1HYFA

Ribonuclease t1 v16a mutant in complex with sr2+
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDASTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITHTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The contribution of metal ions to the conformational stability of ribonuclease T1: crystal versus solution.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Hydrolase
molecule keywords GUANYL-SPECIFIC RIBONUCLEASE T1
total genus 24
structure length 104
sequence length 104
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 2001-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 1hyfA00
4BU4A 1BRHA 1DETA 1GOYA 3BIRA 3D4AA 1RGGA 1UCKA 6RNTA 1JBTA 1LNIA 3BU4A 2SARA 1BRNL 1C54A 1RGCA 1BANA 1DE3A 1T2IA 1X1YA 1MGWA 4HAAA 1RGFA 1B27A 5BIRA 1G02A 1GMQA 1GSPA 1RSNA 2KAAA 1BRSA 1TRQA 1BRGA 1R4YA 1YGWA 2KF6A 2F5MA 2RNTA 3DH2A 3SYUA 1RGLA 1MGRA 1PYLA 1RCLA 3AHSA 1BVIA 1X1UA 1RN1A 4HOHA 2ZA4A 1BIRA 4GSPA 1BSDA 1I2EA 1B2ZA 2F56A 1BNEA 1GOVA 3WHOA 4BIRA 1X1XA 8RNTA 3RNTA 4RNTA 3AGOA 4GHOA 1BNFA 1ZGXA 1X1WA 1TRPA 1BRIA 1UCIA 1AY7A 1LOWA 1LOYA 1RGKA 1PY3A 1YNVX 1BNJA 2F5WA 3DGYA 3HOHA 1BNRA 1FUTA 1BRKA 5GSPA 1SARA 1BU4A 1RGEA 1CH0A 2KF4A 2AAEA 1HZ1A 1FW7A 2GSPA 1RDSA 2HOHA 1RCKA 3URPA 3WR2A 3KCHA 7GSPA 1BGSA 3AGNA 1BUJA 2C4BA 1YVSA 1I3IA 1RLSA 2KF3A 1BSEA 3D5GA 1T2HA 1UCLA 1B2SA 1JBRA 1RHLA 1I2FA 2RBIA 1RN4A 3GSPA 1RMSA 1A2PA 2F4YA 3Q3FA 1I70A 1BRJA 1LOVA 1BSAA 1I2GA 1I0XA 1B2MA 2BIRA 1B3SA 3A5EA 9RNTA 1UCJA 1B2XA 5HOHA 2BU4A 3D5IA 1BSCA 1GOUA 5RNTA 1B20A 1FZUA 1GMPA 1RTUA 1BOXA 2AADA 1I3FA 1RNTA 1BNGA 1TTOA 4J5GA 1B21A 2KF5A 3AHWA 1B2UA 1RNBA 1BSBA 1GMRA 1LRAA 1I8VA 1RGAA 1JBSA 1IYYA 1BAOA 5BU4A 1BNIA 4J5KA 1HYFA 1I0VA 1Q9EA 1FYSA 1FUSA 1AQZA 6GSPA 1BNSA 7RNTA 1RGHA
chains in the Genus database with same CATH superfamily
4BU4A 7STDA 3WOEB 5D82A 4N6UA 3D4AA 1JZDA 2GXFA 4N6V0 2INXA 3MSOA 1SIIA 2IMJA 2IYJA 2OOVA 4OUQA 3JUOA 3BNCA 4J9AA 1RGCA 3NX0A 5KP1A 1IDPA 1T3BA 2B1XB 1STDA 4L8OA 3J7Yd 5EEOA 4X2HA 1IQXA 5BIRA 3G6E3 1Q7Y4 4LMIA 3EN1B 1M904 1EQKA 3EQQB 3X3ZA 8CHOA 3KKGA 2KAAA 1ULIB 4LEHA 1U8CB 2F99A 3F40A 3Q90A 4FCMA 2OCTA 5KP3A 5CF2A 5IW9A 3LTDA 3SOAA 1BRGA 1YGWA 2BMRB 3KE7A 4HVNA 3UL6A 1YJN3 2GU1A 4BTXA 2IY2A 3DH2A 4EC6A 5AYRB 4HM0B 1MGRA 3AHSA 4K61A 2XFSA 2Q07A 1EKMA 1UUWB 1O7HB 1BSDA 1I2EA 4IIAA 4AKZA 4KVHA 3FGYA 4BIRA 3BNDA 2BMQB 1MWSA 8RNTA 3TDGA 2WGOA 3FH1A 1LNHA 5AIIA 4OK0A 1CQSA 2Y73A 3AGOA 3FZWA 1QVF2 1FGOA 1BRIA 1UCIA 4J8TA 2HMMB 1LOYA 2WOHA 3EBTA 3UJMA 3G4S3 4IPBA 2GEYA 1DYUA 3NUVA 1IT7A 1Q40B 5ELUA 2F5WA 3M8CA 4FR9A 1MWRA 3JUPA 5GSPA 3JVCA 1V58A 1AV4A 1CH0A 4LGQA 2AAEA 3T0UA 5IG3A 3H51A 1W7CA 1U5OA 3F7XA 1DMQA 3PZWA 3PS8A 1VQN3 3ZFZA 1WMOA 1KSIA 3FSDA 4EW5A 1UW1A 3WR2A 7GSPA 2IUJA 3F14A 2QA43 1OCVA 2XSOB 3HX8A 1T2HA 3CCM3 1UCLA 1JBRA 3D79A 2LYXA 1NDOB 1Q40A 1N9EA 2W9QA 1DVDA 1UI8A 2XGLA 1JN5B 3NHXA 3GSPA 2CFWA 2HMJB 3UL5A 1RRHA 5FW5A 1TP6A 2F4YA 2KXGA 3ER7A 3S28A 4K1UA 4EBGA 1FUWA 3HIGA 3MG3A 3A5EA 3CNMA 1AVLA 2FXTA 1UCJA 5DRVA 5HOHA 1VZZA 1PFPA 4O02B 1DMNA 3CC43 4KFDA 3BNBA 3BB9A 1VQP3 3NM7A 4N6LA 3N54B 3DZLA 1SJWA 1ASKA 2O3OA 1FZUA 1GMPA 1RTUA 1N5PA 2FNQA 1IU7A 2CFGA 4J5GA 3NM2A 4BTYA 3LH4A 3AHWA 1BUQA 3VGNA 1JJ22 1BSBA 1GMRA 5AIHA 4RBNA 3CCV3 3NQYA 1OGXA 1WTHA 5M18A 2V1LA 3UNLA 2H0GA 3VF1A 1FUSA 2H0IA 1IQYA 3N9HA 1BNSA 5IG5A 2HMOB 3DY5A 2BMOB 4HM5B 3EX9A 4O8SA 3MG2A 1O7WB 1QJGA 1W6YA 2CWUA 3DMCA 3MPHA 2WOFA 1BRHA 4KT3B 3B4OA 5IG0A 2XR8B 1W5ZA 1UCKA 3FF2A 1O7MB 1MWUA 3G0KA 1JBTA 1LNIA 2SARA 3FG3A 4RNZA 2W2CA 5I97A 2K0MA 1MGWA 1T5YA 4HYZA 1RGFA 4L7KA 1TUHA 3CNXA 1G02A 1DMMA 1GMQA 2UX0A 1EG9B 3CCJ3 2HMLB 5CLKA 2YX9A 3PXMA 4R1KA 2W03A 1R4YA 4N3VA 3KIIA 2F5MA 2RNTA 4WWUC 3SYUA 3OWUA 1YI23 3KN4A 4N6OB 1RCLA 4HOHA 1K8A4 2ZA4A 1BIRA 1V57A 2P0MA 4GSPA 1ZS7A 3NQZA 1KQS2 3OXAA 1BNEA 1GOVA 1X1XA 3HIIA 1CEWI 4WP5A 1RN7A 1V74A 3RNTA 5AIGA 1G96A 1MWTA 1TRPA 5TGNA 2MF7A 2CK3H 3B8LA 1OHOA 1ZO2A 2GBXB 4HZ9B 3BNEA 3NBRA 2BHMA 2R41A 1IV9A 4KFEA 2RSXA 1JN5A 1K9M4 2FGTA 1OF5B 2B24B 2J8XB 3LYGA 5AEWB 3HOHA 3BLZA 4QWTA 1FUTA 3CC73 1W4NA 2Z7AA 3Q2PA 1N8R4 1EA2A 1JNQA 3X3XA 4WYKB 4ZM8A 1BU4A 1RGEA 2KRTA 3H3HA 1JB2A 2WGQA 1HZ1A 2W04A 1YVBI 2GSPA 1VQQA 5M1AA 1KC84 5STDA 4IT7A 1RCKA 3KCHA 3CPOA 1IV7A 4NHFA 1UUVB 2ZL8A 3X41A 1YVSA 1I3IA 1UUGB 2KF3A 1BSEA 1E97A 3U97A 3PYJA 3CCL3 1B2SA 2D1WA 4PEJA 5G2GA 5IF6A 1NU3A 1RN4A 2E2TA 3IMAB 2H0HA 5G1LA 1RJOA 2CW9A 1RMSA 2JDIH 1STFI 2HMKB 2RCDA 2Z77A 4I5QA 3Q3FA 4HM2B 2XRXB 3RGAA 4HM6B 3NBJA 3UB1A 1O7NB 1VQL3 3F9SA 4MMZB 1I0XA 1B2MA 2BIRA 2QGUA 3B4PA 2YFLB 4ILFA 5IENA 3CME3 3CC23 2QIYA 1K734 4N6MA 3DGOA 1VQO3 1MNLA 1GOUA 3SVAA 1M9GA 3CCR3 1B20A 3EE1A 4KFFA 5D83A 3V98A 1IK3A 3SLUA 3D3LA 4CCVA 1OHPA 4CPKA 2AADA 3NV0B 4K90B 1FGQA 1BNGA 1O7GB 3CMA3 1ZX2A 1TTOA 4FCJA 2D42A 1B21A 3K7CA 5CXOA 5BVBA 1OF5A 2LQVA 3I553 1JBSA 3DUKA 1FGRA 1NB5I 3K5TA 1IYYA 4XDWA 2GEXA 1EEJA 2OWPA 1QAFA 1LXEA 2RFRA 2RGQA 5BU4A 1HYFA 1Q864 1VQ93 1W01A 2P09A 2Y74A 1NB3I 3JUQA 3HI7A 6GSPA 1IVWA 1G0TA 2R4IA 1A90A 1TIJA 4CJNA 1VQK3 1GOYA 3BIRA 1WQLB 2W0QA 1W00A 4HM1B 3F8HA 5AEUB 4FMAA 3OV4A 3FLJA 4KZ1A 2Z6BA 4RNYA 3LOYA 4BTWA 5EQLA 1A2VA 1T2IA 1X1YA 4HAAA 1YGEA 3FKAA 3EC9A 4X2OA 1B27A 5JPPA 2M7OA 2P38A 1GSPA 3G8ZA 1RSNA 5LC7A 2CHCA 3B7CA 4R4KA 3OX9A 5ELJA 1IT8A 1BRSA 1IVUA 3K9MC 3CU3A 2CWVA 4ORLA 1QAKA 2KF6A 3KSPA 3QK9A 2PNCA 4N6NB 1FGTA 1PYLA 1NWWA 2MC8A 2KCDA 1X1UA 2CKFB 3GZBA 3OWSA 5BXQA 3RDEA 1TFKA 4EXRA 1B2ZA 1E3RA 1YJ93 2F98A 1AVKA 2CX0A 3IJEB 3FG1A 1JB4A 3WHOA 1YJW3 3ECFA 4CDLA 2CFDA 2YFJB 2C11A 5CF1A 2K54A 2IA7A 3ZG5A 1TFOA 1BNFA 2XSHB 4MEIA 1X1WA 4NREA 5FGOA 3WDGB 1GS3A 5DREA 1JV2B 3GZXB 1LOWA 1GD3A 1RGKA 1N8QA 3EN8A 3I0YA 1WMNA 1E3VA 2GU3A 3G713 3WOFB 1VQ73 3A76A 3DGNA 2CX1A 3GRDA 1BRKA 3ALAA 1SARA 1A2KA 1ROVA 4RZMA 2KF4A 1N9JA 2UUGC 4FMBA 2PZVA 1RDSA 5IEPA 3NXJA 1VQ83 2HOHA 1OPYA 5IEOA 4HZBB 1A67A 2BNGA 3URPA 1MOLA 1OGZA 1K41A 2CFLA 1BUJA 2C10A 3WMDA 4DKIA 1RLSA 1WNHA 4WFOA 1RKYA 1OH0A 3PCSA 4O3VA 3OW22 3NV0A 1RHLA 4EYCA 2RBIA 3EBYA 3GAXA 1K28A 5HGRA 2BT3A 1NJI4 3S67A 1JKGB 3KSED 3OWYA 1A2PA 2WO0A 3AMOA 4BL2A 2JQ5A 4LZIA 1IQ8A 3DGLA 3SOYA 5AIFA 3EF8A 3LTAA 1C7HA 5JBSA 3MWZA 4HBRA 1BSAA 1I2GA 4TX4A 1W02A 4HJLB 5CK6A 1US1A 3V92A 1FA3A 1B3SA 2O9UX 1B2XA 2BU4A 1EUIC 3IPTA 2OOVC 2I9WA 1UDII 3MG1A 3DXOA 1BSCA 4HM7B 5RNTA 3KZTA 4MMXB 1CYVA 3VSYA 2A15A 4GB5A 2W56B 4AKYA 2L1SA 2SBLA 1BOXA 4WYKA 1I3FA 1RNTA 1FGMA 2ZHXB 3LT9A 1QALA 4NPBA 1D6UA 1W6GA 5EVHA 1OUNA 3ROBA 3E99A 2CG0A 1B2UA 3MKIA 3NBBA 3Q1CA 1RNBA 1GD4A 3S5CA 2XEPA 1S723 4XBYA 4AEQA 3RGRA 1VQ63 2QEX3 1HU9A 4J5KA 4HM4B 4EV5A 1Q9EA 1FYSA 2OQEA 3MHEA 4MMYB 2F86B 1RGHA 1ISKA 4LSOA 1HKXA 3HZPA 3CCQ3 1Y4KA 4I4KA 4WHAA 1DETA 3STDA 4H3UA 2L4VA 1VQ43 3T8UA 1YHQ3 1RGGA 2CWTA 3CPW2 2OTL3 6RNTA 5LC6A 4HM8B 3BU4A 1WMPA 3DGMA 1BRNL 3SXXA 3PCRA 4N6TA 1C54A 1BANA 1DE3A 1LQGC 1YIT3 1O7PB 1PU4A 2CH9A 1D6YA 3SX1A 3X42A 4GL6A 5AI1A 1LQMB 4K1VA 1ROAA 1Z1SA 1JZOA 5JPUA 3CCS3 4XDVA 3GWRA 1LOXA 1TRQA 1ULJB 3EB8A 4L8PA 3FG4A 1M1K4 4XM4A 3LTBA 1RGLA 2E2VA 1IVXA 4R80A 1BVIA 3SEDA 1RN1A 4EV2A 1OHSA 4U13A 1AR0A 1J2BA 4OVMA 2F56A 4H61A 3K0ZA 4FCZA 1RRLA 2W6JH 1OACA 4MJDA 5IG4A 4RNTA 3CCU3 1SPUA 4GHOA 4R9LA 3KFQC 2XFTA 2XF3A 1ZGXA 2CG1A 1TJDA 1KWIA 2YFIB 3LZAA 3F8XA 1GY5A 3FF0A 4FMDA 1AY7A 1GYBA 2XH9A 3AMOB 1PY3A 1NO3A 1JKGA 1YNVX 4JRFA 3CCE3 1BNJA 3DGYA 1BNRA 3HK4A 6STDA 3D9RA 1FW7A 1YIJ3 3F7SA 3EJVA 1Q42A 1QMAA 1JB5A 3L0RA 3LMLA 1M1XB 5D81A 3WODG 5M19A 3FCSB 1BGSA 3AGNA 3G16A 1LVNA 1Q7HA 2C4BA 4HKVB 1UGHI 3JUNA 1IVVA 3PGBA 3D5GA 1Q824 2P05A 3EHCA 3I563 1VQ53 5IERA 1SIHA 1I2FA 1D6ZA 3GZRA 2CC3A 5A0OB 2K3DA 1GY6A 4XBTA 2GBWB 4G1MB 4O2HA 3CXC2 1JRQA 2IUKA 1I70A 1BRJA 1LOVA 1UI7A 1S5AA 4BL3A 3LXUX 5G1KA 5KP4A 1W2ZA 2BO9B 3V99A 3CD63 3ZG0A 1W6CA 2E2UA 3WA3A 9RNTA 2OTJ3 1QVG2 5AYSC 2XGNA 3D5IA 1R4CA 4XB5A 2ZDJA 3K63A 4R9KA 1W2B2 4XBXA 3O8YA 1Q814 1DVCA 1VQM3 1SQWA 3LTCA 3T8NA 1N5HA 2STDA 3GZYB 1CYUA 2Z76A 3S29A 3LT8A 4FMCA 2ML6A 2W56A 2KF5A 4HM3B 2OQEC 3U1WA 1LRAA 4LYLB 1RGAA 1I8VA 1KD14 1GY7A 3MYTA 1F8NA 1UGIA 2HMNB 3DM8A 1L5GB 3S27A 4STDA 1BAOA 1BNIA 2CIUA 2P0XA 3N8BA 1I0VA 4JF8A 4Q53A 2CFKA 1AQZA 3X40A 1NNVA 2ML5A 3QRDA 7RNTA 2UGIA 3WA2X 3X3YA 3JUMA 2W9PA 1TU5A
chains in the Genus database with same CATH topology
4BU4A 1BRHA 1DETA 1GOYA 3BIRA 3D4AA 1RGGA 1UCKA 6RNTA 1JBTA 1LNIA 3BU4A 2SARA 1BRNL 1C54A 1RGCA 1BANA 1DE3A 1T2IA 1X1YA 1MGWA 4HAAA 1RGFA 1B27A 5BIRA 1G02A 1GMQA 1GSPA 1RSNA 2KAAA 1BRSA 1TRQA 1BRGA 1R4YA 1YGWA 2KF6A 2F5MA 2RNTA 3DH2A 3SYUA 1RGLA 1MGRA 1PYLA 1RCLA 3AHSA 1BVIA 1X1UA 1RN1A 4HOHA 2ZA4A 1BIRA 4GSPA 1BSDA 1I2EA 1B2ZA 2F56A 1BNEA 1GOVA 3WHOA 4BIRA 1X1XA 8RNTA 3RNTA 4RNTA 3AGOA 4GHOA 1BNFA 1ZGXA 1X1WA 1TRPA 1BRIA 1UCIA 1AY7A 1LOWA 1LOYA 1RGKA 1PY3A 1YNVX 1BNJA 2F5WA 3DGYA 3HOHA 1BNRA 1FUTA 1BRKA 5GSPA 1SARA 1BU4A 1RGEA 1CH0A 2KF4A 2AAEA 1HZ1A 1FW7A 2GSPA 1RDSA 2HOHA 1RCKA 3URPA 3WR2A 3KCHA 7GSPA 1BGSA 3AGNA 1BUJA 2C4BA 1YVSA 1I3IA 1RLSA 2KF3A 1BSEA 3D5GA 1T2HA 1UCLA 1B2SA 1JBRA 1RHLA 1I2FA 2RBIA 1RN4A 3GSPA 1RMSA 1A2PA 2F4YA 3Q3FA 1I70A 1BRJA 1LOVA 1BSAA 1I2GA 1I0XA 1B2MA 2BIRA 1B3SA 3A5EA 9RNTA 1UCJA 1B2XA 5HOHA 2BU4A 3D5IA 1BSCA 1GOUA 5RNTA 1B20A 1FZUA 1GMPA 1RTUA 1BOXA 2AADA 1I3FA 1RNTA 1BNGA 1TTOA 4J5GA 1B21A 2KF5A 3AHWA 1B2UA 1RNBA 1BSBA 1GMRA 1LRAA 1I8VA 1RGAA 1JBSA 1IYYA 1BAOA 5BU4A 1BNIA 4J5KA 1HYFA 1I0VA 1Q9EA 1FYSA 1FUSA 1AQZA 6GSPA 1BNSA 7RNTA 1RGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BU4 A;  1BRH A;  1DET A;  1GOY A;  3BIR A;  3D4A A;  1RGG A;  1UCK A;  6RNT A;  1JBT A;  1LNI A;  3BU4 A;  2SAR A;  1BRN L;  1C54 A;  1RGC A;  1BAN A;  1DE3 A;  1T2I A;  1X1Y A;  1MGW A;  4HAA A;  1RGF A;  1B27 A;  5BIR A;  1G02 A;  1GMQ A;  1GSP A;  1RSN A;  2KAA A;  1BRS A;  1TRQ A;  1BRG A;  1R4Y A;  1YGW A;  2KF6 A;  2F5M A;  2RNT A;  3DH2 A;  3SYU A;  1RGL A;  1MGR A;  1PYL A;  1RCL A;  3AHS A;  1BVI A;  1X1U A;  1RN1 A;  4HOH A;  2ZA4 A;  1BIR A;  4GSP A;  1BSD A;  1I2E A;  1B2Z A;  2F56 A;  1BNE A;  1GOV A;  3WHO A;  4BIR A;  1X1X A;  8RNT A;  3RNT A;  4RNT A;  3AGO A;  4GHO A;  1BNF A;  1ZGX A;  1X1W A;  1TRP A;  1BRI A;  1UCI A;  1AY7 A;  1LOW A;  1LOY A;  1RGK A;  1PY3 A;  1YNV X;  1BNJ A;  2F5W A;  3DGY A;  3HOH A;  1BNR A;  1FUT A;  1BRK A;  5GSP A;  1SAR A;  1BU4 A;  1RGE A;  1CH0 A;  2KF4 A;  2AAE A;  1HZ1 A;  1FW7 A;  2GSP A;  1RDS A;  2HOH A;  1RCK A;  3URP A;  3WR2 A;  3KCH A;  7GSP A;  1BGS A;  3AGN A;  1BUJ A;  2C4B A;  1YVS A;  1I3I A;  1RLS A;  2KF3 A;  1BSE A;  3D5G A;  1T2H A;  1UCL A;  1B2S A;  1JBR A;  1RHL A;  1I2F A;  2RBI A;  1RN4 A;  3GSP A;  1RMS A;  1A2P A;  2F4Y A;  3Q3F A;  1I70 A;  1BRJ A;  1LOV A;  1BSA A;  1I2G A;  1I0X A;  1B2M A;  2BIR A;  1B3S A;  3A5E A;  9RNT A;  1UCJ A;  1B2X A;  5HOH A;  2BU4 A;  3D5I A;  1BSC A;  1GOU A;  5RNT A;  1B20 A;  1FZU A;  1GMP A;  1RTU A;  1BOX A;  2AAD A;  1I3F A;  1RNT A;  1BNG A;  1TTO A;  4J5G A;  1B21 A;  2KF5 A;  3AHW A;  1B2U A;  1RNB A;  1BSB A;  1GMR A;  1LRA A;  1I8V A;  1RGA A;  1JBS A;  1IYY A;  1BAO A;  5BU4 A;  1BNI A;  4J5K A;  1HYF A;  1I0V A;  1Q9E A;  1FYS A;  1FUS A;  1AQZ A;  6GSP A;  1BNS A;  7RNT A;  1RGH A; 
#chains in the Genus database with same CATH topology
 4BU4 A;  7STD A;  3WOE B;  5D82 A;  4N6U A;  3D4A A;  1JZD A;  2GXF A;  4N6V 0;  2INX A;  3MSO A;  1SII A;  2IMJ A;  2IYJ A;  2OOV A;  4OUQ A;  3JUO A;  3BNC A;  4J9A A;  1RGC A;  3NX0 A;  5KP1 A;  1IDP A;  1T3B A;  2B1X B;  1STD A;  4L8O A;  3J7Y d;  5EEO A;  4X2H A;  1IQX A;  5BIR A;  3G6E 3;  1Q7Y 4;  4LMI A;  3EN1 B;  1M90 4;  1EQK A;  3EQQ B;  3X3Z A;  8CHO A;  3KKG A;  2KAA A;  1ULI B;  4LEH A;  1U8C B;  2F99 A;  3F40 A;  3Q90 A;  4FCM A;  2OCT A;  5KP3 A;  5CF2 A;  5IW9 A;  3LTD A;  3SOA A;  1BRG A;  1YGW A;  2BMR B;  3KE7 A;  4HVN A;  3UL6 A;  1YJN 3;  2GU1 A;  4BTX A;  2IY2 A;  3DH2 A;  4EC6 A;  5AYR B;  4HM0 B;  1MGR A;  3AHS A;  4K61 A;  2XFS A;  2Q07 A;  1EKM A;  1UUW B;  1O7H B;  1BSD A;  1I2E A;  4IIA A;  4AKZ A;  4KVH A;  3FGY A;  4BIR A;  3BND A;  2BMQ B;  1MWS A;  8RNT A;  3TDG A;  2WGO A;  3FH1 A;  1LNH A;  5AII A;  4OK0 A;  1CQS A;  2Y73 A;  3AGO A;  3FZW A;  1QVF 2;  1FGO A;  1BRI A;  1UCI A;  4J8T A;  2HMM B;  1LOY A;  2WOH A;  3EBT A;  3UJM A;  3G4S 3;  4IPB A;  2GEY A;  1DYU A;  3NUV A;  1IT7 A;  1Q40 B;  5ELU A;  2F5W A;  3M8C A;  4FR9 A;  1MWR A;  3JUP A;  5GSP A;  3JVC A;  1V58 A;  1AV4 A;  1CH0 A;  4LGQ A;  2AAE A;  3T0U A;  5IG3 A;  3H51 A;  1W7C A;  1U5O A;  3F7X A;  1DMQ A;  3PZW A;  3PS8 A;  1VQN 3;  3ZFZ A;  1WMO A;  1KSI A;  3FSD A;  4EW5 A;  1UW1 A;  3WR2 A;  7GSP A;  2IUJ A;  3F14 A;  2QA4 3;  1OCV A;  2XSO B;  3HX8 A;  1T2H A;  3CCM 3;  1UCL A;  1JBR A;  3D79 A;  2LYX A;  1NDO B;  1Q40 A;  1N9E A;  2W9Q A;  1DVD A;  1UI8 A;  2XGL A;  1JN5 B;  3NHX A;  3GSP A;  2CFW A;  2HMJ B;  3UL5 A;  1RRH A;  5FW5 A;  1TP6 A;  2F4Y A;  2KXG A;  3ER7 A;  3S28 A;  4K1U A;  4EBG A;  1FUW A;  3HIG A;  3MG3 A;  3A5E A;  3CNM A;  1AVL A;  2FXT A;  1UCJ A;  5DRV A;  5HOH A;  1VZZ A;  1PFP A;  4O02 B;  1DMN A;  3CC4 3;  4KFD A;  3BNB A;  3BB9 A;  1VQP 3;  3NM7 A;  4N6L A;  3N54 B;  3DZL A;  1SJW A;  1ASK A;  2O3O A;  1FZU A;  1GMP A;  1RTU A;  1N5P A;  2FNQ A;  1IU7 A;  2CFG A;  4J5G A;  3NM2 A;  4BTY A;  3LH4 A;  3AHW A;  1BUQ A;  3VGN A;  1JJ2 2;  1BSB A;  1GMR A;  5AIH A;  4RBN A;  3CCV 3;  3NQY A;  1OGX A;  1WTH A;  5M18 A;  2V1L A;  3UNL A;  2H0G A;  3VF1 A;  1FUS A;  2H0I A;  1IQY A;  3N9H A;  1BNS A;  5IG5 A;  2HMO B;  3DY5 A;  2BMO B;  4HM5 B;  3EX9 A;  4O8S A;  3MG2 A;  1O7W B;  1QJG A;  1W6Y A;  2CWU A;  3DMC A;  3MPH A;  2WOF A;  1BRH A;  4KT3 B;  3B4O A;  5IG0 A;  2XR8 B;  1W5Z A;  1UCK A;  3FF2 A;  1O7M B;  1MWU A;  3G0K A;  1JBT A;  1LNI A;  2SAR A;  3FG3 A;  4RNZ A;  2W2C A;  5I97 A;  2K0M A;  1MGW A;  1T5Y A;  4HYZ A;  1RGF A;  4L7K A;  1TUH A;  3CNX A;  1G02 A;  1DMM A;  1GMQ A;  2UX0 A;  1EG9 B;  3CCJ 3;  2HML B;  5CLK A;  2YX9 A;  3PXM A;  4R1K A;  2W03 A;  1R4Y A;  4N3V A;  3KII A;  2F5M A;  2RNT A;  4WWU C;  3SYU A;  3OWU A;  1YI2 3;  3KN4 A;  4N6O B;  1RCL A;  4HOH A;  1K8A 4;  2ZA4 A;  1BIR A;  1V57 A;  2P0M A;  4GSP A;  1ZS7 A;  3NQZ A;  1KQS 2;  3OXA A;  1BNE A;  1GOV A;  1X1X A;  3HII A;  1CEW I;  4WP5 A;  1RN7 A;  1V74 A;  3RNT A;  5AIG A;  1G96 A;  1MWT A;  1TRP A;  5TGN A;  2MF7 A;  2CK3 H;  3B8L A;  1OHO A;  1ZO2 A;  2GBX B;  4HZ9 B;  3BNE A;  3NBR A;  2BHM A;  2R41 A;  1IV9 A;  4KFE A;  2RSX A;  1JN5 A;  1K9M 4;  2FGT A;  1OF5 B;  2B24 B;  2J8X B;  3LYG A;  5AEW B;  3HOH A;  3BLZ A;  4QWT A;  1FUT A;  3CC7 3;  1W4N A;  2Z7A A;  3Q2P A;  1N8R 4;  1EA2 A;  1JNQ A;  3X3X A;  4WYK B;  4ZM8 A;  1BU4 A;  1RGE A;  2KRT A;  3H3H A;  1JB2 A;  2WGQ A;  1HZ1 A;  2W04 A;  1YVB I;  2GSP A;  1VQQ A;  5M1A A;  1KC8 4;  5STD A;  4IT7 A;  1RCK A;  3KCH A;  3CPO A;  1IV7 A;  4NHF A;  1UUV B;  2ZL8 A;  3X41 A;  1YVS A;  1I3I A;  1UUG B;  2KF3 A;  1BSE A;  1E97 A;  3U97 A;  3PYJ A;  3CCL 3;  1B2S A;  2D1W A;  4PEJ A;  5G2G A;  5IF6 A;  1NU3 A;  1RN4 A;  2E2T A;  3IMA B;  2H0H A;  5G1L A;  1RJO A;  2CW9 A;  1RMS A;  2JDI H;  1STF I;  2HMK B;  2RCD A;  2Z77 A;  4I5Q A;  3Q3F A;  4HM2 B;  2XRX B;  3RGA A;  4HM6 B;  3NBJ A;  3UB1 A;  1O7N B;  1VQL 3;  3F9S A;  4MMZ B;  1I0X A;  1B2M A;  2BIR A;  2QGU A;  3B4P A;  2YFL B;  4ILF A;  5IEN A;  3CME 3;  3CC2 3;  2QIY A;  1K73 4;  4N6M A;  3DGO A;  1VQO 3;  1MNL A;  1GOU A;  3SVA A;  1M9G A;  3CCR 3;  1B20 A;  3EE1 A;  4KFF A;  5D83 A;  3V98 A;  1IK3 A;  3SLU A;  3D3L A;  4CCV A;  1OHP A;  4CPK A;  2AAD A;  3NV0 B;  4K90 B;  1FGQ A;  1BNG A;  1O7G B;  3CMA 3;  1ZX2 A;  1TTO A;  4FCJ A;  2D42 A;  1B21 A;  3K7C A;  5CXO A;  5BVB A;  1OF5 A;  2LQV A;  3I55 3;  1JBS A;  3DUK A;  1FGR A;  1NB5 I;  3K5T A;  1IYY A;  4XDW A;  2GEX A;  1EEJ A;  2OWP A;  1QAF A;  1LXE A;  2RFR A;  2RGQ A;  5BU4 A;  1HYF A;  1Q86 4;  1VQ9 3;  1W01 A;  2P09 A;  2Y74 A;  1NB3 I;  3JUQ A;  3HI7 A;  6GSP A;  1IVW A;  1G0T A;  2R4I A;  1A90 A;  1TIJ A;  4CJN A;  1VQK 3;  1GOY A;  3BIR A;  1WQL B;  2W0Q A;  1W00 A;  4HM1 B;  3F8H A;  5AEU B;  4FMA A;  3OV4 A;  3FLJ A;  4KZ1 A;  2Z6B A;  4RNY A;  3LOY A;  4BTW A;  5EQL A;  1A2V A;  1T2I A;  1X1Y A;  4HAA A;  1YGE A;  3FKA A;  3EC9 A;  4X2O A;  1B27 A;  5JPP A;  2M7O A;  2P38 A;  1GSP A;  3G8Z A;  1RSN A;  5LC7 A;  2CHC A;  3B7C A;  4R4K A;  3OX9 A;  5ELJ A;  1IT8 A;  1BRS A;  1IVU A;  3K9M C;  3CU3 A;  2CWV A;  4ORL A;  1QAK A;  2KF6 A;  3KSP A;  3QK9 A;  2PNC A;  4N6N B;  1FGT A;  1PYL A;  1NWW A;  2MC8 A;  2KCD A;  1X1U A;  2CKF B;  3GZB A;  3OWS A;  5BXQ A;  3RDE A;  1TFK A;  4EXR A;  1B2Z A;  1E3R A;  1YJ9 3;  2F98 A;  1AVK A;  2CX0 A;  3IJE B;  3FG1 A;  1JB4 A;  3WHO A;  1YJW 3;  3ECF A;  4CDL A;  2CFD A;  2YFJ B;  2C11 A;  5CF1 A;  2K54 A;  2IA7 A;  3ZG5 A;  1TFO A;  1BNF A;  2XSH B;  4MEI A;  1X1W A;  4NRE A;  5FGO A;  3WDG B;  1GS3 A;  5DRE A;  1JV2 B;  3GZX B;  1LOW A;  1GD3 A;  1RGK A;  1N8Q A;  3EN8 A;  3I0Y A;  1WMN A;  1E3V A;  2GU3 A;  3G71 3;  3WOF B;  1VQ7 3;  3A76 A;  3DGN A;  2CX1 A;  3GRD A;  1BRK A;  3ALA A;  1SAR A;  1A2K A;  1ROV A;  4RZM A;  2KF4 A;  1N9J A;  2UUG C;  4FMB A;  2PZV A;  1RDS A;  5IEP A;  3NXJ A;  1VQ8 3;  2HOH A;  1OPY A;  5IEO A;  4HZB B;  1A67 A;  2BNG A;  3URP A;  1MOL A;  1OGZ A;  1K41 A;  2CFL A;  1BUJ A;  2C10 A;  3WMD A;  4DKI A;  1RLS A;  1WNH A;  4WFO A;  1RKY A;  1OH0 A;  3PCS A;  4O3V A;  3OW2 2;  3NV0 A;  1RHL A;  4EYC A;  2RBI A;  3EBY A;  3GAX A;  1K28 A;  5HGR A;  2BT3 A;  1NJI 4;  3S67 A;  1JKG B;  3KSE D;  3OWY A;  1A2P A;  2WO0 A;  3AMO A;  4BL2 A;  2JQ5 A;  4LZI A;  1IQ8 A;  3DGL A;  3SOY A;  5AIF A;  3EF8 A;  3LTA A;  1C7H A;  5JBS A;  3MWZ A;  4HBR A;  1BSA A;  1I2G A;  4TX4 A;  1W02 A;  4HJL B;  5CK6 A;  1US1 A;  3V92 A;  1FA3 A;  1B3S A;  2O9U X;  1B2X A;  2BU4 A;  1EUI C;  3IPT A;  2OOV C;  2I9W A;  1UDI I;  3MG1 A;  3DXO A;  1BSC A;  4HM7 B;  5RNT A;  3KZT A;  4MMX B;  1CYV A;  3VSY A;  2A15 A;  4GB5 A;  2W56 B;  4AKY A;  2L1S A;  2SBL A;  1BOX A;  4WYK A;  1I3F A;  1RNT A;  1FGM A;  2ZHX B;  3LT9 A;  1QAL A;  4NPB A;  1D6U A;  1W6G A;  5EVH A;  1OUN A;  3ROB A;  3E99 A;  2CG0 A;  1B2U A;  3MKI A;  3NBB A;  3Q1C A;  1RNB A;  1GD4 A;  3S5C A;  2XEP A;  1S72 3;  4XBY A;  4AEQ A;  3RGR A;  1VQ6 3;  2QEX 3;  1HU9 A;  4J5K A;  4HM4 B;  4EV5 A;  1Q9E A;  1FYS A;  2OQE A;  3MHE A;  4MMY B;  2F86 B;  1RGH A;  1ISK A;  4LSO A;  1HKX A;  3HZP A;  3CCQ 3;  1Y4K A;  4I4K A;  4WHA A;  1DET A;  3STD A;  4H3U A;  2L4V A;  1VQ4 3;  3T8U A;  1YHQ 3;  1RGG A;  2CWT A;  3CPW 2;  2OTL 3;  6RNT A;  5LC6 A;  4HM8 B;  3BU4 A;  1WMP A;  3DGM A;  1BRN L;  3SXX A;  3PCR A;  4N6T A;  1C54 A;  1BAN A;  1DE3 A;  1LQG C;  1YIT 3;  1O7P B;  1PU4 A;  2CH9 A;  1D6Y A;  3SX1 A;  3X42 A;  4GL6 A;  5AI1 A;  1LQM B;  4K1V A;  1ROA A;  1Z1S A;  1JZO A;  5JPU A;  3CCS 3;  4XDV A;  3GWR A;  1LOX A;  1TRQ A;  1ULJ B;  3EB8 A;  4L8P A;  3FG4 A;  1M1K 4;  4XM4 A;  3LTB A;  1RGL A;  2E2V A;  1IVX A;  4R80 A;  1BVI A;  3SED A;  1RN1 A;  4EV2 A;  1OHS A;  4U13 A;  1AR0 A;  1J2B A;  4OVM A;  2F56 A;  4H61 A;  3K0Z A;  4FCZ A;  1RRL A;  2W6J H;  1OAC A;  4MJD A;  5IG4 A;  4RNT A;  3CCU 3;  1SPU A;  4GHO A;  4R9L A;  3KFQ C;  2XFT A;  2XF3 A;  1ZGX A;  2CG1 A;  1TJD A;  1KWI A;  2YFI B;  3LZA A;  3F8X A;  1GY5 A;  3FF0 A;  4FMD A;  1AY7 A;  1GYB A;  2XH9 A;  3AMO B;  1PY3 A;  1NO3 A;  1JKG A;  1YNV X;  4JRF A;  3CCE 3;  1BNJ A;  3DGY A;  1BNR A;  3HK4 A;  6STD A;  3D9R A;  1FW7 A;  1YIJ 3;  3F7S A;  3EJV A;  1Q42 A;  1QMA A;  1JB5 A;  3L0R A;  3LML A;  1M1X B;  5D81 A;  3WOD G;  5M19 A;  3FCS B;  1BGS A;  3AGN A;  3G16 A;  1LVN A;  1Q7H A;  2C4B A;  4HKV B;  1UGH I;  3JUN A;  1IVV A;  3PGB A;  3D5G A;  1Q82 4;  2P05 A;  3EHC A;  3I56 3;  1VQ5 3;  5IER A;  1SIH A;  1I2F A;  1D6Z A;  3GZR A;  2CC3 A;  5A0O B;  2K3D A;  1GY6 A;  4XBT A;  2GBW B;  4G1M B;  4O2H A;  3CXC 2;  1JRQ A;  2IUK A;  1I70 A;  1BRJ A;  1LOV A;  1UI7 A;  1S5A A;  4BL3 A;  3LXU X;  5G1K A;  5KP4 A;  1W2Z A;  2BO9 B;  3V99 A;  3CD6 3;  3ZG0 A;  1W6C A;  2E2U A;  3WA3 A;  9RNT A;  2OTJ 3;  1QVG 2;  5AYS C;  2XGN A;  3D5I A;  1R4C A;  4XB5 A;  2ZDJ A;  3K63 A;  4R9K A;  1W2B 2;  4XBX A;  3O8Y A;  1Q81 4;  1DVC A;  1VQM 3;  1SQW A;  3LTC A;  3T8N A;  1N5H A;  2STD A;  3GZY B;  1CYU A;  2Z76 A;  3S29 A;  3LT8 A;  4FMC A;  2ML6 A;  2W56 A;  2KF5 A;  4HM3 B;  2OQE C;  3U1W A;  1LRA A;  4LYL B;  1RGA A;  1I8V A;  1KD1 4;  1GY7 A;  3MYT A;  1F8N A;  1UGI A;  2HMN B;  3DM8 A;  1L5G B;  3S27 A;  4STD A;  1BAO A;  1BNI A;  2CIU A;  2P0X A;  3N8B A;  1I0V A;  4JF8 A;  4Q53 A;  2CFK A;  1AQZ A;  3X40 A;  1NNV A;  2ML5 A;  3QRD A;  7RNT A;  2UGI A;  3WA2 X;  3X3Y A;  3JUM A;  2W9P A;  1TU5 A; 
#chains in the Genus database with same CATH homology
 4BU4 A;  1BRH A;  1DET A;  1GOY A;  3BIR A;  3D4A A;  1RGG A;  1UCK A;  6RNT A;  1JBT A;  1LNI A;  3BU4 A;  2SAR A;  1BRN L;  1C54 A;  1RGC A;  1BAN A;  1DE3 A;  1T2I A;  1X1Y A;  1MGW A;  4HAA A;  1RGF A;  1B27 A;  5BIR A;  1G02 A;  1GMQ A;  1GSP A;  1RSN A;  2KAA A;  1BRS A;  1TRQ A;  1BRG A;  1R4Y A;  1YGW A;  2KF6 A;  2F5M A;  2RNT A;  3DH2 A;  3SYU A;  1RGL A;  1MGR A;  1PYL A;  1RCL A;  3AHS A;  1BVI A;  1X1U A;  1RN1 A;  4HOH A;  2ZA4 A;  1BIR A;  4GSP A;  1BSD A;  1I2E A;  1B2Z A;  2F56 A;  1BNE A;  1GOV A;  3WHO A;  4BIR A;  1X1X A;  8RNT A;  3RNT A;  4RNT A;  3AGO A;  4GHO A;  1BNF A;  1ZGX A;  1X1W A;  1TRP A;  1BRI A;  1UCI A;  1AY7 A;  1LOW A;  1LOY A;  1RGK A;  1PY3 A;  1YNV X;  1BNJ A;  2F5W A;  3DGY A;  3HOH A;  1BNR A;  1FUT A;  1BRK A;  5GSP A;  1SAR A;  1BU4 A;  1RGE A;  1CH0 A;  2KF4 A;  2AAE A;  1HZ1 A;  1FW7 A;  2GSP A;  1RDS A;  2HOH A;  1RCK A;  3URP A;  3WR2 A;  3KCH A;  7GSP A;  1BGS A;  3AGN A;  1BUJ A;  2C4B A;  1YVS A;  1I3I A;  1RLS A;  2KF3 A;  1BSE A;  3D5G A;  1T2H A;  1UCL A;  1B2S A;  1JBR A;  1RHL A;  1I2F A;  2RBI A;  1RN4 A;  3GSP A;  1RMS A;  1A2P A;  2F4Y A;  3Q3F A;  1I70 A;  1BRJ A;  1LOV A;  1BSA A;  1I2G A;  1I0X A;  1B2M A;  2BIR A;  1B3S A;  3A5E A;  9RNT A;  1UCJ A;  1B2X A;  5HOH A;  2BU4 A;  3D5I A;  1BSC A;  1GOU A;  5RNT A;  1B20 A;  1FZU A;  1GMP A;  1RTU A;  1BOX A;  2AAD A;  1I3F A;  1RNT A;  1BNG A;  1TTO A;  4J5G A;  1B21 A;  2KF5 A;  3AHW A;  1B2U A;  1RNB A;  1BSB A;  1GMR A;  1LRA A;  1I8V A;  1RGA A;  1JBS A;  1IYY A;  1BAO A;  5BU4 A;  1BNI A;  4J5K A;  1HYF A;  1I0V A;  1Q9E A;  1FYS A;  1FUS A;  1AQZ A;  6GSP A;  1BNS A;  7RNT A;  1RGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...