1HYFA

Ribonuclease t1 v16a mutant in complex with sr2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hyfA00
3AHSA 3Q3FA 2BU4A 1DE3A 2C4BA 2F56A 3RNTA 1MGRA 2HOHA 1BVIA 1YVSA 1X1YA 6RNTA 1T2IA 1BAOA 1BOXA 1B20A 1BGSA 1I0XA 1BNIA 1GMRA 1I3IA 1R4YA 1YGWA 1A2PA 1BRNL 1RGCA 1B2XA 1T2HA 1LOYA 1B2SA 1I2GA 4BU4A 1C54A 2KF3A 1BRIA 4GSPA 7RNTA 1PYLA 1FW7A 1RGLA 1RGKA 1FUTA 1BSCA 2F4YA 1RGFA 1RDSA 1RTUA 3AGOA 1JBSA 1RGEA 3BIRA 6GSPA 1GSPA 1IYYA 2F5WA 7GSPA 3SYUA 2AADA 1BANA 1BNGA 5HOHA 1JBTA 1RSNA 1BNSA 1PY3A 1BIRA 1RCLA 1DETA 1CH0A 1YNVX 3D4AA 2RNTA 2KF4A 4J5KA 2GSPA 1GOUA 3DGYA 4GHOA 4BIRA 1RGHA 1RNTA 1I2FA 9RNTA 3GSPA 1ZGXA 1GOVA 4HOHA 5BIRA 1JBRA 1RGGA 1UCKA 2RBIA 1AQZA 1BNRA 1FZUA 1B21A 2ZA4A 1BU4A 3AGNA 1B3SA 2BIRA 1GMPA 1HZ1A 1RN1A 2KF5A 1B2ZA 1I8VA 1I0VA 1HYFA 3D5GA 1LOVA 4J5GA 3WHOA 1G02A 1TTOA 5BU4A 1B27A 1UCLA 4RNTA 1RGAA 1FYSA 1X1WA 1AY7A 2KF6A 1B2UA 1TRPA 1B2MA 1LRAA 1RCKA 1RMSA 1TRQA 1BRJA 3AHWA 1BNFA 2SARA 5RNTA 3A5EA 1GMQA 1LNIA 3BU4A 2F5MA 1RNBA 1BNEA 1I3FA 1BNJA 2KAAA 1RHLA 1BSAA 3WR2A 1MGWA 1BUJA 1SARA 1I2EA 1I70A 1UCJA 1X1XA 1BRSA 1GOYA 1LOWA 3KCHA 1X1UA 5GSPA 1BSBA 8RNTA 1BRHA 1BRGA 3URPA 1Q9EA 2AAEA 1RN4A 1UCIA 3HOHA 1BSEA 3D5IA 4HAAA 1BRKA 1BSDA 1FUSA 3DH2A 1RLSA
chains in the Genus database with same CATH superfamily
3T8NA 5IENA 5HGRA 4EXRA 4WP5A 2CWTA 2BU4A 5CF1A 2C4BA 3NM7A 5IG4A 1DE3A 1FA3A 3EF8A 5TGNA 1X1YA 5DREA 1GY7A 5D82A 1T2IA 1UI7A 4IT7A 2OQEC 3LT9A 4O2HA 1BAOA 5IG0A 1RKYA 2PZVA 2OQEA 1I0XA 3CCQ3 2BT3A 1GMRA 1YGWA 1R4YA 3CU3A 1QVG2 1A2PA 1CYVA 1BRNL 1EG9B 2YFJB 1W01A 2W03A 3TDGA 1SPUA 1DVCA 4KFFA 4HM3B 1YIT3 1C54A 3QK9A 2CW9A 3LXUX 7RNTA 3MSOA 1TFKA 4XBTA 3BNCA 1J2BA 1OHOA 3GZYB 1VZZA 3NHXA 1CQSA 3N54B 1Q7Y4 5A0OB 6GSPA 4EBGA 1AVLA 2UUGC 1IYYA 4O02B 2F98A 1W5ZA 2UX0A 3D79A 4AKZA 3ECFA 2OTJ3 1C7HA 2OTL3 1V57A 3LTDA 1BNGA 5HOHA 1RSNA 4EV5A 1VQN3 1W02A 4R1KA 4DKIA 2KXGA 4HBRA 1R4CA 1CH0A 2INXA 1WMNA 5IF6A 2MF7A 1TP6A 2D1WA 3I563 1A67A 3GAXA 2RNTA 3WODG 5CXOA 4HJLB 4N3VA 3ROBA 3EQQB 1JKGB 1GOUA 1Q814 5IW9A 3A76A 2WGOA 3GZBA 1ZGXA 3FG4A 3KFQC 1JZDA 4HOHA 1YIJ3 3KN4A 2W9QA 2F86B 1GS3A 3MG3A 2RBIA 5FGOA 1BNRA 3LOYA 1BU4A 4N6TA 2PNCA 2GEXA 3CPOA 4O3VA 1VQO3 1M9GA 4G1MB 4HM0B 2KF5A 4HM7B 1ULJB 3MG1A 5STDA 2CHCA 3CC73 3JUOA 1IVWA 3DY5A 1OF5B 5G1LA 4BTXA 1IV9A 1HYFA 1OHSA 1G02A 2HMKB 4HYZA 3MYTA 3CCM3 1UUVB 1VQK3 2IMJA 2P09A 1UCLA 1S5AA 2WOFA 4R9LA 1DVDA 1Q40A 1M1XB 1RN7A 1MWTA 4EYCA 4LSOA 3BNEA 2R41A 1OCVA 1DMNA 4KFEA 1NB3I 5M19A 3K5TA 2H0HA 3MKIA 3FKAA 1Q824 5AEWB 1K28A 3OXAA 1LOXA 3Q1CA 1BNEA 2XSOB 3NM2A 2I9WA 1I3FA 3L0RA 2A15A 1K734 3B8LA 1EKMA 1MOLA 1N9JA 5KP1A 1QAKA 3FG1A 1FGQA 3ZG5A 1E3VA 4RNYA 1YJ93 3WR2A 3S29A 1STDA 1FUWA 1US1A 4R9KA 4LYLB 1GOYA 1LOWA 1Q40B 3CCR3 2XFSA 8RNTA 4X2HA 1BRHA 1BRGA 2D42A 1Q9EA 2AAEA 2STDA 2YFLB 3DMCA 1QJGA 3Q90A 1MWSA 4K1VA 2IUJA 1PU4A 1UUWB 3CCL3 3CMA3 3HIIA 2IA7A 3SEDA 1OGZA 4STDA 4I5QA 2ML6A 3KSED 4LEHA 1GYBA 3N8BA 1HKXA 3G0KA 2QIYA 1BVIA 3D9RA 1YVSA 6RNTA 1Q7HA 1WNHA 3KIIA 3SXXA 3HK4A 2W56B 5AYRB 3V98A 5IEPA 3OWUA 2B24B 4CJNA 1BUQA 1D6ZA 3MPHA 4CCVA 1STFI 1WQLB 2OOVA 3SX1A 1UUGB 3UNLA 3CXC2 1PFPA 2XGNA 3GZRA 3WA3A 2H0IA 4WYKB 3VF1A 2IYJA 1O7GB 4N6MA 1BSCA 2F4YA 1RGFA 3AGOA 1K41A 1RGEA 2WOHA 1YHQ3 4HM6B 1QALA 4GL6A 4KT3B 2WO0A 2K3DA 3GWRA 5M18A 5IG5A 4KFDA 2Z77A 3EX9A 7GSPA 3FSDA 1IVXA 1LXEA 2ZL8A 1BANA 1ZO2A 3KSPA 4FMCA 2IUKA 3EC9A 3IMAB 1BIRA 1JBTA 1TFOA 3EBYA 4Q53A 3D4AA 1SQWA 4JF8A 1V58A 2W56A 1NWWA 4J5KA 3AMOA 3G6E3 3CNMA 2BNGA 2CX0A 2XGLA 5AYSC 1FGTA 4HVNA 3F9SA 2BO9B 1I2FA 4FMDA 9RNTA 1KWIA 5BVBA 1UGIA 3F14A 2SBLA 2RFRA 1ULIB 1AR0A 1EA2A 3HX8A 5DRVA 2IY2A 1A2KA 4FR9A 2CK3H 2CWVA 2Z7AA 2ZA4A 3O8YA 4MMXB 5D81A 3V99A 1IQXA 3CC43 1FGOA 2QA43 3PCSA 3T8UA 5AEUB 3FGYA 1U8CB 2RCDA 3F8XA 3EJVA 1JZOA 4MMYB 5LC7A 3WDGB 3Q2PA 5BXQA 4BL2A 4N6OB 4U13A 2CC3A 1MNLA 1SJWA 2LYXA 4NPBA 5EVHA 1IU7A 3HI7A 4RNTA 3OW22 1RGAA 2GXFA 1IDPA 1X1WA 3FZWA 4L7KA 5I97A 2CWUA 1O7PB 5JPUA 1ASKA 1AY7A 1B2MA 1B2UA 3OWYA 5KP3A 1KC84 2HMJB 2KCDA 3E99A 1BRJA 2CKFB 3OX9A 3LTCA 3X3YA 1WMPA 1KSIA 4XDWA 1LNIA 2OOVC 3BU4A 2ZHXB 3NQYA 3S28A 8CHOA 1RNBA 3OV4A 4RZMA 4ILFA 1BNJA 2KAAA 3F7XA 3WA2X 3FG3A 2K54A 1G0TA 3VGNA 3F40A 1MGWA 1EQKA 1BUJA 4EV2A 4OVMA 3X3XA 1I2EA 3U1WA 1X1XA 1LQGC 1OF5A 1IQYA 3ER7A 1IT7A 1O7HB 2E2UA 3X42A 3KCHA 1X1UA 5GSPA 3NV0A 1BSBA 3STDA 3KZTA 3WMDA 4XM4A 2O3OA 3BB9A 3PZWA 1BSDA 2H0GA 1YI23 2ML5A 1VQQA 1JNQA 3B4OA 3NBJA 3VSYA 2P05A 6STDA 4WHAA 3F7SA 4BL3A 3MWZA 4PEJA 1VQ53 2F56A 3RNTA 3FH1A 2HOHA 4K1UA 3CD63 1N5PA 2V1LA 1GD4A 3SLUA 1Q42A 2CFLA 3S27A 2BMRB 2Z6BA 2KRTA 1JB5A 3JUNA 3LT8A 4QWTA 1BOXA 1RJOA 5KP4A 1W2B2 3FF2A 1B20A 2CFDA 1BGSA 1BNIA 2CFKA 1I3IA 1MWRA 1N5HA 3LH4A 4TX4A 2R4IA 2XF3A 3ZFZA 2C10A 1LOYA 3NXJA 1I2GA 3PYJA 4JRFA 1DMQA 1HU9A 1WMOA 1N9EA 3HZPA 1IVUA 2P38A 3H3HA 2KF3A 4HM1B 4KVHA 1JN5A 1T3BA 1RGLA 4H3UA 5JBSA 1GY6A 1KQS2 1RGKA 1FUTA 1RTUA 4HZBB 1JBSA 4BTWA 2GU1A 1OACA 3G8ZA 3DM8A 3BIRA 3SOAA 1S723 2C11A 1VQ63 1YGEA 1E97A 2XH9A 3S5CA 2F5WA 4IPBA 5ELJA 3LTAA 5ELUA 3DGLA 4FCJA 4FMAA 3SYUA 1TIJA 1W6GA 2W04A 4OK0A 1LVNA 2HMLB 1RCLA 3DGMA 1SIIA 5IEOA 1JRQA 4XBXA 1AVKA 2GEYA 3EBTA 2P0XA 1Z1SA 3B7CA 3NUVA 1A90A 5CK6A 4NREA 5FW5A 2E2TA 4R4KA 2UGIA 3MG2A 1V74A 3PGBA 4XDVA 4NHFA 1FGMA 4BIRA 5G2GA 3WOFB 5IERA 1NU3A 1RNTA 3IPTA 4J9AA 1K9M4 3GSPA 1GOVA 2CFWA 3T0UA 1JBRA 2QGUA 4K61A 1RRHA 3QRDA 3JUPA 5IG3A 3FF0A 2Y74A 3I0YA 4BTYA 1AQZA 5AIGA 1VQ43 2E2VA 3G16A 3AGNA 4RNZA 1GMPA 1W00A 1RN1A 1TJDA 2ZDJA 1W6YA 2OCTA 5EEOA 3J7Yd 2OWPA 4LMIA 3KKGA 7STDA 4EC6A 4CDLA 1ROAA 3D5GA 3V92A 4J5GA 3WHOA 4HKVB 2BMQB 5G1KA 1VQM3 1VQL3 1VQ73 2CG1A 2J8XB 1FYSA 3OWSA 1D6YA 1EUIC 2M7OA 3B4PA 3CPW2 1O7NB 2KF6A 4AEQA 2CG0A 4MEIA 1LRAA 1RCKA 3K9MC 1UDII 1BNFA 3UB1A 1FGRA 3G713 3JUMA 2SARA 5RNTA 1VQP3 3A5EA 1VQ83 1IT8A 4KZ1A 2QEX3 2O9UX 1CYUA 1JB4A 4N6NB 2L1SA 4OUQA 1ISKA 2W6JH 2L4VA 3DUKA 1BSAA 3EN1B 3F8HA 2CH9A 3CCS3 4MJDA 1N8R4 4J8TA 3EB8A 1W7CA 1SARA 1UCJA 1T5YA 3PS8A 1K8A4 1BRSA 1OH0A 3SOYA 4MMZB 1JV2B 2FXTA 2WGQA 3PCRA 1NNVA 3D3LA 1RN4A 1UCIA 3NQZA 4IIAA 1BSEA 3IJEB 2GBXB 5M1AA 2CX1A 4HAAA 5AIFA 1ZX2A 5CF2A 1BRKA 1IV7A 2Y73A 3FCSB 4XBYA 3CCU3 3KE7A 3LZAA 3AHSA 3Q3FA 3WOEB 2HMNB 1F8NA 1OUNA 1D6UA 1O7MB 1MGRA 1M1K4 3LTBA 4WFOA 3LMLA 1QAFA 4HM8B 2LQVA 4EW5A 1MWUA 2RGQA 4X2OA 2XSHB 3G4S3 4FMBA 2XR8B 3EN8A 4WWUC 1KD14 1W6CA 1OHPA 3M8CA 1RGCA 1B2XA 2W0QA 4XB5A 1T2HA 1B2SA 1Q864 4BU4A 4I4KA 1IQ8A 2XEPA 4HM5B 1NJI4 3UL6A 3CCE3 3K0ZA 4L8OA 1BRIA 4GSPA 3I553 1PYLA 3X40A 1FW7A 3DZLA 3BNBA 4ORLA 1LNHA 1RDSA 3DXOA 1O7WB 1A2VA 4LGQA 4HM2B 1SIHA 1GSPA 3NBBA 4O8SA 2FNQA 3FLJA 2FGTA 1CEWI 1E3RA 4HM4B 1BNSA 1JB2A 1PY3A 2RSXA 3DGNA 1GD3A 1JKGA 1DETA 1YNVX 3ALAA 3GRDA 4RBNA 1JN5B 3NV0B 2JDIH 2Z76A 4FCZA 1U5OA 2HMOB 3NBRA 5EQLA 3BLZA 4HZ9B 1DYUA 2KF4A 1YJN3 2GSPA 3K7CA 3DGYA 2CFGA 3CCV3 4GHOA 1QMAA 1W2ZA 3RGRA 1RGHA 1IK3A 2GU3A 3X3ZA 1YJW3 1LQMB 3K63A 3S67A 3CNXA 4AKYA 5BIRA 1W4NA 2K0MA 1RGGA 3UL5A 4WYKA 1NB5I 1UCKA 3GZXB 2YX9A 3NX0A 2MC8A 1FZUA 2GBWB 1B21A 1M904 1JJ22 2B1XB 1B3SA 3MHEA 3RDEA 2BIRA 1N8QA 1HZ1A 1WTHA 3AMOB 1RLSA 1IVVA 4LZIA 2BMOB 1B2ZA 3DGOA 1I8VA 2W2CA 1NO3A 2Q07A 1I0VA 1LOVA 1RRLA 1TTOA 5BU4A 3H51A 2CIUA 1B27A 4R80A 4FCMA 1AV4A 3RGAA 1OGXA 1YVBI 5AIHA 2F99A 1TU5A 1UI8A 5LC6A 1TRPA 4CPKA 1TUHA 5D83A 1RMSA 3CCJ3 1TRQA 3EHCA 4GB5A 3SVAA 3JVCA 3AHWA 1G96A 3LYGA 1GMQA 3N9HA 2F5MA 1DMMA 2W9PA 1L5GB 1GY5A 5AIIA 1NDOB 1RHLA 5AI1A 1UGHI 2P0MA 3JUQA 3PXMA 3ZG0A 1EEJA 4ZM8A 1ZS7A 4N6UA 1VQ93 4N6V0 1I70A 1OPYA 2XRXB 2BHMA 4N6LA 2HMMB 2JQ5A 1QVF2 1Y4KA 4K90B 4L8PA 5JPPA 3CC23 3U97A 3HIGA 3URPA 3BNDA 5CLKA 3EE1A 3HOHA 3D5IA 3CME3 3UJMA 1ROVA 2YFIB 3X41A 2XFTA 1FUSA 1UW1A 3DH2A 2AADA 4H61A
chains in the Genus database with same CATH topology
3AHSA 3Q3FA 2BU4A 1DE3A 2C4BA 2F56A 3RNTA 1MGRA 2HOHA 1BVIA 1YVSA 1X1YA 6RNTA 1T2IA 1BAOA 1BOXA 1B20A 1BGSA 1I0XA 1BNIA 1GMRA 1I3IA 1R4YA 1YGWA 1A2PA 1BRNL 1RGCA 1B2XA 1T2HA 1LOYA 1B2SA 1I2GA 4BU4A 1C54A 2KF3A 1BRIA 4GSPA 7RNTA 1PYLA 1FW7A 1RGLA 1RGKA 1FUTA 1BSCA 2F4YA 1RGFA 1RDSA 1RTUA 3AGOA 1JBSA 1RGEA 3BIRA 6GSPA 1GSPA 1IYYA 2F5WA 7GSPA 3SYUA 2AADA 1BANA 1BNGA 5HOHA 1JBTA 1RSNA 1BNSA 1PY3A 1BIRA 1RCLA 1DETA 1CH0A 1YNVX 3D4AA 2RNTA 2KF4A 4J5KA 2GSPA 1GOUA 3DGYA 4GHOA 4BIRA 1RGHA 1RNTA 1I2FA 9RNTA 3GSPA 1ZGXA 1GOVA 4HOHA 5BIRA 1JBRA 1RGGA 1UCKA 2RBIA 1AQZA 1BNRA 1FZUA 1B21A 2ZA4A 1BU4A 3AGNA 1B3SA 2BIRA 1GMPA 1HZ1A 1RN1A 2KF5A 1B2ZA 1I8VA 1I0VA 1HYFA 3D5GA 1LOVA 4J5GA 3WHOA 1G02A 1TTOA 5BU4A 1B27A 1UCLA 4RNTA 1RGAA 1FYSA 1X1WA 1AY7A 2KF6A 1B2UA 1TRPA 1B2MA 1LRAA 1RCKA 1RMSA 1TRQA 1BRJA 3AHWA 1BNFA 2SARA 5RNTA 3A5EA 1GMQA 1LNIA 3BU4A 2F5MA 1RNBA 1BNEA 1I3FA 1BNJA 2KAAA 1RHLA 1BSAA 3WR2A 1MGWA 1BUJA 1SARA 1I2EA 1I70A 1UCJA 1X1XA 1BRSA 1GOYA 1LOWA 3KCHA 1X1UA 5GSPA 1BSBA 8RNTA 1BRHA 1BRGA 3URPA 1Q9EA 2AAEA 1RN4A 1UCIA 3HOHA 1BSEA 3D5IA 4HAAA 1BRKA 1BSDA 1FUSA 3DH2A 1RLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AHS A;  3Q3F A;  2BU4 A;  1DE3 A;  2C4B A;  2F56 A;  3RNT A;  1MGR A;  2HOH A;  1BVI A;  1YVS A;  1X1Y A;  6RNT A;  1T2I A;  1BAO A;  1BOX A;  1B20 A;  1BGS A;  1I0X A;  1BNI A;  1GMR A;  1I3I A;  1R4Y A;  1YGW A;  1A2P A;  1BRN L;  1RGC A;  1B2X A;  1T2H A;  1LOY A;  1B2S A;  1I2G A;  4BU4 A;  1C54 A;  2KF3 A;  1BRI A;  4GSP A;  7RNT A;  1PYL A;  1FW7 A;  1RGL A;  1RGK A;  1FUT A;  1BSC A;  2F4Y A;  1RGF A;  1RDS A;  1RTU A;  3AGO A;  1JBS A;  1RGE A;  3BIR A;  6GSP A;  1GSP A;  1IYY A;  2F5W A;  7GSP A;  3SYU A;  2AAD A;  1BAN A;  1BNG A;  5HOH A;  1JBT A;  1RSN A;  1BNS A;  1PY3 A;  1BIR A;  1RCL A;  1DET A;  1CH0 A;  1YNV X;  3D4A A;  2RNT A;  2KF4 A;  4J5K A;  2GSP A;  1GOU A;  3DGY A;  4GHO A;  4BIR A;  1RGH A;  1RNT A;  1I2F A;  9RNT A;  3GSP A;  1ZGX A;  1GOV A;  4HOH A;  5BIR A;  1JBR A;  1RGG A;  1UCK A;  2RBI A;  1AQZ A;  1BNR A;  1FZU A;  1B21 A;  2ZA4 A;  1BU4 A;  3AGN A;  1B3S A;  2BIR A;  1GMP A;  1HZ1 A;  1RN1 A;  2KF5 A;  1B2Z A;  1I8V A;  1I0V A;  1HYF A;  3D5G A;  1LOV A;  4J5G A;  3WHO A;  1G02 A;  1TTO A;  5BU4 A;  1B27 A;  1UCL A;  4RNT A;  1RGA A;  1FYS A;  1X1W A;  1AY7 A;  2KF6 A;  1B2U A;  1TRP A;  1B2M A;  1LRA A;  1RCK A;  1RMS A;  1TRQ A;  1BRJ A;  3AHW A;  1BNF A;  2SAR A;  5RNT A;  3A5E A;  1GMQ A;  1LNI A;  3BU4 A;  2F5M A;  1RNB A;  1BNE A;  1I3F A;  1BNJ A;  2KAA A;  1RHL A;  1BSA A;  3WR2 A;  1MGW A;  1BUJ A;  1SAR A;  1I2E A;  1I70 A;  1UCJ A;  1X1X A;  1BRS A;  1GOY A;  1LOW A;  3KCH A;  1X1U A;  5GSP A;  1BSB A;  8RNT A;  1BRH A;  1BRG A;  3URP A;  1Q9E A;  2AAE A;  1RN4 A;  1UCI A;  3HOH A;  1BSE A;  3D5I A;  4HAA A;  1BRK A;  1BSD A;  1FUS A;  3DH2 A;  1RLS A; 
#chains in the Genus database with same CATH topology
 3T8N A;  5IEN A;  5HGR A;  4EXR A;  4WP5 A;  2CWT A;  2BU4 A;  5CF1 A;  2C4B A;  3NM7 A;  5IG4 A;  1DE3 A;  1FA3 A;  3EF8 A;  5TGN A;  1X1Y A;  5DRE A;  1GY7 A;  5D82 A;  1T2I A;  1UI7 A;  4IT7 A;  2OQE C;  3LT9 A;  4O2H A;  1BAO A;  5IG0 A;  1RKY A;  2PZV A;  2OQE A;  1I0X A;  3CCQ 3;  2BT3 A;  1GMR A;  1YGW A;  1R4Y A;  3CU3 A;  1QVG 2;  1A2P A;  1CYV A;  1BRN L;  1EG9 B;  2YFJ B;  1W01 A;  2W03 A;  3TDG A;  1SPU A;  1DVC A;  4KFF A;  4HM3 B;  1YIT 3;  1C54 A;  3QK9 A;  2CW9 A;  3LXU X;  7RNT A;  3MSO A;  1TFK A;  4XBT A;  3BNC A;  1J2B A;  1OHO A;  3GZY B;  1VZZ A;  3NHX A;  1CQS A;  3N54 B;  1Q7Y 4;  5A0O B;  6GSP A;  4EBG A;  1AVL A;  2UUG C;  1IYY A;  4O02 B;  2F98 A;  1W5Z A;  2UX0 A;  3D79 A;  4AKZ A;  3ECF A;  2OTJ 3;  1C7H A;  2OTL 3;  1V57 A;  3LTD A;  1BNG A;  5HOH A;  1RSN A;  4EV5 A;  1VQN 3;  1W02 A;  4R1K A;  4DKI A;  2KXG A;  4HBR A;  1R4C A;  1CH0 A;  2INX A;  1WMN A;  5IF6 A;  2MF7 A;  1TP6 A;  2D1W A;  3I56 3;  1A67 A;  3GAX A;  2RNT A;  3WOD G;  5CXO A;  4HJL B;  4N3V A;  3ROB A;  3EQQ B;  1JKG B;  1GOU A;  1Q81 4;  5IW9 A;  3A76 A;  2WGO A;  3GZB A;  1ZGX A;  3FG4 A;  3KFQ C;  1JZD A;  4HOH A;  1YIJ 3;  3KN4 A;  2W9Q A;  2F86 B;  1GS3 A;  3MG3 A;  2RBI A;  5FGO A;  1BNR A;  3LOY A;  1BU4 A;  4N6T A;  2PNC A;  2GEX A;  3CPO A;  4O3V A;  1VQO 3;  1M9G A;  4G1M B;  4HM0 B;  2KF5 A;  4HM7 B;  1ULJ B;  3MG1 A;  5STD A;  2CHC A;  3CC7 3;  3JUO A;  1IVW A;  3DY5 A;  1OF5 B;  5G1L A;  4BTX A;  1IV9 A;  1HYF A;  1OHS A;  1G02 A;  2HMK B;  4HYZ A;  3MYT A;  3CCM 3;  1UUV B;  1VQK 3;  2IMJ A;  2P09 A;  1UCL A;  1S5A A;  2WOF A;  4R9L A;  1DVD A;  1Q40 A;  1M1X B;  1RN7 A;  1MWT A;  4EYC A;  4LSO A;  3BNE A;  2R41 A;  1OCV A;  1DMN A;  4KFE A;  1NB3 I;  5M19 A;  3K5T A;  2H0H A;  3MKI A;  3FKA A;  1Q82 4;  5AEW B;  1K28 A;  3OXA A;  1LOX A;  3Q1C A;  1BNE A;  2XSO B;  3NM2 A;  2I9W A;  1I3F A;  3L0R A;  2A15 A;  1K73 4;  3B8L A;  1EKM A;  1MOL A;  1N9J A;  5KP1 A;  1QAK A;  3FG1 A;  1FGQ A;  3ZG5 A;  1E3V A;  4RNY A;  1YJ9 3;  3WR2 A;  3S29 A;  1STD A;  1FUW A;  1US1 A;  4R9K A;  4LYL B;  1GOY A;  1LOW A;  1Q40 B;  3CCR 3;  2XFS A;  8RNT A;  4X2H A;  1BRH A;  1BRG A;  2D42 A;  1Q9E A;  2AAE A;  2STD A;  2YFL B;  3DMC A;  1QJG A;  3Q90 A;  1MWS A;  4K1V A;  2IUJ A;  1PU4 A;  1UUW B;  3CCL 3;  3CMA 3;  3HII A;  2IA7 A;  3SED A;  1OGZ A;  4STD A;  4I5Q A;  2ML6 A;  3KSE D;  4LEH A;  1GYB A;  3N8B A;  1HKX A;  3G0K A;  2QIY A;  1BVI A;  3D9R A;  1YVS A;  6RNT A;  1Q7H A;  1WNH A;  3KII A;  3SXX A;  3HK4 A;  2W56 B;  5AYR B;  3V98 A;  5IEP A;  3OWU A;  2B24 B;  4CJN A;  1BUQ A;  1D6Z A;  3MPH A;  4CCV A;  1STF I;  1WQL B;  2OOV A;  3SX1 A;  1UUG B;  3UNL A;  3CXC 2;  1PFP A;  2XGN A;  3GZR A;  3WA3 A;  2H0I A;  4WYK B;  3VF1 A;  2IYJ A;  1O7G B;  4N6M A;  1BSC A;  2F4Y A;  1RGF A;  3AGO A;  1K41 A;  1RGE A;  2WOH A;  1YHQ 3;  4HM6 B;  1QAL A;  4GL6 A;  4KT3 B;  2WO0 A;  2K3D A;  3GWR A;  5M18 A;  5IG5 A;  4KFD A;  2Z77 A;  3EX9 A;  7GSP A;  3FSD A;  1IVX A;  1LXE A;  2ZL8 A;  1BAN A;  1ZO2 A;  3KSP A;  4FMC A;  2IUK A;  3EC9 A;  3IMA B;  1BIR A;  1JBT A;  1TFO A;  3EBY A;  4Q53 A;  3D4A A;  1SQW A;  4JF8 A;  1V58 A;  2W56 A;  1NWW A;  4J5K A;  3AMO A;  3G6E 3;  3CNM A;  2BNG A;  2CX0 A;  2XGL A;  5AYS C;  1FGT A;  4HVN A;  3F9S A;  2BO9 B;  1I2F A;  4FMD A;  9RNT A;  1KWI A;  5BVB A;  1UGI A;  3F14 A;  2SBL A;  2RFR A;  1ULI B;  1AR0 A;  1EA2 A;  3HX8 A;  5DRV A;  2IY2 A;  1A2K A;  4FR9 A;  2CK3 H;  2CWV A;  2Z7A A;  2ZA4 A;  3O8Y A;  4MMX B;  5D81 A;  3V99 A;  1IQX A;  3CC4 3;  1FGO A;  2QA4 3;  3PCS A;  3T8U A;  5AEU B;  3FGY A;  1U8C B;  2RCD A;  3F8X A;  3EJV A;  1JZO A;  4MMY B;  5LC7 A;  3WDG B;  3Q2P A;  5BXQ A;  4BL2 A;  4N6O B;  4U13 A;  2CC3 A;  1MNL A;  1SJW A;  2LYX A;  4NPB A;  5EVH A;  1IU7 A;  3HI7 A;  4RNT A;  3OW2 2;  1RGA A;  2GXF A;  1IDP A;  1X1W A;  3FZW A;  4L7K A;  5I97 A;  2CWU A;  1O7P B;  5JPU A;  1ASK A;  1AY7 A;  1B2M A;  1B2U A;  3OWY A;  5KP3 A;  1KC8 4;  2HMJ B;  2KCD A;  3E99 A;  1BRJ A;  2CKF B;  3OX9 A;  3LTC A;  3X3Y A;  1WMP A;  1KSI A;  4XDW A;  1LNI A;  2OOV C;  3BU4 A;  2ZHX B;  3NQY A;  3S28 A;  8CHO A;  1RNB A;  3OV4 A;  4RZM A;  4ILF A;  1BNJ A;  2KAA A;  3F7X A;  3WA2 X;  3FG3 A;  2K54 A;  1G0T A;  3VGN A;  3F40 A;  1MGW A;  1EQK A;  1BUJ A;  4EV2 A;  4OVM A;  3X3X A;  1I2E A;  3U1W A;  1X1X A;  1LQG C;  1OF5 A;  1IQY A;  3ER7 A;  1IT7 A;  1O7H B;  2E2U A;  3X42 A;  3KCH A;  1X1U A;  5GSP A;  3NV0 A;  1BSB A;  3STD A;  3KZT A;  3WMD A;  4XM4 A;  2O3O A;  3BB9 A;  3PZW A;  1BSD A;  2H0G A;  1YI2 3;  2ML5 A;  1VQQ A;  1JNQ A;  3B4O A;  3NBJ A;  3VSY A;  2P05 A;  6STD A;  4WHA A;  3F7S A;  4BL3 A;  3MWZ A;  4PEJ A;  1VQ5 3;  2F56 A;  3RNT A;  3FH1 A;  2HOH A;  4K1U A;  3CD6 3;  1N5P A;  2V1L A;  1GD4 A;  3SLU A;  1Q42 A;  2CFL A;  3S27 A;  2BMR B;  2Z6B A;  2KRT A;  1JB5 A;  3JUN A;  3LT8 A;  4QWT A;  1BOX A;  1RJO A;  5KP4 A;  1W2B 2;  3FF2 A;  1B20 A;  2CFD A;  1BGS A;  1BNI A;  2CFK A;  1I3I A;  1MWR A;  1N5H A;  3LH4 A;  4TX4 A;  2R4I A;  2XF3 A;  3ZFZ A;  2C10 A;  1LOY A;  3NXJ A;  1I2G A;  3PYJ A;  4JRF A;  1DMQ A;  1HU9 A;  1WMO A;  1N9E A;  3HZP A;  1IVU A;  2P38 A;  3H3H A;  2KF3 A;  4HM1 B;  4KVH A;  1JN5 A;  1T3B A;  1RGL A;  4H3U A;  5JBS A;  1GY6 A;  1KQS 2;  1RGK A;  1FUT A;  1RTU A;  4HZB B;  1JBS A;  4BTW A;  2GU1 A;  1OAC A;  3G8Z A;  3DM8 A;  3BIR A;  3SOA A;  1S72 3;  2C11 A;  1VQ6 3;  1YGE A;  1E97 A;  2XH9 A;  3S5C A;  2F5W A;  4IPB A;  5ELJ A;  3LTA A;  5ELU A;  3DGL A;  4FCJ A;  4FMA A;  3SYU A;  1TIJ A;  1W6G A;  2W04 A;  4OK0 A;  1LVN A;  2HML B;  1RCL A;  3DGM A;  1SII A;  5IEO A;  1JRQ A;  4XBX A;  1AVK A;  2GEY A;  3EBT A;  2P0X A;  1Z1S A;  3B7C A;  3NUV A;  1A90 A;  5CK6 A;  4NRE A;  5FW5 A;  2E2T A;  4R4K A;  2UGI A;  3MG2 A;  1V74 A;  3PGB A;  4XDV A;  4NHF A;  1FGM A;  4BIR A;  5G2G A;  3WOF B;  5IER A;  1NU3 A;  1RNT A;  3IPT A;  4J9A A;  1K9M 4;  3GSP A;  1GOV A;  2CFW A;  3T0U A;  1JBR A;  2QGU A;  4K61 A;  1RRH A;  3QRD A;  3JUP A;  5IG3 A;  3FF0 A;  2Y74 A;  3I0Y A;  4BTY A;  1AQZ A;  5AIG A;  1VQ4 3;  2E2V A;  3G16 A;  3AGN A;  4RNZ A;  1GMP A;  1W00 A;  1RN1 A;  1TJD A;  2ZDJ A;  1W6Y A;  2OCT A;  5EEO A;  3J7Y d;  2OWP A;  4LMI A;  3KKG A;  7STD A;  4EC6 A;  4CDL A;  1ROA A;  3D5G A;  3V92 A;  4J5G A;  3WHO A;  4HKV B;  2BMQ B;  5G1K A;  1VQM 3;  1VQL 3;  1VQ7 3;  2CG1 A;  2J8X B;  1FYS A;  3OWS A;  1D6Y A;  1EUI C;  2M7O A;  3B4P A;  3CPW 2;  1O7N B;  2KF6 A;  4AEQ A;  2CG0 A;  4MEI A;  1LRA A;  1RCK A;  3K9M C;  1UDI I;  1BNF A;  3UB1 A;  1FGR A;  3G71 3;  3JUM A;  2SAR A;  5RNT A;  1VQP 3;  3A5E A;  1VQ8 3;  1IT8 A;  4KZ1 A;  2QEX 3;  2O9U X;  1CYU A;  1JB4 A;  4N6N B;  2L1S A;  4OUQ A;  1ISK A;  2W6J H;  2L4V A;  3DUK A;  1BSA A;  3EN1 B;  3F8H A;  2CH9 A;  3CCS 3;  4MJD A;  1N8R 4;  4J8T A;  3EB8 A;  1W7C A;  1SAR A;  1UCJ A;  1T5Y A;  3PS8 A;  1K8A 4;  1BRS A;  1OH0 A;  3SOY A;  4MMZ B;  1JV2 B;  2FXT A;  2WGQ A;  3PCR A;  1NNV A;  3D3L A;  1RN4 A;  1UCI A;  3NQZ A;  4IIA A;  1BSE A;  3IJE B;  2GBX B;  5M1A A;  2CX1 A;  4HAA A;  5AIF A;  1ZX2 A;  5CF2 A;  1BRK A;  1IV7 A;  2Y73 A;  3FCS B;  4XBY A;  3CCU 3;  3KE7 A;  3LZA A;  3AHS A;  3Q3F A;  3WOE B;  2HMN B;  1F8N A;  1OUN A;  1D6U A;  1O7M B;  1MGR A;  1M1K 4;  3LTB A;  4WFO A;  3LML A;  1QAF A;  4HM8 B;  2LQV A;  4EW5 A;  1MWU A;  2RGQ A;  4X2O A;  2XSH B;  3G4S 3;  4FMB A;  2XR8 B;  3EN8 A;  4WWU C;  1KD1 4;  1W6C A;  1OHP A;  3M8C A;  1RGC A;  1B2X A;  2W0Q A;  4XB5 A;  1T2H A;  1B2S A;  1Q86 4;  4BU4 A;  4I4K A;  1IQ8 A;  2XEP A;  4HM5 B;  1NJI 4;  3UL6 A;  3CCE 3;  3K0Z A;  4L8O A;  1BRI A;  4GSP A;  3I55 3;  1PYL A;  3X40 A;  1FW7 A;  3DZL A;  3BNB A;  4ORL A;  1LNH A;  1RDS A;  3DXO A;  1O7W B;  1A2V A;  4LGQ A;  4HM2 B;  1SIH A;  1GSP A;  3NBB A;  4O8S A;  2FNQ A;  3FLJ A;  2FGT A;  1CEW I;  1E3R A;  4HM4 B;  1BNS A;  1JB2 A;  1PY3 A;  2RSX A;  3DGN A;  1GD3 A;  1JKG A;  1DET A;  1YNV X;  3ALA A;  3GRD A;  4RBN A;  1JN5 B;  3NV0 B;  2JDI H;  2Z76 A;  4FCZ A;  1U5O A;  2HMO B;  3NBR A;  5EQL A;  3BLZ A;  4HZ9 B;  1DYU A;  2KF4 A;  1YJN 3;  2GSP A;  3K7C A;  3DGY A;  2CFG A;  3CCV 3;  4GHO A;  1QMA A;  1W2Z A;  3RGR A;  1RGH A;  1IK3 A;  2GU3 A;  3X3Z A;  1YJW 3;  1LQM B;  3K63 A;  3S67 A;  3CNX A;  4AKY A;  5BIR A;  1W4N A;  2K0M A;  1RGG A;  3UL5 A;  4WYK A;  1NB5 I;  1UCK A;  3GZX B;  2YX9 A;  3NX0 A;  2MC8 A;  1FZU A;  2GBW B;  1B21 A;  1M90 4;  1JJ2 2;  2B1X B;  1B3S A;  3MHE A;  3RDE A;  2BIR A;  1N8Q A;  1HZ1 A;  1WTH A;  3AMO B;  1RLS A;  1IVV A;  4LZI A;  2BMO B;  1B2Z A;  3DGO A;  1I8V A;  2W2C A;  1NO3 A;  2Q07 A;  1I0V A;  1LOV A;  1RRL A;  1TTO A;  5BU4 A;  3H51 A;  2CIU A;  1B27 A;  4R80 A;  4FCM A;  1AV4 A;  3RGA A;  1OGX A;  1YVB I;  5AIH A;  2F99 A;  1TU5 A;  1UI8 A;  5LC6 A;  1TRP A;  4CPK A;  1TUH A;  5D83 A;  1RMS A;  3CCJ 3;  1TRQ A;  3EHC A;  4GB5 A;  3SVA A;  3JVC A;  3AHW A;  1G96 A;  3LYG A;  1GMQ A;  3N9H A;  2F5M A;  1DMM A;  2W9P A;  1L5G B;  1GY5 A;  5AII A;  1NDO B;  1RHL A;  5AI1 A;  1UGH I;  2P0M A;  3JUQ A;  3PXM A;  3ZG0 A;  1EEJ A;  4ZM8 A;  1ZS7 A;  4N6U A;  1VQ9 3;  4N6V 0;  1I70 A;  1OPY A;  2XRX B;  2BHM A;  4N6L A;  2HMM B;  2JQ5 A;  1QVF 2;  1Y4K A;  4K90 B;  4L8P A;  5JPP A;  3CC2 3;  3U97 A;  3HIG A;  3URP A;  3BND A;  5CLK A;  3EE1 A;  3HOH A;  3D5I A;  3CME 3;  3UJM A;  1ROV A;  2YFI B;  3X41 A;  2XFT A;  1FUS A;  1UW1 A;  3DH2 A;  2AAD A;  4H61 A; 
#chains in the Genus database with same CATH homology
 3AHS A;  3Q3F A;  2BU4 A;  1DE3 A;  2C4B A;  2F56 A;  3RNT A;  1MGR A;  2HOH A;  1BVI A;  1YVS A;  1X1Y A;  6RNT A;  1T2I A;  1BAO A;  1BOX A;  1B20 A;  1BGS A;  1I0X A;  1BNI A;  1GMR A;  1I3I A;  1R4Y A;  1YGW A;  1A2P A;  1BRN L;  1RGC A;  1B2X A;  1T2H A;  1LOY A;  1B2S A;  1I2G A;  4BU4 A;  1C54 A;  2KF3 A;  1BRI A;  4GSP A;  7RNT A;  1PYL A;  1FW7 A;  1RGL A;  1RGK A;  1FUT A;  1BSC A;  2F4Y A;  1RGF A;  1RDS A;  1RTU A;  3AGO A;  1JBS A;  1RGE A;  3BIR A;  6GSP A;  1GSP A;  1IYY A;  2F5W A;  7GSP A;  3SYU A;  2AAD A;  1BAN A;  1BNG A;  5HOH A;  1JBT A;  1RSN A;  1BNS A;  1PY3 A;  1BIR A;  1RCL A;  1DET A;  1CH0 A;  1YNV X;  3D4A A;  2RNT A;  2KF4 A;  4J5K A;  2GSP A;  1GOU A;  3DGY A;  4GHO A;  4BIR A;  1RGH A;  1RNT A;  1I2F A;  9RNT A;  3GSP A;  1ZGX A;  1GOV A;  4HOH A;  5BIR A;  1JBR A;  1RGG A;  1UCK A;  2RBI A;  1AQZ A;  1BNR A;  1FZU A;  1B21 A;  2ZA4 A;  1BU4 A;  3AGN A;  1B3S A;  2BIR A;  1GMP A;  1HZ1 A;  1RN1 A;  2KF5 A;  1B2Z A;  1I8V A;  1I0V A;  1HYF A;  3D5G A;  1LOV A;  4J5G A;  3WHO A;  1G02 A;  1TTO A;  5BU4 A;  1B27 A;  1UCL A;  4RNT A;  1RGA A;  1FYS A;  1X1W A;  1AY7 A;  2KF6 A;  1B2U A;  1TRP A;  1B2M A;  1LRA A;  1RCK A;  1RMS A;  1TRQ A;  1BRJ A;  3AHW A;  1BNF A;  2SAR A;  5RNT A;  3A5E A;  1GMQ A;  1LNI A;  3BU4 A;  2F5M A;  1RNB A;  1BNE A;  1I3F A;  1BNJ A;  2KAA A;  1RHL A;  1BSA A;  3WR2 A;  1MGW A;  1BUJ A;  1SAR A;  1I2E A;  1I70 A;  1UCJ A;  1X1X A;  1BRS A;  1GOY A;  1LOW A;  3KCH A;  1X1U A;  5GSP A;  1BSB A;  8RNT A;  1BRH A;  1BRG A;  3URP A;  1Q9E A;  2AAE A;  1RN4 A;  1UCI A;  3HOH A;  1BSE A;  3D5I A;  4HAA A;  1BRK A;  1BSD A;  1FUS A;  3DH2 A;  1RLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...