1OHPA

Crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal Structure of 5-3-Ketosteroid Isomerase Mutant D38N from Pseudomonas Testosteroni Complexed with 5Alpha-Estran-3,17-Dione
rcsb
source organism Pseudomonas testosteroni
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohpA00
4R1KA 4XBYA 5KP1A 1NDOB 3DMCA 3NV0A 1A2KA 5AIHA 1W00A 3CU3A 3FF0A 4HM2B 3MG3A 3EX9A 4CDLA 3SOYA 3KZTA 5D83A 5CK6A 5AI1A 5JPUA 3OX9A 1O7WB 1OPYA 3A76A 4WWUC 4IIAA 3EF8A 3EC9A 1ISKA 3GWRA 1WQLB 3ECFA 1O7NB 5D81A 5G2GA 3FH1A 4J8TA 1JKGB 2I9WA 1AR0A 3K7CA 2CKFB 4RZMA 4ORLA 2Z7AA 4KVHA 5AIGA 2OWPA 2BMOB 1TUHA 1VZZA 4LMIA 3VSYA 1OHSA 4HM4B 5D82A 4X2HA 1Q40A 1U5OA 3F14A 3FF2A 5AIFA 4HM8B 2BMQB 4XDVA 3G0KA 4I4KA 4XBTA 3JUPA 3KSPA 2BNGA 3EHCA 1E3RA 2YFJB 2RFRA 3IPTA 3FZWA 5IG0A 2Z77A 3LZAA 2INXA 1S5AA 5TGNA 2YFLB 3GZRA 1Z1SA 3MHEA 5IF6A 1DMMA 1ULJB 4R9LA 3OWUA 3EBYA 3FGYA 4HM3B 5IEOA 3BLZA 5BXQA 2F98A 3S5CA 1JN5A 1W01A 3EQQB 1W02A 1OF5A 5BVBA 2QGUA 4HJLB 4OVMA 5HGRA 4WP5A 4HM7B 2GBWB 1W6YA 4HKVB 4H3UA 3HZPA 4Q53A 5IERA 1C7HA 1OUNA 3DM8A 3EN1B 4LGQA 3K0ZA 4GB5A 4STDA 1JB4A 5AEUB 4XDWA 4HZ9B 2HMJB 3EN8A 1OGXA 3JUOA 2W2CA 1JB2A 1BUQA 3M8CA 3B4PA 3T8UA 4XB5A 2JQ5A 3B7CA 2GEYA 5EVHA 1NU3A 2BMRB 4HM5B 5DREA 2IMJA 3GRDA 5DRVA 3MSOA 2R4IA 5IG5A 5CXOA 1DMNA 1UUWB 3JUMA 4L8OA 1JN5B 4HM6B 8CHOA 5IENA 1GY5A 2CHCA 3F8HA 5JPPA 6STDA 5KP4A 3SOAA 1HKXA 3OWSA 3D9RA 3B4OA 3ER7A 3RGAA 3OWYA 4MJDA 1E3VA 3NV0B 3KKGA 4OUQA 4L8PA 4K1VA 2HMMB 1IDPA 3CNXA 7STDA 1SJWA 3LYGA 1ULIB 1UUVB 3GZYB 3FSDA 4HVNA 3NUVA 3E99A 2GXFA 2YFIB 1GS3A 2RCDA 4K1UA 4FCMA 3F7SA 3BB9A 3VGNA 3NHXA 3B8LA 5CLKA 3GZXB 3NM2A 4HZBB 3OXAA 3F9SA 3CPOA 1CQSA 5CF1A 1Q40B 1O7MB 3H51A 3F7XA 4LEHA 1JKGA 4R9KA 1EG9B 2A15A 3JUNA 3JUQA 3EBTA 2RGQA 5STDA 1GY7A 1Q42A 4XM4A 1O7GB 1OGZA 4HM1B 2XRXB 3NBRA 3OV4A 5AEWB 1K41A 5KP3A 3DUKA 3UJMA 2HMKB 2B24B 3F8XA 5IG3A 4WYKA 3UNLA 5IEPA 3EJVA 3FLJA 5FW5A 4J9AA 1OF5B 4U13A 1O7PB 2PZVA 1GY6A 3MG1A 5CF2A 1NWWA 2K54A 4L7KA 3HK4A 3KE7A 3HX8A 3WMDA 1STDA 3T8NA 4N3VA 1EA2A 2UX0A 3F40A 3GZBA 4X2OA 3MYTA 2QIYA 1OHOA 5IG4A 3SEDA 2GEXA 3MG2A 2XR8B 2XSHB 3G16A 4WYKB 4FCJA 1OHPA 2HMLB 1QMAA 3ROBA 3DZLA 1TP6A 3Q90A 2F86B 1DMQA 3STDA 1OH0A 2Z76A 4HM0B 2GBXB 3DXOA 3MKIA 2HMNB 1GYBA 3G8ZA 2XSOB 1ZX2A 3RGRA 3CNMA 2B1XB 3I0YA 3NXJA 3H3HA 1JB5A 1QJGA 3FKAA 1ZO2A 4XBXA 1OCVA 1ASKA 2HMOB 1E97A 1O7HB 4PEJA 5AIIA 2STDA 2F99A
chains in the Genus database with same CATH superfamily
1FGTA 4CPKA 4R1KA 4XBYA 3WOFB 5KP1A 1NDOB 3DGMA 3DMCA 2IYJA 3NV0A 2F56A 2W56B 1MNLA 1VQQA 2KF6A 2ZHXB 4EW5A 1A2KA 1LRAA 2BT3A 5AIHA 1V57A 2ZDJA 4WHAA 2GU3A 1W00A 1RCLA 3CU3A 1RN4A 4ILFA 1YJW3 3FF0A 4HM2B 3MG3A 1IQXA 2H0IA 2K0MA 3EX9A 4MMXB 4CDLA 3EB8A 4G1MB 3SOYA 3CC43 3KZTA 4WFOA 5D83A 1B27A 5CK6A 3Q3FA 3A5EA 5AI1A 2C4BA 5JPUA 1YIT3 3OX9A 1GMPA 1O7WB 3ZG0A 1OPYA 3IMAB 2XFTA 1VQO3 4EC6A 3A76A 1FA3A 1N9JA 1RKYA 1BSEA 1RGKA 1GOYA 4FR9A 1PYLA 2P09A 4EBGA 3K5TA 1W6GA 4WWUC 3I563 1Q824 1DVCA 1QAKA 1FW7A 4IIAA 1LOYA 1D6ZA 2BO9B 3NQZA 3EF8A 3EC9A 1CH0A 2P0XA 1ISKA 1U8CB 3GWRA 1WQLB 3ECFA 1DYUA 1MWTA 1O7NB 5D81A 5G2GA 4O8SA 3FH1A 3DGLA 2KF5A 4BL3A 4J8TA 5ELJA 3NBBA 1JKGB 1ZS7A 1AR0A 2CX1A 2I9WA 2XEPA 4R80A 2XF3A 5AYSC 1KQS2 1IT8A 4N6NB 3K7CA 2CKFB 1BGSA 1QAFA 4RZMA 1LVNA 2GU1A 4LYLB 4ORLA 2E2TA 1RMSA 2Z7AA 4KVHA 2OWPA 2FNQA 2IUKA 5AIGA 2BMOB 1JBTA 1BIRA 3O8YA 1TUHA 1VZZA 1I2FA 1RJOA 1BSBA 4LMIA 3VSYA 1IVUA 1EEJA 4H61A 1OHSA 1QALA 4HM4B 5D82A 4X2HA 1Q40A 1U5OA 1FGRA 3F14A 2HOHA 3WHOA 1V58A 1LNIA 3FF2A 5AIFA 3X3YA 4HM8B 1MOLA 3VF1A 2BMQB 1Q7HA 4XDVA 3G0KA 3PGBA 4I4KA 3WODG 2MC8A 4XBTA 4N6UA 3JUPA 4R4KA 1X1YA 3FCSB 3KSPA 2BNGA 3CCU3 3EHCA 1LOXA 1E3RA 1VQ43 2GSPA 2YFJB 2RFRA 2W9PA 3IPTA 4GL6A 2L1SA 6GSPA 3FZWA 4NPBA 5IG0A 1WMPA 1SPUA 2INXA 1RGCA 2Z77A 1I0XA 1N8QA 1RGAA 3LZAA 1S5AA 3DGYA 1V74A 3WR2A 5TGNA 2YFLB 3GZRA 1TJDA 1Z1SA 3MHEA 1UUGB 3S28A 2CFKA 1PFPA 3X42A 2SBLA 3G6E3 1RTUA 2QEX3 3KIIA 4BL2A 5IF6A 3G4S3 1YIJ3 5BIRA 3CD63 1BSCA 4K61A 2KRTA 5M1AA 2CIUA 1DMMA 1ULJB 3RDEA 4HBRA 1UCLA 4R9LA 3OWUA 3NBJA 1VQ53 3EBYA 1K28A 3FGYA 1MGWA 4HM3B 3AHSA 5HOHA 5IEOA 1BNJA 1RSNA 3BLZA 2BU4A 2F98A 3AGNA 5BXQA 3S5CA 5BVBA 1JN5A 1N5PA 1YGWA 4ZM8A 1GOUA 1W01A 1BNGA 2AAEA 3EQQB 1W02A 1OF5A 4MEIA 1UCIA 1JV2B 2F5WA 2QGUA 4HAAA 4HJLB 4QWTA 2XGNA 1S723 4OVMA 4O02B 5EEOA 1ROAA 4FMDA 5HGRA 2CWVA 3KFQC 1Q814 2E2UA 4WP5A 2OOVA 2QA43 2XH9A 3BNEA 3GAXA 4HM7B 4KT3B 2MF7A 2GBWB 1K734 3N8BA 3TDGA 1W6YA 2C10A 1ZGXA 4HKVB 1BRGA 4H3UA 1VQP3 3HZPA 4Q53A 3CCV3 5AYRB 1EUIC 4RBNA 1US1A 1VQ93 3AMOA 5IERA 1LXEA 1IV7A 1C7HA 1CYVA 2CWTA 1W2B2 1WTHA 1OUNA 5AIIA 2KAAA 1RNTA 1UW1A 2V1LA 1IT7A 1RGGA 1X1XA 3DM8A 1I70A 1MWUA 1VQK3 3AHWA 3EN1B 3RNTA 2W0QA 1B2ZA 1WNHA 4LGQA 1NB3I 3FG4A 1RDSA 3K0ZA 4GB5A 4STDA 1T5YA 1GOVA 1JB4A 1Y4KA 4XDWA 3PCSA 5AEUB 3HI7A 4HZ9B 2HMJB 3URPA 3EN8A 3CCE3 2Y74A 1C54A 1OGXA 5LC6A 3JUOA 3UB1A 2W2CA 1JB2A 1IU7A 3NQYA 1STFI 1BUQA 3M8CA 3B4PA 1W2ZA 3FG3A 1YGEA 4XB5A 2JQ5A 2ZL8A 3T8UA 2Y73A 3B7CA 3S29A 1IQ8A 3JVCA 4LSOA 1K9M4 1X1WA 2GEYA 3LTDA 5EVHA 1NU3A 3K9MC 4NHFA 4BTYA 4N6MA 2F4YA 1B2SA 2CFWA 1BRSA 2BMRB 2AADA 4HM5B 1RGHA 2IMJA 2WGQA 1AQZA 2CX0A 3GRDA 4J5GA 3MSOA 5DRVA 5DREA 1RRLA 3UL6A 1GSPA 2R4IA 5IG5A 1FZUA 3BU4A 5CXOA 3CME3 3X3XA 1I2EA 4O3VA 1DMNA 1MWSA 3V99A 1VQN3 1W5ZA 1UUWB 2CWUA 3NX0A 3LXUX 3JUMA 2KCDA 2W04A 4L8OA 1JN5B 4EV2A 3X41A 1DETA 3DY5A 4BIRA 4HM6B 8CHOA 5IENA 1GY5A 2CHCA 2KXGA 1RGFA 2PNCA 3F8HA 5JPPA 2WOFA 6STDA 2UUGC 3ZFZA 5KP4A 1AV4A 3D4AA 3WA3A 1F8NA 2RNTA 4N6LA 1HKXA 3OWSA 3SOAA 2CFLA 2UGIA 4AKYA 3BIRA 1VQ63 3D9RA 4BTWA 3S27A 1K8A4 3B4OA 3ER7A 1CYUA 1GD3A 1KWIA 3RGAA 1T2IA 3OWYA 1FUSA 3X3ZA 2CC3A 1HU9A 4EXRA 2CW9A 1FGOA 1WMOA 2E2VA 4MJDA 1E3VA 5I97A 1SIIA 4O2HA 3NV0B 3KKGA 2R41A 2W6JH 1FYSA 3KCHA 4OUQA 1NB5I 4L8PA 4K1VA 2HMMB 1RLSA 1YNVX 2OQEC 1BVIA 3CCQ3 1IDPA 3AGOA 3CNXA 3DGOA 4AKZA 2CK3H 7STDA 4JRFA 1SJWA 2KF4A 3LYGA 1N9EA 1ULIB 2FXTA 1RHLA 4HOHA 4N6TA 1LOWA 1BANA 3WA2X 4LZIA 2W56A 3U1WA 1RCKA 2RBIA 4RNTA 1T2HA 3SX1A 1HYFA 2W9QA 3T0UA 1UUVB 1M1K4 1A90A 3GZYB 3LTBA 3FSDA 4HVNA 1DE3A 3CMA3 4DKIA 1IVXA 1YHQ3 1UCKA 3NUVA 1QVG2 1SARA 5A0OB 3E99A 1I3FA 1B2XA 1SIHA 1SQWA 3FG1A 2GXFA 1EQKA 2YFIB 2C11A 1GS3A 2RCDA 2P38A 4K1UA 3K63A 5FGOA 1OACA 5ELUA 4GSPA 6RNTA 1DVDA 3MWZA 4FCMA 5GSPA 3F7SA 2ZA4A 1FUTA 3LTAA 5M19A 1UGHI 3BB9A 3VGNA 3NHXA 1M1XB 2JDIH 3B8LA 5CLKA 3GZXB 3NM2A 4JF8A 1UCJA 4HZBB 5RNTA 3OXAA 3ALAA 2CG1A 1I2GA 3F9SA 1EKMA 3X40A 3CPOA 1CQSA 1RRHA 2CFDA 5CF1A 1M9GA 4N6OB 4RNYA 1PU4A 3SXXA 4HYZA 3IJEB 1TRPA 1Q40B 1BSAA 1O7MB 3H51A 3F7XA 4TX4A 4LEHA 3HOHA 1JKGA 4R9KA 2A15A 1EG9B 3JUNA 3JUQA 3EBTA 1KD14 1BRNL 1MGRA 1YVSA 2O3OA 2RGQA 3QRDA 5STDA 5BU4A 4NREA 1KSIA 1GY7A 1Q42A 1WMNA 3PZWA 4OK0A 4XM4A 4AEQA 3CC73 1O7GB 1OGZA 4HM1B 3BNDA 1LQMB 3BNBA 2XRXB 1TFOA 1YI23 3NBRA 4KFEA 3SVAA 3OV4A 1VQ73 3WDGB 4FCZA 4K90B 1BRIA 1BAOA 1FGMA 5AEWB 2BHMA 3S67A 2Z6BA 4CJNA 9RNTA 1K41A 5KP3A 3DUKA 3UJMA 2LYXA 3V98A 4J5KA 2HMKB 1Q7Y4 1QVF2 2IUJA 2B24B 2CFGA 5G1LA 1A2PA 1R4YA 3D3LA 3F8XA 1AY7A 2FGTA 5IG3A 1BUJA 1GMRA 3NM7A 1L5GB 4WYKA 1W6CA 4KZ1A 1GMQA 7RNTA 3UNLA 1BNIA 8RNTA 2P0MA 5IEPA 2D42A 1IK3A 5LC7A 3U97A 1TU5A 4FMAA 3EJVA 3FLJA 1JZOA 3WOEB 1BU4A 1I0VA 2L4VA 5FW5A 3UL5A 3LH4A 4J9AA 1I3IA 1OF5B 4U13A 1BNFA 3PYJA 2OTL3 1Q864 1A67A 4FMCA 1O7PB 3LT9A 2IY2A 1JNQA 1YVBI 2CH9A 3V92A 3CPW2 3CCS3 4IPBA 3GSPA 4CCVA 4EYCA 2PZVA 1UDII 1GY6A 3MG1A 2H0HA 5CF2A 1NWWA 2K54A 3CXC2 1HZ1A 4MMYB 3OW22 3KSED 1W4NA 1VQM3 2WGOA 4L7KA 3HK4A 1IVVA 3KN4A 3KE7A 3AMOB 3BNCA 1A2VA 3EE1A 3HX8A 1JBRA 2OOVC 3CCJ3 1MWRA 1LOVA 3HIIA 3WMDA 1STDA 1N8R4 1B2UA 2LQVA 3T8NA 1JBSA 3CC23 3N54B 1G0TA 4N3VA 1EA2A 2UX0A 5JBSA 3CCM3 1PY3A 1RGLA 3F40A 1FUWA 1TIJA 1FGQA 3GZBA 4BTXA 1BRHA 2YX9A 1TRQA 4GHOA 4X2OA 3I553 3MYTA 1BRJA 5G1KA 1JJ22 3Q1CA 2QIYA 2XGLA 4I5QA 5IW9A 1OHOA 5IG4A 2OTJ3 5M18A 4EV5A 1X1UA 3SEDA 1BNEA 2J8XB 1J2BA 1BRKA 7GSPA 4KFDA 2GEXA 4FMBA 3MG2A 2XR8B 1RNBA 2XSHB 3G16A 1GD4A 3D5IA 2WOHA 1CEWI 4WYKB 1YJ93 3LTCA 1NJI4 4FCJA 1Q9EA 1OHPA 2D1WA 1JRQA 2O9UX 1B20A 1R4CA 2HMLB 2KF3A 1B21A 3ZG5A 1BOXA 1AVLA 2H0GA 1VQL3 3PCRA 1QMAA 1JZDA 3ROBA 1TTOA 1D6UA 3DZLA 1TP6A 3G713 1RN7A 1UI7A 1VQ83 2K3DA 3Q90A 2F86B 1DMQA 3HIGA 3LT8A 3LMLA 3D79A 3STDA 1OH0A 1RGEA 2Z76A 4HM0B 2GBXB 2IA7A 1IVWA 2RSXA 2XFSA 1B3SA 3DXOA 3MKIA 2HMNB 2CG0A 2WO0A 1D6YA 1GYBA 1ROVA 2SARA 3G8ZA 1NNVA 2XSOB 4MMZB 4N6V0 1BNSA 2ML6A 4IT7A 1IQYA 4RNZA 1YJN3 1BNRA 1ZX2A 3RGRA 1IYYA 3PS8A 3CNMA 3DH2A 1UI8A 2B1XB 4KFFA 2BIRA 1AVKA 1G96A 3I0YA 3L0RA 3NXJA 3H3HA 1RN1A 1JB5A 1TFKA 2M7OA 1W7CA 1QJGA 1N5HA 3FKAA 3Q2PA 1ZO2A 3D5GA 1NO3A 4XBXA 3LOYA 3J7Yd 1UGIA 1OCVA 1ASKA 3N9HA 3QK9A 1LNHA 2HMOB 3CCR3 1G02A 2F5MA 5EQLA 2Q07A 1E97A 1BSDA 2OCTA 2P05A 2W03A 3SYUA 4BU4A 1KC84 1M904 1LQGC 1O7HB 4PEJA 3SLUA 1B2MA 3PXMA 3DGNA 1IV9A 2OQEA 1T3BA 3MPHA 3CCL3 2ML5A 2STDA 2F99A 1I8VA
chains in the Genus database with same CATH topology
1FGTA 4R1KA 4XBYA 3WOFB 5KP1A 1NDOB 3DGMA 3DMCA 3NV0A 2W56B 1MNLA 1A2KA 2BT3A 5AIHA 2ZDJA 4WHAA 2GU3A 1W00A 3CU3A 1YJW3 3FF0A 4HM2B 3MG3A 1IQXA 3EX9A 2K0MA 4CDLA 4MMXB 3EB8A 4G1MB 3SOYA 3CC43 3KZTA 4WFOA 5D83A 5CK6A 1YIT3 5AI1A 5JPUA 3OX9A 1O7WB 1OPYA 3IMAB 2XFTA 1VQO3 4EC6A 3A76A 1FA3A 1N9JA 1RKYA 4FR9A 2P09A 4EBGA 3K5TA 1W6GA 4WWUC 3I563 1Q824 1DVCA 1QAKA 4IIAA 1D6ZA 2BO9B 3NQZA 3EF8A 3EC9A 2P0XA 1ISKA 1U8CB 3GWRA 1WQLB 3ECFA 1DYUA 1O7NB 5D81A 5G2GA 4O8SA 3FH1A 3DGLA 4J8TA 5ELJA 3NBBA 1JKGB 2I9WA 1AR0A 1NB5I 2XEPA 4R80A 2XF3A 5AYSC 1IT8A 4N6NB 3K7CA 2CKFB 4RZMA 1QAFA 1LVNA 2GU1A 4ORLA 2E2TA 2Z7AA 4KVHA 2OWPA 2FNQA 2IUKA 5AIGA 2BMOB 3O8YA 1TUHA 1VZZA 1RJOA 4LMIA 3VSYA 1IVUA 4H61A 1OHSA 1QALA 4HM4B 5D82A 4X2HA 1Q40A 1U5OA 1FGRA 3F14A 3FF2A 5AIFA 3X3YA 4HM8B 1MOLA 3VF1A 2BMQB 4XDVA 3G0KA 3PGBA 4I4KA 3WODG 2MC8A 4XBTA 4N6UA 3JUPA 4R4KA 3FCSB 3KSPA 2BNGA 3CCU3 3EHCA 1LOXA 1E3RA 1VQ43 2YFJB 2RFRA 2W9PA 3IPTA 4GL6A 3FZWA 5IG0A 1WMPA 1SPUA 2INXA 2Z77A 3LZAA 1N8QA 1S5AA 1V74A 5TGNA 2YFLB 3GZRA 1Z1SA 3MHEA 3S28A 2CFKA 1PFPA 3X42A 2SBLA 3G6E3 2QEX3 3KIIA 5IF6A 3G4S3 1YIJ3 3CD63 4K61A 2KRTA 2CIUA 1DMMA 1ULJB 3RDEA 4HBRA 4R9LA 3OWUA 3NBJA 1VQ53 3EBYA 1K28A 3FGYA 4HM3B 5IEOA 3BLZA 5BXQA 2F98A 3S5CA 1JN5A 1N5PA 4ZM8A 1W01A 3EQQB 1W02A 1OF5A 4MEIA 4QWTA 1JV2B 2QGUA 5BVBA 4HJLB 2XGNA 1S723 4OVMA 4O02B 5EEOA 1ROAA 4FMDA 5HGRA 2CWVA 3KFQC 1Q814 2E2UA 4WP5A 2OOVA 2QA43 2XH9A 3BNEA 3GAXA 4HM7B 2MF7A 2GBWB 1K734 3N8BA 3TDGA 1W6YA 2C10A 4HKVB 4H3UA 1VQP3 3HZPA 4Q53A 3CCV3 5AYRB 4RBNA 1US1A 1VQ93 3AMOA 5IERA 1LXEA 1IV7A 1C7HA 1CYVA 2CWTA 1W2B2 1WTHA 1OUNA 5AIIA 1UW1A 2V1LA 1IT7A 3DM8A 1VQK3 3EN1B 2W0QA 1WNHA 4LGQA 1NB3I 3FG4A 3K0ZA 4GB5A 4STDA 1T5YA 1JB4A 1Y4KA 4XDWA 3PCSA 5AEUB 3HI7A 4HZ9B 2HMJB 3EN8A 3CCE3 2Y74A 1OGXA 5LC6A 3JUOA 3UB1A 2W2CA 1JB2A 1IU7A 3NQYA 1STFI 1BUQA 3M8CA 3B4PA 1W2ZA 3FG3A 1YGEA 4XB5A 2JQ5A 2ZL8A 3T8UA 2Y73A 3B7CA 3S29A 1IQ8A 3JVCA 4LSOA 1K9M4 2GEYA 3LTDA 5EVHA 1NU3A 3K9MC 4NHFA 4BTYA 4N6MA 2CFWA 2BMRB 4HM5B 2WGQA 2IMJA 3GRDA 5DRVA 5DREA 3MSOA 1RRLA 3UL6A 2R4IA 5IG5A 5CXOA 3CME3 3X3XA 4O3VA 3V99A 1DMNA 1VQN3 1W5ZA 1UUWB 2CWUA 3NX0A 3LXUX 3JUMA 2KCDA 2W04A 4L8OA 1JN5B 4EV2A 3X41A 3DY5A 4HM6B 8CHOA 5IENA 1GY5A 2CHCA 2KXGA 2PNCA 3F8HA 5JPPA 2WOFA 6STDA 5KP4A 1AV4A 3WA3A 1F8NA 4N6LA 1HKXA 3OWSA 3SOAA 2CFLA 4AKYA 1VQ63 3D9RA 4BTWA 3S27A 1K8A4 3B4OA 3ER7A 1CYUA 1GD3A 1KWIA 3RGAA 3OWYA 3X3ZA 2CC3A 1HU9A 4EXRA 2CW9A 1FGOA 1WMOA 2E2VA 4MJDA 1E3VA 5I97A 1SIIA 4O2HA 3NV0B 3KKGA 2W6JH 4OUQA 4L8PA 4K1VA 2HMMB 2OQEC 3CCQ3 1IDPA 3DGOA 3CNXA 4AKZA 7STDA 2CK3H 4JRFA 1SJWA 3LYGA 1N9EA 1ULIB 2FXTA 4N6TA 3WA2X 4LZIA 2W56A 3U1WA 3SX1A 2W9QA 3T0UA 1UUVB 1M1K4 1A90A 3GZYB 3LTBA 3FSDA 4HVNA 3CMA3 1IVXA 1YHQ3 3NUVA 1QVG2 5A0OB 3E99A 1SIHA 1SQWA 3FG1A 2GXFA 1EQKA 2YFIB 2C11A 1GS3A 2RCDA 2P38A 4K1UA 3K63A 5FGOA 1OACA 5ELUA 1DVDA 3MWZA 4FCMA 3F7SA 3LTAA 3BB9A 3VGNA 3NHXA 1M1XB 2JDIH 3B8LA 5CLKA 3GZXB 3NM2A 4JF8A 4HZBB 3OXAA 3ALAA 2CG1A 3F9SA 1EKMA 3X40A 3CPOA 1CQSA 1RRHA 2CFDA 5CF1A 1M9GA 4N6OB 4RNYA 1PU4A 3SXXA 4HYZA 3IJEB 1Q40B 1O7MB 3H51A 3F7XA 4TX4A 4LEHA 1JKGA 4R9KA 1EG9B 2A15A 3JUNA 3JUQA 3EBTA 1KD14 2O3OA 2RGQA 3QRDA 5STDA 4NREA 1KSIA 1GY7A 1Q42A 1WMNA 3PZWA 4OK0A 4XM4A 4AEQA 3CC73 1O7GB 1OGZA 4HM1B 3BNDA 3BNBA 2XRXB 1TFOA 1YI23 3NBRA 4KFEA 3SVAA 3OV4A 1VQ73 3WDGB 4FCZA 4K90B 1FGMA 5AEWB 2BHMA 3S67A 2Z6BA 1K41A 5KP3A 3DUKA 3UJMA 2LYXA 3V98A 1Q7Y4 2HMKB 1QVF2 2IUJA 2B24B 2CFGA 3D3LA 3F8XA 2FGTA 5IG3A 3NM7A 1L5GB 4WYKA 1W6CA 4KZ1A 3UNLA 2P0MA 5IEPA 2D42A 1IK3A 5LC7A 3U97A 1TU5A 4FMAA 3EJVA 3FLJA 3WOEB 2L4VA 5FW5A 3UL5A 3LH4A 4J9AA 1OF5B 4U13A 2OTL3 3PYJA 1Q864 1A67A 4FMCA 1O7PB 3LT9A 1JNQA 1YVBI 2CH9A 3V92A 3CPW2 3CCS3 4IPBA 4CCVA 4EYCA 2PZVA 1GY6A 3MG1A 5CF2A 1NWWA 2K54A 3CXC2 4MMYB 3OW22 3KSED 1W4NA 1VQM3 2WGOA 4L7KA 3HK4A 1IVVA 3KN4A 3KE7A 3AMOB 3BNCA 1A2VA 3EE1A 3HX8A 2OOVC 3CCJ3 3HIIA 3WMDA 1N8R4 1STDA 2LQVA 3T8NA 3CC23 3N54B 4N3VA 1EA2A 2UX0A 5JBSA 3CCM3 3F40A 1FUWA 1TIJA 1FGQA 3GZBA 4BTXA 2YX9A 4X2OA 3I553 3MYTA 1JJ22 3Q1CA 2QIYA 2XGLA 5IW9A 1OHOA 5IG4A 2OTJ3 4EV5A 3SEDA 1J2BA 4KFDA 2GEXA 4FMBA 3MG2A 2XR8B 2XSHB 3G16A 1GD4A 2WOHA 1CEWI 4WYKB 1YJ93 3LTCA 1NJI4 4FCJA 2D1WA 1OHPA 1JRQA 2O9UX 1R4CA 2HMLB 1AVLA 1VQL3 3PCRA 1QMAA 3ROBA 1D6UA 3DZLA 1TP6A 3G713 1RN7A 1UI7A 1VQ83 3Q90A 2F86B 1DMQA 3HIGA 3LT8A 3LMLA 3STDA 1OH0A 2Z76A 4HM0B 2GBXB 2IA7A 1IVWA 2RSXA 2XFSA 3DXOA 3MKIA 2HMNB 2CG0A 2WO0A 1GYBA 1D6YA 1ROVA 3G8ZA 2XSOB 4MMZB 4N6V0 2ML6A 4RNZA 4IT7A 1IQYA 1YJN3 1ZX2A 3RGRA 3PS8A 3CNMA 1UI8A 2B1XB 4KFFA 3I0YA 1AVKA 1G96A 3L0RA 3NXJA 3H3HA 1JB5A 1TFKA 2M7OA 1W7CA 1QJGA 1N5HA 3FKAA 3Q2PA 1ZO2A 1NO3A 4XBXA 3LOYA 3J7Yd 1OCVA 1ASKA 3N9HA 3QK9A 1LNHA 2HMOB 3CCR3 1KQS2 5EQLA 2Q07A 1E97A 2OCTA 2P05A 2W03A 1KC84 1M904 1O7HB 3SLUA 4PEJA 3PXMA 3DGNA 1IV9A 2OQEA 3MPHA 3CCL3 2ML5A 2STDA 2F99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1K A;  4XBY A;  5KP1 A;  1NDO B;  3DMC A;  3NV0 A;  1A2K A;  5AIH A;  1W00 A;  3CU3 A;  3FF0 A;  4HM2 B;  3MG3 A;  3EX9 A;  4CDL A;  3SOY A;  3KZT A;  5D83 A;  5CK6 A;  5AI1 A;  5JPU A;  3OX9 A;  1O7W B;  1OPY A;  3A76 A;  4WWU C;  4IIA A;  3EF8 A;  3EC9 A;  1ISK A;  3GWR A;  1WQL B;  3ECF A;  1O7N B;  5D81 A;  5G2G A;  3FH1 A;  4J8T A;  1JKG B;  2I9W A;  1AR0 A;  3K7C A;  2CKF B;  4RZM A;  4ORL A;  2Z7A A;  4KVH A;  5AIG A;  2OWP A;  2BMO B;  1TUH A;  1VZZ A;  4LMI A;  3VSY A;  1OHS A;  4HM4 B;  5D82 A;  4X2H A;  1Q40 A;  1U5O A;  3F14 A;  3FF2 A;  5AIF A;  4HM8 B;  2BMQ B;  4XDV A;  3G0K A;  4I4K A;  4XBT A;  3JUP A;  3KSP A;  2BNG A;  3EHC A;  1E3R A;  2YFJ B;  2RFR A;  3IPT A;  3FZW A;  5IG0 A;  2Z77 A;  3LZA A;  2INX A;  1S5A A;  5TGN A;  2YFL B;  3GZR A;  1Z1S A;  3MHE A;  5IF6 A;  1DMM A;  1ULJ B;  4R9L A;  3OWU A;  3EBY A;  3FGY A;  4HM3 B;  5IEO A;  3BLZ A;  5BXQ A;  2F98 A;  3S5C A;  1JN5 A;  1W01 A;  3EQQ B;  1W02 A;  1OF5 A;  5BVB A;  2QGU A;  4HJL B;  4OVM A;  5HGR A;  4WP5 A;  4HM7 B;  2GBW B;  1W6Y A;  4HKV B;  4H3U A;  3HZP A;  4Q53 A;  5IER A;  1C7H A;  1OUN A;  3DM8 A;  3EN1 B;  4LGQ A;  3K0Z A;  4GB5 A;  4STD A;  1JB4 A;  5AEU B;  4XDW A;  4HZ9 B;  2HMJ B;  3EN8 A;  1OGX A;  3JUO A;  2W2C A;  1JB2 A;  1BUQ A;  3M8C A;  3B4P A;  3T8U A;  4XB5 A;  2JQ5 A;  3B7C A;  2GEY A;  5EVH A;  1NU3 A;  2BMR B;  4HM5 B;  5DRE A;  2IMJ A;  3GRD A;  5DRV A;  3MSO A;  2R4I A;  5IG5 A;  5CXO A;  1DMN A;  1UUW B;  3JUM A;  4L8O A;  1JN5 B;  4HM6 B;  8CHO A;  5IEN A;  1GY5 A;  2CHC A;  3F8H A;  5JPP A;  6STD A;  5KP4 A;  3SOA A;  1HKX A;  3OWS A;  3D9R A;  3B4O A;  3ER7 A;  3RGA A;  3OWY A;  4MJD A;  1E3V A;  3NV0 B;  3KKG A;  4OUQ A;  4L8P A;  4K1V A;  2HMM B;  1IDP A;  3CNX A;  7STD A;  1SJW A;  3LYG A;  1ULI B;  1UUV B;  3GZY B;  3FSD A;  4HVN A;  3NUV A;  3E99 A;  2GXF A;  2YFI B;  1GS3 A;  2RCD A;  4K1U A;  4FCM A;  3F7S A;  3BB9 A;  3VGN A;  3NHX A;  3B8L A;  5CLK A;  3GZX B;  3NM2 A;  4HZB B;  3OXA A;  3F9S A;  3CPO A;  1CQS A;  5CF1 A;  1Q40 B;  1O7M B;  3H51 A;  3F7X A;  4LEH A;  1JKG A;  4R9K A;  1EG9 B;  2A15 A;  3JUN A;  3JUQ A;  3EBT A;  2RGQ A;  5STD A;  1GY7 A;  1Q42 A;  4XM4 A;  1O7G B;  1OGZ A;  4HM1 B;  2XRX B;  3NBR A;  3OV4 A;  5AEW B;  1K41 A;  5KP3 A;  3DUK A;  3UJM A;  2HMK B;  2B24 B;  3F8X A;  5IG3 A;  4WYK A;  3UNL A;  5IEP A;  3EJV A;  3FLJ A;  5FW5 A;  4J9A A;  1OF5 B;  4U13 A;  1O7P B;  2PZV A;  1GY6 A;  3MG1 A;  5CF2 A;  1NWW A;  2K54 A;  4L7K A;  3HK4 A;  3KE7 A;  3HX8 A;  3WMD A;  1STD A;  3T8N A;  4N3V A;  1EA2 A;  2UX0 A;  3F40 A;  3GZB A;  4X2O A;  3MYT A;  2QIY A;  1OHO A;  5IG4 A;  3SED A;  2GEX A;  3MG2 A;  2XR8 B;  2XSH B;  3G16 A;  4WYK B;  4FCJ A;  1OHP A;  2HML B;  1QMA A;  3ROB A;  3DZL A;  1TP6 A;  3Q90 A;  2F86 B;  1DMQ A;  3STD A;  1OH0 A;  2Z76 A;  4HM0 B;  2GBX B;  3DXO A;  3MKI A;  2HMN B;  1GYB A;  3G8Z A;  2XSO B;  1ZX2 A;  3RGR A;  3CNM A;  2B1X B;  3I0Y A;  3NXJ A;  3H3H A;  1JB5 A;  1QJG A;  3FKA A;  1ZO2 A;  4XBX A;  1OCV A;  1ASK A;  2HMO B;  1E97 A;  1O7H B;  4PEJ A;  5AII A;  2STD A;  2F99 A; 
#chains in the Genus database with same CATH topology
 1FGT A;  4CPK A;  4R1K A;  4XBY A;  3WOF B;  5KP1 A;  1NDO B;  3DGM A;  3DMC A;  2IYJ A;  3NV0 A;  2F56 A;  2W56 B;  1MNL A;  1VQQ A;  2KF6 A;  2ZHX B;  4EW5 A;  1A2K A;  1LRA A;  2BT3 A;  5AIH A;  1V57 A;  2ZDJ A;  4WHA A;  2GU3 A;  1W00 A;  1RCL A;  3CU3 A;  1RN4 A;  4ILF A;  1YJW 3;  3FF0 A;  4HM2 B;  3MG3 A;  1IQX A;  2H0I A;  2K0M A;  3EX9 A;  4MMX B;  4CDL A;  3EB8 A;  4G1M B;  3SOY A;  3CC4 3;  3KZT A;  4WFO A;  5D83 A;  1B27 A;  5CK6 A;  3Q3F A;  3A5E A;  5AI1 A;  2C4B A;  5JPU A;  1YIT 3;  3OX9 A;  1GMP A;  1O7W B;  3ZG0 A;  1OPY A;  3IMA B;  2XFT A;  1VQO 3;  4EC6 A;  3A76 A;  1FA3 A;  1N9J A;  1RKY A;  1BSE A;  1RGK A;  1GOY A;  4FR9 A;  1PYL A;  2P09 A;  4EBG A;  3K5T A;  1W6G A;  4WWU C;  3I56 3;  1Q82 4;  1DVC A;  1QAK A;  1FW7 A;  4IIA A;  1LOY A;  1D6Z A;  2BO9 B;  3NQZ A;  3EF8 A;  3EC9 A;  1CH0 A;  2P0X A;  1ISK A;  1U8C B;  3GWR A;  1WQL B;  3ECF A;  1DYU A;  1MWT A;  1O7N B;  5D81 A;  5G2G A;  4O8S A;  3FH1 A;  3DGL A;  2KF5 A;  4BL3 A;  4J8T A;  5ELJ A;  3NBB A;  1JKG B;  1ZS7 A;  1AR0 A;  2CX1 A;  2I9W A;  2XEP A;  4R80 A;  2XF3 A;  5AYS C;  1KQS 2;  1IT8 A;  4N6N B;  3K7C A;  2CKF B;  1BGS A;  1QAF A;  4RZM A;  1LVN A;  2GU1 A;  4LYL B;  4ORL A;  2E2T A;  1RMS A;  2Z7A A;  4KVH A;  2OWP A;  2FNQ A;  2IUK A;  5AIG A;  2BMO B;  1JBT A;  1BIR A;  3O8Y A;  1TUH A;  1VZZ A;  1I2F A;  1RJO A;  1BSB A;  4LMI A;  3VSY A;  1IVU A;  1EEJ A;  4H61 A;  1OHS A;  1QAL A;  4HM4 B;  5D82 A;  4X2H A;  1Q40 A;  1U5O A;  1FGR A;  3F14 A;  2HOH A;  3WHO A;  1V58 A;  1LNI A;  3FF2 A;  5AIF A;  3X3Y A;  4HM8 B;  1MOL A;  3VF1 A;  2BMQ B;  1Q7H A;  4XDV A;  3G0K A;  3PGB A;  4I4K A;  3WOD G;  2MC8 A;  4XBT A;  4N6U A;  3JUP A;  4R4K A;  1X1Y A;  3FCS B;  3KSP A;  2BNG A;  3CCU 3;  3EHC A;  1LOX A;  1E3R A;  1VQ4 3;  2GSP A;  2YFJ B;  2RFR A;  2W9P A;  3IPT A;  4GL6 A;  2L1S A;  6GSP A;  3FZW A;  4NPB A;  5IG0 A;  1WMP A;  1SPU A;  2INX A;  1RGC A;  2Z77 A;  1I0X A;  1N8Q A;  1RGA A;  3LZA A;  1S5A A;  3DGY A;  1V74 A;  3WR2 A;  5TGN A;  2YFL B;  3GZR A;  1TJD A;  1Z1S A;  3MHE A;  1UUG B;  3S28 A;  2CFK A;  1PFP A;  3X42 A;  2SBL A;  3G6E 3;  1RTU A;  2QEX 3;  3KII A;  4BL2 A;  5IF6 A;  3G4S 3;  1YIJ 3;  5BIR A;  3CD6 3;  1BSC A;  4K61 A;  2KRT A;  5M1A A;  2CIU A;  1DMM A;  1ULJ B;  3RDE A;  4HBR A;  1UCL A;  4R9L A;  3OWU A;  3NBJ A;  1VQ5 3;  3EBY A;  1K28 A;  3FGY A;  1MGW A;  4HM3 B;  3AHS A;  5HOH A;  5IEO A;  1BNJ A;  1RSN A;  3BLZ A;  2BU4 A;  2F98 A;  3AGN A;  5BXQ A;  3S5C A;  5BVB A;  1JN5 A;  1N5P A;  1YGW A;  4ZM8 A;  1GOU A;  1W01 A;  1BNG A;  2AAE A;  3EQQ B;  1W02 A;  1OF5 A;  4MEI A;  1UCI A;  1JV2 B;  2F5W A;  2QGU A;  4HAA A;  4HJL B;  4QWT A;  2XGN A;  1S72 3;  4OVM A;  4O02 B;  5EEO A;  1ROA A;  4FMD A;  5HGR A;  2CWV A;  3KFQ C;  1Q81 4;  2E2U A;  4WP5 A;  2OOV A;  2QA4 3;  2XH9 A;  3BNE A;  3GAX A;  4HM7 B;  4KT3 B;  2MF7 A;  2GBW B;  1K73 4;  3N8B A;  3TDG A;  1W6Y A;  2C10 A;  1ZGX A;  4HKV B;  1BRG A;  4H3U A;  1VQP 3;  3HZP A;  4Q53 A;  3CCV 3;  5AYR B;  1EUI C;  4RBN A;  1US1 A;  1VQ9 3;  3AMO A;  5IER A;  1LXE A;  1IV7 A;  1C7H A;  1CYV A;  2CWT A;  1W2B 2;  1WTH A;  1OUN A;  5AII A;  2KAA A;  1RNT A;  1UW1 A;  2V1L A;  1IT7 A;  1RGG A;  1X1X A;  3DM8 A;  1I70 A;  1MWU A;  1VQK 3;  3AHW A;  3EN1 B;  3RNT A;  2W0Q A;  1B2Z A;  1WNH A;  4LGQ A;  1NB3 I;  3FG4 A;  1RDS A;  3K0Z A;  4GB5 A;  4STD A;  1T5Y A;  1GOV A;  1JB4 A;  1Y4K A;  4XDW A;  3PCS A;  5AEU B;  3HI7 A;  4HZ9 B;  2HMJ B;  3URP A;  3EN8 A;  3CCE 3;  2Y74 A;  1C54 A;  1OGX A;  5LC6 A;  3JUO A;  3UB1 A;  2W2C A;  1JB2 A;  1IU7 A;  3NQY A;  1STF I;  1BUQ A;  3M8C A;  3B4P A;  1W2Z A;  3FG3 A;  1YGE A;  4XB5 A;  2JQ5 A;  2ZL8 A;  3T8U A;  2Y73 A;  3B7C A;  3S29 A;  1IQ8 A;  3JVC A;  4LSO A;  1K9M 4;  1X1W A;  2GEY A;  3LTD A;  5EVH A;  1NU3 A;  3K9M C;  4NHF A;  4BTY A;  4N6M A;  2F4Y A;  1B2S A;  2CFW A;  1BRS A;  2BMR B;  2AAD A;  4HM5 B;  1RGH A;  2IMJ A;  2WGQ A;  1AQZ A;  2CX0 A;  3GRD A;  4J5G A;  3MSO A;  5DRV A;  5DRE A;  1RRL A;  3UL6 A;  1GSP A;  2R4I A;  5IG5 A;  1FZU A;  3BU4 A;  5CXO A;  3CME 3;  3X3X A;  1I2E A;  4O3V A;  1DMN A;  1MWS A;  3V99 A;  1VQN 3;  1W5Z A;  1UUW B;  2CWU A;  3NX0 A;  3LXU X;  3JUM A;  2KCD A;  2W04 A;  4L8O A;  1JN5 B;  4EV2 A;  3X41 A;  1DET A;  3DY5 A;  4BIR A;  4HM6 B;  8CHO A;  5IEN A;  1GY5 A;  2CHC A;  2KXG A;  1RGF A;  2PNC A;  3F8H A;  5JPP A;  2WOF A;  6STD A;  2UUG C;  3ZFZ A;  5KP4 A;  1AV4 A;  3D4A A;  3WA3 A;  1F8N A;  2RNT A;  4N6L A;  1HKX A;  3OWS A;  3SOA A;  2CFL A;  2UGI A;  4AKY A;  3BIR A;  1VQ6 3;  3D9R A;  4BTW A;  3S27 A;  1K8A 4;  3B4O A;  3ER7 A;  1CYU A;  1GD3 A;  1KWI A;  3RGA A;  1T2I A;  3OWY A;  1FUS A;  3X3Z A;  2CC3 A;  1HU9 A;  4EXR A;  2CW9 A;  1FGO A;  1WMO A;  2E2V A;  4MJD A;  1E3V A;  5I97 A;  1SII A;  4O2H A;  3NV0 B;  3KKG A;  2R41 A;  2W6J H;  1FYS A;  3KCH A;  4OUQ A;  1NB5 I;  4L8P A;  4K1V A;  2HMM B;  1RLS A;  1YNV X;  2OQE C;  1BVI A;  3CCQ 3;  1IDP A;  3AGO A;  3CNX A;  3DGO A;  4AKZ A;  2CK3 H;  7STD A;  4JRF A;  1SJW A;  2KF4 A;  3LYG A;  1N9E A;  1ULI B;  2FXT A;  1RHL A;  4HOH A;  4N6T A;  1LOW A;  1BAN A;  3WA2 X;  4LZI A;  2W56 A;  3U1W A;  1RCK A;  2RBI A;  4RNT A;  1T2H A;  3SX1 A;  1HYF A;  2W9Q A;  3T0U A;  1UUV B;  1M1K 4;  1A90 A;  3GZY B;  3LTB A;  3FSD A;  4HVN A;  1DE3 A;  3CMA 3;  4DKI A;  1IVX A;  1YHQ 3;  1UCK A;  3NUV A;  1QVG 2;  1SAR A;  5A0O B;  3E99 A;  1I3F A;  1B2X A;  1SIH A;  1SQW A;  3FG1 A;  2GXF A;  1EQK A;  2YFI B;  2C11 A;  1GS3 A;  2RCD A;  2P38 A;  4K1U A;  3K63 A;  5FGO A;  1OAC A;  5ELU A;  4GSP A;  6RNT A;  1DVD A;  3MWZ A;  4FCM A;  5GSP A;  3F7S A;  2ZA4 A;  1FUT A;  3LTA A;  5M19 A;  1UGH I;  3BB9 A;  3VGN A;  3NHX A;  1M1X B;  2JDI H;  3B8L A;  5CLK A;  3GZX B;  3NM2 A;  4JF8 A;  1UCJ A;  4HZB B;  5RNT A;  3OXA A;  3ALA A;  2CG1 A;  1I2G A;  3F9S A;  1EKM A;  3X40 A;  3CPO A;  1CQS A;  1RRH A;  2CFD A;  5CF1 A;  1M9G A;  4N6O B;  4RNY A;  1PU4 A;  3SXX A;  4HYZ A;  3IJE B;  1TRP A;  1Q40 B;  1BSA A;  1O7M B;  3H51 A;  3F7X A;  4TX4 A;  4LEH A;  3HOH A;  1JKG A;  4R9K A;  2A15 A;  1EG9 B;  3JUN A;  3JUQ A;  3EBT A;  1KD1 4;  1BRN L;  1MGR A;  1YVS A;  2O3O A;  2RGQ A;  3QRD A;  5STD A;  5BU4 A;  4NRE A;  1KSI A;  1GY7 A;  1Q42 A;  1WMN A;  3PZW A;  4OK0 A;  4XM4 A;  4AEQ A;  3CC7 3;  1O7G B;  1OGZ A;  4HM1 B;  3BND A;  1LQM B;  3BNB A;  2XRX B;  1TFO A;  1YI2 3;  3NBR A;  4KFE A;  3SVA A;  3OV4 A;  1VQ7 3;  3WDG B;  4FCZ A;  4K90 B;  1BRI A;  1BAO A;  1FGM A;  5AEW B;  2BHM A;  3S67 A;  2Z6B A;  4CJN A;  9RNT A;  1K41 A;  5KP3 A;  3DUK A;  3UJM A;  2LYX A;  3V98 A;  4J5K A;  2HMK B;  1Q7Y 4;  1QVF 2;  2IUJ A;  2B24 B;  2CFG A;  5G1L A;  1A2P A;  1R4Y A;  3D3L A;  3F8X A;  1AY7 A;  2FGT A;  5IG3 A;  1BUJ A;  1GMR A;  3NM7 A;  1L5G B;  4WYK A;  1W6C A;  4KZ1 A;  1GMQ A;  7RNT A;  3UNL A;  1BNI A;  8RNT A;  2P0M A;  5IEP A;  2D42 A;  1IK3 A;  5LC7 A;  3U97 A;  1TU5 A;  4FMA A;  3EJV A;  3FLJ A;  1JZO A;  3WOE B;  1BU4 A;  1I0V A;  2L4V A;  5FW5 A;  3UL5 A;  3LH4 A;  4J9A A;  1I3I A;  1OF5 B;  4U13 A;  1BNF A;  3PYJ A;  2OTL 3;  1Q86 4;  1A67 A;  4FMC A;  1O7P B;  3LT9 A;  2IY2 A;  1JNQ A;  1YVB I;  2CH9 A;  3V92 A;  3CPW 2;  3CCS 3;  4IPB A;  3GSP A;  4CCV A;  4EYC A;  2PZV A;  1UDI I;  1GY6 A;  3MG1 A;  2H0H A;  5CF2 A;  1NWW A;  2K54 A;  3CXC 2;  1HZ1 A;  4MMY B;  3OW2 2;  3KSE D;  1W4N A;  1VQM 3;  2WGO A;  4L7K A;  3HK4 A;  1IVV A;  3KN4 A;  3KE7 A;  3AMO B;  3BNC A;  1A2V A;  3EE1 A;  3HX8 A;  1JBR A;  2OOV C;  3CCJ 3;  1MWR A;  1LOV A;  3HII A;  3WMD A;  1STD A;  1N8R 4;  1B2U A;  2LQV A;  3T8N A;  1JBS A;  3CC2 3;  3N54 B;  1G0T A;  4N3V A;  1EA2 A;  2UX0 A;  5JBS A;  3CCM 3;  1PY3 A;  1RGL A;  3F40 A;  1FUW A;  1TIJ A;  1FGQ A;  3GZB A;  4BTX A;  1BRH A;  2YX9 A;  1TRQ A;  4GHO A;  4X2O A;  3I55 3;  3MYT A;  1BRJ A;  5G1K A;  1JJ2 2;  3Q1C A;  2QIY A;  2XGL A;  4I5Q A;  5IW9 A;  1OHO A;  5IG4 A;  2OTJ 3;  5M18 A;  4EV5 A;  1X1U A;  3SED A;  1BNE A;  2J8X B;  1J2B A;  1BRK A;  7GSP A;  4KFD A;  2GEX A;  4FMB A;  3MG2 A;  2XR8 B;  1RNB A;  2XSH B;  3G16 A;  1GD4 A;  3D5I A;  2WOH A;  1CEW I;  4WYK B;  1YJ9 3;  3LTC A;  1NJI 4;  4FCJ A;  1Q9E A;  1OHP A;  2D1W A;  1JRQ A;  2O9U X;  1B20 A;  1R4C A;  2HML B;  2KF3 A;  1B21 A;  3ZG5 A;  1BOX A;  1AVL A;  2H0G A;  1VQL 3;  3PCR A;  1QMA A;  1JZD A;  3ROB A;  1TTO A;  1D6U A;  3DZL A;  1TP6 A;  3G71 3;  1RN7 A;  1UI7 A;  1VQ8 3;  2K3D A;  3Q90 A;  2F86 B;  1DMQ A;  3HIG A;  3LT8 A;  3LML A;  3D79 A;  3STD A;  1OH0 A;  1RGE A;  2Z76 A;  4HM0 B;  2GBX B;  2IA7 A;  1IVW A;  2RSX A;  2XFS A;  1B3S A;  3DXO A;  3MKI A;  2HMN B;  2CG0 A;  2WO0 A;  1D6Y A;  1GYB A;  1ROV A;  2SAR A;  3G8Z A;  1NNV A;  2XSO B;  4MMZ B;  4N6V 0;  1BNS A;  2ML6 A;  4IT7 A;  1IQY A;  4RNZ A;  1YJN 3;  1BNR A;  1ZX2 A;  3RGR A;  1IYY A;  3PS8 A;  3CNM A;  3DH2 A;  1UI8 A;  2B1X B;  4KFF A;  2BIR A;  1AVK A;  1G96 A;  3I0Y A;  3L0R A;  3NXJ A;  3H3H A;  1RN1 A;  1JB5 A;  1TFK A;  2M7O A;  1W7C A;  1QJG A;  1N5H A;  3FKA A;  3Q2P A;  1ZO2 A;  3D5G A;  1NO3 A;  4XBX A;  3LOY A;  3J7Y d;  1UGI A;  1OCV A;  1ASK A;  3N9H A;  3QK9 A;  1LNH A;  2HMO B;  3CCR 3;  1G02 A;  2F5M A;  5EQL A;  2Q07 A;  1E97 A;  1BSD A;  2OCT A;  2P05 A;  2W03 A;  3SYU A;  4BU4 A;  1KC8 4;  1M90 4;  1LQG C;  1O7H B;  4PEJ A;  3SLU A;  1B2M A;  3PXM A;  3DGN A;  1IV9 A;  2OQE A;  1T3B A;  3MPH A;  3CCL 3;  2ML5 A;  2STD A;  2F99 A;  1I8V A; 
#chains in the Genus database with same CATH homology
 1FGT A;  4R1K A;  4XBY A;  3WOF B;  5KP1 A;  1NDO B;  3DGM A;  3DMC A;  3NV0 A;  2W56 B;  1MNL A;  1A2K A;  2BT3 A;  5AIH A;  2ZDJ A;  4WHA A;  2GU3 A;  1W00 A;  3CU3 A;  1YJW 3;  3FF0 A;  4HM2 B;  3MG3 A;  1IQX A;  3EX9 A;  2K0M A;  4CDL A;  4MMX B;  3EB8 A;  4G1M B;  3SOY A;  3CC4 3;  3KZT A;  4WFO A;  5D83 A;  5CK6 A;  1YIT 3;  5AI1 A;  5JPU A;  3OX9 A;  1O7W B;  1OPY A;  3IMA B;  2XFT A;  1VQO 3;  4EC6 A;  3A76 A;  1FA3 A;  1N9J A;  1RKY A;  4FR9 A;  2P09 A;  4EBG A;  3K5T A;  1W6G A;  4WWU C;  3I56 3;  1Q82 4;  1DVC A;  1QAK A;  4IIA A;  1D6Z A;  2BO9 B;  3NQZ A;  3EF8 A;  3EC9 A;  2P0X A;  1ISK A;  1U8C B;  3GWR A;  1WQL B;  3ECF A;  1DYU A;  1O7N B;  5D81 A;  5G2G A;  4O8S A;  3FH1 A;  3DGL A;  4J8T A;  5ELJ A;  3NBB A;  1JKG B;  2I9W A;  1AR0 A;  1NB5 I;  2XEP A;  4R80 A;  2XF3 A;  5AYS C;  1IT8 A;  4N6N B;  3K7C A;  2CKF B;  4RZM A;  1QAF A;  1LVN A;  2GU1 A;  4ORL A;  2E2T A;  2Z7A A;  4KVH A;  2OWP A;  2FNQ A;  2IUK A;  5AIG A;  2BMO B;  3O8Y A;  1TUH A;  1VZZ A;  1RJO A;  4LMI A;  3VSY A;  1IVU A;  4H61 A;  1OHS A;  1QAL A;  4HM4 B;  5D82 A;  4X2H A;  1Q40 A;  1U5O A;  1FGR A;  3F14 A;  3FF2 A;  5AIF A;  3X3Y A;  4HM8 B;  1MOL A;  3VF1 A;  2BMQ B;  4XDV A;  3G0K A;  3PGB A;  4I4K A;  3WOD G;  2MC8 A;  4XBT A;  4N6U A;  3JUP A;  4R4K A;  3FCS B;  3KSP A;  2BNG A;  3CCU 3;  3EHC A;  1LOX A;  1E3R A;  1VQ4 3;  2YFJ B;  2RFR A;  2W9P A;  3IPT A;  4GL6 A;  3FZW A;  5IG0 A;  1WMP A;  1SPU A;  2INX A;  2Z77 A;  3LZA A;  1N8Q A;  1S5A A;  1V74 A;  5TGN A;  2YFL B;  3GZR A;  1Z1S A;  3MHE A;  3S28 A;  2CFK A;  1PFP A;  3X42 A;  2SBL A;  3G6E 3;  2QEX 3;  3KII A;  5IF6 A;  3G4S 3;  1YIJ 3;  3CD6 3;  4K61 A;  2KRT A;  2CIU A;  1DMM A;  1ULJ B;  3RDE A;  4HBR A;  4R9L A;  3OWU A;  3NBJ A;  1VQ5 3;  3EBY A;  1K28 A;  3FGY A;  4HM3 B;  5IEO A;  3BLZ A;  5BXQ A;  2F98 A;  3S5C A;  1JN5 A;  1N5P A;  4ZM8 A;  1W01 A;  3EQQ B;  1W02 A;  1OF5 A;  4MEI A;  4QWT A;  1JV2 B;  2QGU A;  5BVB A;  4HJL B;  2XGN A;  1S72 3;  4OVM A;  4O02 B;  5EEO A;  1ROA A;  4FMD A;  5HGR A;  2CWV A;  3KFQ C;  1Q81 4;  2E2U A;  4WP5 A;  2OOV A;  2QA4 3;  2XH9 A;  3BNE A;  3GAX A;  4HM7 B;  2MF7 A;  2GBW B;  1K73 4;  3N8B A;  3TDG A;  1W6Y A;  2C10 A;  4HKV B;  4H3U A;  1VQP 3;  3HZP A;  4Q53 A;  3CCV 3;  5AYR B;  4RBN A;  1US1 A;  1VQ9 3;  3AMO A;  5IER A;  1LXE A;  1IV7 A;  1C7H A;  1CYV A;  2CWT A;  1W2B 2;  1WTH A;  1OUN A;  5AII A;  1UW1 A;  2V1L A;  1IT7 A;  3DM8 A;  1VQK 3;  3EN1 B;  2W0Q A;  1WNH A;  4LGQ A;  1NB3 I;  3FG4 A;  3K0Z A;  4GB5 A;  4STD A;  1T5Y A;  1JB4 A;  1Y4K A;  4XDW A;  3PCS A;  5AEU B;  3HI7 A;  4HZ9 B;  2HMJ B;  3EN8 A;  3CCE 3;  2Y74 A;  1OGX A;  5LC6 A;  3JUO A;  3UB1 A;  2W2C A;  1JB2 A;  1IU7 A;  3NQY A;  1STF I;  1BUQ A;  3M8C A;  3B4P A;  1W2Z A;  3FG3 A;  1YGE A;  4XB5 A;  2JQ5 A;  2ZL8 A;  3T8U A;  2Y73 A;  3B7C A;  3S29 A;  1IQ8 A;  3JVC A;  4LSO A;  1K9M 4;  2GEY A;  3LTD A;  5EVH A;  1NU3 A;  3K9M C;  4NHF A;  4BTY A;  4N6M A;  2CFW A;  2BMR B;  4HM5 B;  2WGQ A;  2IMJ A;  3GRD A;  5DRV A;  5DRE A;  3MSO A;  1RRL A;  3UL6 A;  2R4I A;  5IG5 A;  5CXO A;  3CME 3;  3X3X A;  4O3V A;  3V99 A;  1DMN A;  1VQN 3;  1W5Z A;  1UUW B;  2CWU A;  3NX0 A;  3LXU X;  3JUM A;  2KCD A;  2W04 A;  4L8O A;  1JN5 B;  4EV2 A;  3X41 A;  3DY5 A;  4HM6 B;  8CHO A;  5IEN A;  1GY5 A;  2CHC A;  2KXG A;  2PNC A;  3F8H A;  5JPP A;  2WOF A;  6STD A;  5KP4 A;  1AV4 A;  3WA3 A;  1F8N A;  4N6L A;  1HKX A;  3OWS A;  3SOA A;  2CFL A;  4AKY A;  1VQ6 3;  3D9R A;  4BTW A;  3S27 A;  1K8A 4;  3B4O A;  3ER7 A;  1CYU A;  1GD3 A;  1KWI A;  3RGA A;  3OWY A;  3X3Z A;  2CC3 A;  1HU9 A;  4EXR A;  2CW9 A;  1FGO A;  1WMO A;  2E2V A;  4MJD A;  1E3V A;  5I97 A;  1SII A;  4O2H A;  3NV0 B;  3KKG A;  2W6J H;  4OUQ A;  4L8P A;  4K1V A;  2HMM B;  2OQE C;  3CCQ 3;  1IDP A;  3DGO A;  3CNX A;  4AKZ A;  7STD A;  2CK3 H;  4JRF A;  1SJW A;  3LYG A;  1N9E A;  1ULI B;  2FXT A;  4N6T A;  3WA2 X;  4LZI A;  2W56 A;  3U1W A;  3SX1 A;  2W9Q A;  3T0U A;  1UUV B;  1M1K 4;  1A90 A;  3GZY B;  3LTB A;  3FSD A;  4HVN A;  3CMA 3;  1IVX A;  1YHQ 3;  3NUV A;  1QVG 2;  5A0O B;  3E99 A;  1SIH A;  1SQW A;  3FG1 A;  2GXF A;  1EQK A;  2YFI B;  2C11 A;  1GS3 A;  2RCD A;  2P38 A;  4K1U A;  3K63 A;  5FGO A;  1OAC A;  5ELU A;  1DVD A;  3MWZ A;  4FCM A;  3F7S A;  3LTA A;  3BB9 A;  3VGN A;  3NHX A;  1M1X B;  2JDI H;  3B8L A;  5CLK A;  3GZX B;  3NM2 A;  4JF8 A;  4HZB B;  3OXA A;  3ALA A;  2CG1 A;  3F9S A;  1EKM A;  3X40 A;  3CPO A;  1CQS A;  1RRH A;  2CFD A;  5CF1 A;  1M9G A;  4N6O B;  4RNY A;  1PU4 A;  3SXX A;  4HYZ A;  3IJE B;  1Q40 B;  1O7M B;  3H51 A;  3F7X A;  4TX4 A;  4LEH A;  1JKG A;  4R9K A;  1EG9 B;  2A15 A;  3JUN A;  3JUQ A;  3EBT A;  1KD1 4;  2O3O A;  2RGQ A;  3QRD A;  5STD A;  4NRE A;  1KSI A;  1GY7 A;  1Q42 A;  1WMN A;  3PZW A;  4OK0 A;  4XM4 A;  4AEQ A;  3CC7 3;  1O7G B;  1OGZ A;  4HM1 B;  3BND A;  3BNB A;  2XRX B;  1TFO A;  1YI2 3;  3NBR A;  4KFE A;  3SVA A;  3OV4 A;  1VQ7 3;  3WDG B;  4FCZ A;  4K90 B;  1FGM A;  5AEW B;  2BHM A;  3S67 A;  2Z6B A;  1K41 A;  5KP3 A;  3DUK A;  3UJM A;  2LYX A;  3V98 A;  1Q7Y 4;  2HMK B;  1QVF 2;  2IUJ A;  2B24 B;  2CFG A;  3D3L A;  3F8X A;  2FGT A;  5IG3 A;  3NM7 A;  1L5G B;  4WYK A;  1W6C A;  4KZ1 A;  3UNL A;  2P0M A;  5IEP A;  2D42 A;  1IK3 A;  5LC7 A;  3U97 A;  1TU5 A;  4FMA A;  3EJV A;  3FLJ A;  3WOE B;  2L4V A;  5FW5 A;  3UL5 A;  3LH4 A;  4J9A A;  1OF5 B;  4U13 A;  2OTL 3;  3PYJ A;  1Q86 4;  1A67 A;  4FMC A;  1O7P B;  3LT9 A;  1JNQ A;  1YVB I;  2CH9 A;  3V92 A;  3CPW 2;  3CCS 3;  4IPB A;  4CCV A;  4EYC A;  2PZV A;  1GY6 A;  3MG1 A;  5CF2 A;  1NWW A;  2K54 A;  3CXC 2;  4MMY B;  3OW2 2;  3KSE D;  1W4N A;  1VQM 3;  2WGO A;  4L7K A;  3HK4 A;  1IVV A;  3KN4 A;  3KE7 A;  3AMO B;  3BNC A;  1A2V A;  3EE1 A;  3HX8 A;  2OOV C;  3CCJ 3;  3HII A;  3WMD A;  1N8R 4;  1STD A;  2LQV A;  3T8N A;  3CC2 3;  3N54 B;  4N3V A;  1EA2 A;  2UX0 A;  5JBS A;  3CCM 3;  3F40 A;  1FUW A;  1TIJ A;  1FGQ A;  3GZB A;  4BTX A;  2YX9 A;  4X2O A;  3I55 3;  3MYT A;  1JJ2 2;  3Q1C A;  2QIY A;  2XGL A;  5IW9 A;  1OHO A;  5IG4 A;  2OTJ 3;  4EV5 A;  3SED A;  1J2B A;  4KFD A;  2GEX A;  4FMB A;  3MG2 A;  2XR8 B;  2XSH B;  3G16 A;  1GD4 A;  2WOH A;  1CEW I;  4WYK B;  1YJ9 3;  3LTC A;  1NJI 4;  4FCJ A;  2D1W A;  1OHP A;  1JRQ A;  2O9U X;  1R4C A;  2HML B;  1AVL A;  1VQL 3;  3PCR A;  1QMA A;  3ROB A;  1D6U A;  3DZL A;  1TP6 A;  3G71 3;  1RN7 A;  1UI7 A;  1VQ8 3;  3Q90 A;  2F86 B;  1DMQ A;  3HIG A;  3LT8 A;  3LML A;  3STD A;  1OH0 A;  2Z76 A;  4HM0 B;  2GBX B;  2IA7 A;  1IVW A;  2RSX A;  2XFS A;  3DXO A;  3MKI A;  2HMN B;  2CG0 A;  2WO0 A;  1GYB A;  1D6Y A;  1ROV A;  3G8Z A;  2XSO B;  4MMZ B;  4N6V 0;  2ML6 A;  4RNZ A;  4IT7 A;  1IQY A;  1YJN 3;  1ZX2 A;  3RGR A;  3PS8 A;  3CNM A;  1UI8 A;  2B1X B;  4KFF A;  3I0Y A;  1AVK A;  1G96 A;  3L0R A;  3NXJ A;  3H3H A;  1JB5 A;  1TFK A;  2M7O A;  1W7C A;  1QJG A;  1N5H A;  3FKA A;  3Q2P A;  1ZO2 A;  1NO3 A;  4XBX A;  3LOY A;  3J7Y d;  1OCV A;  1ASK A;  3N9H A;  3QK9 A;  1LNH A;  2HMO B;  3CCR 3;  1KQS 2;  5EQL A;  2Q07 A;  1E97 A;  2OCT A;  2P05 A;  2W03 A;  1KC8 4;  1M90 4;  1O7H B;  3SLU A;  4PEJ A;  3PXM A;  3DGN A;  1IV9 A;  2OQE A;  3MPH A;  3CCL 3;  2ML5 A;  2STD A;  2F99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...