1OHPA

Crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
125
structure length
125
Chain Sequence
MNTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFIVSFEYQGRKTVVAPIDHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Crystal Structure of 5-3-Ketosteroid Isomerase Mutant D38N from Pseudomonas Testosteroni Complexed with 5Alpha-Estran-3,17-Dione
rcsb
source organism Pseudomonas testosteroni
molecule tags Isomerase
total genus 32
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2003-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1ohpA00
3UNLA 3GWRA 3EHCA 3BB9A 3I0YA 3HK4A 2XSHB 4H3UA 1OGZA 5JPPA 3KE7A 2BMRB 1C7HA 5AI1A 1QJGA 4HM0B 5KP1A 1U5OA 3JUPA 2HMNB 3F14A 5IERA 2B24B 1OHOA 3G16A 1O7MB 3OWSA 1GY6A 2W2CA 1NDOB 1NU3A 5JPUA 5EVHA 1ISKA 3OXAA 2JQ5A 3H3HA 2HMKB 4HM6B 3VGNA 5HGRA 1O7NB 3EBYA 1Q42A 3FZWA 3EX9A 2GXFA 5TGNA 2F98A 5D83A 3FF0A 3T8NA 1HKXA 2HMOB 3DXOA 2IMJA 3MG2A 3EF8A 4K1UA 3B8LA 4X2OA 1JKGB 2R4IA 1OHPA 2F99A 3GRDA 4XBXA 4HZBB 1OF5B 2XSOB 2OWPA 5G2GA 5CLKA 1ZO2A 1E3VA 4L8PA 3WMDA 2RCDA 1JB4A 3MSOA 2HMMB 3DZLA 3KZTA 1JN5B 1W01A 3SOYA 3NV0A 1CQSA 2HMJB 5FW5A 3MKIA 5IF6A 4XBTA 3DMCA 4HKVB 4U13A 1ULIB 3F40A 2RFRA 1Q40B 2RGQA 3H51A 4J8TA 5KP3A 4OUQA 4WYKA 3BLZA 1TP6A 2K54A 1DMNA 1UUWB 4K1VA 5AIFA 3NBRA 5DRVA 3EBTA 3ER7A 1VZZA 2Z76A 3OX9A 1GS3A 2HMLB 4XDVA 2XR8B 3OWUA 2GEYA 2YFJB 3F8XA 3HX8A 5AIGA 4HM2B 1GY5A 5IG3A 3EQQB 1S5AA 2I9WA 1A2KA 1STDA 1UUVB 1DMMA 2INXA 3GZRA 5CXOA 1BUQA 1AR0A 4FCMA 3CNMA 2PZVA 3KSPA 4L7KA 4J9AA 3LYGA 1W02A 3MYTA 4HM3B 4X2HA 4KVHA 1W6YA 1QMAA 3GZYB 1DMQA 3OWYA 3E99A 1ASKA 1OPYA 3MHEA 2QIYA 1OCVA 1EA2A 4HM4B 5DREA 5IG0A 3B4OA 2B1XB 1JB2A 1Z1SA 5AIHA 3CU3A 4HJLB 1ULJB 3STDA 2BMOB 3JUNA 8CHOA 4MJDA 3M8CA 2GEXA 4FCJA 5D82A 1OF5A 4I4KA 3G0KA 1SJWA 3ECFA 5STDA 2BMQB 5CK6A 3JUQA 3K0ZA 1JB5A 3FF2A 3JUOA 1O7WB 5CF1A 3K7CA 3FLJA 3NXJA 5IEOA 5BXQA 4WWUC 1OHSA 3ROBA 2UX0A 1GY7A 3NV0B 6STDA 3NM2A 2F86B 1OH0A 4XB5A 4XBYA 4XM4A 4Q53A 4IIAA 5IENA 1NWWA 1ZX2A 1Q40A 5AEUB 1IDPA 3OV4A 4OVMA 4GB5A 4RZMA 3UJMA 5IG4A 4WYKB 1E97A 3LZAA 1TUHA 3HZPA 4LEHA 4HVNA 1K41A 2YFIB 3GZXB 2XRXB 2CHCA 3F8HA 3MG3A 3T8UA 3EN1B 3EJVA 5BVBA 4STDA 2CKFB 4N3VA 4R1KA 3SOAA 4HM1B 3Q90A 3RGRA 4ORLA 2YFLB 3NUVA 2A15A 3B7CA 3JUMA 5D81A 4HZ9B 3RGAA 3G8ZA 4XDWA 3MG1A 2GBWB 1GYBA 2Z7AA 1O7PB 3NHXA 4L8OA 1JKGA 4HM8B 4HM5B 3A76A 2BNGA 3EC9A 5IG5A 3S5CA 3FSDA 4R9LA 3EN8A 3F7SA 1O7HB 1W00A 4LMIA 2QGUA 2STDA 3VSYA 1EG9B 3D9RA 3FKAA 4CDLA 5CF2A 1OUNA 1JN5A 7STDA 2Z77A 4PEJA 1O7GB 5KP4A 3F9SA 3CPOA 1WQLB 3DUKA 3FH1A 5AEWB 4R9KA 2GBXB 1OGXA 3F7XA 3SEDA 5IEPA 4WP5A 3KKGA 5AIIA 4LGQA 3DM8A 3IPTA 3FGYA 3GZBA 3CNXA 1E3RA 3B4PA 4HM7B
chains in the Genus database with same CATH superfamily
3UNLA 2CX1A 2L1SA 2KF6A 3GWRA 4EV5A 3PCRA 1VQ73 3EHCA 1N5HA 4GSPA 5JBSA 4R4KA 3BB9A 1ZGXA 2OTL3 3I0YA 5IENA 4IT7A 1IQYA 1BSCA 3HK4A 3DGLA 1LQGC 2HOHA 2XSHB 1X1WA 1YGWA 4H3UA 1FUSA 1OGZA 5JPPA 3CME3 1I0XA 2GU3A 4TX4A 1NO3A 1T5YA 3KE7A 1KSIA 3V92A 2BMRB 1C7HA 5AI1A 1QJGA 3WOFB 1A2VA 2O3OA 3N54B 4K90B 3WHOA 4BTXA 4EW5A 1VQO3 1IK3A 1JJ22 4HM0B 1FA3A 3CCM3 5G1LA 1N9JA 1UW1A 1N8QA 2XFSA 4FMAA 1RN1A 5KP1A 1QAKA 1R4CA 1U5OA 4O02B 3JUPA 1CYVA 1FUTA 4EC6A 1LOYA 1BRNL 1OACA 1F8NA 1SIIA 3S67A 2H0GA 2HMNB 4NPBA 3F14A 2C10A 5IERA 1GD4A 2B24B 1OHOA 3G16A 5M18A 2OOVC 4EBGA 1O7MB 3OWSA 3FG4A 1Q7Y4 3L0RA 1GY6A 2W2CA 1NDOB 1TTOA 4N6NB 2Q07A 1MWRA 1IVWA 1NU3A 1YJW3 5JPUA 1GSPA 5EVHA 1ISKA 1BRGA 2O9UX 3OXAA 3PS8A 2OOVA 1JNQA 2JQ5A 3H3HA 2HMKB 1NB5I 4HM6B 3VGNA 4AKZA 2KXGA 5HGRA 1M1XB 1O7NB 2BU4A 3X3YA 1Q824 3IMAB 2CW9A 2CWTA 1Q42A 3EBYA 3EX9A 2GXFA 3FZWA 5G1KA 5TGNA 1WMOA 3S27A 2CWVA 3CCE3 4KT3B 2F98A 1LXEA 5D83A 2IYJA 3BNDA 2C4BA 3FF0A 3T8NA 1RGLA 1HKXA 3O8YA 2HMOB 1Q814 1KD14 3DXOA 2WO0A 2ZHXB 2UGIA 2IMJA 3MG2A 1ROVA 2WGOA 3FG3A 3EF8A 2E2TA 1US1A 4K1UA 1GMPA 3B8LA 4X2OA 1JKGB 2CFKA 2WOFA 1UCJA 2P0MA 1EEJA 3AMOB 2R4IA 1BAOA 2RSXA 1BU4A 1BSEA 1OHPA 2F99A 3GRDA 5M1AA 4XBXA 2KF3A 4HZBB 1GOVA 4H61A 2D42A 1UI8A 2D1WA 1OF5B 1ROAA 1WNHA 2AAEA 2XSOB 2OWPA 2F4YA 5G2GA 5CLKA 1RRLA 1MNLA 2W9QA 5EQLA 1ZO2A 1UCKA 2CX0A 3S28A 2MF7A 1E3VA 4L8PA 3WMDA 3SXXA 1J2BA 1RGAA 4KZ1A 3KN4A 4BL3A 2RCDA 1BSBA 3LTBA 1T2IA 1I70A 1G96A 1RCLA 1TIJA 2GU1A 1JB4A 4ZM8A 3MSOA 1JBSA 1RTUA 1UGHI 3HI7A 2HMMB 3DZLA 1FGMA 3KZTA 5AYSC 3T0UA 6RNTA 1JN5B 2CFGA 4HOHA 5I97A 3SX1A 1W01A 3LOYA 3SOYA 3NV0A 4EYCA 1HU9A 1CQSA 4RBNA 2MC8A 1GOYA 2HMJB 1WTHA 5FW5A 2CFWA 2W56A 4BU4A 1RRHA 3MKIA 3D5IA 5IF6A 1C54A 3U1WA 3QK9A 3ALAA 1LOXA 1VQQA 4XBTA 1JZOA 3DMCA 4HKVB 4U13A 1ULIB 1V58A 3F40A 1W6GA 4R80A 2RFRA 1B2ZA 1Q40B 1L5GB 1YIT3 3CCU3 2RGQA 1EQKA 3X3XA 4NHFA 2R41A 2W04A 3LXUX 3SYUA 3CCV3 3H51A 4J8TA 5KP3A 2H0HA 3CPW2 4OUQA 1A2PA 1RGFA 3BIRA 4J5GA 4WYKA 1MWSA 3BLZA 1YVSA 1TP6A 2K54A 2KF4A 1DMNA 4KFEA 1UUWB 1UCIA 4BTYA 2M7OA 3I553 4K1VA 5AIFA 1D6ZA 3WDGB 2QA43 1AV4A 1BNRA 3NBRA 5DRVA 3LMLA 3DGNA 3EBTA 2IY2A 1RGHA 2K3DA 2L4VA 3ER7A 2P09A 1SIHA 2UUGC 4DKIA 4FCZA 1VZZA 3UL6A 1RLSA 2Z76A 1HYFA 3EE1A 3FCSB 4JF8A 3OX9A 1GS3A 2HMLB 2BHMA 4XDVA 5ELUA 2XR8B 3N8BA 4IPBA 3LTAA 1N8R4 1CEWI 1UUGB 1FUWA 1FZUA 2ML5A 3OWUA 3QRDA 4FR9A 2GEYA 1TRPA 2W9PA 2YFJB 3F8XA 3HX8A 4NREA 5AIGA 4CPKA 3KSED 2P38A 2XFTA 4HM2B 1B2XA 4CCVA 1B3SA 1JBRA 1GY5A 5IG3A 3HOHA 3EQQB 3G4S3 1YI23 1IYYA 1G02A 8RNTA 1D6UA 4N6OB 1RGKA 1B2SA 1S5AA 2I9WA 3GAXA 1M9GA 3LT9A 2XH9A 1RCKA 3BU4A 3NX0A 2K0MA 1A2KA 2LYXA 3PXMA 1STDA 1UUVB 1LVNA 1DMMA 2INXA 2WGQA 3GZRA 1W2B2 5CXOA 2LQVA 3UB1A 1A90A 1AR0A 1BUQA 4ILFA 4FCMA 2CG0A 2YX9A 3CNMA 1D6YA 1IVVA 4JRFA 4EXRA 2FNQA 5A0OB 1Q7HA 1RN7A 2PZVA 2W03A 3DGOA 1RNBA 1BVIA 3KSPA 4L7KA 1IT7A 4J9AA 4J5KA 5LC7A 3LYGA 1W02A 1TJDA 3MYTA 3VF1A 3WR2A 1KQS2 2E2UA 2OQEC 1DVCA 3NM7A 4HM3B 1IVXA 2CK3H 1T3BA 1NJI4 3ZG0A 4X2HA 4KVHA 1RGEA 3G6E3 1CYUA 1K8A4 1EKMA 1W6YA 1QMAA 1DMQA 3GZYB 1RHLA 3KFQC 3OWYA 3E99A 4I5QA 3UL5A 3MPHA 3WA3A 1ASKA 2OQEA 4AEQA 2CFDA 1DETA 1OPYA 3MHEA 1VQP3 1BRIA 1OCVA 1EA2A 1V57A 2QIYA 4HM4B 5DREA 5IG0A 1TFKA 3CCR3 1W5ZA 3B4OA 5EEOA 2B1XB 7RNTA 2QEX3 2KCDA 1JB2A 1W6CA 1Z1SA 5AIHA 3TDGA 1I2FA 3CU3A 3GSPA 4HJLB 1ULJB 1JV2B 1SQWA 3STDA 2BMOB 5HOHA 1Y4KA 3JUNA 4HYZA 3M8CA 2GEXA 4FCJA 1NNVA 4MJDA 1OF5A 5D82A 1MOLA 2E2VA 1R4YA 3JVCA 4I4KA 4RNTA 2BT3A 3G0KA 1M904 4LZIA 5LC6A 2Z6BA 4LYLB 1SARA 2CWUA 1LNIA 1B2UA 3V99A 1SJWA 1V74A 1VQ83 3ECFA 1Q9EA 1DVDA 5STDA 2BMQB 5CK6A 1YNVX 3JUQA 3K0ZA 3U97A 3MWZA 3IJEB 1JB5A 4BIRA 4N6V0 1JRQA 2SARA 3FF2A 3JUOA 4GL6A 1DYUA 1O7WB 1RSNA 1TU5A 5CF1A 2F5WA 4KFFA 3K7CA 1LQMB 1STFI 2Y74A 3FLJA 4N6LA 3NXJA 1DE3A 1K734 5IEOA 1B27A 8CHOA 5BU4A 2J8XB 2FGTA 5BXQA 1I0VA 1Q864 4WWUC 1OHSA 3ROBA 1IU7A 1QVF2 2UX0A 1I3IA 2IUJA 2ML6A 1BIRA 3K9MC 1GY7A 1BRSA 3CMA3 1IT8A 3NV0B 6STDA 2PNCA 3NM2A 1QAFA 2F86B 1IQ8A 1OH0A 1RDSA 4XB5A 2W56B 4XBYA 1U8CB 4XM4A 2CG1A 4Q53A 4BTWA 2P05A 2FXTA 1GMQA 2CIUA 2RNTA 4IIAA 3G713 1BANA 3RDEA 1RJOA 1NWWA 3KCHA 1NB3I 1ZX2A 3LH4A 5FGOA 4MMZB 3SLUA 1Q40A 1FGOA 5M19A 2RBIA 3HIIA 1BUJA 2XGLA 5AEUB 1IDPA 3OV4A 1BGSA 4OVMA 4GB5A 3DY5A 4RZMA 3D79A 3DGYA 1TFOA 1VQM3 4FMDA 2Y73A 3UJMA 3CXC2 3NBBA 1YJN3 1LRAA 5IG4A 1BRHA 3EB8A 2F56A 5ELJA 4WYKB 1BSAA 3AGNA 1E97A 3K5TA 1BSDA 2ZDJA 1PY3A 3LZAA 1BNSA 1RN4A 1RGCA 1LNHA 3Q3FA 1TUHA 1I3FA 3HIGA 3HZPA 4LEHA 1JZDA 1VQ63 1T2HA 1LOWA 4HVNA 1IVUA 1VQ93 1YHQ3 1I2EA 1AQZA 1K41A 2YFIB 3I563 3GZXB 4GHOA 4BL2A 1WMPA 2XRXB 2CHCA 3F8HA 2AADA 3LTCA 3CC43 3MG3A 1AY7A 1B21A 1BNFA 2XF3A 3T8UA 3EN1B 1FGQA 3EJVA 2OCTA 3WA2X 5BVBA 4STDA 5AYRB 1BNJA 3BNBA 1BNIA 2CKFB 4FMBA 2KAAA 4LSOA 1W2ZA 3NQYA 1VQN3 4FMCA 4EV2A 2BO9B 4N3VA 1LOVA 3D3LA 4R1KA 3WOEB 1KWIA 3V98A 1GMRA 3SOAA 4HM1B 2CFLA 5RNTA 1A67A 3Q90A 3RGRA 1W7CA 4RNZA 2XGNA 2JDIH 1N9EA 1BNGA 4ORLA 1UCLA 2YFLB 3D5GA 1QALA 2KRTA 3NUVA 3PYJA 1EUIC 1I2GA 2H0IA 3CCL3 1CH0A 1MWTA 1YVBI 1UI7A 1HZ1A 2A15A 2ZA4A 3X42A 3B7CA 4AKYA 3JUMA 3ZFZA 3J7Yd 5D81A 5GSPA 4HZ9B 1K28A 1PYLA 3G8ZA 4RNYA 3RGAA 1KC84 1IV9A 4XDWA 1W4NA 3N9HA 1X1XA 1X1YA 2GBWB 3MG1A 3URPA 1BRKA 3K63A 2C11A 3CCJ3 1VQL3 3Q1CA 2F5MA 4HAAA 1GYBA 2W0QA 2Z7AA 1O7PB 1IQXA 4CJNA 4N6TA 1JBTA 3NHXA 4L8OA 1JKGA 3X41A 4HM8B 4HM5B 1RKYA 3A76A 3AHSA 3AMOA 3CC73 1AVLA 3A5EA 3WODG 3OW22 1UGIA 1FGRA 1IV7A 3D4AA 3RNTA 1QVG2 2BNGA 1MGWA 3EC9A 5IG5A 1RGGA 1RNTA 1BRJA 9RNTA 1VQ43 3AGOA 3BNEA 1B20A 3PGBA 3S5CA 3ZG5A 1UDII 2XEPA 4HBRA 3NBJA 3FSDA 4R9LA 1ZS7A 1GOUA 3X40A 3EN8A 4O2HA 4WHAA 3F7SA 1O7HB 4KFDA 3SVAA 2V1LA 1W00A 1FW7A 1FYSA 1WMNA 2QGUA 4LMIA 3CCQ3 1FGTA 2STDA 3VSYA 1GD3A 5IW9A 1N5PA 2GSPA 1EG9B 2BIRA 1TRQA 2IA7A 2IUKA 3CD63 2WOHA 3D9RA 3FKAA 4CDLA 5CF2A 1VQK3 4N6MA 1K9M4 3BNCA 1OUNA 1X1UA 1JN5A 4K61A 7GSPA 7STDA 1YJ93 1VQ53 1I8VA 3PZWA 2Z77A 4PEJA 1O7GB 5KP4A 1BOXA 3F9SA 1MWUA 3CCS3 3CPOA 1M1K4 4MMYB 2CH9A 1S723 1PU4A 1SPUA 1PFPA 1G0TA 1WQLB 4WFOA 4O3VA 4MMXB 3DUKA 3FH1A 3NQZA 5BIRA 5AEWB 4R9KA 3Q2PA 2KF5A 3DH2A 2GBXB 1MGRA 1OGXA 1RMSA 2P0XA 3F7XA 3LTDA 4OK0A 1YGEA 3S29A 3SEDA 3X3ZA 3LT8A 2ZL8A 5IEPA 4WP5A 2CC3A 3KKGA 5AIIA 2OTJ3 4LGQA 3DM8A 3IPTA 3FG1A 4MEIA 2W6JH 4QWTA 1YIJ3 1AVKA 1BNEA 3FGYA 3GZBA 3PCSA 3CC23 4G1MB 4O8SA 3CNXA 1E3RA 3B4PA 6GSPA 4N6UA 2SBLA 1B2MA 3KIIA 3AHWA 3DGMA 4HM7B
chains in the Genus database with same CATH topology
3UNLA 3GWRA 4EV5A 3PCRA 1VQ73 3EHCA 1N5HA 5JBSA 4R4KA 3BB9A 2OTL3 3I0YA 4IT7A 1IQYA 3HK4A 3DGLA 2XSHB 4H3UA 1OGZA 5JPPA 3CME3 2GU3A 4TX4A 1NO3A 1T5YA 3KE7A 1KSIA 3V92A 2BMRB 1C7HA 5AI1A 1QJGA 3WOFB 1A2VA 2O3OA 3N54B 4K90B 4BTXA 1VQO3 1IK3A 1JJ22 4HM0B 1FA3A 3CCM3 1N9JA 1UW1A 1N8QA 2XFSA 4FMAA 5KP1A 1QAKA 1R4CA 1U5OA 4O02B 3JUPA 1CYVA 4EC6A 1OACA 1F8NA 1SIIA 3S67A 2HMNB 3F14A 2C10A 5IERA 1GD4A 2B24B 1OHOA 3G16A 2OOVC 4EBGA 1O7MB 3OWSA 3FG4A 1Q7Y4 3L0RA 1GY6A 2W2CA 1NDOB 4N6NB 2Q07A 1IVWA 1NU3A 1YJW3 5JPUA 5EVHA 1ISKA 2O9UX 3OXAA 3PS8A 2OOVA 1JNQA 2JQ5A 3H3HA 2HMKB 1NB5I 4HM6B 3VGNA 4AKZA 2KXGA 5HGRA 1M1XB 1O7NB 3X3YA 1Q824 3IMAB 2CW9A 2CWTA 1Q42A 3EBYA 3EX9A 2GXFA 3FZWA 5TGNA 1WMOA 3S27A 2CWVA 3CCE3 2F98A 1LXEA 5D83A 3BNDA 3FF0A 3T8NA 1HKXA 3O8YA 2HMOB 1Q814 1KD14 3DXOA 2WO0A 2IMJA 3MG2A 1ROVA 2WGOA 3FG3A 3EF8A 2E2TA 1US1A 4K1UA 3B8LA 4X2OA 1JKGB 2CFKA 2WOFA 2P0MA 3AMOB 2R4IA 2RSXA 1OHPA 2F99A 3GRDA 4XBXA 4HZBB 4H61A 2D42A 1UI8A 2D1WA 1OF5B 2XSOB 1ROAA 1WNHA 2OWPA 5G2GA 5CLKA 1RRLA 1MNLA 2W9QA 5EQLA 1ZO2A 3S28A 2MF7A 1E3VA 4L8PA 3WMDA 3SXXA 1J2BA 4KZ1A 3KN4A 2RCDA 3LTBA 1G96A 1TIJA 2GU1A 4ZM8A 1JB4A 3MSOA 5AYSC 3HI7A 2HMMB 3DZLA 1FGMA 3KZTA 5I97A 3T0UA 1JN5B 2CFGA 3SX1A 1W01A 3LOYA 3SOYA 3NV0A 4EYCA 1HU9A 1CQSA 4RBNA 2MC8A 2HMJB 1WTHA 5FW5A 2CFWA 2W56A 1RRHA 3MKIA 5IF6A 3U1WA 3QK9A 3ALAA 1LOXA 4XBTA 3DMCA 4HKVB 4U13A 1ULIB 3F40A 1W6GA 4R80A 2RFRA 1Q40B 1L5GB 1YIT3 3CCU3 2RGQA 1EQKA 3X3XA 4NHFA 2W04A 3LXUX 3CCV3 3H51A 4J8TA 5KP3A 3CPW2 4OUQA 4WYKA 3BLZA 1TP6A 2K54A 4KFEA 1DMNA 1UUWB 4BTYA 2M7OA 3I553 4K1VA 5AIFA 1D6ZA 3WDGB 2QA43 1AV4A 3NBRA 5DRVA 3LMLA 3DGNA 3EBTA 2L4VA 3ER7A 2P09A 1SIHA 4FCZA 1VZZA 3UL6A 2Z76A 3EE1A 3FCSB 4JF8A 3OX9A 1GS3A 2HMLB 2BHMA 4XDVA 5ELUA 2XR8B 3N8BA 4IPBA 3LTAA 1N8R4 1CEWI 1FUWA 3QRDA 2ML5A 3OWUA 4FR9A 2GEYA 2W9PA 2YFJB 3F8XA 3HX8A 4NREA 5AIGA 3KSED 2P38A 2XFTA 4HM2B 4CCVA 1GY5A 5IG3A 1YI23 3EQQB 3G4S3 1D6UA 4N6OB 1S5AA 2I9WA 3GAXA 1M9GA 3LT9A 2XH9A 3NX0A 2K0MA 1A2KA 2LYXA 3PXMA 1STDA 1UUVB 1LVNA 1DMMA 2INXA 2WGQA 3GZRA 1W2B2 5CXOA 2LQVA 3UB1A 1A90A 1AR0A 1BUQA 4FCMA 2CG0A 2YX9A 3CNMA 1D6YA 1IVVA 4JRFA 4EXRA 2FNQA 5A0OB 2W03A 1RN7A 2PZVA 3DGOA 3KSPA 4L7KA 1IT7A 4J9AA 5LC7A 3LYGA 1W02A 3VF1A 3MYTA 1KQS2 2E2UA 2OQEC 1DVCA 3NM7A 4HM3B 1IVXA 2CK3H 1NJI4 4X2HA 4KVHA 3G6E3 1CYUA 1K8A4 1EKMA 1W6YA 1QMAA 1DMQA 3GZYB 3KFQC 3OWYA 3E99A 3UL5A 3MPHA 3WA3A 1ASKA 2OQEA 4AEQA 2CFDA 1OPYA 1VQP3 3MHEA 2QIYA 1OCVA 1EA2A 4HM4B 5DREA 5IG0A 1TFKA 3CCR3 1W5ZA 3B4OA 5EEOA 2B1XB 2QEX3 2KCDA 1JB2A 1W6CA 1Z1SA 5AIHA 3TDGA 3CU3A 4HJLB 1ULJB 1JV2B 1SQWA 3STDA 2BMOB 1Y4KA 3JUNA 4HYZA 3M8CA 2GEXA 4FCJA 4MJDA 5D82A 1OF5A 8CHOA 1MOLA 2E2VA 3JVCA 4I4KA 2BT3A 3G0KA 1M904 4LZIA 5LC6A 2Z6BA 2CWUA 3V99A 1SJWA 1V74A 1VQ83 3ECFA 1DVDA 5STDA 2BMQB 5CK6A 3JUQA 3K0ZA 3U97A 3MWZA 3IJEB 1JB5A 4N6V0 1JRQA 3FF2A 3JUOA 4GL6A 1DYUA 1O7WB 1TU5A 5CF1A 4KFFA 3K7CA 2Y74A 1STFI 3FLJA 4N6LA 3NXJA 1K734 5IEOA 2FGTA 5BXQA 1Q864 4WWUC 1OHSA 3ROBA 1IU7A 1QVF2 2UX0A 2IUJA 2ML6A 3K9MC 1GY7A 3CMA3 1IT8A 3NV0B 6STDA 2PNCA 3NM2A 1QAFA 2F86B 1IQ8A 1OH0A 4XB5A 2W56B 4XBYA 1U8CB 4XM4A 2CG1A 4Q53A 4BTWA 2P05A 2FXTA 2CIUA 3G713 4IIAA 5IENA 3RDEA 1RJOA 1NWWA 3LH4A 1NB3I 1ZX2A 5FGOA 4MMZB 3SLUA 1Q40A 1FGOA 3HIIA 2XGLA 5AEUB 1IDPA 3OV4A 4OVMA 4GB5A 3DY5A 4RZMA 1TFOA 1VQM3 4FMDA 2Y73A 3UJMA 3CXC2 3NBBA 1YJN3 5IG4A 3EB8A 5ELJA 4WYKB 1E97A 3K5TA 2ZDJA 3LZAA 1LNHA 1TUHA 3HIGA 3HZPA 4LEHA 1VQ63 4HVNA 1IVUA 1VQ93 1YHQ3 1K41A 2YFIB 3I563 3GZXB 2XRXB 1WMPA 2CHCA 3F8HA 3LTCA 3CC43 3MG3A 2XF3A 3T8UA 3EN1B 1FGQA 3EJVA 2OCTA 3WA2X 5BVBA 4STDA 5AYRB 3BNBA 2CKFB 4FMBA 4LSOA 1W2ZA 3NQYA 1VQN3 4FMCA 4EV2A 2BO9B 4N3VA 4R1KA 3D3LA 3WOEB 1KWIA 3V98A 3SOAA 4HM1B 2CFLA 1A67A 3Q90A 3RGRA 1W7CA 4RNZA 2XGNA 2JDIH 1N9EA 4ORLA 2YFLB 3NUVA 1QALA 2KRTA 3PYJA 3CCL3 1YVBI 1UI7A 3X42A 2A15A 4AKYA 3B7CA 3JUMA 3J7Yd 5D81A 4HZ9B 1K28A 4RNYA 3G8ZA 3RGAA 1KC84 1IV9A 4XDWA 1W4NA 3N9HA 3MG1A 2GBWB 3CCJ3 1VQL3 3K63A 2C11A 3Q1CA 1GYBA 2W0QA 2Z7AA 1O7PB 1IQXA 4N6TA 3NHXA 4L8OA 1JKGA 3X41A 4HM8B 4HM5B 1RKYA 3A76A 3AMOA 3CC73 1AVLA 3WODG 3OW22 1FGRA 1IV7A 1QVG2 2BNGA 3EC9A 5IG5A 1VQ43 3S5CA 3BNEA 3PGBA 2XEPA 4HBRA 3NBJA 3FSDA 4R9LA 3X40A 3EN8A 4O2HA 4WHAA 3F7SA 1O7HB 4KFDA 3SVAA 2V1LA 1W00A 1WMNA 4LMIA 2QGUA 3CCQ3 1FGTA 2STDA 3VSYA 1GD3A 5IW9A 1N5PA 1EG9B 2IA7A 2IUKA 3CD63 2WOHA 3D9RA 3FKAA 4CDLA 5CF2A 1VQK3 4N6MA 1K9M4 3BNCA 1OUNA 1JN5A 4K61A 7STDA 1YJ93 1VQ53 3PZWA 2Z77A 4PEJA 1O7GB 5KP4A 3F9SA 3CCS3 3CPOA 1M1K4 4MMYB 2CH9A 1S723 1PU4A 1SPUA 1PFPA 1WQLB 4WFOA 4O3VA 4MMXB 3DUKA 3FH1A 3NQZA 5AEWB 4R9KA 3Q2PA 2GBXB 1OGXA 2P0XA 3F7XA 3LTDA 4OK0A 1YGEA 3S29A 3SEDA 3X3ZA 3LT8A 2ZL8A 5IEPA 4WP5A 2CC3A 3KKGA 5AIIA 2OTJ3 4LGQA 3DM8A 3IPTA 3FG1A 4MEIA 2W6JH 4QWTA 1YIJ3 1AVKA 3FGYA 3GZBA 3PCSA 3CC23 4G1MB 4O8SA 3CNXA 1E3RA 3B4PA 4N6UA 2SBLA 3KIIA 3DGMA 4HM7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UNL A;  3GWR A;  3EHC A;  3BB9 A;  3I0Y A;  3HK4 A;  2XSH B;  4H3U A;  1OGZ A;  5JPP A;  3KE7 A;  2BMR B;  1C7H A;  5AI1 A;  1QJG A;  4HM0 B;  5KP1 A;  1U5O A;  3JUP A;  2HMN B;  3F14 A;  5IER A;  2B24 B;  1OHO A;  3G16 A;  1O7M B;  3OWS A;  1GY6 A;  2W2C A;  1NDO B;  1NU3 A;  5JPU A;  5EVH A;  1ISK A;  3OXA A;  2JQ5 A;  3H3H A;  2HMK B;  4HM6 B;  3VGN A;  5HGR A;  1O7N B;  3EBY A;  1Q42 A;  3FZW A;  3EX9 A;  2GXF A;  5TGN A;  2F98 A;  5D83 A;  3FF0 A;  3T8N A;  1HKX A;  2HMO B;  3DXO A;  2IMJ A;  3MG2 A;  3EF8 A;  4K1U A;  3B8L A;  4X2O A;  1JKG B;  2R4I A;  1OHP A;  2F99 A;  3GRD A;  4XBX A;  4HZB B;  1OF5 B;  2XSO B;  2OWP A;  5G2G A;  5CLK A;  1ZO2 A;  1E3V A;  4L8P A;  3WMD A;  2RCD A;  1JB4 A;  3MSO A;  2HMM B;  3DZL A;  3KZT A;  1JN5 B;  1W01 A;  3SOY A;  3NV0 A;  1CQS A;  2HMJ B;  5FW5 A;  3MKI A;  5IF6 A;  4XBT A;  3DMC A;  4HKV B;  4U13 A;  1ULI B;  3F40 A;  2RFR A;  1Q40 B;  2RGQ A;  3H51 A;  4J8T A;  5KP3 A;  4OUQ A;  4WYK A;  3BLZ A;  1TP6 A;  2K54 A;  1DMN A;  1UUW B;  4K1V A;  5AIF A;  3NBR A;  5DRV A;  3EBT A;  3ER7 A;  1VZZ A;  2Z76 A;  3OX9 A;  1GS3 A;  2HML B;  4XDV A;  2XR8 B;  3OWU A;  2GEY A;  2YFJ B;  3F8X A;  3HX8 A;  5AIG A;  4HM2 B;  1GY5 A;  5IG3 A;  3EQQ B;  1S5A A;  2I9W A;  1A2K A;  1STD A;  1UUV B;  1DMM A;  2INX A;  3GZR A;  5CXO A;  1BUQ A;  1AR0 A;  4FCM A;  3CNM A;  2PZV A;  3KSP A;  4L7K A;  4J9A A;  3LYG A;  1W02 A;  3MYT A;  4HM3 B;  4X2H A;  4KVH A;  1W6Y A;  1QMA A;  3GZY B;  1DMQ A;  3OWY A;  3E99 A;  1ASK A;  1OPY A;  3MHE A;  2QIY A;  1OCV A;  1EA2 A;  4HM4 B;  5DRE A;  5IG0 A;  3B4O A;  2B1X B;  1JB2 A;  1Z1S A;  5AIH A;  3CU3 A;  4HJL B;  1ULJ B;  3STD A;  2BMO B;  3JUN A;  8CHO A;  4MJD A;  3M8C A;  2GEX A;  4FCJ A;  5D82 A;  1OF5 A;  4I4K A;  3G0K A;  1SJW A;  3ECF A;  5STD A;  2BMQ B;  5CK6 A;  3JUQ A;  3K0Z A;  1JB5 A;  3FF2 A;  3JUO A;  1O7W B;  5CF1 A;  3K7C A;  3FLJ A;  3NXJ A;  5IEO A;  5BXQ A;  4WWU C;  1OHS A;  3ROB A;  2UX0 A;  1GY7 A;  3NV0 B;  6STD A;  3NM2 A;  2F86 B;  1OH0 A;  4XB5 A;  4XBY A;  4XM4 A;  4Q53 A;  4IIA A;  5IEN A;  1NWW A;  1ZX2 A;  1Q40 A;  5AEU B;  1IDP A;  3OV4 A;  4OVM A;  4GB5 A;  4RZM A;  3UJM A;  5IG4 A;  4WYK B;  1E97 A;  3LZA A;  1TUH A;  3HZP A;  4LEH A;  4HVN A;  1K41 A;  2YFI B;  3GZX B;  2XRX B;  2CHC A;  3F8H A;  3MG3 A;  3T8U A;  3EN1 B;  3EJV A;  5BVB A;  4STD A;  2CKF B;  4N3V A;  4R1K A;  3SOA A;  4HM1 B;  3Q90 A;  3RGR A;  4ORL A;  2YFL B;  3NUV A;  2A15 A;  3B7C A;  3JUM A;  5D81 A;  4HZ9 B;  3RGA A;  3G8Z A;  4XDW A;  3MG1 A;  2GBW B;  1GYB A;  2Z7A A;  1O7P B;  3NHX A;  4L8O A;  1JKG A;  4HM8 B;  4HM5 B;  3A76 A;  2BNG A;  3EC9 A;  5IG5 A;  3S5C A;  3FSD A;  4R9L A;  3EN8 A;  3F7S A;  1O7H B;  1W00 A;  4LMI A;  2QGU A;  2STD A;  3VSY A;  1EG9 B;  3D9R A;  3FKA A;  4CDL A;  5CF2 A;  1OUN A;  1JN5 A;  7STD A;  2Z77 A;  4PEJ A;  1O7G B;  5KP4 A;  3F9S A;  3CPO A;  1WQL B;  3DUK A;  3FH1 A;  5AEW B;  4R9K A;  2GBX B;  1OGX A;  3F7X A;  3SED A;  5IEP A;  4WP5 A;  3KKG A;  5AII A;  4LGQ A;  3DM8 A;  3IPT A;  3FGY A;  3GZB A;  3CNX A;  1E3R A;  3B4P A;  4HM7 B; 
#chains in the Genus database with same CATH topology
 3UNL A;  2CX1 A;  2L1S A;  2KF6 A;  3GWR A;  4EV5 A;  3PCR A;  1VQ7 3;  3EHC A;  1N5H A;  4GSP A;  5JBS A;  4R4K A;  3BB9 A;  1ZGX A;  2OTL 3;  3I0Y A;  5IEN A;  4IT7 A;  1IQY A;  1BSC A;  3HK4 A;  3DGL A;  1LQG C;  2HOH A;  2XSH B;  1X1W A;  1YGW A;  4H3U A;  1FUS A;  1OGZ A;  5JPP A;  3CME 3;  1I0X A;  2GU3 A;  4TX4 A;  1NO3 A;  1T5Y A;  3KE7 A;  1KSI A;  3V92 A;  2BMR B;  1C7H A;  5AI1 A;  1QJG A;  3WOF B;  1A2V A;  2O3O A;  3N54 B;  4K90 B;  3WHO A;  4BTX A;  4EW5 A;  1VQO 3;  1IK3 A;  1JJ2 2;  4HM0 B;  1FA3 A;  3CCM 3;  5G1L A;  1N9J A;  1UW1 A;  1N8Q A;  2XFS A;  4FMA A;  1RN1 A;  5KP1 A;  1QAK A;  1R4C A;  1U5O A;  4O02 B;  3JUP A;  1CYV A;  1FUT A;  4EC6 A;  1LOY A;  1BRN L;  1OAC A;  1F8N A;  1SII A;  3S67 A;  2H0G A;  2HMN B;  4NPB A;  3F14 A;  2C10 A;  5IER A;  1GD4 A;  2B24 B;  1OHO A;  3G16 A;  5M18 A;  2OOV C;  4EBG A;  1O7M B;  3OWS A;  3FG4 A;  1Q7Y 4;  3L0R A;  1GY6 A;  2W2C A;  1NDO B;  1TTO A;  4N6N B;  2Q07 A;  1MWR A;  1IVW A;  1NU3 A;  1YJW 3;  5JPU A;  1GSP A;  5EVH A;  1ISK A;  1BRG A;  2O9U X;  3OXA A;  3PS8 A;  2OOV A;  1JNQ A;  2JQ5 A;  3H3H A;  2HMK B;  1NB5 I;  4HM6 B;  3VGN A;  4AKZ A;  2KXG A;  5HGR A;  1M1X B;  1O7N B;  2BU4 A;  3X3Y A;  1Q82 4;  3IMA B;  2CW9 A;  2CWT A;  1Q42 A;  3EBY A;  3EX9 A;  2GXF A;  3FZW A;  5G1K A;  5TGN A;  1WMO A;  3S27 A;  2CWV A;  3CCE 3;  4KT3 B;  2F98 A;  1LXE A;  5D83 A;  2IYJ A;  3BND A;  2C4B A;  3FF0 A;  3T8N A;  1RGL A;  1HKX A;  3O8Y A;  2HMO B;  1Q81 4;  1KD1 4;  3DXO A;  2WO0 A;  2ZHX B;  2UGI A;  2IMJ A;  3MG2 A;  1ROV A;  2WGO A;  3FG3 A;  3EF8 A;  2E2T A;  1US1 A;  4K1U A;  1GMP A;  3B8L A;  4X2O A;  1JKG B;  2CFK A;  2WOF A;  1UCJ A;  2P0M A;  1EEJ A;  3AMO B;  2R4I A;  1BAO A;  2RSX A;  1BU4 A;  1BSE A;  1OHP A;  2F99 A;  3GRD A;  5M1A A;  4XBX A;  2KF3 A;  4HZB B;  1GOV A;  4H61 A;  2D42 A;  1UI8 A;  2D1W A;  1OF5 B;  1ROA A;  1WNH A;  2AAE A;  2XSO B;  2OWP A;  2F4Y A;  5G2G A;  5CLK A;  1RRL A;  1MNL A;  2W9Q A;  5EQL A;  1ZO2 A;  1UCK A;  2CX0 A;  3S28 A;  2MF7 A;  1E3V A;  4L8P A;  3WMD A;  3SXX A;  1J2B A;  1RGA A;  4KZ1 A;  3KN4 A;  4BL3 A;  2RCD A;  1BSB A;  3LTB A;  1T2I A;  1I70 A;  1G96 A;  1RCL A;  1TIJ A;  2GU1 A;  1JB4 A;  4ZM8 A;  3MSO A;  1JBS A;  1RTU A;  1UGH I;  3HI7 A;  2HMM B;  3DZL A;  1FGM A;  3KZT A;  5AYS C;  3T0U A;  6RNT A;  1JN5 B;  2CFG A;  4HOH A;  5I97 A;  3SX1 A;  1W01 A;  3LOY A;  3SOY A;  3NV0 A;  4EYC A;  1HU9 A;  1CQS A;  4RBN A;  2MC8 A;  1GOY A;  2HMJ B;  1WTH A;  5FW5 A;  2CFW A;  2W56 A;  4BU4 A;  1RRH A;  3MKI A;  3D5I A;  5IF6 A;  1C54 A;  3U1W A;  3QK9 A;  3ALA A;  1LOX A;  1VQQ A;  4XBT A;  1JZO A;  3DMC A;  4HKV B;  4U13 A;  1ULI B;  1V58 A;  3F40 A;  1W6G A;  4R80 A;  2RFR A;  1B2Z A;  1Q40 B;  1L5G B;  1YIT 3;  3CCU 3;  2RGQ A;  1EQK A;  3X3X A;  4NHF A;  2R41 A;  2W04 A;  3LXU X;  3SYU A;  3CCV 3;  3H51 A;  4J8T A;  5KP3 A;  2H0H A;  3CPW 2;  4OUQ A;  1A2P A;  1RGF A;  3BIR A;  4J5G A;  4WYK A;  1MWS A;  3BLZ A;  1YVS A;  1TP6 A;  2K54 A;  2KF4 A;  1DMN A;  4KFE A;  1UUW B;  1UCI A;  4BTY A;  2M7O A;  3I55 3;  4K1V A;  5AIF A;  1D6Z A;  3WDG B;  2QA4 3;  1AV4 A;  1BNR A;  3NBR A;  5DRV A;  3LML A;  3DGN A;  3EBT A;  2IY2 A;  1RGH A;  2K3D A;  2L4V A;  3ER7 A;  2P09 A;  1SIH A;  2UUG C;  4DKI A;  4FCZ A;  1VZZ A;  3UL6 A;  1RLS A;  2Z76 A;  1HYF A;  3EE1 A;  3FCS B;  4JF8 A;  3OX9 A;  1GS3 A;  2HML B;  2BHM A;  4XDV A;  5ELU A;  2XR8 B;  3N8B A;  4IPB A;  3LTA A;  1N8R 4;  1CEW I;  1UUG B;  1FUW A;  1FZU A;  2ML5 A;  3OWU A;  3QRD A;  4FR9 A;  2GEY A;  1TRP A;  2W9P A;  2YFJ B;  3F8X A;  3HX8 A;  4NRE A;  5AIG A;  4CPK A;  3KSE D;  2P38 A;  2XFT A;  4HM2 B;  1B2X A;  4CCV A;  1B3S A;  1JBR A;  1GY5 A;  5IG3 A;  3HOH A;  3EQQ B;  3G4S 3;  1YI2 3;  1IYY A;  1G02 A;  8RNT A;  1D6U A;  4N6O B;  1RGK A;  1B2S A;  1S5A A;  2I9W A;  3GAX A;  1M9G A;  3LT9 A;  2XH9 A;  1RCK A;  3BU4 A;  3NX0 A;  2K0M A;  1A2K A;  2LYX A;  3PXM A;  1STD A;  1UUV B;  1LVN A;  1DMM A;  2INX A;  2WGQ A;  3GZR A;  1W2B 2;  5CXO A;  2LQV A;  3UB1 A;  1A90 A;  1AR0 A;  1BUQ A;  4ILF A;  4FCM A;  2CG0 A;  2YX9 A;  3CNM A;  1D6Y A;  1IVV A;  4JRF A;  4EXR A;  2FNQ A;  5A0O B;  1Q7H A;  1RN7 A;  2PZV A;  2W03 A;  3DGO A;  1RNB A;  1BVI A;  3KSP A;  4L7K A;  1IT7 A;  4J9A A;  4J5K A;  5LC7 A;  3LYG A;  1W02 A;  1TJD A;  3MYT A;  3VF1 A;  3WR2 A;  1KQS 2;  2E2U A;  2OQE C;  1DVC A;  3NM7 A;  4HM3 B;  1IVX A;  2CK3 H;  1T3B A;  1NJI 4;  3ZG0 A;  4X2H A;  4KVH A;  1RGE A;  3G6E 3;  1CYU A;  1K8A 4;  1EKM A;  1W6Y A;  1QMA A;  1DMQ A;  3GZY B;  1RHL A;  3KFQ C;  3OWY A;  3E99 A;  4I5Q A;  3UL5 A;  3MPH A;  3WA3 A;  1ASK A;  2OQE A;  4AEQ A;  2CFD A;  1DET A;  1OPY A;  3MHE A;  1VQP 3;  1BRI A;  1OCV A;  1EA2 A;  1V57 A;  2QIY A;  4HM4 B;  5DRE A;  5IG0 A;  1TFK A;  3CCR 3;  1W5Z A;  3B4O A;  5EEO A;  2B1X B;  7RNT A;  2QEX 3;  2KCD A;  1JB2 A;  1W6C A;  1Z1S A;  5AIH A;  3TDG A;  1I2F A;  3CU3 A;  3GSP A;  4HJL B;  1ULJ B;  1JV2 B;  1SQW A;  3STD A;  2BMO B;  5HOH A;  1Y4K A;  3JUN A;  4HYZ A;  3M8C A;  2GEX A;  4FCJ A;  1NNV A;  4MJD A;  1OF5 A;  5D82 A;  1MOL A;  2E2V A;  1R4Y A;  3JVC A;  4I4K A;  4RNT A;  2BT3 A;  3G0K A;  1M90 4;  4LZI A;  5LC6 A;  2Z6B A;  4LYL B;  1SAR A;  2CWU A;  1LNI A;  1B2U A;  3V99 A;  1SJW A;  1V74 A;  1VQ8 3;  3ECF A;  1Q9E A;  1DVD A;  5STD A;  2BMQ B;  5CK6 A;  1YNV X;  3JUQ A;  3K0Z A;  3U97 A;  3MWZ A;  3IJE B;  1JB5 A;  4BIR A;  4N6V 0;  1JRQ A;  2SAR A;  3FF2 A;  3JUO A;  4GL6 A;  1DYU A;  1O7W B;  1RSN A;  1TU5 A;  5CF1 A;  2F5W A;  4KFF A;  3K7C A;  1LQM B;  1STF I;  2Y74 A;  3FLJ A;  4N6L A;  3NXJ A;  1DE3 A;  1K73 4;  5IEO A;  1B27 A;  8CHO A;  5BU4 A;  2J8X B;  2FGT A;  5BXQ A;  1I0V A;  1Q86 4;  4WWU C;  1OHS A;  3ROB A;  1IU7 A;  1QVF 2;  2UX0 A;  1I3I A;  2IUJ A;  2ML6 A;  1BIR A;  3K9M C;  1GY7 A;  1BRS A;  3CMA 3;  1IT8 A;  3NV0 B;  6STD A;  2PNC A;  3NM2 A;  1QAF A;  2F86 B;  1IQ8 A;  1OH0 A;  1RDS A;  4XB5 A;  2W56 B;  4XBY A;  1U8C B;  4XM4 A;  2CG1 A;  4Q53 A;  4BTW A;  2P05 A;  2FXT A;  1GMQ A;  2CIU A;  2RNT A;  4IIA A;  3G71 3;  1BAN A;  3RDE A;  1RJO A;  1NWW A;  3KCH A;  1NB3 I;  1ZX2 A;  3LH4 A;  5FGO A;  4MMZ B;  3SLU A;  1Q40 A;  1FGO A;  5M19 A;  2RBI A;  3HII A;  1BUJ A;  2XGL A;  5AEU B;  1IDP A;  3OV4 A;  1BGS A;  4OVM A;  4GB5 A;  3DY5 A;  4RZM A;  3D79 A;  3DGY A;  1TFO A;  1VQM 3;  4FMD A;  2Y73 A;  3UJM A;  3CXC 2;  3NBB A;  1YJN 3;  1LRA A;  5IG4 A;  1BRH A;  3EB8 A;  2F56 A;  5ELJ A;  4WYK B;  1BSA A;  3AGN A;  1E97 A;  3K5T A;  1BSD A;  2ZDJ A;  1PY3 A;  3LZA A;  1BNS A;  1RN4 A;  1RGC A;  1LNH A;  3Q3F A;  1TUH A;  1I3F A;  3HIG A;  3HZP A;  4LEH A;  1JZD A;  1VQ6 3;  1T2H A;  1LOW A;  4HVN A;  1IVU A;  1VQ9 3;  1YHQ 3;  1I2E A;  1AQZ A;  1K41 A;  2YFI B;  3I56 3;  3GZX B;  4GHO A;  4BL2 A;  1WMP A;  2XRX B;  2CHC A;  3F8H A;  2AAD A;  3LTC A;  3CC4 3;  3MG3 A;  1AY7 A;  1B21 A;  1BNF A;  2XF3 A;  3T8U A;  3EN1 B;  1FGQ A;  3EJV A;  2OCT A;  3WA2 X;  5BVB A;  4STD A;  5AYR B;  1BNJ A;  3BNB A;  1BNI A;  2CKF B;  4FMB A;  2KAA A;  4LSO A;  1W2Z A;  3NQY A;  1VQN 3;  4FMC A;  4EV2 A;  2BO9 B;  4N3V A;  1LOV A;  3D3L A;  4R1K A;  3WOE B;  1KWI A;  3V98 A;  1GMR A;  3SOA A;  4HM1 B;  2CFL A;  5RNT A;  1A67 A;  3Q90 A;  3RGR A;  1W7C A;  4RNZ A;  2XGN A;  2JDI H;  1N9E A;  1BNG A;  4ORL A;  1UCL A;  2YFL B;  3D5G A;  1QAL A;  2KRT A;  3NUV A;  3PYJ A;  1EUI C;  1I2G A;  2H0I A;  3CCL 3;  1CH0 A;  1MWT A;  1YVB I;  1UI7 A;  1HZ1 A;  2A15 A;  2ZA4 A;  3X42 A;  3B7C A;  4AKY A;  3JUM A;  3ZFZ A;  3J7Y d;  5D81 A;  5GSP A;  4HZ9 B;  1K28 A;  1PYL A;  3G8Z A;  4RNY A;  3RGA A;  1KC8 4;  1IV9 A;  4XDW A;  1W4N A;  3N9H A;  1X1X A;  1X1Y A;  2GBW B;  3MG1 A;  3URP A;  1BRK A;  3K63 A;  2C11 A;  3CCJ 3;  1VQL 3;  3Q1C A;  2F5M A;  4HAA A;  1GYB A;  2W0Q A;  2Z7A A;  1O7P B;  1IQX A;  4CJN A;  4N6T A;  1JBT A;  3NHX A;  4L8O A;  1JKG A;  3X41 A;  4HM8 B;  4HM5 B;  1RKY A;  3A76 A;  3AHS A;  3AMO A;  3CC7 3;  1AVL A;  3A5E A;  3WOD G;  3OW2 2;  1UGI A;  1FGR A;  1IV7 A;  3D4A A;  3RNT A;  1QVG 2;  2BNG A;  1MGW A;  3EC9 A;  5IG5 A;  1RGG A;  1RNT A;  1BRJ A;  9RNT A;  1VQ4 3;  3AGO A;  3BNE A;  1B20 A;  3PGB A;  3S5C A;  3ZG5 A;  1UDI I;  2XEP A;  4HBR A;  3NBJ A;  3FSD A;  4R9L A;  1ZS7 A;  1GOU A;  3X40 A;  3EN8 A;  4O2H A;  4WHA A;  3F7S A;  1O7H B;  4KFD A;  3SVA A;  2V1L A;  1W00 A;  1FW7 A;  1FYS A;  1WMN A;  2QGU A;  4LMI A;  3CCQ 3;  1FGT A;  2STD A;  3VSY A;  1GD3 A;  5IW9 A;  1N5P A;  2GSP A;  1EG9 B;  2BIR A;  1TRQ A;  2IA7 A;  2IUK A;  3CD6 3;  2WOH A;  3D9R A;  3FKA A;  4CDL A;  5CF2 A;  1VQK 3;  4N6M A;  1K9M 4;  3BNC A;  1OUN A;  1X1U A;  1JN5 A;  4K61 A;  7GSP A;  7STD A;  1YJ9 3;  1VQ5 3;  1I8V A;  3PZW A;  2Z77 A;  4PEJ A;  1O7G B;  5KP4 A;  1BOX A;  3F9S A;  1MWU A;  3CCS 3;  3CPO A;  1M1K 4;  4MMY B;  2CH9 A;  1S72 3;  1PU4 A;  1SPU A;  1PFP A;  1G0T A;  1WQL B;  4WFO A;  4O3V A;  4MMX B;  3DUK A;  3FH1 A;  3NQZ A;  5BIR A;  5AEW B;  4R9K A;  3Q2P A;  2KF5 A;  3DH2 A;  2GBX B;  1MGR A;  1OGX A;  1RMS A;  2P0X A;  3F7X A;  3LTD A;  4OK0 A;  1YGE A;  3S29 A;  3SED A;  3X3Z A;  3LT8 A;  2ZL8 A;  5IEP A;  4WP5 A;  2CC3 A;  3KKG A;  5AII A;  2OTJ 3;  4LGQ A;  3DM8 A;  3IPT A;  3FG1 A;  4MEI A;  2W6J H;  4QWT A;  1YIJ 3;  1AVK A;  1BNE A;  3FGY A;  3GZB A;  3PCS A;  3CC2 3;  4G1M B;  4O8S A;  3CNX A;  1E3R A;  3B4P A;  6GSP A;  4N6U A;  2SBL A;  1B2M A;  3KII A;  3AHW A;  3DGM A;  4HM7 B; 
#chains in the Genus database with same CATH homology
 3UNL A;  3GWR A;  4EV5 A;  3PCR A;  1VQ7 3;  3EHC A;  1N5H A;  5JBS A;  4R4K A;  3BB9 A;  2OTL 3;  3I0Y A;  4IT7 A;  1IQY A;  3HK4 A;  3DGL A;  2XSH B;  4H3U A;  1OGZ A;  5JPP A;  3CME 3;  2GU3 A;  4TX4 A;  1NO3 A;  1T5Y A;  3KE7 A;  1KSI A;  3V92 A;  2BMR B;  1C7H A;  5AI1 A;  1QJG A;  3WOF B;  1A2V A;  2O3O A;  3N54 B;  4K90 B;  4BTX A;  1VQO 3;  1IK3 A;  1JJ2 2;  4HM0 B;  1FA3 A;  3CCM 3;  1N9J A;  1UW1 A;  1N8Q A;  2XFS A;  4FMA A;  5KP1 A;  1QAK A;  1R4C A;  1U5O A;  4O02 B;  3JUP A;  1CYV A;  4EC6 A;  1OAC A;  1F8N A;  1SII A;  3S67 A;  2HMN B;  3F14 A;  2C10 A;  5IER A;  1GD4 A;  2B24 B;  1OHO A;  3G16 A;  2OOV C;  4EBG A;  1O7M B;  3OWS A;  3FG4 A;  1Q7Y 4;  3L0R A;  1GY6 A;  2W2C A;  1NDO B;  4N6N B;  2Q07 A;  1IVW A;  1NU3 A;  1YJW 3;  5JPU A;  5EVH A;  1ISK A;  2O9U X;  3OXA A;  3PS8 A;  2OOV A;  1JNQ A;  2JQ5 A;  3H3H A;  2HMK B;  1NB5 I;  4HM6 B;  3VGN A;  4AKZ A;  2KXG A;  5HGR A;  1M1X B;  1O7N B;  3X3Y A;  1Q82 4;  3IMA B;  2CW9 A;  2CWT A;  1Q42 A;  3EBY A;  3EX9 A;  2GXF A;  3FZW A;  5TGN A;  1WMO A;  3S27 A;  2CWV A;  3CCE 3;  2F98 A;  1LXE A;  5D83 A;  3BND A;  3FF0 A;  3T8N A;  1HKX A;  3O8Y A;  2HMO B;  1Q81 4;  1KD1 4;  3DXO A;  2WO0 A;  2IMJ A;  3MG2 A;  1ROV A;  2WGO A;  3FG3 A;  3EF8 A;  2E2T A;  1US1 A;  4K1U A;  3B8L A;  4X2O A;  1JKG B;  2CFK A;  2WOF A;  2P0M A;  3AMO B;  2R4I A;  2RSX A;  1OHP A;  2F99 A;  3GRD A;  4XBX A;  4HZB B;  4H61 A;  2D42 A;  1UI8 A;  2D1W A;  1OF5 B;  2XSO B;  1ROA A;  1WNH A;  2OWP A;  5G2G A;  5CLK A;  1RRL A;  1MNL A;  2W9Q A;  5EQL A;  1ZO2 A;  3S28 A;  2MF7 A;  1E3V A;  4L8P A;  3WMD A;  3SXX A;  1J2B A;  4KZ1 A;  3KN4 A;  2RCD A;  3LTB A;  1G96 A;  1TIJ A;  2GU1 A;  4ZM8 A;  1JB4 A;  3MSO A;  5AYS C;  3HI7 A;  2HMM B;  3DZL A;  1FGM A;  3KZT A;  5I97 A;  3T0U A;  1JN5 B;  2CFG A;  3SX1 A;  1W01 A;  3LOY A;  3SOY A;  3NV0 A;  4EYC A;  1HU9 A;  1CQS A;  4RBN A;  2MC8 A;  2HMJ B;  1WTH A;  5FW5 A;  2CFW A;  2W56 A;  1RRH A;  3MKI A;  5IF6 A;  3U1W A;  3QK9 A;  3ALA A;  1LOX A;  4XBT A;  3DMC A;  4HKV B;  4U13 A;  1ULI B;  3F40 A;  1W6G A;  4R80 A;  2RFR A;  1Q40 B;  1L5G B;  1YIT 3;  3CCU 3;  2RGQ A;  1EQK A;  3X3X A;  4NHF A;  2W04 A;  3LXU X;  3CCV 3;  3H51 A;  4J8T A;  5KP3 A;  3CPW 2;  4OUQ A;  4WYK A;  3BLZ A;  1TP6 A;  2K54 A;  4KFE A;  1DMN A;  1UUW B;  4BTY A;  2M7O A;  3I55 3;  4K1V A;  5AIF A;  1D6Z A;  3WDG B;  2QA4 3;  1AV4 A;  3NBR A;  5DRV A;  3LML A;  3DGN A;  3EBT A;  2L4V A;  3ER7 A;  2P09 A;  1SIH A;  4FCZ A;  1VZZ A;  3UL6 A;  2Z76 A;  3EE1 A;  3FCS B;  4JF8 A;  3OX9 A;  1GS3 A;  2HML B;  2BHM A;  4XDV A;  5ELU A;  2XR8 B;  3N8B A;  4IPB A;  3LTA A;  1N8R 4;  1CEW I;  1FUW A;  3QRD A;  2ML5 A;  3OWU A;  4FR9 A;  2GEY A;  2W9P A;  2YFJ B;  3F8X A;  3HX8 A;  4NRE A;  5AIG A;  3KSE D;  2P38 A;  2XFT A;  4HM2 B;  4CCV A;  1GY5 A;  5IG3 A;  1YI2 3;  3EQQ B;  3G4S 3;  1D6U A;  4N6O B;  1S5A A;  2I9W A;  3GAX A;  1M9G A;  3LT9 A;  2XH9 A;  3NX0 A;  2K0M A;  1A2K A;  2LYX A;  3PXM A;  1STD A;  1UUV B;  1LVN A;  1DMM A;  2INX A;  2WGQ A;  3GZR A;  1W2B 2;  5CXO A;  2LQV A;  3UB1 A;  1A90 A;  1AR0 A;  1BUQ A;  4FCM A;  2CG0 A;  2YX9 A;  3CNM A;  1D6Y A;  1IVV A;  4JRF A;  4EXR A;  2FNQ A;  5A0O B;  2W03 A;  1RN7 A;  2PZV A;  3DGO A;  3KSP A;  4L7K A;  1IT7 A;  4J9A A;  5LC7 A;  3LYG A;  1W02 A;  3VF1 A;  3MYT A;  1KQS 2;  2E2U A;  2OQE C;  1DVC A;  3NM7 A;  4HM3 B;  1IVX A;  2CK3 H;  1NJI 4;  4X2H A;  4KVH A;  3G6E 3;  1CYU A;  1K8A 4;  1EKM A;  1W6Y A;  1QMA A;  1DMQ A;  3GZY B;  3KFQ C;  3OWY A;  3E99 A;  3UL5 A;  3MPH A;  3WA3 A;  1ASK A;  2OQE A;  4AEQ A;  2CFD A;  1OPY A;  1VQP 3;  3MHE A;  2QIY A;  1OCV A;  1EA2 A;  4HM4 B;  5DRE A;  5IG0 A;  1TFK A;  3CCR 3;  1W5Z A;  3B4O A;  5EEO A;  2B1X B;  2QEX 3;  2KCD A;  1JB2 A;  1W6C A;  1Z1S A;  5AIH A;  3TDG A;  3CU3 A;  4HJL B;  1ULJ B;  1JV2 B;  1SQW A;  3STD A;  2BMO B;  1Y4K A;  3JUN A;  4HYZ A;  3M8C A;  2GEX A;  4FCJ A;  4MJD A;  5D82 A;  1OF5 A;  8CHO A;  1MOL A;  2E2V A;  3JVC A;  4I4K A;  2BT3 A;  3G0K A;  1M90 4;  4LZI A;  5LC6 A;  2Z6B A;  2CWU A;  3V99 A;  1SJW A;  1V74 A;  1VQ8 3;  3ECF A;  1DVD A;  5STD A;  2BMQ B;  5CK6 A;  3JUQ A;  3K0Z A;  3U97 A;  3MWZ A;  3IJE B;  1JB5 A;  4N6V 0;  1JRQ A;  3FF2 A;  3JUO A;  4GL6 A;  1DYU A;  1O7W B;  1TU5 A;  5CF1 A;  4KFF A;  3K7C A;  2Y74 A;  1STF I;  3FLJ A;  4N6L A;  3NXJ A;  1K73 4;  5IEO A;  2FGT A;  5BXQ A;  1Q86 4;  4WWU C;  1OHS A;  3ROB A;  1IU7 A;  1QVF 2;  2UX0 A;  2IUJ A;  2ML6 A;  3K9M C;  1GY7 A;  3CMA 3;  1IT8 A;  3NV0 B;  6STD A;  2PNC A;  3NM2 A;  1QAF A;  2F86 B;  1IQ8 A;  1OH0 A;  4XB5 A;  2W56 B;  4XBY A;  1U8C B;  4XM4 A;  2CG1 A;  4Q53 A;  4BTW A;  2P05 A;  2FXT A;  2CIU A;  3G71 3;  4IIA A;  5IEN A;  3RDE A;  1RJO A;  1NWW A;  3LH4 A;  1NB3 I;  1ZX2 A;  5FGO A;  4MMZ B;  3SLU A;  1Q40 A;  1FGO A;  3HII A;  2XGL A;  5AEU B;  1IDP A;  3OV4 A;  4OVM A;  4GB5 A;  3DY5 A;  4RZM A;  1TFO A;  1VQM 3;  4FMD A;  2Y73 A;  3UJM A;  3CXC 2;  3NBB A;  1YJN 3;  5IG4 A;  3EB8 A;  5ELJ A;  4WYK B;  1E97 A;  3K5T A;  2ZDJ A;  3LZA A;  1LNH A;  1TUH A;  3HIG A;  3HZP A;  4LEH A;  1VQ6 3;  4HVN A;  1IVU A;  1VQ9 3;  1YHQ 3;  1K41 A;  2YFI B;  3I56 3;  3GZX B;  2XRX B;  1WMP A;  2CHC A;  3F8H A;  3LTC A;  3CC4 3;  3MG3 A;  2XF3 A;  3T8U A;  3EN1 B;  1FGQ A;  3EJV A;  2OCT A;  3WA2 X;  5BVB A;  4STD A;  5AYR B;  3BNB A;  2CKF B;  4FMB A;  4LSO A;  1W2Z A;  3NQY A;  1VQN 3;  4FMC A;  4EV2 A;  2BO9 B;  4N3V A;  4R1K A;  3D3L A;  3WOE B;  1KWI A;  3V98 A;  3SOA A;  4HM1 B;  2CFL A;  1A67 A;  3Q90 A;  3RGR A;  1W7C A;  4RNZ A;  2XGN A;  2JDI H;  1N9E A;  4ORL A;  2YFL B;  3NUV A;  1QAL A;  2KRT A;  3PYJ A;  3CCL 3;  1YVB I;  1UI7 A;  3X42 A;  2A15 A;  4AKY A;  3B7C A;  3JUM A;  3J7Y d;  5D81 A;  4HZ9 B;  1K28 A;  4RNY A;  3G8Z A;  3RGA A;  1KC8 4;  1IV9 A;  4XDW A;  1W4N A;  3N9H A;  3MG1 A;  2GBW B;  3CCJ 3;  1VQL 3;  3K63 A;  2C11 A;  3Q1C A;  1GYB A;  2W0Q A;  2Z7A A;  1O7P B;  1IQX A;  4N6T A;  3NHX A;  4L8O A;  1JKG A;  3X41 A;  4HM8 B;  4HM5 B;  1RKY A;  3A76 A;  3AMO A;  3CC7 3;  1AVL A;  3WOD G;  3OW2 2;  1FGR A;  1IV7 A;  1QVG 2;  2BNG A;  3EC9 A;  5IG5 A;  1VQ4 3;  3S5C A;  3BNE A;  3PGB A;  2XEP A;  4HBR A;  3NBJ A;  3FSD A;  4R9L A;  3X40 A;  3EN8 A;  4O2H A;  4WHA A;  3F7S A;  1O7H B;  4KFD A;  3SVA A;  2V1L A;  1W00 A;  1WMN A;  4LMI A;  2QGU A;  3CCQ 3;  1FGT A;  2STD A;  3VSY A;  1GD3 A;  5IW9 A;  1N5P A;  1EG9 B;  2IA7 A;  2IUK A;  3CD6 3;  2WOH A;  3D9R A;  3FKA A;  4CDL A;  5CF2 A;  1VQK 3;  4N6M A;  1K9M 4;  3BNC A;  1OUN A;  1JN5 A;  4K61 A;  7STD A;  1YJ9 3;  1VQ5 3;  3PZW A;  2Z77 A;  4PEJ A;  1O7G B;  5KP4 A;  3F9S A;  3CCS 3;  3CPO A;  1M1K 4;  4MMY B;  2CH9 A;  1S72 3;  1PU4 A;  1SPU A;  1PFP A;  1WQL B;  4WFO A;  4O3V A;  4MMX B;  3DUK A;  3FH1 A;  3NQZ A;  5AEW B;  4R9K A;  3Q2P A;  2GBX B;  1OGX A;  2P0X A;  3F7X A;  3LTD A;  4OK0 A;  1YGE A;  3S29 A;  3SED A;  3X3Z A;  3LT8 A;  2ZL8 A;  5IEP A;  4WP5 A;  2CC3 A;  3KKG A;  5AII A;  2OTJ 3;  4LGQ A;  3DM8 A;  3IPT A;  3FG1 A;  4MEI A;  2W6J H;  4QWT A;  1YIJ 3;  1AVK A;  3FGY A;  3GZB A;  3PCS A;  3CC2 3;  4G1M B;  4O8S A;  3CNX A;  1E3R A;  3B4P A;  4N6U A;  2SBL A;  3KII A;  3DGM A;  4HM7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...