSD A;  1BSA A;  8RNT A;  4HOH A;  1A2P A;  2C4B A;  1RGK A;  2F5M A;  1AY7 A;  1GMQ A;  1GOY A;  2GSP A;  1LNI A;  1TRQ A;  1BNJ A;  2BIR A;  2BU4 A;  3D4A A;  1BNF A;  1RGE A;  2F4Y A;  1RCK A;  1PYL A;  1YNV X;  2F5W A;  1RSN A;  5GSP A;  1LRA A;  1RN1 A;  1B2S A;  5RNT A;  2KF4 A;  1YGW A;  1LOW A;  1BSE A;  1LOY A;  1IYY A;  1I3I A;  1BNI A;  1I2E A;  1RCL A;  1RGF A;  1RGC A;  2AAE A;  1FYS A;  1FZU A;  1B2Z A;  1R4Y A;  1RHL A;  1RLS A;  1MGR A;  7RNT A;  3BU4 A;  4HAA A;  1JBR A;  4BIR A;  2HOH A;  2ZA4 A;  1TTO A;  1DET A;  1X1Y A;  2RNT A;  1BAO A;  1I2G A;  1HZ1 A;  3BIR A;  3D5G A;  1BAN A;  1DE3 A;  1GSP A;  1I0X A;  1SAR A;  1T2H A;  1BRN L;  1I2F A;  1GOV A;  3GSP A;  1BSB A;  1AQZ A;  1BGS A;  1RTU A;  1G02 A;  1RGH A;  4BU4 A;  3WR2 A;  1I0V A;  3WHO A;  2AAD A;  1BSC A;  2KF3 A;  3Q3F A;  1B3S A;  1UCI A;  4RNT A;  1UCJ A;  3A5E A;  3HOH A;  1JBT A;  1C54 A;  1BNG A;  4GSP A;  1T2I A;  1BOX A;  2F56 A;  3DGY A;  4GHO A;  1JBS A;  1BRK A;  7GSP A;  1RNB A;  4J5G A;  1LOV A;  3DH2 A;  6GSP A;  1RGA A;  1FUS A;  1GMP A;  1X1W A;  1I70 A;  2KF6 A;  1I8V A;  3AGN A;  1B20 A;  1B2M A;  1RGG A;  1BNS A;  1BRS A;  1X1U A;  1BIR A;  1BNE A;  3AGO A;  2KAA A;  5HOH A;  1RGL A;  1GOU A;  1RMS A;  3SYU A;  1ZGX A;  3KCH A;  1B2X A;  2RBI A;  1X1X A;  1BUJ A;  1B27 A;  1RNT A;  1Q9E A;  1BRG A;  2KF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...