1OHPA

Crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal Structure of 5-3-Ketosteroid Isomerase Mutant D38N from Pseudomonas Testosteroni Complexed with 5Alpha-Estran-3,17-Dione
rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohpA00
3MSOA 1OUNA 3NBRA 1ASKA 3F8XA 2B1XB 5CF1A 1ULIB 3S5CA 1JKGA 3K0ZA 4HM3B 2GEYA 3G0KA 5AIIA 5D81A 5CXOA 3CPOA 3H3HA 3NXJA 1IDPA 2BNGA 4L8OA 3OX9A 3EC9A 4X2HA 4FCJA 1JN5A 5CF2A 3HX8A 4R9LA 3EBYA 3MKIA 7STDA 4HM6B 5AIFA 4HM2B 1ZX2A 1Q40A 3OXAA 4LMIA 5BXQA 3F8HA 3DMCA 1OHSA 2XR8B 2HMKB 4J8TA 1O7MB 5IEOA 3GZXB 1TUHA 3T8NA 1OCVA 3VSYA 3MG3A 1ULJB 4XDWA 5KP1A 4WWUC 1JB4A 2R4IA 1Q42A 5IG5A 4HVNA 4WP5A 3FH1A 1S5AA 3RGRA 3FKAA 3B4PA 1E97A 4XBYA 2RGQA 4HM1B 5DRVA 4WYKA 4XDVA 3MYTA 3MG1A 3HK4A 3VGNA 3FSDA 1EG9B 1OF5B 3KE7A 4MJDA 1HKXA 1O7WB 3SOAA 3GZBA 3WMDA 4R9KA 1GS3A 3D9RA 4HM7B 4U13A 2HMJB 2RFRA 3DUKA 1O7PB 4XM4A 1UUWB 4HZBB 3IPTA 1C7HA 3HZPA 2F99A 3JUMA 5AIGA 4LGQA 4N3VA 1WQLB 3OWSA 4K1UA 1OGXA 1DMMA 2QIYA 4STDA 5IG0A 2CKFB 4HJLB 3F7SA 4HZ9B 3UJMA 4XBXA 2W2CA 3JUQA 5AIHA 5TGNA 5BVBA 3OWUA 1NU3A 1E3RA 2OWPA 2YFLB 3FZWA 3DXOA 1DMNA 1W00A 1GYBA 4IIAA 2XRXB 4ORLA 6STDA 3FLJA 3KSPA 4XB5A 1W01A 5JPUA 2YFJB 1Z1SA 1OHOA 1NDOB 3OV4A 2K54A 3BB9A 3LYGA 3KKGA 2I9WA 1GY7A 2YFIB 1O7NB 4HM5B 3LZAA 3F40A 5DREA 4KVHA 3NM2A 4Q53A 2BMRB 1DMQA 3K7CA 3B4OA 5AEWB 3EJVA 4HM0B 1OPYA 1TP6A 3GRDA 5D83A 5G2GA 3B7CA 2F98A 5EVHA 3ER7A 2PZVA 2XSHB 1JKGB 3EHCA 3CNXA 8CHOA 3JUNA 3JUOA 1EA2A 2HMLB 3FGYA 3STDA 3GWRA 1JN5B 3F9SA 5IENA 4J9AA 5IG4A 3F14A 1ISKA 1Q40B 4X2OA 3I0YA 1O7GB 1VZZA 1NWWA 5AEUB 2HMMB 1QJGA 5AI1A 3G8ZA 3MHEA 1BUQA 4H3UA 2B24B 1W6YA 2UX0A 4R1KA 4CDLA 1OF5A 1QMAA 3FF2A 3E99A 5FW5A 4PEJA 5JPPA 2XSOB 5IEPA 5STDA 3CNMA 3EX9A 4LEHA 2BMQB 3NV0A 2QGUA 3B8LA 1W02A 4GB5A 4WYKB 3CU3A 4HKVB 4OUQA 5CK6A 1CQSA 3SOYA 1E3VA 3GZRA 1GY6A 5IERA 2GEXA 3ROBA 1ZO2A 3SEDA 5KP4A 1AR0A 2Z7AA 3EN1B 3M8CA 2CHCA 3EQQB 1O7HB 3H51A 4OVMA 5D82A 3JUPA 4FCMA 3EN8A 1GY5A 4K1VA 3F7XA 4XBTA 4HM8B 2BMOB 3KZTA 2INXA 3GZYB 2HMNB 4L7KA 3UNLA 4RZMA 1U5OA 2F86B 2IMJA 2GBXB 1UUVB 3DM8A 3NUVA 4HM4B 1JB2A 5IG3A 4L8PA 2GXFA 5HGRA 1OH0A 3T8UA 2Z77A 2A15A 3OWYA 3FF0A 2STDA 4I4KA 2HMOB 1K41A 3A76A 1JB5A 3NHXA 1A2KA 2GBWB 3EBTA 2RCDA 5KP3A 3MG2A 5IF6A 3Q90A 1SJWA 2Z76A 1STDA 3EF8A 1OGZA 3G16A 3DZLA 3NV0B 2JQ5A 3BLZA 3RGAA 3ECFA 5CLKA 1OHPA
chains in the Genus database with same CATH superfamily
1B2UA 3BNEA 3SX1A 3X41A 5BIRA 4FMDA 2RNTA 2F5WA 1VQN3 1T3BA 1VQP3 1TIJA 2H0HA 3MSOA 1OUNA 3NBRA 1ASKA 1YHQ3 3F8XA 2B1XB 5CF1A 5G1LA 1ULIB 3S5CA 2BU4A 2OCTA 1JKGA 3HIGA 1IVWA 1VQ43 4LYLB 2W04A 3G713 3X42A 3X40A 3GAXA 1I2EA 1K28A 2IY2A 1TRPA 4RNYA 3K0ZA 4HM3B 3L0RA 4HYZA 2GEYA 3S67A 3G0KA 1RDSA 5HOHA 1G0TA 1RRHA 1BNIA 5AIIA 5D81A 1AVKA 1FYSA 4JRFA 5CXOA 3CPOA 3BNCA 3H3HA 3NXJA 1CH0A 2SARA 2CIUA 2H0IA 1IDPA 2M7OA 3NQYA 3LTDA 2XGLA 2BNGA 4L8OA 1WMPA 2CG0A 3KCHA 3OX9A 3WDGB 3EC9A 1I8VA 5A0OB 2OTL3 4O2HA 4FCJA 1JN5A 2CH9A 4X2HA 3UB1A 3DGNA 5CF2A 3I553 2IYJA 1RGCA 4IT7A 1LNIA 3HX8A 4R9LA 3PCRA 3EBYA 3MKIA 7STDA 4HM6B 3S29A 4AEQA 1BNFA 3CPW2 1PU4A 2KF3A 3BU4A 1LVNA 5AIFA 4HM2B 3IJEB 1Q40A 1NO3A 2C11A 3OXAA 4H61A 4N6V0 4LMIA 2BHMA 1X1YA 3DGLA 3F8HA 1M1XB 5BXQA 3WA3A 1RCKA 3DMCA 2PNCA 4NPBA 3X3XA 1NB3I 3CCJ3 1VQ83 2F5MA 5GSPA 5M19A 3TDGA 1OHSA 2GU3A 1SIHA 3UL6A 3V99A 1Y4KA 5CLKA 1IVXA 2O3OA 1YVSA 4FMAA 1S723 2XR8B 2HMKB 2C4BA 4J8TA 1LQGC 2CFWA 2CWTA 1O7MB 5JBSA 3D5GA 3WODG 3BIRA 1RN1A 5BU4A 5IEOA 2KF4A 1BNRA 3Q3FA 1RNTA 3D79A 4JF8A 3URPA 3GZXB 3CMA3 4RNZA 1GMQA 1ROAA 1T2HA 1TUHA 3LH4A 3T8NA 1UDII 1JBSA 1JBTA 1NB5I 1OCVA 4TX4A 3VSYA 3QRDA 3PXMA 3PS8A 4BIRA 3WA2X 1R4YA 3ZFZA 3A5EA 3MG3A 1ULJB 4XDWA 5KP1A 5RNTA 4WWUC 1X1XA 1JB4A 1WNHA 4MMZB 1EKMA 2R4IA 1RN4A 1Q42A 1Q7Y4 5IG5A 4HVNA 4WP5A 1D6UA 3PYJA 3FH1A 1S5AA 1BRGA 3FKAA 3RGRA 1UUGB 1E97A 1TJDA 3B4PA 1F8NA 2RGQA 3D3LA 4XBYA 4HM1B 5DRVA 4WYKA 1A67A 1BSBA 1UI7A 1IYYA 1B21A 2OQEA 1C54A 1YGEA 1BIRA 3MYTA 3AHWA 4XDVA 1W2ZA 3J7Yd 1BSEA 1UGHI 1K8A4 3MG1A 4EYCA 2LYXA 3HK4A 4N6NB 4BTYA 3VGNA 3FSDA 1EG9B 2HOHA 3CC73 1OF5B 1W6GA 3O8YA 3KE7A 2FNQA 4N6UA 1IQXA 1HKXA 1O7WB 4MJDA 5ELUA 3SOAA 1EQKA 3GZBA 3WMDA 2KF6A 4R9KA 1GS3A 3D9RA 4RNTA 1IK3A 5AYRB 4G1MB 4HM7B 2WGOA 4U13A 4GHOA 2HMJB 1WMNA 1BNGA 1YIJ3 2XH9A 2RFRA 3CCQ3 3DUKA 1RGKA 3NBBA 1O7PB 3N9HA 4XM4A 1UUWB 2CW9A 4HZBB 3IPTA 2KRTA 1C7HA 3HZPA 2P38A 2F99A 1RNBA 2WOFA 3JUMA 1JJ22 1MOLA 1GD4A 3KN4A 5AIGA 1VQ53 1KQS2 2BO9B 1IT7A 1MNLA 4LGQA 4HAAA 4N3VA 1BSDA 1U8CB 3CD63 6GSPA 4KT3B 1WQLB 1CEWI 2ML6A 1RN7A 3OWSA 1SARA 1W7CA 1IVUA 3CXC2 4K1UA 1OGXA 2QA43 1YJ93 2F56A 2W9QA 3S28A 1G96A 1EUIC 1B2SA 2W6JH 2AAEA 4OK0A 4EC6A 1DMMA 2QIYA 4STDA 4EV2A 1YI23 2SBLA 5IG0A 2D1WA 1YGWA 1FGQA 2CX0A 2K3DA 4FMBA 3WR2A 2CKFB 1LXEA 4HJLB 1JZOA 1V57A 3CCV3 3F7SA 4HZ9B 4I5QA 3CCL3 3UJMA 1RGAA 4XBXA 2W2CA 3DGYA 1FUWA 2FXTA 1MGWA 2J8XB 3AMOB 3JUQA 5AIHA 5TGNA 1B20A 4N6OB 2K0MA 5EEOA 1BRSA 1FGOA 1RSNA 4ILFA 5BVBA 1KWIA 3G4S3 3OWUA 8RNTA 1LOYA 1V58A 1NU3A 3LMLA 1E3RA 4EBGA 1FGRA 2W56A 2OOVC 2OWPA 1DVDA 4WHAA 1N5HA 1TFKA 2YFLB 1DYUA 1SIIA 2XF3A 3LT8A 3LTAA 3FZWA 1T5YA 3DXOA 4KFEA 1UGIA 2GSPA 1DMNA 3NQZA 1W00A 2IUJA 3LXUX 3CCU3 1GYBA 2XFTA 3KSED 1FGMA 3N8BA 3KIIA 2CFGA 4IIAA 1A2PA 2XRXB 4ORLA 4J5GA 6STDA 2P09A 2Z6BA 3FLJA 3WOEB 1VQM3 2WGQA 2BIRA 3KSPA 4XB5A 1W01A 1SPUA 2W9PA 1BANA 2P0MA 1VQ93 3S27A 4N6LA 4RBNA 4HBRA 1N8QA 3QK9A 1BNEA 1I3FA 1KSIA 1PY3A 6RNTA 1AV4A 1BSCA 1STFI 1YNVX 9RNTA 2XEPA 1FZUA 5I97A 5JPUA 2YFJB 1BSAA 1M9GA 1GOVA 1Z1SA 3FG1A 3JVCA 1OHOA 5AYSC 1LOVA 4IPBA 1LNHA 1NDOB 1RMSA 3OV4A 3U1WA 1BRHA 5M1AA 3RNTA 2K54A 3BB9A 4NREA 3LYGA 3D4AA 2H0GA 2P05A 3GSPA 1TFOA 3DGMA 3HIIA 1W5ZA 3KKGA 2I9WA 1GY7A 1R4CA 2YFIB 1O7NB 4HM5B 4GSPA 1IVVA 3LZAA 3F40A 5DREA 1VQL3 3X3YA 1LRAA 4KVHA 3NM2A 2GU1A 3DGOA 4Q53A 3ZG5A 1X1WA 2W0QA 4AKYA 3AGOA 2BMRB 1DMQA 1MGRA 1US1A 1WMOA 2YX9A 2E2UA 1B2ZA 1BRJA 1BNJA 3K7CA 3SLUA 4BTWA 3B4OA 1AQZA 4LZIA 1UW1A 5AEWB 3D5IA 3EJVA 1BUJA 4CJNA 1JZDA 1RJOA 1LOXA 4HM0B 1OPYA 1TP6A 3GRDA 3CME3 1Q814 1ZS7A 5D83A 5G2GA 3B7CA 1RHLA 3LTBA 5M18A 2F98A 4O3VA 1BRNL 5EVHA 3K9MC 3ER7A 1BAOA 3SYUA 1BU4A 2CG1A 2IA7A 2PZVA 2XSHB 1JKGB 2UUGC 3VF1A 1GMPA 1OHPA 4LSOA 3EHCA 1KC84 3CCS3 1IV7A 3KFQC 3CNXA 3WHOA 4BTXA 2L4VA 8CHOA 3JUNA 1B2XA 1JBRA 1Q9EA 1EA2A 3JUOA 2HMLB 3MPHA 2C10A 1HYFA 3T0UA 4N6TA 1N9EA 1QAFA 3DH2A 3FGYA 3STDA 1VQ73 4FMCA 1I2GA 1B2MA 2RSXA 2WO0A 1V74A 1G02A 3ALAA 1GD3A 4O02B 2CX1A 1FGTA 3EB8A 4QWTA 1RGLA 3AGNA 4FCZA 1Q864 3GWRA 3K63A 4GL6A 1JN5B 3F9SA 2Y74A 1LOWA 2OTJ3 2LQVA 5IENA 2FGTA 4J9AA 5IG4A 3F14A 1OACA 4CPKA 1GOUA 4KFFA 1ISKA 1IT8A 1W6CA 1Q40B 3LTCA 3OW22 2CFKA 4ZM8A 4X2OA 4HOHA 1B3SA 2IUKA 3I0YA 3LT9A 1O7GB 1UCIA 1VZZA 1UCLA 1IU7A 4EXRA 1NWWA 5AEUB 1I3IA 4MMYB 2HMMB 2ZHXB 3K5TA 1QJGA 5FGOA 1A2VA 1RGHA 5AI1A 2Y73A 1IQYA 3G8ZA 3N54B 1RGEA 2CC3A 3MHEA 3Q1CA 1NJI4 1BUQA 2ML5A 4H3UA 2B24B 2ZL8A 2D42A 1W6YA 3MWZA 1J2BA 3ZG0A 1JV2B 2UX0A 1FUSA 4R1KA 5EQLA 4CDLA 4EW5A 1W2B2 3X3ZA 1YIT3 1OF5A 1MWSA 1QMAA 3FF2A 1AVLA 3BNBA 3NX0A 3E99A 1B27A 1I70A 1RCLA 3BNDA 5FW5A 4PEJA 4R4KA 1BRIA 5JPPA 1GSPA 1I2FA 2XSOB 2V1LA 5STDA 5IEPA 1PFPA 1AY7A 4BU4A 1UI8A 3CNMA 4FR9A 3EX9A 4LEHA 2BMQB 4KFDA 1M1K4 3NV0A 2QGUA 3B8LA 1EEJA 1W02A 1D6YA 3NM7A 4GB5A 3CC43 1MWTA 1L5GB 4WYKB 3CU3A 4HKVB 4OUQA 2ZA4A 5CK6A 2XFSA 1X1UA 3PZWA 1CQSA 3CCE3 3HOHA 1MWUA 1PYLA 2CWUA 1M904 1QAKA 1K9M4 1YJW3 4KZ1A 1SQWA 3CCM3 1YJN3 1N5PA 3SOYA 2Q07A 1E3VA 1WTHA 1BGSA 4K90B 1FW7A 2CFLA 2QEX3 1VQQA 3GZRA 1BOXA 1GY6A 3LOYA 1CYUA 5IERA 2GEXA 3EE1A 2E2VA 1ZO2A 1I0VA 3ROBA 3FCSB 4K61A 4EV5A 1TTOA 1BVIA 1NNVA 2MC8A 3SEDA 5KP4A 3V92A 1AR0A 4MEIA 1RGGA 4R80A 2Z7AA 3EN1B 1UCJA 1JNQA 3SVAA 3M8CA 2CHCA 3EQQB 1Q824 1UCKA 4NHFA 1O7HB 3CCR3 3H51A 4OVMA 3AMOA 1MWRA 5D82A 3U97A 3JUPA 4FCMA 1K734 2KF5A 1GY5A 1RRLA 3EN8A 1I0XA 1T2IA 3F7XA 4K1VA 4XBTA 4HM8B 1FA3A 2BMOB 2ZDJA 2F4YA 3KZTA 2INXA 1QVG2 5G1KA 3G6E3 3GZYB 2R41A 2HMNB 2AADA 4L7KA 1Q7HA 2W03A 1YVBI 1HU9A 1ROVA 2XGNA 3UNLA 1DE3A 3WOFB 1RGFA 2E2TA 4RZMA 1U5OA 4N6MA 2F86B 2IMJA 3NBJA 5IW9A 2GBXB 1UUVB 1VQ63 2KAAA 3DM8A 2P0XA 3NUVA 4BL2A 4AKZA 4HM4B 1JB2A 1DETA 5IG3A 3DY5A 1GOYA 4DKIA 2KXGA 1RLSA 4L8PA 2GXFA 2KCDA 5HGRA 3CC23 1RKYA 1OH0A 3T8UA 3SXXA 2MF7A 2Z77A 1LQMB 2CFDA 2A15A 4MMXB 1QALA 1RTUA 3OWYA 7GSPA 1A90A 3FF0A 1GMRA 1FUTA 2RBIA 4J5KA 2STDA 4I4KA 2BT3A 1ZGXA 2O9UX 4WFOA 3FG3A 1TU5A 2HMOB 4O8SA 1K41A 3A76A 1JB5A 5LC6A 1N9JA 1BNSA 3NHXA 5ELJA 1A2KA 2GBWB 2W56B 3EBTA 2RCDA 1BRKA 2L1SA 2UGIA 3FG4A 3MG2A 5KP3A 3UL5A 3V98A 1VQO3 5IF6A 2JDIH 2OQEC 1W4NA 5LC7A 1QVF2 7RNTA 2WOHA 3IMAB 3Q90A 2Z76A 3PCSA 1STDA 3RDEA 3AHSA 1KD14 3EF8A 1D6ZA 1N8R4 1OGZA 2CK3H 3HI7A 4CCVA 3G16A 3DZLA 1HZ1A 3NV0B 1IV9A 2CWVA 2JQ5A 1VQK3 3I563 3BLZA 3PGBA 4BL3A 1TRQA 1CYVA 1DVCA 1JRQA 3RGAA 3ECFA 1IQ8A 1ZX2A 1SJWA 3Q2PA 2OOVA
chains in the Genus database with same CATH topology
3BNEA 3SX1A 3X41A 4FMDA 1VQN3 1VQP3 1TIJA 3MSOA 1OUNA 3NBRA 1ASKA 1YHQ3 3F8XA 2B1XB 5CF1A 1ULIB 3S5CA 2OCTA 1JKGA 3HIGA 1IVWA 1VQ43 3G713 2W04A 3X42A 3X40A 3GAXA 1K28A 4RNYA 3K0ZA 4HM3B 3L0RA 4HYZA 2GEYA 3S67A 3G0KA 1RRHA 5AIIA 5D81A 1AVKA 4JRFA 5CXOA 3CPOA 3BNCA 3H3HA 3NXJA 2CIUA 1IDPA 2M7OA 3NQYA 3LTDA 2XGLA 2BNGA 4L8OA 1WMPA 2CG0A 3WDGB 3OX9A 3EC9A 5A0OB 2OTL3 4O2HA 4FCJA 1JN5A 2CH9A 4X2HA 3UB1A 3DGNA 5CF2A 3I553 4IT7A 3HX8A 4R9LA 3PCRA 3EBYA 3MKIA 7STDA 4HM6B 3S29A 4AEQA 3CPW2 1PU4A 5AIFA 1LVNA 4HM2B 3IJEB 1Q40A 1NO3A 2C11A 3OXAA 4H61A 4N6V0 4LMIA 2BHMA 3DGLA 3F8HA 1M1XB 5BXQA 3WA3A 3DMCA 2PNCA 3X3XA 1VQ83 1NB3I 3CCJ3 3TDGA 1OHSA 2GU3A 1SIHA 3UL6A 3V99A 1Y4KA 5CLKA 1IVXA 2O3OA 4FMAA 1S723 2XR8B 2HMKB 4J8TA 2CFWA 2CWTA 5JBSA 1O7MB 3WODG 5IEOA 4JF8A 3GZXB 3CMA3 4RNZA 1ROAA 3LH4A 1TUHA 3T8NA 1NB5I 1OCVA 4TX4A 3VSYA 3QRDA 3PXMA 3PS8A 3WA2X 3MG3A 1ULJB 4XDWA 5KP1A 4WWUC 1JB4A 1WNHA 4MMZB 1EKMA 2R4IA 1Q42A 1Q7Y4 5IG5A 4HVNA 4WP5A 1D6UA 3PYJA 3FH1A 1S5AA 3FKAA 3RGRA 3B4PA 1E97A 3D3LA 4XBYA 1F8NA 2RGQA 4HM1B 5DRVA 4WYKA 1A67A 1UI7A 2OQEA 1YGEA 3MYTA 4XDVA 3J7Yd 1K8A4 1W2ZA 3MG1A 4EYCA 2LYXA 3HK4A 4N6NB 4BTYA 3VGNA 3FSDA 1EG9B 3CC73 1OF5B 1W6GA 3O8YA 3KE7A 2FNQA 4N6UA 1IQXA 1HKXA 1O7WB 4MJDA 5ELUA 3SOAA 1EQKA 3GZBA 3WMDA 4R9KA 1GS3A 3D9RA 1IK3A 5AYRB 4G1MB 4HM7B 2WGOA 4U13A 2HMJB 1WMNA 1YIJ3 2XH9A 2RFRA 3CCQ3 3DUKA 3NBBA 1O7PB 3N9HA 4XM4A 1UUWB 2CW9A 4HZBB 3IPTA 2KRTA 1C7HA 3HZPA 2P38A 2F99A 2WOFA 3JUMA 1JJ22 1MOLA 1GD4A 3KN4A 5AIGA 1VQ53 1KQS2 2BO9B 1IT7A 1MNLA 4LGQA 4N3VA 1U8CB 3CD63 1WQLB 1CEWI 2ML6A 1RN7A 3OWSA 1W7CA 1IVUA 3CXC2 4K1UA 1OGXA 2QA43 1YJ93 2W9QA 3S28A 1G96A 2W6JH 4OK0A 4EC6A 1DMMA 2QIYA 4STDA 4EV2A 1YI23 2SBLA 5IG0A 2D1WA 1FGQA 4FMBA 2CKFB 1LXEA 4HJLB 3CCV3 3F7SA 4HZ9B 3CCL3 3UJMA 4XBXA 2W2CA 1FUWA 2FXTA 3AMOB 3JUQA 5AIHA 5TGNA 4N6OB 2K0MA 5EEOA 1FGOA 5BVBA 1KWIA 3G4S3 3OWUA 1NU3A 3LMLA 1E3RA 4EBGA 1FGRA 2W56A 2OOVC 2OWPA 1DVDA 4WHAA 1N5HA 1TFKA 2YFLB 1DYUA 1SIIA 2XF3A 3LT8A 3LTAA 3FZWA 1T5YA 3DXOA 4KFEA 1DMNA 3NQZA 1W00A 2IUJA 3LXUX 3CCU3 1GYBA 2XFTA 3KSED 1FGMA 3N8BA 3KIIA 2CFGA 4IIAA 2XRXB 4ORLA 6STDA 2P09A 2Z6BA 3FLJA 3WOEB 1VQM3 2WGQA 3KSPA 4XB5A 1W01A 1SPUA 2W9PA 2P0MA 1VQ93 3S27A 4N6LA 4RBNA 4HBRA 1N8QA 3QK9A 1KSIA 1AV4A 1STFI 2XEPA 5I97A 5JPUA 2YFJB 1M9GA 1Z1SA 3FG1A 3JVCA 1OHOA 5AYSC 4IPBA 1LNHA 1NDOB 3OV4A 3U1WA 2K54A 3BB9A 4NREA 3LYGA 2P05A 1TFOA 3DGMA 3HIIA 1W5ZA 3KKGA 2I9WA 1GY7A 1R4CA 2YFIB 1O7NB 4HM5B 1IVVA 3LZAA 3F40A 5DREA 1VQL3 3X3YA 4KVHA 3NM2A 2GU1A 3DGOA 4Q53A 2W0QA 4AKYA 2BMRB 1DMQA 1US1A 1WMOA 2YX9A 3SLUA 2E2UA 3K7CA 4BTWA 3B4OA 4LZIA 1UW1A 5AEWB 3EJVA 1RJOA 1LOXA 4HM0B 1OPYA 1TP6A 3GRDA 3CME3 1Q814 5D83A 5G2GA 3B7CA 3LTBA 2F98A 4O3VA 5EVHA 3K9MC 3ER7A 2CG1A 2IA7A 2PZVA 2XSHB 1JKGB 3VF1A 1OHPA 4LSOA 3EHCA 1KC84 3CCS3 1IV7A 3KFQC 3CNXA 4BTXA 2L4VA 8CHOA 3JUNA 3JUOA 1EA2A 2HMLB 3MPHA 2C10A 3T0UA 4N6TA 1N9EA 1QAFA 3FGYA 3STDA 1VQ73 4FMCA 2RSXA 2WO0A 1V74A 3ALAA 1GD3A 4O02B 1FGTA 3EB8A 4QWTA 4FCZA 1Q864 3GWRA 3K63A 4GL6A 1JN5B 3F9SA 2Y74A 2OTJ3 2LQVA 5IENA 2FGTA 4J9AA 5IG4A 3F14A 1OACA 4KFFA 1ISKA 1IT8A 1W6CA 1Q40B 3LTCA 3OW22 2CFKA 4ZM8A 4X2OA 2IUKA 3I0YA 3LT9A 1O7GB 1VZZA 1IU7A 4EXRA 1NWWA 5AEUB 4MMYB 2HMMB 3K5TA 1QJGA 5FGOA 1A2VA 5AI1A 2Y73A 1IQYA 3G8ZA 3N54B 2CC3A 3MHEA 3Q1CA 1BUQA 1NJI4 2ML5A 4H3UA 2B24B 2ZL8A 2D42A 1W6YA 3MWZA 1J2BA 1JV2B 2UX0A 4R1KA 4CDLA 5EQLA 1W2B2 3X3ZA 1YIT3 1OF5A 1QMAA 3FF2A 3NX0A 1AVLA 3BNBA 3E99A 3BNDA 5FW5A 4PEJA 4R4KA 5JPPA 2XSOB 2V1LA 5STDA 5IEPA 1PFPA 1UI8A 3CNMA 4FR9A 3EX9A 4LEHA 2BMQB 4KFDA 1M1K4 3NV0A 2QGUA 3B8LA 1W02A 1D6YA 3NM7A 4GB5A 3CC43 1L5GB 4WYKB 3CU3A 4HKVB 4OUQA 5CK6A 2XFSA 3PZWA 3CCE3 1CQSA 2CWUA 1M904 1QAKA 1K9M4 1YJW3 4KZ1A 1SQWA 3CCM3 1YJN3 1N5PA 3SOYA 2Q07A 1E3VA 1WTHA 4K90B 2CFLA 2QEX3 3GZRA 3LOYA 1GY6A 1CYUA 5IERA 2GEXA 3EE1A 2E2VA 1ZO2A 3ROBA 4EV5A 3FCSB 4K61A 2MC8A 3SEDA 5KP4A 3V92A 1AR0A 4MEIA 4R80A 2Z7AA 3EN1B 1JNQA 3SVAA 3M8CA 2CHCA 3EQQB 1Q824 4NHFA 1O7HB 3CCR3 3H51A 4OVMA 3AMOA 5D82A 3U97A 3JUPA 4FCMA 1K734 3EN8A 1GY5A 1RRLA 4K1VA 3F7XA 4XBTA 4HM8B 1FA3A 2BMOB 2ZDJA 3KZTA 2INXA 1QVG2 3G6E3 3GZYB 2HMNB 4L7KA 2W03A 1YVBI 1HU9A 1ROVA 2XGNA 3UNLA 3WOFB 2E2TA 4RZMA 1U5OA 4N6MA 2F86B 2IMJA 3NBJA 5IW9A 2GBXB 1UUVB 1VQ63 3DM8A 2P0XA 3NUVA 4AKZA 4HM4B 1JB2A 5IG3A 3DY5A 2KXGA 4L8PA 2GXFA 2KCDA 5HGRA 3CC23 1RKYA 1OH0A 3T8UA 3SXXA 2MF7A 2Z77A 2CFDA 2A15A 4MMXB 1QALA 3OWYA 1A90A 3FF0A 2STDA 4I4KA 2BT3A 2O9UX 4WFOA 3FG3A 1TU5A 2HMOB 4O8SA 1K41A 3A76A 1JB5A 5LC6A 1N9JA 3NHXA 5ELJA 1A2KA 2GBWB 2W56B 3EBTA 2RCDA 3FG4A 3MG2A 5KP3A 3V98A 3UL5A 1VQO3 5IF6A 2JDIH 2OQEC 1W4NA 5LC7A 1QVF2 2WOHA 3IMAB 3Q90A 2Z76A 3PCSA 1STDA 3RDEA 1KD14 3EF8A 1D6ZA 1N8R4 1OGZA 2CK3H 3HI7A 4CCVA 3G16A 3DZLA 3NV0B 1IV9A 2CWVA 2JQ5A 1VQK3 3I563 3BLZA 3PGBA 1CYVA 1DVCA 1JRQA 3RGAA 3ECFA 1IQ8A 1ZX2A 1SJWA 3Q2PA 2OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MSO A;  1OUN A;  3NBR A;  1ASK A;  3F8X A;  2B1X B;  5CF1 A;  1ULI B;  3S5C A;  1JKG A;  3K0Z A;  4HM3 B;  2GEY A;  3G0K A;  5AII A;  5D81 A;  5CXO A;  3CPO A;  3H3H A;  3NXJ A;  1IDP A;  2BNG A;  4L8O A;  3OX9 A;  3EC9 A;  4X2H A;  4FCJ A;  1JN5 A;  5CF2 A;  3HX8 A;  4R9L A;  3EBY A;  3MKI A;  7STD A;  4HM6 B;  5AIF A;  4HM2 B;  1ZX2 A;  1Q40 A;  3OXA A;  4LMI A;  5BXQ A;  3F8H A;  3DMC A;  1OHS A;  2XR8 B;  2HMK B;  4J8T A;  1O7M B;  5IEO A;  3GZX B;  1TUH A;  3T8N A;  1OCV A;  3VSY A;  3MG3 A;  1ULJ B;  4XDW A;  5KP1 A;  4WWU C;  1JB4 A;  2R4I A;  1Q42 A;  5IG5 A;  4HVN A;  4WP5 A;  3FH1 A;  1S5A A;  3RGR A;  3FKA A;  3B4P A;  1E97 A;  4XBY A;  2RGQ A;  4HM1 B;  5DRV A;  4WYK A;  4XDV A;  3MYT A;  3MG1 A;  3HK4 A;  3VGN A;  3FSD A;  1EG9 B;  1OF5 B;  3KE7 A;  4MJD A;  1HKX A;  1O7W B;  3SOA A;  3GZB A;  3WMD A;  4R9K A;  1GS3 A;  3D9R A;  4HM7 B;  4U13 A;  2HMJ B;  2RFR A;  3DUK A;  1O7P B;  4XM4 A;  1UUW B;  4HZB B;  3IPT A;  1C7H A;  3HZP A;  2F99 A;  3JUM A;  5AIG A;  4LGQ A;  4N3V A;  1WQL B;  3OWS A;  4K1U A;  1OGX A;  1DMM A;  2QIY A;  4STD A;  5IG0 A;  2CKF B;  4HJL B;  3F7S A;  4HZ9 B;  3UJM A;  4XBX A;  2W2C A;  3JUQ A;  5AIH A;  5TGN A;  5BVB A;  3OWU A;  1NU3 A;  1E3R A;  2OWP A;  2YFL B;  3FZW A;  3DXO A;  1DMN A;  1W00 A;  1GYB A;  4IIA A;  2XRX B;  4ORL A;  6STD A;  3FLJ A;  3KSP A;  4XB5 A;  1W01 A;  5JPU A;  2YFJ B;  1Z1S A;  1OHO A;  1NDO B;  3OV4 A;  2K54 A;  3BB9 A;  3LYG A;  3KKG A;  2I9W A;  1GY7 A;  2YFI B;  1O7N B;  4HM5 B;  3LZA A;  3F40 A;  5DRE A;  4KVH A;  3NM2 A;  4Q53 A;  2BMR B;  1DMQ A;  3K7C A;  3B4O A;  5AEW B;  3EJV A;  4HM0 B;  1OPY A;  1TP6 A;  3GRD A;  5D83 A;  5G2G A;  3B7C A;  2F98 A;  5EVH A;  3ER7 A;  2PZV A;  2XSH B;  1JKG B;  3EHC A;  3CNX A;  8CHO A;  3JUN A;  3JUO A;  1EA2 A;  2HML B;  3FGY A;  3STD A;  3GWR A;  1JN5 B;  3F9S A;  5IEN A;  4J9A A;  5IG4 A;  3F14 A;  1ISK A;  1Q40 B;  4X2O A;  3I0Y A;  1O7G B;  1VZZ A;  1NWW A;  5AEU B;  2HMM B;  1QJG A;  5AI1 A;  3G8Z A;  3MHE A;  1BUQ A;  4H3U A;  2B24 B;  1W6Y A;  2UX0 A;  4R1K A;  4CDL A;  1OF5 A;  1QMA A;  3FF2 A;  3E99 A;  5FW5 A;  4PEJ A;  5JPP A;  2XSO B;  5IEP A;  5STD A;  3CNM A;  3EX9 A;  4LEH A;  2BMQ B;  3NV0 A;  2QGU A;  3B8L A;  1W02 A;  4GB5 A;  4WYK B;  3CU3 A;  4HKV B;  4OUQ A;  5CK6 A;  1CQS A;  3SOY A;  1E3V A;  3GZR A;  1GY6 A;  5IER A;  2GEX A;  3ROB A;  1ZO2 A;  3SED A;  5KP4 A;  1AR0 A;  2Z7A A;  3EN1 B;  3M8C A;  2CHC A;  3EQQ B;  1O7H B;  3H51 A;  4OVM A;  5D82 A;  3JUP A;  4FCM A;  3EN8 A;  1GY5 A;  4K1V A;  3F7X A;  4XBT A;  4HM8 B;  2BMO B;  3KZT A;  2INX A;  3GZY B;  2HMN B;  4L7K A;  3UNL A;  4RZM A;  1U5O A;  2F86 B;  2IMJ A;  2GBX B;  1UUV B;  3DM8 A;  3NUV A;  4HM4 B;  1JB2 A;  5IG3 A;  4L8P A;  2GXF A;  5HGR A;  1OH0 A;  3T8U A;  2Z77 A;  2A15 A;  3OWY A;  3FF0 A;  2STD A;  4I4K A;  2HMO B;  1K41 A;  3A76 A;  1JB5 A;  3NHX A;  1A2K A;  2GBW B;  3EBT A;  2RCD A;  5KP3 A;  3MG2 A;  5IF6 A;  3Q90 A;  1SJW A;  2Z76 A;  1STD A;  3EF8 A;  1OGZ A;  3G16 A;  3DZL A;  3NV0 B;  2JQ5 A;  3BLZ A;  3RGA A;  3ECF A;  5CLK A;  1OHP A; 
#chains in the Genus database with same CATH topology
 1B2U A;  3BNE A;  3SX1 A;  3X41 A;  5BIR A;  4FMD A;  2RNT A;  2F5W A;  1VQN 3;  1T3B A;  1VQP 3;  1TIJ A;  2H0H A;  3MSO A;  1OUN A;  3NBR A;  1ASK A;  1YHQ 3;  3F8X A;  2B1X B;  5CF1 A;  5G1L A;  1ULI B;  3S5C A;  2BU4 A;  2OCT A;  1JKG A;  3HIG A;  1IVW A;  1VQ4 3;  4LYL B;  2W04 A;  3G71 3;  3X42 A;  3X40 A;  3GAX A;  1I2E A;  1K28 A;  2IY2 A;  1TRP A;  4RNY A;  3K0Z A;  4HM3 B;  3L0R A;  4HYZ A;  2GEY A;  3S67 A;  3G0K A;  1RDS A;  5HOH A;  1G0T A;  1RRH A;  1BNI A;  5AII A;  5D81 A;  1AVK A;  1FYS A;  4JRF A;  5CXO A;  3CPO A;  3BNC A;  3H3H A;  3NXJ A;  1CH0 A;  2SAR A;  2CIU A;  2H0I A;  1IDP A;  2M7O A;  3NQY A;  3LTD A;  2XGL A;  2BNG A;  4L8O A;  1WMP A;  2CG0 A;  3KCH A;  3OX9 A;  3WDG B;  3EC9 A;  1I8V A;  5A0O B;  2OTL 3;  4O2H A;  4FCJ A;  1JN5 A;  2CH9 A;  4X2H A;  3UB1 A;  3DGN A;  5CF2 A;  3I55 3;  2IYJ A;  1RGC A;  4IT7 A;  1LNI A;  3HX8 A;  4R9L A;  3PCR A;  3EBY A;  3MKI A;  7STD A;  4HM6 B;  3S29 A;  4AEQ A;  1BNF A;  3CPW 2;  1PU4 A;  2KF3 A;  3BU4 A;  1LVN A;  5AIF A;  4HM2 B;  3IJE B;  1Q40 A;  1NO3 A;  2C11 A;  3OXA A;  4H61 A;  4N6V 0;  4LMI A;  2BHM A;  1X1Y A;  3DGL A;  3F8H A;  1M1X B;  5BXQ A;  3WA3 A;  1RCK A;  3DMC A;  2PNC A;  4NPB A;  3X3X A;  1NB3 I;  3CCJ 3;  1VQ8 3;  2F5M A;  5GSP A;  5M19 A;  3TDG A;  1OHS A;  2GU3 A;  1SIH A;  3UL6 A;  3V99 A;  1Y4K A;  5CLK A;  1IVX A;  2O3O A;  1YVS A;  4FMA A;  1S72 3;  2XR8 B;  2HMK B;  2C4B A;  4J8T A;  1LQG C;  2CFW A;  2CWT A;  1O7M B;  5JBS A;  3D5G A;  3WOD G;  3BIR A;  1RN1 A;  5BU4 A;  5IEO A;  2KF4 A;  1BNR A;  3Q3F A;  1RNT A;  3D79 A;  4JF8 A;  3URP A;  3GZX B;  3CMA 3;  4RNZ A;  1GMQ A;  1ROA A;  1T2H A;  1TUH A;  3LH4 A;  3T8N A;  1UDI I;  1JBS A;  1JBT A;  1NB5 I;  1OCV A;  4TX4 A;  3VSY A;  3QRD A;  3PXM A;  3PS8 A;  4BIR A;  3WA2 X;  1R4Y A;  3ZFZ A;  3A5E A;  3MG3 A;  1ULJ B;  4XDW A;  5KP1 A;  5RNT A;  4WWU C;  1X1X A;  1JB4 A;  1WNH A;  4MMZ B;  1EKM A;  2R4I A;  1RN4 A;  1Q42 A;  1Q7Y 4;  5IG5 A;  4HVN A;  4WP5 A;  1D6U A;  3PYJ A;  3FH1 A;  1S5A A;  1BRG A;  3FKA A;  3RGR A;  1UUG B;  1E97 A;  1TJD A;  3B4P A;  1F8N A;  2RGQ A;  3D3L A;  4XBY A;  4HM1 B;  5DRV A;  4WYK A;  1A67 A;  1BSB A;  1UI7 A;  1IYY A;  1B21 A;  2OQE A;  1C54 A;  1YGE A;  1BIR A;  3MYT A;  3AHW A;  4XDV A;  1W2Z A;  3J7Y d;  1BSE A;  1UGH I;  1K8A 4;  3MG1 A;  4EYC A;  2LYX A;  3HK4 A;  4N6N B;  4BTY A;  3VGN A;  3FSD A;  1EG9 B;  2HOH A;  3CC7 3;  1OF5 B;  1W6G A;  3O8Y A;  3KE7 A;  2FNQ A;  4N6U A;  1IQX A;  1HKX A;  1O7W B;  4MJD A;  5ELU A;  3SOA A;  1EQK A;  3GZB A;  3WMD A;  2KF6 A;  4R9K A;  1GS3 A;  3D9R A;  4RNT A;  1IK3 A;  5AYR B;  4G1M B;  4HM7 B;  2WGO A;  4U13 A;  4GHO A;  2HMJ B;  1WMN A;  1BNG A;  1YIJ 3;  2XH9 A;  2RFR A;  3CCQ 3;  3DUK A;  1RGK A;  3NBB A;  1O7P B;  3N9H A;  4XM4 A;  1UUW B;  2CW9 A;  4HZB B;  3IPT A;  2KRT A;  1C7H A;  3HZP A;  2P38 A;  2F99 A;  1RNB A;  2WOF A;  3JUM A;  1JJ2 2;  1MOL A;  1GD4 A;  3KN4 A;  5AIG A;  1VQ5 3;  1KQS 2;  2BO9 B;  1IT7 A;  1MNL A;  4LGQ A;  4HAA A;  4N3V A;  1BSD A;  1U8C B;  3CD6 3;  6GSP A;  4KT3 B;  1WQL B;  1CEW I;  2ML6 A;  1RN7 A;  3OWS A;  1SAR A;  1W7C A;  1IVU A;  3CXC 2;  4K1U A;  1OGX A;  2QA4 3;  1YJ9 3;  2F56 A;  2W9Q A;  3S28 A;  1G96 A;  1EUI C;  1B2S A;  2W6J H;  2AAE A;  4OK0 A;  4EC6 A;  1DMM A;  2QIY A;  4STD A;  4EV2 A;  1YI2 3;  2SBL A;  5IG0 A;  2D1W A;  1YGW A;  1FGQ A;  2CX0 A;  2K3D A;  4FMB A;  3WR2 A;  2CKF B;  1LXE A;  4HJL B;  1JZO A;  1V57 A;  3CCV 3;  3F7S A;  4HZ9 B;  4I5Q A;  3CCL 3;  3UJM A;  1RGA A;  4XBX A;  2W2C A;  3DGY A;  1FUW A;  2FXT A;  1MGW A;  2J8X B;  3AMO B;  3JUQ A;  5AIH A;  5TGN A;  1B20 A;  4N6O B;  2K0M A;  5EEO A;  1BRS A;  1FGO A;  1RSN A;  4ILF A;  5BVB A;  1KWI A;  3G4S 3;  3OWU A;  8RNT A;  1LOY A;  1V58 A;  1NU3 A;  3LML A;  1E3R A;  4EBG A;  1FGR A;  2W56 A;  2OOV C;  2OWP A;  1DVD A;  4WHA A;  1N5H A;  1TFK A;  2YFL B;  1DYU A;  1SII A;  2XF3 A;  3LT8 A;  3LTA A;  3FZW A;  1T5Y A;  3DXO A;  4KFE A;  1UGI A;  2GSP A;  1DMN A;  3NQZ A;  1W00 A;  2IUJ A;  3LXU X;  3CCU 3;  1GYB A;  2XFT A;  3KSE D;  1FGM A;  3N8B A;  3KII A;  2CFG A;  4IIA A;  1A2P A;  2XRX B;  4ORL A;  4J5G A;  6STD A;  2P09 A;  2Z6B A;  3FLJ A;  3WOE B;  1VQM 3;  2WGQ A;  2BIR A;  3KSP A;  4XB5 A;  1W01 A;  1SPU A;  2W9P A;  1BAN A;  2P0M A;  1VQ9 3;  3S27 A;  4N6L A;  4RBN A;  4HBR A;  1N8Q A;  3QK9 A;  1BNE A;  1I3F A;  1KSI A;  1PY3 A;  6RNT A;  1AV4 A;  1BSC A;  1STF I;  1YNV X;  9RNT A;  2XEP A;  1FZU A;  5I97 A;  5JPU A;  2YFJ B;  1BSA A;  1M9G A;  1GOV A;  1Z1S A;  3FG1 A;  3JVC A;  1OHO A;  5AYS C;  1LOV A;  4IPB A;  1LNH A;  1NDO B;  1RMS A;  3OV4 A;  3U1W A;  1BRH A;  5M1A A;  3RNT A;  2K54 A;  3BB9 A;  4NRE A;  3LYG A;  3D4A A;  2H0G A;  2P05 A;  3GSP A;  1TFO A;  3DGM A;  3HII A;  1W5Z A;  3KKG A;  2I9W A;  1GY7 A;  1R4C A;  2YFI B;  1O7N B;  4HM5 B;  4GSP A;  1IVV A;  3LZA A;  3F40 A;  5DRE A;  1VQL 3;  3X3Y A;  1LRA A;  4KVH A;  3NM2 A;  2GU1 A;  3DGO A;  4Q53 A;  3ZG5 A;  1X1W A;  2W0Q A;  4AKY A;  3AGO A;  2BMR B;  1DMQ A;  1MGR A;  1US1 A;  1WMO A;  2YX9 A;  2E2U A;  1B2Z A;  1BRJ A;  1BNJ A;  3K7C A;  3SLU A;  4BTW A;  3B4O A;  1AQZ A;  4LZI A;  1UW1 A;  5AEW B;  3D5I A;  3EJV A;  1BUJ A;  4CJN A;  1JZD A;  1RJO A;  1LOX A;  4HM0 B;  1OPY A;  1TP6 A;  3GRD A;  3CME 3;  1Q81 4;  1ZS7 A;  5D83 A;  5G2G A;  3B7C A;  1RHL A;  3LTB A;  5M18 A;  2F98 A;  4O3V A;  1BRN L;  5EVH A;  3K9M C;  3ER7 A;  1BAO A;  3SYU A;  1BU4 A;  2CG1 A;  2IA7 A;  2PZV A;  2XSH B;  1JKG B;  2UUG C;  3VF1 A;  1GMP A;  1OHP A;  4LSO A;  3EHC A;  1KC8 4;  3CCS 3;  1IV7 A;  3KFQ C;  3CNX A;  3WHO A;  4BTX A;  2L4V A;  8CHO A;  3JUN A;  1B2X A;  1JBR A;  1Q9E A;  1EA2 A;  3JUO A;  2HML B;  3MPH A;  2C10 A;  1HYF A;  3T0U A;  4N6T A;  1N9E A;  1QAF A;  3DH2 A;  3FGY A;  3STD A;  1VQ7 3;  4FMC A;  1I2G A;  1B2M A;  2RSX A;  2WO0 A;  1V74 A;  1G02 A;  3ALA A;  1GD3 A;  4O02 B;  2CX1 A;  1FGT A;  3EB8 A;  4QWT A;  1RGL A;  3AGN A;  4FCZ A;  1Q86 4;  3GWR A;  3K63 A;  4GL6 A;  1JN5 B;  3F9S A;  2Y74 A;  1LOW A;  2OTJ 3;  2LQV A;  5IEN A;  2FGT A;  4J9A A;  5IG4 A;  3F14 A;  1OAC A;  4CPK A;  1GOU A;  4KFF A;  1ISK A;  1IT8 A;  1W6C A;  1Q40 B;  3LTC A;  3OW2 2;  2CFK A;  4ZM8 A;  4X2O A;  4HOH A;  1B3S A;  2IUK A;  3I0Y A;  3LT9 A;  1O7G B;  1UCI A;  1VZZ A;  1UCL A;  1IU7 A;  4EXR A;  1NWW A;  5AEU B;  1I3I A;  4MMY B;  2HMM B;  2ZHX B;  3K5T A;  1QJG A;  5FGO A;  1A2V A;  1RGH A;  5AI1 A;  2Y73 A;  1IQY A;  3G8Z A;  3N54 B;  1RGE A;  2CC3 A;  3MHE A;  3Q1C A;  1NJI 4;  1BUQ A;  2ML5 A;  4H3U A;  2B24 B;  2ZL8 A;  2D42 A;  1W6Y A;  3MWZ A;  1J2B A;  3ZG0 A;  1JV2 B;  2UX0 A;  1FUS A;  4R1K A;  5EQL A;  4CDL A;  4EW5 A;  1W2B 2;  3X3Z A;  1YIT 3;  1OF5 A;  1MWS A;  1QMA A;  3FF2 A;  1AVL A;  3BNB A;  3NX0 A;  3E99 A;  1B27 A;  1I70 A;  1RCL A;  3BND A;  5FW5 A;  4PEJ A;  4R4K A;  1BRI A;  5JPP A;  1GSP A;  1I2F A;  2XSO B;  2V1L A;  5STD A;  5IEP A;  1PFP A;  1AY7 A;  4BU4 A;  1UI8 A;  3CNM A;  4FR9 A;  3EX9 A;  4LEH A;  2BMQ B;  4KFD A;  1M1K 4;  3NV0 A;  2QGU A;  3B8L A;  1EEJ A;  1W02 A;  1D6Y A;  3NM7 A;  4GB5 A;  3CC4 3;  1MWT A;  1L5G B;  4WYK B;  3CU3 A;  4HKV B;  4OUQ A;  2ZA4 A;  5CK6 A;  2XFS A;  1X1U A;  3PZW A;  1CQS A;  3CCE 3;  3HOH A;  1MWU A;  1PYL A;  2CWU A;  1M90 4;  1QAK A;  1K9M 4;  1YJW 3;  4KZ1 A;  1SQW A;  3CCM 3;  1YJN 3;  1N5P A;  3SOY A;  2Q07 A;  1E3V A;  1WTH A;  1BGS A;  4K90 B;  1FW7 A;  2CFL A;  2QEX 3;  1VQQ A;  3GZR A;  1BOX A;  1GY6 A;  3LOY A;  1CYU A;  5IER A;  2GEX A;  3EE1 A;  2E2V A;  1ZO2 A;  1I0V A;  3ROB A;  3FCS B;  4K61 A;  4EV5 A;  1TTO A;  1BVI A;  1NNV A;  2MC8 A;  3SED A;  5KP4 A;  3V92 A;  1AR0 A;  4MEI A;  1RGG A;  4R80 A;  2Z7A A;  3EN1 B;  1UCJ A;  1JNQ A;  3SVA A;  3M8C A;  2CHC A;  3EQQ B;  1Q82 4;  1UCK A;  4NHF A;  1O7H B;  3CCR 3;  3H51 A;  4OVM A;  3AMO A;  1MWR A;  5D82 A;  3U97 A;  3JUP A;  4FCM A;  1K73 4;  2KF5 A;  1GY5 A;  1RRL A;  3EN8 A;  1I0X A;  1T2I A;  3F7X A;  4K1V A;  4XBT A;  4HM8 B;  1FA3 A;  2BMO B;  2ZDJ A;  2F4Y A;  3KZT A;  2INX A;  1QVG 2;  5G1K A;  3G6E 3;  3GZY B;  2R41 A;  2HMN B;  2AAD A;  4L7K A;  1Q7H A;  2W03 A;  1YVB I;  1HU9 A;  1ROV A;  2XGN A;  3UNL A;  1DE3 A;  3WOF B;  1RGF A;  2E2T A;  4RZM A;  1U5O A;  4N6M A;  2F86 B;  2IMJ A;  3NBJ A;  5IW9 A;  2GBX B;  1UUV B;  1VQ6 3;  2KAA A;  3DM8 A;  2P0X A;  3NUV A;  4BL2 A;  4AKZ A;  4HM4 B;  1JB2 A;  1DET A;  5IG3 A;  3DY5 A;  1GOY A;  4DKI A;  2KXG A;  1RLS A;  4L8P A;  2GXF A;  2KCD A;  5HGR A;  3CC2 3;  1RKY A;  1OH0 A;  3T8U A;  3SXX A;  2MF7 A;  2Z77 A;  1LQM B;  2CFD A;  2A15 A;  4MMX B;  1QAL A;  1RTU A;  3OWY A;  7GSP A;  1A90 A;  3FF0 A;  1GMR A;  1FUT A;  2RBI A;  4J5K A;  2STD A;  4I4K A;  2BT3 A;  1ZGX A;  2O9U X;  4WFO A;  3FG3 A;  1TU5 A;  2HMO B;  4O8S A;  1K41 A;  3A76 A;  1JB5 A;  5LC6 A;  1N9J A;  1BNS A;  3NHX A;  5ELJ A;  1A2K A;  2GBW B;  2W56 B;  3EBT A;  2RCD A;  1BRK A;  2L1S A;  2UGI A;  3FG4 A;  3MG2 A;  5KP3 A;  3UL5 A;  3V98 A;  1VQO 3;  5IF6 A;  2JDI H;  2OQE C;  1W4N A;  5LC7 A;  1QVF 2;  7RNT A;  2WOH A;  3IMA B;  3Q90 A;  2Z76 A;  3PCS A;  1STD A;  3RDE A;  3AHS A;  1KD1 4;  3EF8 A;  1D6Z A;  1N8R 4;  1OGZ A;  2CK3 H;  3HI7 A;  4CCV A;  3G16 A;  3DZL A;  1HZ1 A;  3NV0 B;  1IV9 A;  2CWV A;  2JQ5 A;  1VQK 3;  3I56 3;  3BLZ A;  3PGB A;  4BL3 A;  1TRQ A;  1CYV A;  1DVC A;  1JRQ A;  3RGA A;  3ECF A;  1IQ8 A;  1ZX2 A;  1SJW A;  3Q2P A;  2OOV A; 
#chains in the Genus database with same CATH homology
 3BNE A;  3SX1 A;  3X41 A;  4FMD A;  1VQN 3;  1VQP 3;  1TIJ A;  3MSO A;  1OUN A;  3NBR A;  1ASK A;  1YHQ 3;  3F8X A;  2B1X B;  5CF1 A;  1ULI B;  3S5C A;  2OCT A;  1JKG A;  3HIG A;  1IVW A;  1VQ4 3;  3G71 3;  2W04 A;  3X42 A;  3X40 A;  3GAX A;  1K28 A;  4RNY A;  3K0Z A;  4HM3 B;  3L0R A;  4HYZ A;  2GEY A;  3S67 A;  3G0K A;  1RRH A;  5AII A;  5D81 A;  1AVK A;  4JRF A;  5CXO A;  3CPO A;  3BNC A;  3H3H A;  3NXJ A;  2CIU A;  1IDP A;  2M7O A;  3NQY A;  3LTD A;  2XGL A;  2BNG A;  4L8O A;  1WMP A;  2CG0 A;  3WDG B;  3OX9 A;  3EC9 A;  5A0O B;  2OTL 3;  4O2H A;  4FCJ A;  1JN5 A;  2CH9 A;  4X2H A;  3UB1 A;  3DGN A;  5CF2 A;  3I55 3;  4IT7 A;  3HX8 A;  4R9L A;  3PCR A;  3EBY A;  3MKI A;  7STD A;  4HM6 B;  3S29 A;  4AEQ A;  3CPW 2;  1PU4 A;  5AIF A;  1LVN A;  4HM2 B;  3IJE B;  1Q40 A;  1NO3 A;  2C11 A;  3OXA A;  4H61 A;  4N6V 0;  4LMI A;  2BHM A;  3DGL A;  3F8H A;  1M1X B;  5BXQ A;  3WA3 A;  3DMC A;  2PNC A;  3X3X A;  1VQ8 3;  1NB3 I;  3CCJ 3;  3TDG A;  1OHS A;  2GU3 A;  1SIH A;  3UL6 A;  3V99 A;  1Y4K A;  5CLK A;  1IVX A;  2O3O A;  4FMA A;  1S72 3;  2XR8 B;  2HMK B;  4J8T A;  2CFW A;  2CWT A;  5JBS A;  1O7M B;  3WOD G;  5IEO A;  4JF8 A;  3GZX B;  3CMA 3;  4RNZ A;  1ROA A;  3LH4 A;  1TUH A;  3T8N A;  1NB5 I;  1OCV A;  4TX4 A;  3VSY A;  3QRD A;  3PXM A;  3PS8 A;  3WA2 X;  3MG3 A;  1ULJ B;  4XDW A;  5KP1 A;  4WWU C;  1JB4 A;  1WNH A;  4MMZ B;  1EKM A;  2R4I A;  1Q42 A;  1Q7Y 4;  5IG5 A;  4HVN A;  4WP5 A;  1D6U A;  3PYJ A;  3FH1 A;  1S5A A;  3FKA A;  3RGR A;  3B4P A;  1E97 A;  3D3L A;  4XBY A;  1F8N A;  2RGQ A;  4HM1 B;  5DRV A;  4WYK A;  1A67 A;  1UI7 A;  2OQE A;  1YGE A;  3MYT A;  4XDV A;  3J7Y d;  1K8A 4;  1W2Z A;  3MG1 A;  4EYC A;  2LYX A;  3HK4 A;  4N6N B;  4BTY A;  3VGN A;  3FSD A;  1EG9 B;  3CC7 3;  1OF5 B;  1W6G A;  3O8Y A;  3KE7 A;  2FNQ A;  4N6U A;  1IQX A;  1HKX A;  1O7W B;  4MJD A;  5ELU A;  3SOA A;  1EQK A;  3GZB A;  3WMD A;  4R9K A;  1GS3 A;  3D9R A;  1IK3 A;  5AYR B;  4G1M B;  4HM7 B;  2WGO A;  4U13 A;  2HMJ B;  1WMN A;  1YIJ 3;  2XH9 A;  2RFR A;  3CCQ 3;  3DUK A;  3NBB A;  1O7P B;  3N9H A;  4XM4 A;  1UUW B;  2CW9 A;  4HZB B;  3IPT A;  2KRT A;  1C7H A;  3HZP A;  2P38 A;  2F99 A;  2WOF A;  3JUM A;  1JJ2 2;  1MOL A;  1GD4 A;  3KN4 A;  5AIG A;  1VQ5 3;  1KQS 2;  2BO9 B;  1IT7 A;  1MNL A;  4LGQ A;  4N3V A;  1U8C B;  3CD6 3;  1WQL B;  1CEW I;  2ML6 A;  1RN7 A;  3OWS A;  1W7C A;  1IVU A;  3CXC 2;  4K1U A;  1OGX A;  2QA4 3;  1YJ9 3;  2W9Q A;  3S28 A;  1G96 A;  2W6J H;  4OK0 A;  4EC6 A;  1DMM A;  2QIY A;  4STD A;  4EV2 A;  1YI2 3;  2SBL A;  5IG0 A;  2D1W A;  1FGQ A;  4FMB A;  2CKF B;  1LXE A;  4HJL B;  3CCV 3;  3F7S A;  4HZ9 B;  3CCL 3;  3UJM A;  4XBX A;  2W2C A;  1FUW A;  2FXT A;  3AMO B;  3JUQ A;  5AIH A;  5TGN A;  4N6O B;  2K0M A;  5EEO A;  1FGO A;  5BVB A;  1KWI A;  3G4S 3;  3OWU A;  1NU3 A;  3LML A;  1E3R A;  4EBG A;  1FGR A;  2W56 A;  2OOV C;  2OWP A;  1DVD A;  4WHA A;  1N5H A;  1TFK A;  2YFL B;  1DYU A;  1SII A;  2XF3 A;  3LT8 A;  3LTA A;  3FZW A;  1T5Y A;  3DXO A;  4KFE A;  1DMN A;  3NQZ A;  1W00 A;  2IUJ A;  3LXU X;  3CCU 3;  1GYB A;  2XFT A;  3KSE D;  1FGM A;  3N8B A;  3KII A;  2CFG A;  4IIA A;  2XRX B;  4ORL A;  6STD A;  2P09 A;  2Z6B A;  3FLJ A;  3WOE B;  1VQM 3;  2WGQ A;  3KSP A;  4XB5 A;  1W01 A;  1SPU A;  2W9P A;  2P0M A;  1VQ9 3;  3S27 A;  4N6L A;  4RBN A;  4HBR A;  1N8Q A;  3QK9 A;  1KSI A;  1AV4 A;  1STF I;  2XEP A;  5I97 A;  5JPU A;  2YFJ B;  1M9G A;  1Z1S A;  3FG1 A;  3JVC A;  1OHO A;  5AYS C;  4IPB A;  1LNH A;  1NDO B;  3OV4 A;  3U1W A;  2K54 A;  3BB9 A;  4NRE A;  3LYG A;  2P05 A;  1TFO A;  3DGM A;  3HII A;  1W5Z A;  3KKG A;  2I9W A;  1GY7 A;  1R4C A;  2YFI B;  1O7N B;  4HM5 B;  1IVV A;  3LZA A;  3F40 A;  5DRE A;  1VQL 3;  3X3Y A;  4KVH A;  3NM2 A;  2GU1 A;  3DGO A;  4Q53 A;  2W0Q A;  4AKY A;  2BMR B;  1DMQ A;  1US1 A;  1WMO A;  2YX9 A;  3SLU A;  2E2U A;  3K7C A;  4BTW A;  3B4O A;  4LZI A;  1UW1 A;  5AEW B;  3EJV A;  1RJO A;  1LOX A;  4HM0 B;  1OPY A;  1TP6 A;  3GRD A;  3CME 3;  1Q81 4;  5D83 A;  5G2G A;  3B7C A;  3LTB A;  2F98 A;  4O3V A;  5EVH A;  3K9M C;  3ER7 A;  2CG1 A;  2IA7 A;  2PZV A;  2XSH B;  1JKG B;  3VF1 A;  1OHP A;  4LSO A;  3EHC A;  1KC8 4;  3CCS 3;  1IV7 A;  3KFQ C;  3CNX A;  4BTX A;  2L4V A;  8CHO A;  3JUN A;  3JUO A;  1EA2 A;  2HML B;  3MPH A;  2C10 A;  3T0U A;  4N6T A;  1N9E A;  1QAF A;  3FGY A;  3STD A;  1VQ7 3;  4FMC A;  2RSX A;  2WO0 A;  1V74 A;  3ALA A;  1GD3 A;  4O02 B;  1FGT A;  3EB8 A;  4QWT A;  4FCZ A;  1Q86 4;  3GWR A;  3K63 A;  4GL6 A;  1JN5 B;  3F9S A;  2Y74 A;  2OTJ 3;  2LQV A;  5IEN A;  2FGT A;  4J9A A;  5IG4 A;  3F14 A;  1OAC A;  4KFF A;  1ISK A;  1IT8 A;  1W6C A;  1Q40 B;  3LTC A;  3OW2 2;  2CFK A;  4ZM8 A;  4X2O A;  2IUK A;  3I0Y A;  3LT9 A;  1O7G B;  1VZZ A;  1IU7 A;  4EXR A;  1NWW A;  5AEU B;  4MMY B;  2HMM B;  3K5T A;  1QJG A;  5FGO A;  1A2V A;  5AI1 A;  2Y73 A;  1IQY A;  3G8Z A;  3N54 B;  2CC3 A;  3MHE A;  3Q1C A;  1BUQ A;  1NJI 4;  2ML5 A;  4H3U A;  2B24 B;  2ZL8 A;  2D42 A;  1W6Y A;  3MWZ A;  1J2B A;  1JV2 B;  2UX0 A;  4R1K A;  4CDL A;  5EQL A;  1W2B 2;  3X3Z A;  1YIT 3;  1OF5 A;  1QMA A;  3FF2 A;  3NX0 A;  1AVL A;  3BNB A;  3E99 A;  3BND A;  5FW5 A;  4PEJ A;  4R4K A;  5JPP A;  2XSO B;  2V1L A;  5STD A;  5IEP A;  1PFP A;  1UI8 A;  3CNM A;  4FR9 A;  3EX9 A;  4LEH A;  2BMQ B;  4KFD A;  1M1K 4;  3NV0 A;  2QGU A;  3B8L A;  1W02 A;  1D6Y A;  3NM7 A;  4GB5 A;  3CC4 3;  1L5G B;  4WYK B;  3CU3 A;  4HKV B;  4OUQ A;  5CK6 A;  2XFS A;  3PZW A;  3CCE 3;  1CQS A;  2CWU A;  1M90 4;  1QAK A;  1K9M 4;  1YJW 3;  4KZ1 A;  1SQW A;  3CCM 3;  1YJN 3;  1N5P A;  3SOY A;  2Q07 A;  1E3V A;  1WTH A;  4K90 B;  2CFL A;  2QEX 3;  3GZR A;  3LOY A;  1GY6 A;  1CYU A;  5IER A;  2GEX A;  3EE1 A;  2E2V A;  1ZO2 A;  3ROB A;  4EV5 A;  3FCS B;  4K61 A;  2MC8 A;  3SED A;  5KP4 A;  3V92 A;  1AR0 A;  4MEI A;  4R80 A;  2Z7A A;  3EN1 B;  1JNQ A;  3SVA A;  3M8C A;  2CHC A;  3EQQ B;  1Q82 4;  4NHF A;  1O7H B;  3CCR 3;  3H51 A;  4OVM A;  3AMO A;  5D82 A;  3U97 A;  3JUP A;  4FCM A;  1K73 4;  3EN8 A;  1GY5 A;  1RRL A;  4K1V A;  3F7X A;  4XBT A;  4HM8 B;  1FA3 A;  2BMO B;  2ZDJ A;  3KZT A;  2INX A;  1QVG 2;  3G6E 3;  3GZY B;  2HMN B;  4L7K A;  2W03 A;  1YVB I;  1HU9 A;  1ROV A;  2XGN A;  3UNL A;  3WOF B;  2E2T A;  4RZM A;  1U5O A;  4N6M A;  2F86 B;  2IMJ A;  3NBJ A;  5IW9 A;  2GBX B;  1UUV B;  1VQ6 3;  3DM8 A;  2P0X A;  3NUV A;  4AKZ A;  4HM4 B;  1JB2 A;  5IG3 A;  3DY5 A;  2KXG A;  4L8P A;  2GXF A;  2KCD A;  5HGR A;  3CC2 3;  1RKY A;  1OH0 A;  3T8U A;  3SXX A;  2MF7 A;  2Z77 A;  2CFD A;  2A15 A;  4MMX B;  1QAL A;  3OWY A;  1A90 A;  3FF0 A;  2STD A;  4I4K A;  2BT3 A;  2O9U X;  4WFO A;  3FG3 A;  1TU5 A;  2HMO B;  4O8S A;  1K41 A;  3A76 A;  1JB5 A;  5LC6 A;  1N9J A;  3NHX A;  5ELJ A;  1A2K A;  2GBW B;  2W56 B;  3EBT A;  2RCD A;  3FG4 A;  3MG2 A;  5KP3 A;  3V98 A;  3UL5 A;  1VQO 3;  5IF6 A;  2JDI H;  2OQE C;  1W4N A;  5LC7 A;  1QVF 2;  2WOH A;  3IMA B;  3Q90 A;  2Z76 A;  3PCS A;  1STD A;  3RDE A;  1KD1 4;  3EF8 A;  1D6Z A;  1N8R 4;  1OGZ A;  2CK3 H;  3HI7 A;  4CCV A;  3G16 A;  3DZL A;  3NV0 B;  1IV9 A;  2CWV A;  2JQ5 A;  1VQK 3;  3I56 3;  3BLZ A;  3PGB A;  1CYV A;  1DVC A;  1JRQ A;  3RGA A;  3ECF A;  1IQ8 A;  1ZX2 A;  1SJW A;  3Q2P A;  2OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...