1HYFA

Ribonuclease t1 v16a mutant in complex with sr2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hyfA00
1RNBA 1RGKA 1RGCA 7GSPA 1GMRA 1I2EA 1UCKA 1X1UA 2GSPA 1BSAA 4GHOA 5RNTA 1BNGA 1RNTA 1BSBA 1B2SA 1JBSA 2C4BA 1BSCA 2F5MA 1UCLA 1I0VA 1ZGXA 3WHOA 6RNTA 1TRQA 1LRAA 1HZ1A 1I2FA 1DETA 1BANA 1RN4A 1MGWA 1FUSA 2KF5A 1T2IA 1B20A 1BIRA 1RMSA 1BSEA 1PYLA 1Q9EA 1TRPA 2AAEA 4BU4A 3GSPA 9RNTA 1LOVA 1LOWA 1HYFA 1LOYA 1PY3A 1BRJA 1RGEA 7RNTA 1RDSA 1BU4A 1BVIA 1R4YA 3WR2A 1BRHA 3D4AA 1FZUA 3URPA 1BUJA 1B2ZA 1RCKA 1RN1A 1B27A 1AQZA 1BOXA 1C54A 1UCJA 1BNIA 1YVSA 1SARA 1RGFA 2SARA 1RHLA 1B21A 1B2UA 1FW7A 1GMQA 1I0XA 1BRSA 1GSPA 3DH2A 1RGGA 1AY7A 1I8VA 1BNRA 2HOHA 1I3FA 1RTUA 1GOVA 3AGOA 2BIRA 1I70A 1X1XA 2AADA 3RNTA 3A5EA 1A2PA 2KAAA 5HOHA 3SYUA 2RNTA 3D5IA 1RCLA 3AHWA 1YNVX 5BU4A 2F4YA 3AGNA 1RGHA 1BGSA 5GSPA 1YGWA 1BAOA 2KF4A 1CH0A 1G02A 2RBIA 2ZA4A 1JBRA 1B2MA 1GOYA 5BIRA 1BRIA 3Q3FA 3BU4A 2KF3A 1JBTA 1RLSA 1RGLA 3D5GA 1GOUA 4GSPA 1RGAA 1UCIA 1BNFA 1T2HA 3BIRA 1MGRA 3DGYA 4HAAA 4HOHA 4J5KA 4BIRA 1B3SA 6GSPA 1BRGA 1I2GA 1FUTA 1BNJA 3HOHA 1X1WA 4RNTA 1B2XA 1TTOA 1BNSA 3KCHA 2BU4A 2F5WA 1BSDA 1X1YA 1RSNA 4J5GA 1BNEA 1DE3A 1BRKA 2F56A 1LNIA 1I3IA 3AHSA 1GMPA 1IYYA 2KF6A 8RNTA 1BRNL 1FYSA
chains in the Genus database with same CATH superfamily
1Q40A 1AVKA 1AV4A 1JB5A 1ROAA 3DUKA 1AVLA 3DM8A 3NQYA 1STDA 2OTL3 4XDVA 4WP5A 1UUVB 2F99A 1TU5A 1UCKA 3LTDA 2GSPA 3ZFZA 5ELUA 4BTYA 2ZL8A 4NPBA 5RNTA 1YI23 3VSYA 3FLJA 2CWTA 5AEWB 1BSBA 5G2GA 5M1AA 1N9EA 2CFWA 5AYRB 1B2SA 3GZRA 4GB5A 1JBSA 1T3BA 1Q42A 2C10A 4NREA 2C4BA 5CF1A 2F5MA 2MF7A 1I0VA 4HZ9B 3MSOA 4HM7B 5IENA 1VQ93 3SX1A 1IT7A 1RN4A 2R41A 3EF8A 3KZTA 1W4NA 1F8NA 2A15A 2C11A 1O7NB 3STDA 3KSED 2HMJB 3GZBA 3FG1A 3FG3A 1CYUA 3V99A 1IVVA 1JJ22 3CXC2 9RNTA 3CMA3 1NWWA 3UNLA 3LOYA 2HMKB 3CPW2 4N6TA 1HYFA 3D9RA 3UL6A 4AEQA 1LOYA 3VGNA 2XF3A 1RDSA 1BU4A 1SIIA 2XSHB 3U1WA 3WR2A 3WDGB 3B8LA 3JUPA 1BRHA 4KFEA 5AIHA 3PS8A 2QA43 3K5TA 3BNBA 1W2ZA 1BOXA 1JZOA 4CJNA 1BNIA 3WMDA 1IVXA 1SARA 2D1WA 1N5HA 3JUMA 1FW7A 3DZLA 3F7XA 1RGGA 1EA2A 2GU1A 3BB9A 5JPPA 2IYJA 1AY7A 4L8PA 2YFLB 5BVBA 2OCTA 3D3LA 3GZXB 2HOHA 2STDA 1I3FA 1QJGA 3DMCA 2F86B 1ROVA 4N6MA 4R9LA 4AKZA 1YJN3 1SJWA 1MWRA 3RNTA 3VF1A 1Q864 5AIGA 1A2PA 1WMNA 5HOHA 1ULJB 2RNTA 4KT3B 3SYUA 1O7MB 4R80A 3EC9A 3AHWA 5CK6A 1VQO3 4EXRA 1AR0A 3B7CA 3FSDA 1QAFA 1SPUA 1TFKA 2GEYA 3CCE3 5BU4A 3LYGA 1K41A 3D79A 3AGNA 3OXAA 5IF6A 4ORLA 1UW1A 4LGQA 5GSPA 2KF4A 1UGIA 2RBIA 3F9SA 3Q1CA 4OVMA 1NB5I 1GOYA 1E3RA 1BRIA 1UDII 4KFDA 4HJLB 4RZMA 1DMNA 4BTXA 3BU4A 2KF3A 2BMOB 3G0KA 3LMLA 1JV2B 1S5AA 3D5GA 2BHMA 4N6NB 2W56A 4OK0A 3EBYA 3QK9A 3S29A 1Q7Y4 4G1MB 2CG1A 3PCRA 3BNDA 3F8HA 1RRLA 2WGOA 4J5KA 1GYBA 2OQEC 3F7SA 1B3SA 1O7PB 3CCJ3 1OHPA 1OF5A 1OH0A 5D83A 1V74A 2CFLA 3NBBA 1B2XA 4PEJA 1PFPA 4R1KA 2W56B 3KCHA 3WA2X 4BL2A 1IT8A 2XSOB 2PNCA 1STFI 2CG0A 2YX9A 1OGXA 1LOXA 4IPBA 4N6V0 1BRKA 1M1XB 3CCR3 1LNIA 1ASKA 1OF5B 2CX1A 1MWTA 1IYYA 1OGZA 1BRNL 3H51A 3NQZA 4FMCA 1FYSA 3S28A 3SXXA 2ML5A 3EBTA 2MC8A 1RNBA 1TJDA 2FGTA 7GSPA 1K734 1GMRA 1V57A 4HM4B 1X1UA 1G96A 3HX8A 2CKFB 3DY5A 3FG4A 4FCMA 1NB3I 3OWUA 3OX9A 5AIFA 1RJOA 1JRQA 1LQGC 2B24B 2CHCA 3CCM3 1YIJ3 3G6E3 4N6LA 1WTHA 2LQVA 2W2CA 1D6YA 1D6ZA 2W04A 2QEX3 2FNQA 3V98A 3WHOA 3B4PA 3OWYA 1GD4A 4KVHA 3JUNA 3RGRA 1IQ8A 1FUSA 4CCVA 4I4KA 3G713 1VQK3 1BIRA 3PXMA 1RMSA 3EB8A 1BSEA 1JKGA 2IA7A 4EYCA 4XBTA 2XEPA 2OQEA 3CCS3 1D6UA 3EQQB 4HKVB 1LOVA 1PU4A 3ZG0A 3GZYB 5KP4A 5KP1A 3I563 1C7HA 2SBLA 3BNEA 1W6CA 1W7CA 1BRJA 2CIUA 1JKGB 1BVIA 3EE1A 5M18A 3ZG5A 4RNZA 3WA3A 1MNLA 1IU7A 5EQLA 2WOFA 1BUJA 1CEWI 1KWIA 3Q2PA 3S27A 1RCKA 1RN1A 1JB2A 1B27A 1AQZA 2IUKA 3FKAA 1UCJA 1SQWA 3N8BA 1GY6A 2SARA 1B21A 4KFFA 5IEOA 2CWVA 4FR9A 1K9M4 3BLZA 3WOFB 1IVUA 3LH4A 2XRXB 3CCL3 5ELJA 2KRTA 2XFSA 2BIRA 2H0IA 1SIHA 1X1XA 2AADA 4BL3A 3E99A 2KAAA 3GAXA 1N5PA 3KE7A 1ISKA 2RCDA 1KD14 2BO9B 3F40A 4FCJA 3HIGA 1M1K4 3ALAA 3DXOA 3CU3A 1YNVX 2D42A 3EX9A 2P0MA 2CC3A 4EV5A 3X40A 5G1KA 1LXEA 1RRHA 3KSPA 1YGWA 4L7KA 1CH0A 4HYZA 5JPUA 1OCVA 2ZA4A 3KN4A 1JBRA 2V1LA 3FGYA 3Q3FA 4J8TA 4J9AA 4K61A 3WODG 4U13A 4NHFA 1YVBI 1EG9B 1RGLA 2BT3A 4HM2B 3KIIA 1LQMB 2W9QA 1GOUA 2L1SA 4GSPA 4N6OB 5M19A 3G8ZA 1ZS7A 2IY2A 3DGNA 3CNMA 5EVHA 3S5CA 1A90A 2O3OA 2CWUA 1UCIA 2E2VA 4K1UA 2BNGA 4BIRA 4LEHA 1VQ83 3CC23 3UB1A 1QVF2 1BRGA 2INXA 4EW5A 1BNJA 1OHSA 3FH1A 3HOHA 2YFJB 1X1WA 3B4OA 1HKXA 2GBXB 2GU3A 2JDIH 4HZBB 1TTOA 1BNSA 4GL6A 4MEIA 3TDGA 5LC7A 2K0MA 1EQKA 2YFIB 4RBNA 2UX0A 1FGTA 2BU4A 2RFRA 1YJ93 3QRDA 4R9KA 1RSNA 3IJEB 1NO3A 3KKGA 1KC84 1BNEA 1DE3A 3ECFA 4WWUC 2F56A 3AHSA 1GMPA 2CFDA 4LZIA 2Z76A 5LC6A 1DYUA 2J8XB 2I9WA 1QVG2 1YIT3 4OUQA 3CC43 3FF0A 2PZVA 4WFOA 1RGCA 3L0RA 3T8UA 4QWTA 3U97A 5IG4A 1I2EA 2CW9A 3M8CA 2Q07A 3ROBA 1TP6A 1BSAA 1MWSA 2RSXA 2BMRB 1BNGA 3EN8A 1VQM3 1W6GA 1N9JA 1WQLB 1W01A 4X2HA 5CF2A 1Z1SA 2KCDA 4WYKA 2K54A 2Y73A 1UCLA 2ZDJA 4XM4A 4O2HA 1FGOA 4FCZA 1LRAA 3AMOA 5IG0A 3MG2A 2CX0A 1I2FA 3EHCA 5A0OB 5I97A 5CXOA 3CC73 3SOAA 2KF5A 5AI1A 1B20A 2OWPA 1W6YA 2ML6A 4WYKB 5TGNA 1WMPA 3A76A 1RKYA 3Q90A 1OHOA 2AAEA 3K7CA 4BU4A 1IV9A 3GSPA 3ER7A 3DGLA 3AMOB 1N8QA 3FCSB 1LOWA 5AYSC 2WO0A 4XBYA 1IDPA 3JUQA 3CME3 4AKYA 1IK3A 1M904 2GEXA 1PY3A 1RGEA 7RNTA 1ZX2A 2Z77A 5CLKA 1R4YA 2LYXA 1NNVA 2XGLA 3D4AA 4H3UA 1FZUA 1WNHA 3URPA 1Y4KA 2Y74A 1FA3A 1B2ZA 5FGOA 3N54B 5AIIA 5HGRA 1C54A 1W00A 2UGIA 1YVSA 4R4KA 1A67A 2E2UA 2E2TA 4ILFA 1RGFA 3CD63 5D82A 1GMQA 1I0XA 1BRSA 1GSPA 2GBWB 1IVWA 3DH2A 2XH9A 1UUGB 2CK3H 1RN7A 3N9HA 1BUQA 2P0XA 3AGOA 1LNHA 2H0HA 3X41A 4CDLA 4XBXA 3MG1A 3A5EA 2M7OA 1O7WB 1RCLA 2P38A 3LT9A 1A2KA 4DKIA 2W9PA 1KQS2 4JF8A 1GD3A 4TX4A 2JQ5A 5D81A 2BMQB 2W6JH 3WOEB 4EBGA 1IQYA 1RGHA 1BGSA 2FXTA 1JB4A 2H0GA 2R4IA 3OW22 2Z6BA 1BAOA 3K0ZA 2Z7AA 1K28A 1FUWA 4STDA 1R4CA 4K90B 1B2MA 5BIRA 3MYTA 4BTWA 2WGQA 1JBTA 1RLSA 1QAKA 1G0TA 5IW9A 3CCQ3 3MPHA 1M9GA 5FW5A 1RGAA 1BNFA 1T2HA 1MGRA 3G16A 2GXFA 1NU3A 4L8OA 3X3YA 1I2GA 1OACA 1JN5B 3UJMA 3EN1B 3SEDA 4H61A 2HMLB 3K63A 1Q40B 3FZWA 4LMIA 4O02B 1FGQA 3OV4A 2F5WA 1BSDA 1X1YA 3DGMA 2CH9A 1I3IA 1YGEA 4IIAA 2OOVA 2KF6A 5DREA 8RNTA 2L4VA 3KFQC 3LT8A 1O7HB 2XGNA 3T0UA 2HMMB 4IT7A 1RGKA 4XB5A 3CNXA 3HIIA 3X3XA 3V92A 3NM7A 3FF2A 1KSIA 4HM0B 4RNYA 1V58A 3F14A 3LTBA 4GHOA 1VQ43 1RNTA 2W03A 3NUVA 3GRDA 3J7Yd 3NHXA 3BNCA 1NJI4 4EC6A 4LSOA 1VQP3 5AEUB 5DRVA 3MWZA 1BSCA 3NV0A 4K1VA 2OTJ3 1UI8A 1NDOB 1J2BA 1HU9A 1ZGXA 1TIJA 6RNTA 1TRQA 1L5GB 1HZ1A 3LXUX 1DETA 1BANA 5STDA 1MGWA 3SOYA 4I5QA 1T2IA 1W02A 1K8A4 1OUNA 1TUHA 3NM2A 2IMJA 4MJDA 5BXQA 4WHAA 1PYLA 2QIYA 3LZAA 1Q9EA 4Q53A 1ZO2A 3NV0B 5IG3A 3HI7A 1TRPA 3MKIA 1VQ63 4MMZB 5IG5A 5IEPA 1DMMA 2IUJA 1YHQ3 3CCV3 5KP3A 1FGRA 1DMQA 2XFTA 1O7GB 2W0QA 3RDEA 3MHEA 4MMXB 1MWUA 4O8SA 1S723 1EKMA 1JZDA 3NBRA 1VZZA 4HM1B 1EUIC 1UUWB 5IERA 1RHLA 4FMDA 1B2UA 3IMAB 2F98A 3PCSA 3O8YA 3SVAA 1QALA 1UGHI 3HK4A 4O3VA 3OWSA 1ULIB 3PZWA 3X42A 1Q814 3CCU3 1I8VA 4HVNA 1W2B2 8CHOA 4CPKA 1RTUA 2K3DA 1Q7HA 1GOVA 2WOHA 6STDA 1VQQA 1I70A 1YJW3 3EJVA 1CQSA 3SLUA 3UL5A 1MOLA 4HM6B 5G1LA 1GS3A 1IV7A 1CYVA 3D5IA 4X2OA 1WMOA 2B1XB 2UUGC 1A2VA 4HM3B 4FMBA 1US1A 1EEJA 3IPTA 1IQXA 2F4YA 2RGQA 2CFGA 3H3HA 2P05A 4HM8B 1JNQA 3G4S3 1GY7A 3PGBA 1G02A 3S67A 4HBRA 3LTCA 5JBSA 1TFOA 1FGMA 3NBJA 2ZHXB 4KZ1A 4N3VA 3JVCA 1VQ73 1DVCA 1U8CB 4LYLB 1LVNA 2KXGA 4MMYB 1OPYA 3K9MC 1UI7A 4ZM8A 3NX0A 1VQN3 1DVDA 3NXJA 2OOVC 1QMAA 1GY5A 4XDWA 3BIRA 1N8R4 3DGYA 4HAAA 4HOHA 4EV2A 6GSPA 3MG3A 5EEOA 1U5OA 3X3ZA 1FUTA 1T5YA 3I553 4RNTA 3JUOA 1VQL3 2CFKA 3DGOA 4FMAA 1Q824 7STDA 2QGUA 4JRFA 1E3VA 4J5GA 2P09A 2XR8B 1VQ53 3GWRA 3PYJA 1BNRA 3CPOA 3HZPA 1W5ZA 4HM5B 3LTAA 3F8XA 2HMOB 4N6UA 3RGAA 1JN5A 2HMNB 2O9UX 1E97A 3T8NA 3I0YA
chains in the Genus database with same CATH topology
1RNBA 1RGKA 1RGCA 7GSPA 1GMRA 1I2EA 1UCKA 1X1UA 2GSPA 1BSAA 4GHOA 5RNTA 1BNGA 1RNTA 1BSBA 1B2SA 1JBSA 2C4BA 1BSCA 2F5MA 1UCLA 1I0VA 1ZGXA 3WHOA 6RNTA 1TRQA 1LRAA 1HZ1A 1I2FA 1DETA 1BANA 1RN4A 1MGWA 1FUSA 2KF5A 1T2IA 1B20A 1BIRA 1RMSA 1BSEA 1PYLA 1Q9EA 1TRPA 2AAEA 4BU4A 3GSPA 9RNTA 1LOVA 1LOWA 1HYFA 1LOYA 1PY3A 1BRJA 1RGEA 7RNTA 1RDSA 1BU4A 1BVIA 1R4YA 3WR2A 1BRHA 3D4AA 1FZUA 3URPA 1BUJA 1B2ZA 1RCKA 1RN1A 1B27A 1AQZA 1BOXA 1C54A 1UCJA 1BNIA 1YVSA 1SARA 1RGFA 2SARA 1RHLA 1B21A 1B2UA 1FW7A 1GMQA 1I0XA 1BRSA 1GSPA 3DH2A 1RGGA 1AY7A 1I8VA 1BNRA 2HOHA 1I3FA 1RTUA 1GOVA 3AGOA 2BIRA 1I70A 1X1XA 2AADA 3RNTA 3A5EA 1A2PA 2KAAA 5HOHA 3SYUA 2RNTA 3D5IA 1RCLA 3AHWA 1YNVX 5BU4A 2F4YA 3AGNA 1RGHA 1BGSA 5GSPA 1YGWA 1BAOA 2KF4A 1CH0A 1G02A 2RBIA 2ZA4A 1JBRA 1B2MA 1GOYA 5BIRA 1BRIA 3Q3FA 3BU4A 2KF3A 1JBTA 1RLSA 1RGLA 3D5GA 1GOUA 4GSPA 1RGAA 1UCIA 1BNFA 1T2HA 3BIRA 1MGRA 3DGYA 4HAAA 4HOHA 4J5KA 4BIRA 1B3SA 6GSPA 1BRGA 1I2GA 1FUTA 1BNJA 3HOHA 1X1WA 4RNTA 1B2XA 1TTOA 1BNSA 3KCHA 2BU4A 2F5WA 1BSDA 1X1YA 1RSNA 4J5GA 1BNEA 1DE3A 1BRKA 2F56A 1LNIA 1I3IA 3AHSA 1GMPA 1IYYA 2KF6A 8RNTA 1BRNL 1FYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RNB A;  1RGK A;  1RGC A;  7GSP A;  1GMR A;  1I2E A;  1UCK A;  1X1U A;  2GSP A;  1BSA A;  4GHO A;  5RNT A;  1BNG A;  1RNT A;  1BSB A;  1B2S A;  1JBS A;  2C4B A;  1BSC A;  2F5M A;  1UCL A;  1I0V A;  1ZGX A;  3WHO A;  6RNT A;  1TRQ A;  1LRA A;  1HZ1 A;  1I2F A;  1DET A;  1BAN A;  1RN4 A;  1MGW A;  1FUS A;  2KF5 A;  1T2I A;  1B20 A;  1BIR A;  1RMS A;  1BSE A;  1PYL A;  1Q9E A;  1TRP A;  2AAE A;  4BU4 A;  3GSP A;  9RNT A;  1LOV A;  1LOW A;  1HYF A;  1LOY A;  1PY3 A;  1BRJ A;  1RGE A;  7RNT A;  1RDS A;  1BU4 A;  1BVI A;  1R4Y A;  3WR2 A;  1BRH A;  3D4A A;  1FZU A;  3URP A;  1BUJ A;  1B2Z A;  1RCK A;  1RN1 A;  1B27 A;  1AQZ A;  1BOX A;  1C54 A;  1UCJ A;  1BNI A;  1YVS A;  1SAR A;  1RGF A;  2SAR A;  1RHL A;  1B21 A;  1B2U A;  1FW7 A;  1GMQ A;  1I0X A;  1BRS A;  1GSP A;  3DH2 A;  1RGG A;  1AY7 A;  1I8V A;  1BNR A;  2HOH A;  1I3F A;  1RTU A;  1GOV A;  3AGO A;  2BIR A;  1I70 A;  1X1X A;  2AAD A;  3RNT A;  3A5E A;  1A2P A;  2KAA A;  5HOH A;  3SYU A;  2RNT A;  3D5I A;  1RCL A;  3AHW A;  1YNV X;  5BU4 A;  2F4Y A;  3AGN A;  1RGH A;  1BGS A;  5GSP A;  1YGW A;  1BAO A;  2KF4 A;  1CH0 A;  1G02 A;  2RBI A;  2ZA4 A;  1JBR A;  1B2M A;  1GOY A;  5BIR A;  1BRI A;  3Q3F A;  3BU4 A;  2KF3 A;  1JBT A;  1RLS A;  1RGL A;  3D5G A;  1GOU A;  4GSP A;  1RGA A;  1UCI A;  1BNF A;  1T2H A;  3BIR A;  1MGR A;  3DGY A;  4HAA A;  4HOH A;  4J5K A;  4BIR A;  1B3S A;  6GSP A;  1BRG A;  1I2G A;  1FUT A;  1BNJ A;  3HOH A;  1X1W A;  4RNT A;  1B2X A;  1TTO A;  1BNS A;  3KCH A;  2BU4 A;  2F5W A;  1BSD A;  1X1Y A;  1RSN A;  4J5G A;  1BNE A;  1DE3 A;  1BRK A;  2F56 A;  1LNI A;  1I3I A;  3AHS A;  1GMP A;  1IYY A;  2KF6 A;  8RNT A;  1BRN L;  1FYS A; 
#chains in the Genus database with same CATH topology
 1Q40 A;  1AVK A;  1AV4 A;  1JB5 A;  1ROA A;  3DUK A;  1AVL A;  3DM8 A;  3NQY A;  1STD A;  2OTL 3;  4XDV A;  4WP5 A;  1UUV B;  2F99 A;  1TU5 A;  1UCK A;  3LTD A;  2GSP A;  3ZFZ A;  5ELU A;  4BTY A;  2ZL8 A;  4NPB A;  5RNT A;  1YI2 3;  3VSY A;  3FLJ A;  2CWT A;  5AEW B;  1BSB A;  5G2G A;  5M1A A;  1N9E A;  2CFW A;  5AYR B;  1B2S A;  3GZR A;  4GB5 A;  1JBS A;  1T3B A;  1Q42 A;  2C10 A;  4NRE A;  2C4B A;  5CF1 A;  2F5M A;  2MF7 A;  1I0V A;  4HZ9 B;  3MSO A;  4HM7 B;  5IEN A;  1VQ9 3;  3SX1 A;  1IT7 A;  1RN4 A;  2R41 A;  3EF8 A;  3KZT A;  1W4N A;  1F8N A;  2A15 A;  2C11 A;  1O7N B;  3STD A;  3KSE D;  2HMJ B;  3GZB A;  3FG1 A;  3FG3 A;  1CYU A;  3V99 A;  1IVV A;  1JJ2 2;  3CXC 2;  9RNT A;  3CMA 3;  1NWW A;  3UNL A;  3LOY A;  2HMK B;  3CPW 2;  4N6T A;  1HYF A;  3D9R A;  3UL6 A;  4AEQ A;  1LOY A;  3VGN A;  2XF3 A;  1RDS A;  1BU4 A;  1SII A;  2XSH B;  3U1W A;  3WR2 A;  3WDG B;  3B8L A;  3JUP A;  1BRH A;  4KFE A;  5AIH A;  3PS8 A;  2QA4 3;  3K5T A;  3BNB A;  1W2Z A;  1BOX A;  1JZO A;  4CJN A;  1BNI A;  3WMD A;  1IVX A;  1SAR A;  2D1W A;  1N5H A;  3JUM A;  1FW7 A;  3DZL A;  3F7X A;  1RGG A;  1EA2 A;  2GU1 A;  3BB9 A;  5JPP A;  2IYJ A;  1AY7 A;  4L8P A;  2YFL B;  5BVB A;  2OCT A;  3D3L A;  3GZX B;  2HOH A;  2STD A;  1I3F A;  1QJG A;  3DMC A;  2F86 B;  1ROV A;  4N6M A;  4R9L A;  4AKZ A;  1YJN 3;  1SJW A;  1MWR A;  3RNT A;  3VF1 A;  1Q86 4;  5AIG A;  1A2P A;  1WMN A;  5HOH A;  1ULJ B;  2RNT A;  4KT3 B;  3SYU A;  1O7M B;  4R80 A;  3EC9 A;  3AHW A;  5CK6 A;  1VQO 3;  4EXR A;  1AR0 A;  3B7C A;  3FSD A;  1QAF A;  1SPU A;  1TFK A;  2GEY A;  3CCE 3;  5BU4 A;  3LYG A;  1K41 A;  3D79 A;  3AGN A;  3OXA A;  5IF6 A;  4ORL A;  1UW1 A;  4LGQ A;  5GSP A;  2KF4 A;  1UGI A;  2RBI A;  3F9S A;  3Q1C A;  4OVM A;  1NB5 I;  1GOY A;  1E3R A;  1BRI A;  1UDI I;  4KFD A;  4HJL B;  4RZM A;  1DMN A;  4BTX A;  3BU4 A;  2KF3 A;  2BMO B;  3G0K A;  3LML A;  1JV2 B;  1S5A A;  3D5G A;  2BHM A;  4N6N B;  2W56 A;  4OK0 A;  3EBY A;  3QK9 A;  3S29 A;  1Q7Y 4;  4G1M B;  2CG1 A;  3PCR A;  3BND A;  3F8H A;  1RRL A;  2WGO A;  4J5K A;  1GYB A;  2OQE C;  3F7S A;  1B3S A;  1O7P B;  3CCJ 3;  1OHP A;  1OF5 A;  1OH0 A;  5D83 A;  1V74 A;  2CFL A;  3NBB A;  1B2X A;  4PEJ A;  1PFP A;  4R1K A;  2W56 B;  3KCH A;  3WA2 X;  4BL2 A;  1IT8 A;  2XSO B;  2PNC A;  1STF I;  2CG0 A;  2YX9 A;  1OGX A;  1LOX A;  4IPB A;  4N6V 0;  1BRK A;  1M1X B;  3CCR 3;  1LNI A;  1ASK A;  1OF5 B;  2CX1 A;  1MWT A;  1IYY A;  1OGZ A;  1BRN L;  3H51 A;  3NQZ A;  4FMC A;  1FYS A;  3S28 A;  3SXX A;  2ML5 A;  3EBT A;  2MC8 A;  1RNB A;  1TJD A;  2FGT A;  7GSP A;  1K73 4;  1GMR A;  1V57 A;  4HM4 B;  1X1U A;  1G96 A;  3HX8 A;  2CKF B;  3DY5 A;  3FG4 A;  4FCM A;  1NB3 I;  3OWU A;  3OX9 A;  5AIF A;  1RJO A;  1JRQ A;  1LQG C;  2B24 B;  2CHC A;  3CCM 3;  1YIJ 3;  3G6E 3;  4N6L A;  1WTH A;  2LQV A;  2W2C A;  1D6Y A;  1D6Z A;  2W04 A;  2QEX 3;  2FNQ A;  3V98 A;  3WHO A;  3B4P A;  3OWY A;  1GD4 A;  4KVH A;  3JUN A;  3RGR A;  1IQ8 A;  1FUS A;  4CCV A;  4I4K A;  3G71 3;  1VQK 3;  1BIR A;  3PXM A;  1RMS A;  3EB8 A;  1BSE A;  1JKG A;  2IA7 A;  4EYC A;  4XBT A;  2XEP A;  2OQE A;  3CCS 3;  1D6U A;  3EQQ B;  4HKV B;  1LOV A;  1PU4 A;  3ZG0 A;  3GZY B;  5KP4 A;  5KP1 A;  3I56 3;  1C7H A;  2SBL A;  3BNE A;  1W6C A;  1W7C A;  1BRJ A;  2CIU A;  1JKG B;  1BVI A;  3EE1 A;  5M18 A;  3ZG5 A;  4RNZ A;  3WA3 A;  1MNL A;  1IU7 A;  5EQL A;  2WOF A;  1BUJ A;  1CEW I;  1KWI A;  3Q2P A;  3S27 A;  1RCK A;  1RN1 A;  1JB2 A;  1B27 A;  1AQZ A;  2IUK A;  3FKA A;  1UCJ A;  1SQW A;  3N8B A;  1GY6 A;  2SAR A;  1B21 A;  4KFF A;  5IEO A;  2CWV A;  4FR9 A;  1K9M 4;  3BLZ A;  3WOF B;  1IVU A;  3LH4 A;  2XRX B;  3CCL 3;  5ELJ A;  2KRT A;  2XFS A;  2BIR A;  2H0I A;  1SIH A;  1X1X A;  2AAD A;  4BL3 A;  3E99 A;  2KAA A;  3GAX A;  1N5P A;  3KE7 A;  1ISK A;  2RCD A;  1KD1 4;  2BO9 B;  3F40 A;  4FCJ A;  3HIG A;  1M1K 4;  3ALA A;  3DXO A;  3CU3 A;  1YNV X;  2D42 A;  3EX9 A;  2P0M A;  2CC3 A;  4EV5 A;  3X40 A;  5G1K A;  1LXE A;  1RRH A;  3KSP A;  1YGW A;  4L7K A;  1CH0 A;  4HYZ A;  5JPU A;  1OCV A;  2ZA4 A;  3KN4 A;  1JBR A;  2V1L A;  3FGY A;  3Q3F A;  4J8T A;  4J9A A;  4K61 A;  3WOD G;  4U13 A;  4NHF A;  1YVB I;  1EG9 B;  1RGL A;  2BT3 A;  4HM2 B;  3KII A;  1LQM B;  2W9Q A;  1GOU A;  2L1S A;  4GSP A;  4N6O B;  5M19 A;  3G8Z A;  1ZS7 A;  2IY2 A;  3DGN A;  3CNM A;  5EVH A;  3S5C A;  1A90 A;  2O3O A;  2CWU A;  1UCI A;  2E2V A;  4K1U A;  2BNG A;  4BIR A;  4LEH A;  1VQ8 3;  3CC2 3;  3UB1 A;  1QVF 2;  1BRG A;  2INX A;  4EW5 A;  1BNJ A;  1OHS A;  3FH1 A;  3HOH A;  2YFJ B;  1X1W A;  3B4O A;  1HKX A;  2GBX B;  2GU3 A;  2JDI H;  4HZB B;  1TTO A;  1BNS A;  4GL6 A;  4MEI A;  3TDG A;  5LC7 A;  2K0M A;  1EQK A;  2YFI B;  4RBN A;  2UX0 A;  1FGT A;  2BU4 A;  2RFR A;  1YJ9 3;  3QRD A;  4R9K A;  1RSN A;  3IJE B;  1NO3 A;  3KKG A;  1KC8 4;  1BNE A;  1DE3 A;  3ECF A;  4WWU C;  2F56 A;  3AHS A;  1GMP A;  2CFD A;  4LZI A;  2Z76 A;  5LC6 A;  1DYU A;  2J8X B;  2I9W A;  1QVG 2;  1YIT 3;  4OUQ A;  3CC4 3;  3FF0 A;  2PZV A;  4WFO A;  1RGC A;  3L0R A;  3T8U A;  4QWT A;  3U97 A;  5IG4 A;  1I2E A;  2CW9 A;  3M8C A;  2Q07 A;  3ROB A;  1TP6 A;  1BSA A;  1MWS A;  2RSX A;  2BMR B;  1BNG A;  3EN8 A;  1VQM 3;  1W6G A;  1N9J A;  1WQL B;  1W01 A;  4X2H A;  5CF2 A;  1Z1S A;  2KCD A;  4WYK A;  2K54 A;  2Y73 A;  1UCL A;  2ZDJ A;  4XM4 A;  4O2H A;  1FGO A;  4FCZ A;  1LRA A;  3AMO A;  5IG0 A;  3MG2 A;  2CX0 A;  1I2F A;  3EHC A;  5A0O B;  5I97 A;  5CXO A;  3CC7 3;  3SOA A;  2KF5 A;  5AI1 A;  1B20 A;  2OWP A;  1W6Y A;  2ML6 A;  4WYK B;  5TGN A;  1WMP A;  3A76 A;  1RKY A;  3Q90 A;  1OHO A;  2AAE A;  3K7C A;  4BU4 A;  1IV9 A;  3GSP A;  3ER7 A;  3DGL A;  3AMO B;  1N8Q A;  3FCS B;  1LOW A;  5AYS C;  2WO0 A;  4XBY A;  1IDP A;  3JUQ A;  3CME 3;  4AKY A;  1IK3 A;  1M90 4;  2GEX A;  1PY3 A;  1RGE A;  7RNT A;  1ZX2 A;  2Z77 A;  5CLK A;  1R4Y A;  2LYX A;  1NNV A;  2XGL A;  3D4A A;  4H3U A;  1FZU A;  1WNH A;  3URP A;  1Y4K A;  2Y74 A;  1FA3 A;  1B2Z A;  5FGO A;  3N54 B;  5AII A;  5HGR A;  1C54 A;  1W00 A;  2UGI A;  1YVS A;  4R4K A;  1A67 A;  2E2U A;  2E2T A;  4ILF A;  1RGF A;  3CD6 3;  5D82 A;  1GMQ A;  1I0X A;  1BRS A;  1GSP A;  2GBW B;  1IVW A;  3DH2 A;  2XH9 A;  1UUG B;  2CK3 H;  1RN7 A;  3N9H A;  1BUQ A;  2P0X A;  3AGO A;  1LNH A;  2H0H A;  3X41 A;  4CDL A;  4XBX A;  3MG1 A;  3A5E A;  2M7O A;  1O7W B;  1RCL A;  2P38 A;  3LT9 A;  1A2K A;  4DKI A;  2W9P A;  1KQS 2;  4JF8 A;  1GD3 A;  4TX4 A;  2JQ5 A;  5D81 A;  2BMQ B;  2W6J H;  3WOE B;  4EBG A;  1IQY A;  1RGH A;  1BGS A;  2FXT A;  1JB4 A;  2H0G A;  2R4I A;  3OW2 2;  2Z6B A;  1BAO A;  3K0Z A;  2Z7A A;  1K28 A;  1FUW A;  4STD A;  1R4C A;  4K90 B;  1B2M A;  5BIR A;  3MYT A;  4BTW A;  2WGQ A;  1JBT A;  1RLS A;  1QAK A;  1G0T A;  5IW9 A;  3CCQ 3;  3MPH A;  1M9G A;  5FW5 A;  1RGA A;  1BNF A;  1T2H A;  1MGR A;  3G16 A;  2GXF A;  1NU3 A;  4L8O A;  3X3Y A;  1I2G A;  1OAC A;  1JN5 B;  3UJM A;  3EN1 B;  3SED A;  4H61 A;  2HML B;  3K63 A;  1Q40 B;  3FZW A;  4LMI A;  4O02 B;  1FGQ A;  3OV4 A;  2F5W A;  1BSD A;  1X1Y A;  3DGM A;  2CH9 A;  1I3I A;  1YGE A;  4IIA A;  2OOV A;  2KF6 A;  5DRE A;  8RNT A;  2L4V A;  3KFQ C;  3LT8 A;  1O7H B;  2XGN A;  3T0U A;  2HMM B;  4IT7 A;  1RGK A;  4XB5 A;  3CNX A;  3HII A;  3X3X A;  3V92 A;  3NM7 A;  3FF2 A;  1KSI A;  4HM0 B;  4RNY A;  1V58 A;  3F14 A;  3LTB A;  4GHO A;  1VQ4 3;  1RNT A;  2W03 A;  3NUV A;  3GRD A;  3J7Y d;  3NHX A;  3BNC A;  1NJI 4;  4EC6 A;  4LSO A;  1VQP 3;  5AEU B;  5DRV A;  3MWZ A;  1BSC A;  3NV0 A;  4K1V A;  2OTJ 3;  1UI8 A;  1NDO B;  1J2B A;  1HU9 A;  1ZGX A;  1TIJ A;  6RNT A;  1TRQ A;  1L5G B;  1HZ1 A;  3LXU X;  1DET A;  1BAN A;  5STD A;  1MGW A;  3SOY A;  4I5Q A;  1T2I A;  1W02 A;  1K8A 4;  1OUN A;  1TUH A;  3NM2 A;  2IMJ A;  4MJD A;  5BXQ A;  4WHA A;  1PYL A;  2QIY A;  3LZA A;  1Q9E A;  4Q53 A;  1ZO2 A;  3NV0 B;  5IG3 A;  3HI7 A;  1TRP A;  3MKI A;  1VQ6 3;  4MMZ B;  5IG5 A;  5IEP A;  1DMM A;  2IUJ A;  1YHQ 3;  3CCV 3;  5KP3 A;  1FGR A;  1DMQ A;  2XFT A;  1O7G B;  2W0Q A;  3RDE A;  3MHE A;  4MMX B;  1MWU A;  4O8S A;  1S72 3;  1EKM A;  1JZD A;  3NBR A;  1VZZ A;  4HM1 B;  1EUI C;  1UUW B;  5IER A;  1RHL A;  4FMD A;  1B2U A;  3IMA B;  2F98 A;  3PCS A;  3O8Y A;  3SVA A;  1QAL A;  1UGH I;  3HK4 A;  4O3V A;  3OWS A;  1ULI B;  3PZW A;  3X42 A;  1Q81 4;  3CCU 3;  1I8V A;  4HVN A;  1W2B 2;  8CHO A;  4CPK A;  1RTU A;  2K3D A;  1Q7H A;  1GOV A;  2WOH A;  6STD A;  1VQQ A;  1I70 A;  1YJW 3;  3EJV A;  1CQS A;  3SLU A;  3UL5 A;  1MOL A;  4HM6 B;  5G1L A;  1GS3 A;  1IV7 A;  1CYV A;  3D5I A;  4X2O A;  1WMO A;  2B1X B;  2UUG C;  1A2V A;  4HM3 B;  4FMB A;  1US1 A;  1EEJ A;  3IPT A;  1IQX A;  2F4Y A;  2RGQ A;  2CFG A;  3H3H A;  2P05 A;  4HM8 B;  1JNQ A;  3G4S 3;  1GY7 A;  3PGB A;  1G02 A;  3S67 A;  4HBR A;  3LTC A;  5JBS A;  1TFO A;  1FGM A;  3NBJ A;  2ZHX B;  4KZ1 A;  4N3V A;  3JVC A;  1VQ7 3;  1DVC A;  1U8C B;  4LYL B;  1LVN A;  2KXG A;  4MMY B;  1OPY A;  3K9M C;  1UI7 A;  4ZM8 A;  3NX0 A;  1VQN 3;  1DVD A;  3NXJ A;  2OOV C;  1QMA A;  1GY5 A;  4XDW A;  3BIR A;  1N8R 4;  3DGY A;  4HAA A;  4HOH A;  4EV2 A;  6GSP A;  3MG3 A;  5EEO A;  1U5O A;  3X3Z A;  1FUT A;  1T5Y A;  3I55 3;  4RNT A;  3JUO A;  1VQL 3;  2CFK A;  3DGO A;  4FMA A;  1Q82 4;  7STD A;  2QGU A;  4JRF A;  1E3V A;  4J5G A;  2P09 A;  2XR8 B;  1VQ5 3;  3GWR A;  3PYJ A;  1BNR A;  3CPO A;  3HZP A;  1W5Z A;  4HM5 B;  3LTA A;  3F8X A;  2HMO B;  4N6U A;  3RGA A;  1JN5 A;  2HMN B;  2O9U X;  1E97 A;  3T8N A;  3I0Y A; 
#chains in the Genus database with same CATH homology
 1RNB A;  1RGK A;  1RGC A;  7GSP A;  1GMR A;  1I2E A;  1UCK A;  1X1U A;  2GSP A;  1BSA A;  4GHO A;  5RNT A;  1BNG A;  1RNT A;  1BSB A;  1B2S A;  1JBS A;  2C4B A;  1BSC A;  2F5M A;  1UCL A;  1I0V A;  1ZGX A;  3WHO A;  6RNT A;  1TRQ A;  1LRA A;  1HZ1 A;  1I2F A;  1DET A;  1BAN A;  1RN4 A;  1MGW A;  1FUS A;  2KF5 A;  1T2I A;  1B20 A;  1BIR A;  1RMS A;  1BSE A;  1PYL A;  1Q9E A;  1TRP A;  2AAE A;  4BU4 A;  3GSP A;  9RNT A;  1LOV A;  1LOW A;  1HYF A;  1LOY A;  1PY3 A;  1BRJ A;  1RGE A;  7RNT A;  1RDS A;  1BU4 A;  1BVI A;  1R4Y A;  3WR2 A;  1BRH A;  3D4A A;  1FZU A;  3URP A;  1BUJ A;  1B2Z A;  1RCK A;  1RN1 A;  1B27 A;  1AQZ A;  1BOX A;  1C54 A;  1UCJ A;  1BNI A;  1YVS A;  1SAR A;  1RGF A;  2SAR A;  1RHL A;  1B21 A;  1B2U A;  1FW7 A;  1GMQ A;  1I0X A;  1BRS A;  1GSP A;  3DH2 A;  1RGG A;  1AY7 A;  1I8V A;  1BNR A;  2HOH A;  1I3F A;  1RTU A;  1GOV A;  3AGO A;  2BIR A;  1I70 A;  1X1X A;  2AAD A;  3RNT A;  3A5E A;  1A2P A;  2KAA A;  5HOH A;  3SYU A;  2RNT A;  3D5I A;  1RCL A;  3AHW A;  1YNV X;  5BU4 A;  2F4Y A;  3AGN A;  1RGH A;  1BGS A;  5GSP A;  1YGW A;  1BAO A;  2KF4 A;  1CH0 A;  1G02 A;  2RBI A;  2ZA4 A;  1JBR A;  1B2M A;  1GOY A;  5BIR A;  1BRI A;  3Q3F A;  3BU4 A;  2KF3 A;  1JBT A;  1RLS A;  1RGL A;  3D5G A;  1GOU A;  4GSP A;  1RGA A;  1UCI A;  1BNF A;  1T2H A;  3BIR A;  1MGR A;  3DGY A;  4HAA A;  4HOH A;  4J5K A;  4BIR A;  1B3S A;  6GSP A;  1BRG A;  1I2G A;  1FUT A;  1BNJ A;  3HOH A;  1X1W A;  4RNT A;  1B2X A;  1TTO A;  1BNS A;  3KCH A;  2BU4 A;  2F5W A;  1BSD A;  1X1Y A;  1RSN A;  4J5G A;  1BNE A;  1DE3 A;  1BRK A;  2F56 A;  1LNI A;  1I3I A;  3AHS A;  1GMP A;  1IYY A;  2KF6 A;  8RNT A;  1BRN L;  1FYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...