3PYJA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pyjA00
1MOLA 5ELJA 4N6LA 1YVBI 1A67A 4N6MA 3SVAA 1NB3I 1R4CA 1RN7A 3L0RA 3QRDA 4N6UA 3PS8A 5A0OB 4LZIA 3NX0A 5EQLA 2W9PA 4N6TA 3GAXA 3K9MC 1GD3A 1EQKA 3Q2PA 1DVDA 4TX4A 3UL6A 1FUWA 5LC7A 1NB5I 3PYJA 1G96A 1ROAA 3LH4A 4IT7A 1A90A 1GD4A 1N9JA 4N6V0 5LC6A 1CEWI 4CCVA 1DVCA 2OCTA 4EYCA 3KFQC 3KSED 1MNLA 4ZM8A 1M9GA 4N6NB 2W9QA 1IV9A 3IMAB 2BO9B 3S67A 1N5HA 1KWIA 1WNHA 2O9UX 3PXMA 1CYVA 1TIJA 3UL5A 1CYUA 3MWZA 1LXEA 1PFPA 1IV7A 2CH9A 1STFI 1N5PA 4N6OB 5ELUA 1FA3A 2KXGA
chains in the Genus database with same CATH superfamily
2B24B 2CHCA 4WYKA 4J5GA 5ELJA 1IQYA 1BNJA 3AHSA 3FKAA 1GS3A 1E3VA 2F5WA 2OWPA 3UB1A 1YJW3 3DZLA 2I9WA 4BTXA 3EQQB 1EA2A 1HYFA 1PY3A 2C4BA 3LMLA 1N8R4 1OHSA 1OCVA 3UJMA 5JPPA 5KP4A 3CNXA 4NHFA 4MEIA 1S723 1N9EA 3OWSA 2BNGA 3KE7A 4J8TA 1LRAA 5IF6A 3PZWA 1CH0A 5M18A 1VQ63 1RN7A 1EKMA 3X42A 4EV5A 3CPOA 4XBYA 2OQEA 2XRXB 2XEPA 5I97A 1C7HA 1ISKA 1G02A 2F5MA 4LZIA 1JV2B 1US1A 3B4OA 3HIGA 3T8NA 3FGYA 1I2FA 2KXGA 4ILFA 1WMNA 2KCDA 4FCJA 1K734 3LOYA 1RCLA 1AQZA 3K9MC 2C11A 2HMJB 3X3ZA 1JKGA 4XB5A 2H0IA 2XF3A 1PYLA 1MWTA 3BIRA 1HU9A 2KF3A 1JZOA 4R9LA 3S27A 1RHLA 1RRHA 3CCQ3 4WP5A 1ULJB 2UX0A 1ULIB 3DGNA 3ROBA 3T0UA 1EG9B 2SARA 1M904 3VGNA 4HM5B 4HZBB 1OACA 3K63A 4O8SA 4L8OA 2CWUA 4NPBA 1NB5I 1ROVA 1RTUA 3FLJA 3JUMA 3KKGA 1B2ZA 1UUVB 3D5GA 2OTL3 2HOHA 3Q3FA 1KSIA 1JRQA 2GBWB 1JB4A 1W6YA 3CMA3 1T5YA 3F7SA 2E2VA 3WMDA 1VQL3 2YX9A 2RGQA 1BUJA 3N54B 5AYSC 3DGLA 1W7CA 1BRIA 4HOHA 1OUNA 2RBIA 2BMQB 2UUGC 3FG1A 2CX0A 4N6V0 1STDA 3WODG 1CEWI 5EVHA 1UUGB 3CXC2 3CC43 2F98A 4EYCA 4RBNA 1NJI4 3D4AA 1AY7A 1E3RA 1NO3A 3OV4A 4X2HA 1W6GA 4N6NB 1UCLA 1BRKA 4FR9A 3FG4A 4I4KA 3UNLA 1OF5B 2GSPA 3K7CA 1FYSA 3S28A 3V99A 1TRPA 1W4NA 2XGNA 4MMYB 3WA2X 1Q864 3S67A 2GU1A 3DM8A 2F86B 5JPUA 3I553 2Z6BA 1JB5A 4I5QA 3CCV3 5AEUB 2R41A 1W02A 1CQSA 5FW5A 1DE3A 1CYVA 1LVNA 2K0MA 3BU4A 3UL5A 1CYUA 1FGOA 1O7MB 1LXEA 1OH0A 5G1LA 3HX8A 4HAAA 7GSPA 1RGEA 3G4S3 1EUIC 1ASKA 1Y4KA 3FG3A 2P0XA 3WHOA 2CH9A 4XDWA 1W2B2 1JN5B 4WHAA 3IPTA 2KRTA 4N6OB 1OGXA 3DY5A 1B20A 3I0YA 1IVWA 5AIFA 5M19A 2QGUA 1YGWA 3GZXB 1RJOA 2OOVC 5CXOA 1B21A 2CFWA 4BL2A 1HZ1A 5DREA 1QVF2 2XR8B 1GMRA 5CF2A 1W2ZA 3ZFZA 1W01A 1YVBI 2MF7A 1R4YA 1BSAA 2YFJB 3ALAA 3BB9A 2OTJ3 3NBBA 1RGAA 2CWTA 4FMBA 2JQ5A 4WFOA 1F8NA 1BRSA 3NHXA 4N6MA 5FGOA 1YVSA 4GSPA 4L7KA 3URPA 1NB3I 1R4CA 1UGHI 4O3VA 3RGAA 6RNTA 3CD63 3OXAA 2RCDA 3FSDA 4N3VA 1X1YA 2XH9A 3HK4A 3FZWA 1A2PA 1DETA 1Q7HA 2O3OA 5EQLA 8RNTA 3WOFB 3OWUA 2ML6A 4LYLB 1Z1SA 2F4YA 1UCKA 3F8HA 3GAXA 3GZRA 3N8BA 4G1MB 4CJNA 4DKIA 1YHQ3 4EV2A 3O8YA 1Q814 1D6ZA 1LNHA 3QK9A 1VQ43 4J9AA 2CK3H 2RNTA 1JBRA 4XDVA 3EX9A 3PCRA 1VZZA 2D42A 2CFGA 1BNEA 1LOVA 3SYUA 4XBXA 2STDA 2LYXA 3H3HA 4AKZA 4BU4A 3U97A 1A2KA 1RN4A 2FGTA 3NM7A 3NQYA 3FH1A 3CCE3 1OF5A 1ZO2A 1YGEA 3DUKA 5LC7A 1Q40B 3B7CA 1B2UA 4STDA 2CFLA 7STDA 1IDPA 5M1AA 1GOYA 5BVBA 1RGKA 1FUSA 1B2MA 3LYGA 2BMRB 3CCM3 1D6UA 1I3IA 4MMXB 3K5TA 4KFDA 1BANA 4O02B 1O7GB 4IT7A 4BIRA 1M1K4 1E97A 3CCR3 3LZAA 3OW22 3MPHA 1TRQA 1JB2A 1N9JA 1RNTA 1AVKA 2MC8A 2RFRA 3B8LA 3T8UA 1JN5A 5IENA 2BMOB 2OCTA 1WMPA 2Q07A 3FCSB 3GZYB 2D1WA 2XFSA 2Z77A 3GRDA 5IG4A 4ZM8A 1M9GA 2F99A 3KIIA 3ZG5A 1DMQA 5AIHA 3GZBA 1W5ZA 2IY2A 2W9QA 1FUTA 1T2HA 4RNZA 1Q7Y4 5RNTA 3G16A 2YFIB 1KD14 1GY6A 2GBXB 2WOFA 2BU4A 1VQO3 1U5OA 2QIYA 3M8CA 1TFOA 1SARA 2BO9B 1BRHA 1LQGC 3BLZA 2GEXA 2QEX3 3LTDA 3D3LA 1N5HA 3PGBA 1B27A 4OUQA 4Q53A 3F7XA 4JF8A 1I2GA 1TIJA 3Q90A 1JBTA 2CWVA 4H3UA 1RGHA 4HM4B 1SIIA 3AGOA 2R4IA 3NQZA 5AI1A 3X3XA 1BNGA 1RRLA 1PFPA 1T2IA 2IYJA 2UGIA 4GB5A 4HZ9B 4RNYA 5KP1A 2ZHXB 1VQ73 1UI8A 4FMCA 1BSBA 3SLUA 3CNMA 1GMQA 1IVVA 1V74A 3HIIA 2W56B 1Q42A 2INXA 4GHOA 4KZ1A 5DRVA 3NV0B 4LMIA 1OHOA 1LQMB 4N6LA 3AGNA 1JNQA 1GOUA 2IUKA 3E99A 3LT9A 1FZUA 1X1WA 2CFKA 3MSOA 3V92A 1YIJ3 2W2CA 4L8PA 3D5IA 2CFDA 1V58A 5CLKA 1DMMA 1WTHA 2ML5A 3J7Yd 1MWRA 2IMJA 5TGNA 1Q40A 3KSPA 2CG1A 4HVNA 1TJDA 1B2SA 2W03A 3CCJ3 3DGYA 1UW1A 3VF1A 4KFFA 4CPKA 3MYTA 2KF4A 3NXJA 1MWUA 1RMSA 3QRDA 3CCS3 3TDGA 4N6UA 2J8XB 1AR0A 3MG2A 3PS8A 4HM7B 5A0OB 3NUVA 1UGIA 2KAAA 4N6TA 1OPYA 6STDA 3F9SA 5AYRB 1VQ83 1GOVA 1RCKA 1FGMA 1RDSA 3DH2A 3OWYA 5AIIA 1GD3A 1ZGXA 4KVHA 5BXQA 1QAKA 2ZL8A 3F8XA 1EQKA 3AMOB 1OGZA 3EBTA 2W04A 1BSDA 1QMAA 1DVDA 3SOYA 1MWSA 1MGRA 2XFTA 1FW7A 2M7OA 1LOYA 5STDA 5IEOA 4LSOA 2GEYA 4TX4A 3X41A 1YJ93 4FMAA 1YIT3 2XGLA 1RSNA 4EBGA 3MHEA 1Q9EA 5BIRA 1BRJA 3STDA 1NWWA 3PYJA 2CC3A 2OQEC 4X2OA 2WOHA 1BRNL 3VSYA 5D82A 4BTYA 1DYUA 2P09A 2P38A 4U13A 3Q1CA 4WWUC 3JUQA 1GYBA 3LH4A 2W0QA 4OVMA 5HOHA 3K0ZA 3B4PA 1KC84 1W00A 1UDII 1T3BA 1VQP3 1RGCA 1A90A 1AVLA 1IT8A 1GD4A 1YJN3 3CCL3 3DXOA 3H51A 1BRGA 5LC6A 1DMNA 4PEJA 2Y74A 4NREA 3S29A 4CCVA 5IEPA 1DVCA 5GSPA 2BT3A 3DGOA 4HKVB 2GU3A 3JUOA 4OK0A 1K9M4 3KFQC 1B2XA 1MNLA 3KSED 3MKIA 2W56A 3SEDA 5D81A 1ZX2A 2FNQA 3V98A 2ZDJA 3NV0A 1WQLB 4IPBA 1PU4A 3AHWA 1O7HB 1BAOA 4J5KA 3JUNA 1UI7A 2B1XB 5D83A 1SJWA 4AEQA 4EXRA 3KZTA 2WO0A 1RLSA 2OOVA 3EN1B 4HM8B 3WA3A 1VQQA 3KCHA 1GMPA 2HMLB 2IA7A 1RGFA 1NDOB 4HM3B 3SOAA 1BGSA 2HMNB 1VQ53 1JJ22 2O9UX 1K41A 3PXMA 3LTAA 4MJDA 2K3DA 4HM2B 2PZVA 3OX9A 4FCZA 2YFLB 1A2VA 3WOEB 3MG3A 2W6JH 1VQ93 2CG0A 2IUJA 1IV7A 1STFI 1TFKA 2HMMB 8CHOA 3WR2A 2HMOB 2HMKB 3IJEB 9RNTA 1Q824 2K54A 1IQXA 2RSXA 1G0TA 3A76A 3N9HA 1KQS2 5KP3A 1L5GB 3AMOA 5ELUA 1FA3A 1I8VA 1B3SA 1X1UA 2GXFA 5AEWB 3CME3 3ZG0A 1SQWA 1BNSA 1MOLA 2E2TA 1UCIA 2CW9A 2WGOA 3EN8A 2QA43 2AADA 4IIAA 4ORLA 3HI7A 7RNTA 3I563 2PNCA 4R4KA 1A67A 1BU4A 4R1KA 3CCU3 1VQK3 1QJGA 3RNTA 1UUWB 3WDGB 1GY7A 3SVAA 3CPW2 1YNVX 1RGLA 3CC73 3LTCA 3SX1A 2XSOB 2Z76A 2L4VA 1UCJA 1I3FA 4GL6A 2LQVA 3L0RA 4MMZB 2JDIH 1J2BA 1QALA 2E2UA 1SPUA 1LOXA 4HJLB 3FF2A 1FGTA 1IU7A 1SIHA 3X40A 3G0KA 3NX0A 2W9PA 4HM6B 3EBYA 1NNVA 1V57A 1IQ8A 2P0MA 3FF0A 1BOXA 2CX1A 4R80A 5G1KA 5IERA 3F40A 3EC9A 5IW9A 1VQN3 4FCMA 1I0VA 1S5AA 2ZA4A 1FGQA 1O7PB 3D79A 4K61A 3CC23 3X3YA 1IVXA 3HOHA 4RNTA 3Q2PA 3G713 4WYKB 3CU3A 1BVIA 2KF5A 3EE1A 2H0HA 2V1LA 1GSPA 4BL3A 2F56A 3ECFA 5G2GA 5CK6A 1C54A 2L1SA 3UL6A 1I70A 2AAEA 2Y73A 4K1UA 1M1XB 3DGMA 1D6YA 1K8A4 4FMDA 1FUWA 2A15A 1TTOA 1I2EA 3EF8A 6GSPA 1TU5A 1N8QA 2Z7AA 1BSEA 3D9RA 1G96A 3G6E3 1ROAA 4H61A 2C10A 3PCSA 4HBRA 1BUQA 4EW5A 1QAFA 1IVUA 3EB8A 2CIUA 3GWRA 1O7WB 1RN1A 3LT8A 1BIRA 1RGGA 5JBSA 1RNBA 3BNCA 3S5CA 1BNRA 1I0XA 4HM1B 1BNIA 4O2HA 3KN4A 3HZPA 1LOWA 1JBSA 4XBTA 3NM2A 3RGRA 4AKYA 1JKGB 4KFEA 5IG5A 4BTWA 1WMOA 1YI23 4HYZA 1AV4A 3F14A 4K1VA 1X1XA 3LXUX 1IV9A 4QWTA 3IMAB 1HKXA 4LEHA 5AIGA 1O7NB 3A5EA 3SXXA 1GY5A 4HM0B 4EC6A 1W6CA 1VQM3 1BNFA 4XM4A 1U8CB 4LGQA 4R9KA 2CKFB 5CF1A 5HGRA 2SBLA 1BSCA 3G8ZA 3NBRA 1LNIA 1MGWA 1ZS7A 3BNEA 3RDEA 3NBJA 1KWIA 1JZDA 1WNHA 2FXTA 2BIRA 2H0GA 3BNDA 3ER7A 1EEJA 1QVG2 1FGRA 3LTBA 3MWZA 1TP6A 1IT7A 3U1WA 3MG1A 1IYYA 5EEOA 2BHMA 4RZMA 3JUPA 5IG0A 4CDLA 5IG3A 1TUHA 2WGQA 1OHPA 3JVCA 2XSHB 3GSPA 2KF6A 4K90B 4JRFA 3EJVA 3EHCA 1IK3A 3BNBA 2P05A 1N5PA 1RKYA 3DMCA 4KT3B 5BU4A 1K28A 1NU3A
chains in the Genus database with same CATH topology
2B24B 2CHCA 4WYKA 5ELJA 1IQYA 3FKAA 1GS3A 1E3VA 2OWPA 3UB1A 1YJW3 3DZLA 2I9WA 4BTXA 3EQQB 1EA2A 3LMLA 1N8R4 1OHSA 1OCVA 3UJMA 5JPPA 5KP4A 3CNXA 4NHFA 4MEIA 1S723 1N9EA 3OWSA 2BNGA 3KE7A 4J8TA 5IF6A 3PZWA 1VQ63 1RN7A 1EKMA 3X42A 4EV5A 3CPOA 4XBYA 2OQEA 2XRXB 2XEPA 5I97A 1C7HA 1ISKA 4LZIA 1JV2B 1US1A 3B4OA 3HIGA 3T8NA 3FGYA 1WMNA 2KCDA 4FCJA 1K734 3LOYA 3K9MC 2C11A 2HMJB 3X3ZA 1JKGA 4XB5A 2XF3A 1HU9A 3S27A 4R9LA 1RRHA 3CCQ3 4WP5A 1ULJB 2UX0A 1ULIB 3DGNA 3ROBA 3T0UA 1EG9B 1M904 3VGNA 4HM5B 4HZBB 1OACA 3K63A 4O8SA 4L8OA 2CWUA 1NB5I 1ROVA 3FLJA 3JUMA 3KKGA 1UUVB 2OTL3 1KSIA 1JRQA 2GBWB 1JB4A 1W6YA 3CMA3 1T5YA 3F7SA 2E2VA 3WMDA 1VQL3 2YX9A 2RGQA 3N54B 5AYSC 3DGLA 1W7CA 1OUNA 2BMQB 3FG1A 4N6V0 1STDA 3WODG 1CEWI 5EVHA 3CXC2 3CC43 2F98A 4EYCA 4RBNA 1NJI4 1E3RA 1NO3A 3OV4A 4X2HA 1W6GA 4N6NB 4FR9A 3FG4A 4I4KA 3UNLA 1OF5B 3K7CA 3S28A 3V99A 1W4NA 2XGNA 4MMYB 3WA2X 1Q864 3S67A 2GU1A 3DM8A 2F86B 5JPUA 3I553 2Z6BA 1JB5A 3CCV3 5AEUB 1W02A 1CQSA 5FW5A 1CYVA 1LVNA 2K0MA 3UL5A 1CYUA 1FGOA 1O7MB 1LXEA 1OH0A 3HX8A 3G4S3 1Y4KA 1ASKA 3FG3A 2P0XA 2CH9A 4XDWA 1W2B2 1JN5B 4WHAA 3IPTA 2KRTA 4N6OB 1OGXA 3DY5A 3I0YA 1IVWA 5AIFA 2QGUA 3GZXB 1RJOA 2OOVC 5CXOA 2CFWA 5DREA 1QVF2 2XR8B 5CF2A 1W2ZA 1W01A 1YVBI 2MF7A 2YFJB 3ALAA 3BB9A 2OTJ3 3NBBA 2CWTA 4FMBA 2JQ5A 4WFOA 1F8NA 3NHXA 4N6MA 5FGOA 4L7KA 1NB3I 1R4CA 4O3VA 3RGAA 3CD63 3OXAA 2RCDA 3FSDA 4N3VA 2XH9A 3HK4A 3FZWA 2O3OA 5EQLA 3WOFB 3OWUA 2ML6A 1Z1SA 3F8HA 3GAXA 3GZRA 3N8BA 4G1MB 1YHQ3 4EV2A 3O8YA 1Q814 1D6ZA 1LNHA 3QK9A 1VQ43 4J9AA 2CK3H 4XDVA 3EX9A 3PCRA 1VZZA 2D42A 2CFGA 4XBXA 2STDA 2LYXA 3H3HA 4AKZA 3U97A 1A2KA 2FGTA 3NM7A 3NQYA 3FH1A 3CCE3 1OF5A 1ZO2A 1YGEA 3DUKA 5LC7A 1Q40B 3B7CA 4STDA 2CFLA 7STDA 1IDPA 5BVBA 3LYGA 2BMRB 3CCM3 1D6UA 4MMXB 3K5TA 4KFDA 4O02B 1O7GB 4IT7A 1M1K4 1E97A 3CCR3 3LZAA 3OW22 3MPHA 1JB2A 1N9JA 2MC8A 1AVKA 3T8UA 2RFRA 3B8LA 1JN5A 5IENA 2BMOB 2OCTA 1WMPA 2Q07A 3FCSB 3GZYB 2D1WA 2XFSA 2Z77A 3GRDA 5IG4A 4ZM8A 1M9GA 2F99A 3KIIA 1DMQA 5AIHA 3GZBA 1W5ZA 2W9QA 4RNZA 1Q7Y4 3G16A 2YFIB 1KD14 1GY6A 2GBXB 2WOFA 1VQO3 1U5OA 2QIYA 3M8CA 1TFOA 2BO9B 3BLZA 2GEXA 2QEX3 3LTDA 3D3LA 1N5HA 3PGBA 4OUQA 4Q53A 3F7XA 4JF8A 1TIJA 3Q90A 2CWVA 4H3UA 4HM4B 1SIIA 2R4IA 3NQZA 5AI1A 3X3XA 1RRLA 1PFPA 4HZ9B 4RNYA 4GB5A 5KP1A 1VQ73 1UI8A 4FMCA 3SLUA 3CNMA 1IVVA 1V74A 3HIIA 2W56B 2INXA 1Q42A 4KZ1A 5DRVA 3NV0B 4LMIA 1OHOA 4N6LA 1JNQA 2IUKA 3E99A 3LT9A 2CFKA 3V92A 3MSOA 1YIJ3 2W2CA 4L8PA 2CFDA 5CLKA 1DMMA 1WTHA 2ML5A 3J7Yd 2IMJA 5TGNA 1Q40A 3KSPA 2CG1A 4HVNA 2W03A 3CCJ3 1UW1A 3VF1A 4KFFA 3MYTA 3NXJA 3QRDA 3CCS3 3TDGA 4N6UA 1AR0A 3MG2A 3PS8A 4HM7B 5A0OB 3NUVA 4N6TA 1OPYA 6STDA 3F9SA 5AYRB 1VQ83 1FGMA 3OWYA 5AIIA 1GD3A 4KVHA 5BXQA 1QAKA 2ZL8A 3F8XA 1EQKA 3AMOB 1OGZA 3EBTA 2W04A 1QMAA 1DVDA 3SOYA 2XFTA 2M7OA 5STDA 5IEOA 4LSOA 2GEYA 4TX4A 3X41A 1YJ93 4FMAA 1YIT3 2XGLA 4EBGA 3MHEA 3STDA 1NWWA 3PYJA 2CC3A 2OQEC 4X2OA 2WOHA 3VSYA 5D82A 4BTYA 1DYUA 2P09A 2P38A 4U13A 3Q1CA 4WWUC 3JUQA 1GYBA 3LH4A 2W0QA 4OVMA 3K0ZA 3B4PA 1KC84 1W00A 1VQP3 1A90A 1AVLA 1IT8A 1GD4A 1YJN3 3CCL3 3DXOA 1NU3A 3H51A 5LC6A 1DMNA 4PEJA 2Y74A 4NREA 3S29A 4CCVA 5IEPA 1DVCA 2BT3A 3DGOA 4HKVB 2GU3A 3JUOA 4OK0A 1K9M4 3KFQC 3KSED 1MNLA 3MKIA 3SEDA 2W56A 5D81A 1ZX2A 2FNQA 3V98A 2ZDJA 3NV0A 1WQLB 4IPBA 1PU4A 1O7HB 3JUNA 1UI7A 2B1XB 5D83A 1SJWA 4AEQA 4EXRA 3KZTA 2WO0A 2OOVA 3EN1B 4HM8B 3WA3A 2HMLB 2IA7A 4HM3B 1NDOB 3SOAA 2HMNB 1VQ53 1JJ22 2O9UX 1K41A 3PXMA 3LTAA 4MJDA 4HM2B 2PZVA 3OX9A 4FCZA 2YFLB 1A2VA 3WOEB 3MG3A 2W6JH 1VQ93 2CG0A 2IUJA 1IV7A 1STFI 1TFKA 2HMMB 8CHOA 1Q824 2HMOB 2HMKB 3IJEB 2K54A 1IQXA 2RSXA 3A76A 3N9HA 1KQS2 5KP3A 1L5GB 3AMOA 5ELUA 1FA3A 5AEWB 2GXFA 3CME3 1SQWA 1MOLA 2E2TA 2CW9A 2WGOA 3EN8A 2QA43 4IIAA 4ORLA 3HI7A 3I563 2PNCA 4R4KA 1A67A 4R1KA 3CCU3 1VQK3 1QJGA 3WDGB 1UUWB 1GY7A 3SVAA 3CPW2 3CC73 3LTCA 3SX1A 2XSOB 2Z76A 2L4VA 4GL6A 4MMZB 2LQVA 3L0RA 2JDIH 1J2BA 1QALA 2E2UA 1SPUA 1LOXA 4HJLB 3FF2A 1FGTA 1IU7A 1SIHA 3X40A 3G0KA 3NX0A 2W9PA 4HM6B 3EBYA 1IQ8A 2P0MA 3FF0A 4R80A 5IERA 5IW9A 3F40A 3EC9A 1VQN3 4FCMA 1S5AA 1FGQA 1O7PB 4K61A 3CC23 3X3YA 1IVXA 3G713 3Q2PA 4WYKB 3CU3A 3EE1A 2V1LA 3ECFA 5G2GA 5CK6A 3UL6A 2Y73A 4K1UA 1M1XB 3DGMA 1D6YA 1K8A4 4FMDA 1FUWA 2A15A 3EF8A 1TU5A 1N8QA 2Z7AA 3D9RA 1G96A 3G6E3 1ROAA 4H61A 2C10A 3PCSA 4HBRA 1BUQA 1QAFA 1IVUA 3EB8A 2CIUA 3GWRA 1O7WB 3LT8A 5JBSA 3BNCA 3S5CA 4HM1B 4O2HA 3KN4A 3HZPA 4XBTA 3NM2A 3RGRA 4AKYA 1JKGB 4KFEA 5IG5A 4BTWA 1WMOA 1YI23 4HYZA 1AV4A 3F14A 4K1VA 3LXUX 1IV9A 4QWTA 3IMAB 1HKXA 4LEHA 5AIGA 1O7NB 3SXXA 1GY5A 4HM0B 4EC6A 1W6CA 1VQM3 4XM4A 1U8CB 4LGQA 4R9KA 2CKFB 5CF1A 5HGRA 2SBLA 3G8ZA 3NBRA 3BNEA 3RDEA 3NBJA 1KWIA 1WNHA 2FXTA 3BNDA 3ER7A 1QVG2 1FGRA 3LTBA 3MWZA 1TP6A 1IT7A 3U1WA 3MG1A 5EEOA 2BHMA 4RZMA 3JUPA 5IG0A 4CDLA 5IG3A 1TUHA 2WGQA 1OHPA 3JVCA 2XSHB 4K90B 4JRFA 3EJVA 3EHCA 1IK3A 3BNBA 2P05A 1N5PA 1RKYA 3DMCA 1K28A 2KXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MOL A;  5ELJ A;  4N6L A;  1YVB I;  1A67 A;  4N6M A;  3SVA A;  1NB3 I;  1R4C A;  1RN7 A;  3L0R A;  3QRD A;  4N6U A;  3PS8 A;  5A0O B;  4LZI A;  3NX0 A;  5EQL A;  2W9P A;  4N6T A;  3GAX A;  3K9M C;  1GD3 A;  1EQK A;  3Q2P A;  1DVD A;  4TX4 A;  3UL6 A;  1FUW A;  5LC7 A;  1NB5 I;  3PYJ A;  1G96 A;  1ROA A;  3LH4 A;  4IT7 A;  1A90 A;  1GD4 A;  1N9J A;  4N6V 0;  5LC6 A;  1CEW I;  4CCV A;  1DVC A;  2OCT A;  4EYC A;  3KFQ C;  3KSE D;  1MNL A;  4ZM8 A;  1M9G A;  4N6N B;  2W9Q A;  1IV9 A;  3IMA B;  2BO9 B;  3S67 A;  1N5H A;  1KWI A;  1WNH A;  2O9U X;  3PXM A;  1CYV A;  1TIJ A;  3UL5 A;  1CYU A;  3MWZ A;  1LXE A;  1PFP A;  1IV7 A;  2CH9 A;  1STF I;  1N5P A;  4N6O B;  5ELU A;  1FA3 A;  2KXG A; 
#chains in the Genus database with same CATH topology
 2B24 B;  2CHC A;  4WYK A;  4J5G A;  5ELJ A;  1IQY A;  1BNJ A;  3AHS A;  3FKA A;  1GS3 A;  1E3V A;  2F5W A;  2OWP A;  3UB1 A;  1YJW 3;  3DZL A;  2I9W A;  4BTX A;  3EQQ B;  1EA2 A;  1HYF A;  1PY3 A;  2C4B A;  3LML A;  1N8R 4;  1OHS A;  1OCV A;  3UJM A;  5JPP A;  5KP4 A;  3CNX A;  4NHF A;  4MEI A;  1S72 3;  1N9E A;  3OWS A;  2BNG A;  3KE7 A;  4J8T A;  1LRA A;  5IF6 A;  3PZW A;  1CH0 A;  5M18 A;  1VQ6 3;  1RN7 A;  1EKM A;  3X42 A;  4EV5 A;  3CPO A;  4XBY A;  2OQE A;  2XRX B;  2XEP A;  5I97 A;  1C7H A;  1ISK A;  1G02 A;  2F5M A;  4LZI A;  1JV2 B;  1US1 A;  3B4O A;  3HIG A;  3T8N A;  3FGY A;  1I2F A;  2KXG A;  4ILF A;  1WMN A;  2KCD A;  4FCJ A;  1K73 4;  3LOY A;  1RCL A;  1AQZ A;  3K9M C;  2C11 A;  2HMJ B;  3X3Z A;  1JKG A;  4XB5 A;  2H0I A;  2XF3 A;  1PYL A;  1MWT A;  3BIR A;  1HU9 A;  2KF3 A;  1JZO A;  4R9L A;  3S27 A;  1RHL A;  1RRH A;  3CCQ 3;  4WP5 A;  1ULJ B;  2UX0 A;  1ULI B;  3DGN A;  3ROB A;  3T0U A;  1EG9 B;  2SAR A;  1M90 4;  3VGN A;  4HM5 B;  4HZB B;  1OAC A;  3K63 A;  4O8S A;  4L8O A;  2CWU A;  4NPB A;  1NB5 I;  1ROV A;  1RTU A;  3FLJ A;  3JUM A;  3KKG A;  1B2Z A;  1UUV B;  3D5G A;  2OTL 3;  2HOH A;  3Q3F A;  1KSI A;  1JRQ A;  2GBW B;  1JB4 A;  1W6Y A;  3CMA 3;  1T5Y A;  3F7S A;  2E2V A;  3WMD A;  1VQL 3;  2YX9 A;  2RGQ A;  1BUJ A;  3N54 B;  5AYS C;  3DGL A;  1W7C A;  1BRI A;  4HOH A;  1OUN A;  2RBI A;  2BMQ B;  2UUG C;  3FG1 A;  2CX0 A;  4N6V 0;  1STD A;  3WOD G;  1CEW I;  5EVH A;  1UUG B;  3CXC 2;  3CC4 3;  2F98 A;  4EYC A;  4RBN A;  1NJI 4;  3D4A A;  1AY7 A;  1E3R A;  1NO3 A;  3OV4 A;  4X2H A;  1W6G A;  4N6N B;  1UCL A;  1BRK A;  4FR9 A;  3FG4 A;  4I4K A;  3UNL A;  1OF5 B;  2GSP A;  3K7C A;  1FYS A;  3S28 A;  3V99 A;  1TRP A;  1W4N A;  2XGN A;  4MMY B;  3WA2 X;  1Q86 4;  3S67 A;  2GU1 A;  3DM8 A;  2F86 B;  5JPU A;  3I55 3;  2Z6B A;  1JB5 A;  4I5Q A;  3CCV 3;  5AEU B;  2R41 A;  1W02 A;  1CQS A;  5FW5 A;  1DE3 A;  1CYV A;  1LVN A;  2K0M A;  3BU4 A;  3UL5 A;  1CYU A;  1FGO A;  1O7M B;  1LXE A;  1OH0 A;  5G1L A;  3HX8 A;  4HAA A;  7GSP A;  1RGE A;  3G4S 3;  1EUI C;  1ASK A;  1Y4K A;  3FG3 A;  2P0X A;  3WHO A;  2CH9 A;  4XDW A;  1W2B 2;  1JN5 B;  4WHA A;  3IPT A;  2KRT A;  4N6O B;  1OGX A;  3DY5 A;  1B20 A;  3I0Y A;  1IVW A;  5AIF A;  5M19 A;  2QGU A;  1YGW A;  3GZX B;  1RJO A;  2OOV C;  5CXO A;  1B21 A;  2CFW A;  4BL2 A;  1HZ1 A;  5DRE A;  1QVF 2;  2XR8 B;  1GMR A;  5CF2 A;  1W2Z A;  3ZFZ A;  1W01 A;  1YVB I;  2MF7 A;  1R4Y A;  1BSA A;  2YFJ B;  3ALA A;  3BB9 A;  2OTJ 3;  3NBB A;  1RGA A;  2CWT A;  4FMB A;  2JQ5 A;  4WFO A;  1F8N A;  1BRS A;  3NHX A;  4N6M A;  5FGO A;  1YVS A;  4GSP A;  4L7K A;  3URP A;  1NB3 I;  1R4C A;  1UGH I;  4O3V A;  3RGA A;  6RNT A;  3CD6 3;  3OXA A;  2RCD A;  3FSD A;  4N3V A;  1X1Y A;  2XH9 A;  3HK4 A;  3FZW A;  1A2P A;  1DET A;  1Q7H A;  2O3O A;  5EQL A;  8RNT A;  3WOF B;  3OWU A;  2ML6 A;  4LYL B;  1Z1S A;  2F4Y A;  1UCK A;  3F8H A;  3GAX A;  3GZR A;  3N8B A;  4G1M B;  4CJN A;  4DKI A;  1YHQ 3;  4EV2 A;  3O8Y A;  1Q81 4;  1D6Z A;  1LNH A;  3QK9 A;  1VQ4 3;  4J9A A;  2CK3 H;  2RNT A;  1JBR A;  4XDV A;  3EX9 A;  3PCR A;  1VZZ A;  2D42 A;  2CFG A;  1BNE A;  1LOV A;  3SYU A;  4XBX A;  2STD A;  2LYX A;  3H3H A;  4AKZ A;  4BU4 A;  3U97 A;  1A2K A;  1RN4 A;  2FGT A;  3NM7 A;  3NQY A;  3FH1 A;  3CCE 3;  1OF5 A;  1ZO2 A;  1YGE A;  3DUK A;  5LC7 A;  1Q40 B;  3B7C A;  1B2U A;  4STD A;  2CFL A;  7STD A;  1IDP A;  5M1A A;  1GOY A;  5BVB A;  1RGK A;  1FUS A;  1B2M A;  3LYG A;  2BMR B;  3CCM 3;  1D6U A;  1I3I A;  4MMX B;  3K5T A;  4KFD A;  1BAN A;  4O02 B;  1O7G B;  4IT7 A;  4BIR A;  1M1K 4;  1E97 A;  3CCR 3;  3LZA A;  3OW2 2;  3MPH A;  1TRQ A;  1JB2 A;  1N9J A;  1RNT A;  1AVK A;  2MC8 A;  2RFR A;  3B8L A;  3T8U A;  1JN5 A;  5IEN A;  2BMO B;  2OCT A;  1WMP A;  2Q07 A;  3FCS B;  3GZY B;  2D1W A;  2XFS A;  2Z77 A;  3GRD A;  5IG4 A;  4ZM8 A;  1M9G A;  2F99 A;  3KII A;  3ZG5 A;  1DMQ A;  5AIH A;  3GZB A;  1W5Z A;  2IY2 A;  2W9Q A;  1FUT A;  1T2H A;  4RNZ A;  1Q7Y 4;  5RNT A;  3G16 A;  2YFI B;  1KD1 4;  1GY6 A;  2GBX B;  2WOF A;  2BU4 A;  1VQO 3;  1U5O A;  2QIY A;  3M8C A;  1TFO A;  1SAR A;  2BO9 B;  1BRH A;  1LQG C;  3BLZ A;  2GEX A;  2QEX 3;  3LTD A;  3D3L A;  1N5H A;  3PGB A;  1B27 A;  4OUQ A;  4Q53 A;  3F7X A;  4JF8 A;  1I2G A;  1TIJ A;  3Q90 A;  1JBT A;  2CWV A;  4H3U A;  1RGH A;  4HM4 B;  1SII A;  3AGO A;  2R4I A;  3NQZ A;  5AI1 A;  3X3X A;  1BNG A;  1RRL A;  1PFP A;  1T2I A;  2IYJ A;  2UGI A;  4GB5 A;  4HZ9 B;  4RNY A;  5KP1 A;  2ZHX B;  1VQ7 3;  1UI8 A;  4FMC A;  1BSB A;  3SLU A;  3CNM A;  1GMQ A;  1IVV A;  1V74 A;  3HII A;  2W56 B;  1Q42 A;  2INX A;  4GHO A;  4KZ1 A;  5DRV A;  3NV0 B;  4LMI A;  1OHO A;  1LQM B;  4N6L A;  3AGN A;  1JNQ A;  1GOU A;  2IUK A;  3E99 A;  3LT9 A;  1FZU A;  1X1W A;  2CFK A;  3MSO A;  3V92 A;  1YIJ 3;  2W2C A;  4L8P A;  3D5I A;  2CFD A;  1V58 A;  5CLK A;  1DMM A;  1WTH A;  2ML5 A;  3J7Y d;  1MWR A;  2IMJ A;  5TGN A;  1Q40 A;  3KSP A;  2CG1 A;  4HVN A;  1TJD A;  1B2S A;  2W03 A;  3CCJ 3;  3DGY A;  1UW1 A;  3VF1 A;  4KFF A;  4CPK A;  3MYT A;  2KF4 A;  3NXJ A;  1MWU A;  1RMS A;  3QRD A;  3CCS 3;  3TDG A;  4N6U A;  2J8X B;  1AR0 A;  3MG2 A;  3PS8 A;  4HM7 B;  5A0O B;  3NUV A;  1UGI A;  2KAA A;  4N6T A;  1OPY A;  6STD A;  3F9S A;  5AYR B;  1VQ8 3;  1GOV A;  1RCK A;  1FGM A;  1RDS A;  3DH2 A;  3OWY A;  5AII A;  1GD3 A;  1ZGX A;  4KVH A;  5BXQ A;  1QAK A;  2ZL8 A;  3F8X A;  1EQK A;  3AMO B;  1OGZ A;  3EBT A;  2W04 A;  1BSD A;  1QMA A;  1DVD A;  3SOY A;  1MWS A;  1MGR A;  2XFT A;  1FW7 A;  2M7O A;  1LOY A;  5STD A;  5IEO A;  4LSO A;  2GEY A;  4TX4 A;  3X41 A;  1YJ9 3;  4FMA A;  1YIT 3;  2XGL A;  1RSN A;  4EBG A;  3MHE A;  1Q9E A;  5BIR A;  1BRJ A;  3STD A;  1NWW A;  3PYJ A;  2CC3 A;  2OQE C;  4X2O A;  2WOH A;  1BRN L;  3VSY A;  5D82 A;  4BTY A;  1DYU A;  2P09 A;  2P38 A;  4U13 A;  3Q1C A;  4WWU C;  3JUQ A;  1GYB A;  3LH4 A;  2W0Q A;  4OVM A;  5HOH A;  3K0Z A;  3B4P A;  1KC8 4;  1W00 A;  1UDI I;  1T3B A;  1VQP 3;  1RGC A;  1A90 A;  1AVL A;  1IT8 A;  1GD4 A;  1YJN 3;  3CCL 3;  3DXO A;  3H51 A;  1BRG A;  5LC6 A;  1DMN A;  4PEJ A;  2Y74 A;  4NRE A;  3S29 A;  4CCV A;  5IEP A;  1DVC A;  5GSP A;  2BT3 A;  3DGO A;  4HKV B;  2GU3 A;  3JUO A;  4OK0 A;  1K9M 4;  3KFQ C;  1B2X A;  1MNL A;  3KSE D;  3MKI A;  2W56 A;  3SED A;  5D81 A;  1ZX2 A;  2FNQ A;  3V98 A;  2ZDJ A;  3NV0 A;  1WQL B;  4IPB A;  1PU4 A;  3AHW A;  1O7H B;  1BAO A;  4J5K A;  3JUN A;  1UI7 A;  2B1X B;  5D83 A;  1SJW A;  4AEQ A;  4EXR A;  3KZT A;  2WO0 A;  1RLS A;  2OOV A;  3EN1 B;  4HM8 B;  3WA3 A;  1VQQ A;  3KCH A;  1GMP A;  2HML B;  2IA7 A;  1RGF A;  1NDO B;  4HM3 B;  3SOA A;  1BGS A;  2HMN B;  1VQ5 3;  1JJ2 2;  2O9U X;  1K41 A;  3PXM A;  3LTA A;  4MJD A;  2K3D A;  4HM2 B;  2PZV A;  3OX9 A;  4FCZ A;  2YFL B;  1A2V A;  3WOE B;  3MG3 A;  2W6J H;  1VQ9 3;  2CG0 A;  2IUJ A;  1IV7 A;  1STF I;  1TFK A;  2HMM B;  8CHO A;  3WR2 A;  2HMO B;  2HMK B;  3IJE B;  9RNT A;  1Q82 4;  2K54 A;  1IQX A;  2RSX A;  1G0T A;  3A76 A;  3N9H A;  1KQS 2;  5KP3 A;  1L5G B;  3AMO A;  5ELU A;  1FA3 A;  1I8V A;  1B3S A;  1X1U A;  2GXF A;  5AEW B;  3CME 3;  3ZG0 A;  1SQW A;  1BNS A;  1MOL A;  2E2T A;  1UCI A;  2CW9 A;  2WGO A;  3EN8 A;  2QA4 3;  2AAD A;  4IIA A;  4ORL A;  3HI7 A;  7RNT A;  3I56 3;  2PNC A;  4R4K A;  1A67 A;  1BU4 A;  4R1K A;  3CCU 3;  1VQK 3;  1QJG A;  3RNT A;  1UUW B;  3WDG B;  1GY7 A;  3SVA A;  3CPW 2;  1YNV X;  1RGL A;  3CC7 3;  3LTC A;  3SX1 A;  2XSO B;  2Z76 A;  2L4V A;  1UCJ A;  1I3F A;  4GL6 A;  2LQV A;  3L0R A;  4MMZ B;  2JDI H;  1J2B A;  1QAL A;  2E2U A;  1SPU A;  1LOX A;  4HJL B;  3FF2 A;  1FGT A;  1IU7 A;  1SIH A;  3X40 A;  3G0K A;  3NX0 A;  2W9P A;  4HM6 B;  3EBY A;  1NNV A;  1V57 A;  1IQ8 A;  2P0M A;  3FF0 A;  1BOX A;  2CX1 A;  4R80 A;  5G1K A;  5IER A;  3F40 A;  3EC9 A;  5IW9 A;  1VQN 3;  4FCM A;  1I0V A;  1S5A A;  2ZA4 A;  1FGQ A;  1O7P B;  3D79 A;  4K61 A;  3CC2 3;  3X3Y A;  1IVX A;  3HOH A;  4RNT A;  3Q2P A;  3G71 3;  4WYK B;  3CU3 A;  1BVI A;  2KF5 A;  3EE1 A;  2H0H A;  2V1L A;  1GSP A;  4BL3 A;  2F56 A;  3ECF A;  5G2G A;  5CK6 A;  1C54 A;  2L1S A;  3UL6 A;  1I70 A;  2AAE A;  2Y73 A;  4K1U A;  1M1X B;  3DGM A;  1D6Y A;  1K8A 4;  4FMD A;  1FUW A;  2A15 A;  1TTO A;  1I2E A;  3EF8 A;  6GSP A;  1TU5 A;  1N8Q A;  2Z7A A;  1BSE A;  3D9R A;  1G96 A;  3G6E 3;  1ROA A;  4H61 A;  2C10 A;  3PCS A;  4HBR A;  1BUQ A;  4EW5 A;  1QAF A;  1IVU A;  3EB8 A;  2CIU A;  3GWR A;  1O7W B;  1RN1 A;  3LT8 A;  1BIR A;  1RGG A;  5JBS A;  1RNB A;  3BNC A;  3S5C A;  1BNR A;  1I0X A;  4HM1 B;  1BNI A;  4O2H A;  3KN4 A;  3HZP A;  1LOW A;  1JBS A;  4XBT A;  3NM2 A;  3RGR A;  4AKY A;  1JKG B;  4KFE A;  5IG5 A;  4BTW A;  1WMO A;  1YI2 3;  4HYZ A;  1AV4 A;  3F14 A;  4K1V A;  1X1X A;  3LXU X;  1IV9 A;  4QWT A;  3IMA B;  1HKX A;  4LEH A;  5AIG A;  1O7N B;  3A5E A;  3SXX A;  1GY5 A;  4HM0 B;  4EC6 A;  1W6C A;  1VQM 3;  1BNF A;  4XM4 A;  1U8C B;  4LGQ A;  4R9K A;  2CKF B;  5CF1 A;  5HGR A;  2SBL A;  1BSC A;  3G8Z A;  3NBR A;  1LNI A;  1MGW A;  1ZS7 A;  3BNE A;  3RDE A;  3NBJ A;  1KWI A;  1JZD A;  1WNH A;  2FXT A;  2BIR A;  2H0G A;  3BND A;  3ER7 A;  1EEJ A;  1QVG 2;  1FGR A;  3LTB A;  3MWZ A;  1TP6 A;  1IT7 A;  3U1W A;  3MG1 A;  1IYY A;  5EEO A;  2BHM A;  4RZM A;  3JUP A;  5IG0 A;  4CDL A;  5IG3 A;  1TUH A;  2WGQ A;  1OHP A;  3JVC A;  2XSH B;  3GSP A;  2KF6 A;  4K90 B;  4JRF A;  3EJV A;  3EHC A;  1IK3 A;  3BNB A;  2P05 A;  1N5P A;  1RKY A;  3DMC A;  4KT3 B;  5BU4 A;  1K28 A;  1NU3 A; 
#chains in the Genus database with same CATH homology
 2B24 B;  2CHC A;  4WYK A;  5ELJ A;  1IQY A;  3FKA A;  1GS3 A;  1E3V A;  2OWP A;  3UB1 A;  1YJW 3;  3DZL A;  2I9W A;  4BTX A;  3EQQ B;  1EA2 A;  3LML A;  1N8R 4;  1OHS A;  1OCV A;  3UJM A;  5JPP A;  5KP4 A;  3CNX A;  4NHF A;  4MEI A;  1S72 3;  1N9E A;  3OWS A;  2BNG A;  3KE7 A;  4J8T A;  5IF6 A;  3PZW A;  1VQ6 3;  1RN7 A;  1EKM A;  3X42 A;  4EV5 A;  3CPO A;  4XBY A;  2OQE A;  2XRX B;  2XEP A;  5I97 A;  1C7H A;  1ISK A;  4LZI A;  1JV2 B;  1US1 A;  3B4O A;  3HIG A;  3T8N A;  3FGY A;  1WMN A;  2KCD A;  4FCJ A;  1K73 4;  3LOY A;  3K9M C;  2C11 A;  2HMJ B;  3X3Z A;  1JKG A;  4XB5 A;  2XF3 A;  1HU9 A;  3S27 A;  4R9L A;  1RRH A;  3CCQ 3;  4WP5 A;  1ULJ B;  2UX0 A;  1ULI B;  3DGN A;  3ROB A;  3T0U A;  1EG9 B;  1M90 4;  3VGN A;  4HM5 B;  4HZB B;  1OAC A;  3K63 A;  4O8S A;  4L8O A;  2CWU A;  1NB5 I;  1ROV A;  3FLJ A;  3JUM A;  3KKG A;  1UUV B;  2OTL 3;  1KSI A;  1JRQ A;  2GBW B;  1JB4 A;  1W6Y A;  3CMA 3;  1T5Y A;  3F7S A;  2E2V A;  3WMD A;  1VQL 3;  2YX9 A;  2RGQ A;  3N54 B;  5AYS C;  3DGL A;  1W7C A;  1OUN A;  2BMQ B;  3FG1 A;  4N6V 0;  1STD A;  3WOD G;  1CEW I;  5EVH A;  3CXC 2;  3CC4 3;  2F98 A;  4EYC A;  4RBN A;  1NJI 4;  1E3R A;  1NO3 A;  3OV4 A;  4X2H A;  1W6G A;  4N6N B;  4FR9 A;  3FG4 A;  4I4K A;  3UNL A;  1OF5 B;  3K7C A;  3S28 A;  3V99 A;  1W4N A;  2XGN A;  4MMY B;  3WA2 X;  1Q86 4;  3S67 A;  2GU1 A;  3DM8 A;  2F86 B;  5JPU A;  3I55 3;  2Z6B A;  1JB5 A;  3CCV 3;  5AEU B;  1W02 A;  1CQS A;  5FW5 A;  1CYV A;  1LVN A;  2K0M A;  3UL5 A;  1CYU A;  1FGO A;  1O7M B;  1LXE A;  1OH0 A;  3HX8 A;  3G4S 3;  1Y4K A;  1ASK A;  3FG3 A;  2P0X A;  2CH9 A;  4XDW A;  1W2B 2;  1JN5 B;  4WHA A;  3IPT A;  2KRT A;  4N6O B;  1OGX A;  3DY5 A;  3I0Y A;  1IVW A;  5AIF A;  2QGU A;  3GZX B;  1RJO A;  2OOV C;  5CXO A;  2CFW A;  5DRE A;  1QVF 2;  2XR8 B;  5CF2 A;  1W2Z A;  1W01 A;  1YVB I;  2MF7 A;  2YFJ B;  3ALA A;  3BB9 A;  2OTJ 3;  3NBB A;  2CWT A;  4FMB A;  2JQ5 A;  4WFO A;  1F8N A;  3NHX A;  4N6M A;  5FGO A;  4L7K A;  1NB3 I;  1R4C A;  4O3V A;  3RGA A;  3CD6 3;  3OXA A;  2RCD A;  3FSD A;  4N3V A;  2XH9 A;  3HK4 A;  3FZW A;  2O3O A;  5EQL A;  3WOF B;  3OWU A;  2ML6 A;  1Z1S A;  3F8H A;  3GAX A;  3GZR A;  3N8B A;  4G1M B;  1YHQ 3;  4EV2 A;  3O8Y A;  1Q81 4;  1D6Z A;  1LNH A;  3QK9 A;  1VQ4 3;  4J9A A;  2CK3 H;  4XDV A;  3EX9 A;  3PCR A;  1VZZ A;  2D42 A;  2CFG A;  4XBX A;  2STD A;  2LYX A;  3H3H A;  4AKZ A;  3U97 A;  1A2K A;  2FGT A;  3NM7 A;  3NQY A;  3FH1 A;  3CCE 3;  1OF5 A;  1ZO2 A;  1YGE A;  3DUK A;  5LC7 A;  1Q40 B;  3B7C A;  4STD A;  2CFL A;  7STD A;  1IDP A;  5BVB A;  3LYG A;  2BMR B;  3CCM 3;  1D6U A;  4MMX B;  3K5T A;  4KFD A;  4O02 B;  1O7G B;  4IT7 A;  1M1K 4;  1E97 A;  3CCR 3;  3LZA A;  3OW2 2;  3MPH A;  1JB2 A;  1N9J A;  2MC8 A;  1AVK A;  3T8U A;  2RFR A;  3B8L A;  1JN5 A;  5IEN A;  2BMO B;  2OCT A;  1WMP A;  2Q07 A;  3FCS B;  3GZY B;  2D1W A;  2XFS A;  2Z77 A;  3GRD A;  5IG4 A;  4ZM8 A;  1M9G A;  2F99 A;  3KII A;  1DMQ A;  5AIH A;  3GZB A;  1W5Z A;  2W9Q A;  4RNZ A;  1Q7Y 4;  3G16 A;  2YFI B;  1KD1 4;  1GY6 A;  2GBX B;  2WOF A;  1VQO 3;  1U5O A;  2QIY A;  3M8C A;  1TFO A;  2BO9 B;  3BLZ A;  2GEX A;  2QEX 3;  3LTD A;  3D3L A;  1N5H A;  3PGB A;  4OUQ A;  4Q53 A;  3F7X A;  4JF8 A;  1TIJ A;  3Q90 A;  2CWV A;  4H3U A;  4HM4 B;  1SII A;  2R4I A;  3NQZ A;  5AI1 A;  3X3X A;  1RRL A;  1PFP A;  4HZ9 B;  4RNY A;  4GB5 A;  5KP1 A;  1VQ7 3;  1UI8 A;  4FMC A;  3SLU A;  3CNM A;  1IVV A;  1V74 A;  3HII A;  2W56 B;  2INX A;  1Q42 A;  4KZ1 A;  5DRV A;  3NV0 B;  4LMI A;  1OHO A;  4N6L A;  1JNQ A;  2IUK A;  3E99 A;  3LT9 A;  2CFK A;  3V92 A;  3MSO A;  1YIJ 3;  2W2C A;  4L8P A;  2CFD A;  5CLK A;  1DMM A;  1WTH A;  2ML5 A;  3J7Y d;  2IMJ A;  5TGN A;  1Q40 A;  3KSP A;  2CG1 A;  4HVN A;  2W03 A;  3CCJ 3;  1UW1 A;  3VF1 A;  4KFF A;  3MYT A;  3NXJ A;  3QRD A;  3CCS 3;  3TDG A;  4N6U A;  1AR0 A;  3MG2 A;  3PS8 A;  4HM7 B;  5A0O B;  3NUV A;  4N6T A;  1OPY A;  6STD A;  3F9S A;  5AYR B;  1VQ8 3;  1FGM A;  3OWY A;  5AII A;  1GD3 A;  4KVH A;  5BXQ A;  1QAK A;  2ZL8 A;  3F8X A;  1EQK A;  3AMO B;  1OGZ A;  3EBT A;  2W04 A;  1QMA A;  1DVD A;  3SOY A;  2XFT A;  2M7O A;  5STD A;  5IEO A;  4LSO A;  2GEY A;  4TX4 A;  3X41 A;  1YJ9 3;  4FMA A;  1YIT 3;  2XGL A;  4EBG A;  3MHE A;  3STD A;  1NWW A;  3PYJ A;  2CC3 A;  2OQE C;  4X2O A;  2WOH A;  3VSY A;  5D82 A;  4BTY A;  1DYU A;  2P09 A;  2P38 A;  4U13 A;  3Q1C A;  4WWU C;  3JUQ A;  1GYB A;  3LH4 A;  2W0Q A;  4OVM A;  3K0Z A;  3B4P A;  1KC8 4;  1W00 A;  1VQP 3;  1A90 A;  1AVL A;  1IT8 A;  1GD4 A;  1YJN 3;  3CCL 3;  3DXO A;  1NU3 A;  3H51 A;  5LC6 A;  1DMN A;  4PEJ A;  2Y74 A;  4NRE A;  3S29 A;  4CCV A;  5IEP A;  1DVC A;  2BT3 A;  3DGO A;  4HKV B;  2GU3 A;  3JUO A;  4OK0 A;  1K9M 4;  3KFQ C;  3KSE D;  1MNL A;  3MKI A;  3SED A;  2W56 A;  5D81 A;  1ZX2 A;  2FNQ A;  3V98 A;  2ZDJ A;  3NV0 A;  1WQL B;  4IPB A;  1PU4 A;  1O7H B;  3JUN A;  1UI7 A;  2B1X B;  5D83 A;  1SJW A;  4AEQ A;  4EXR A;  3KZT A;  2WO0 A;  2OOV A;  3EN1 B;  4HM8 B;  3WA3 A;  2HML B;  2IA7 A;  4HM3 B;  1NDO B;  3SOA A;  2HMN B;  1VQ5 3;  1JJ2 2;  2O9U X;  1K41 A;  3PXM A;  3LTA A;  4MJD A;  4HM2 B;  2PZV A;  3OX9 A;  4FCZ A;  2YFL B;  1A2V A;  3WOE B;  3MG3 A;  2W6J H;  1VQ9 3;  2CG0 A;  2IUJ A;  1IV7 A;  1STF I;  1TFK A;  2HMM B;  8CHO A;  1Q82 4;  2HMO B;  2HMK B;  3IJE B;  2K54 A;  1IQX A;  2RSX A;  3A76 A;  3N9H A;  1KQS 2;  5KP3 A;  1L5G B;  3AMO A;  5ELU A;  1FA3 A;  5AEW B;  2GXF A;  3CME 3;  1SQW A;  1MOL A;  2E2T A;  2CW9 A;  2WGO A;  3EN8 A;  2QA4 3;  4IIA A;  4ORL A;  3HI7 A;  3I56 3;  2PNC A;  4R4K A;  1A67 A;  4R1K A;  3CCU 3;  1VQK 3;  1QJG A;  3WDG B;  1UUW B;  1GY7 A;  3SVA A;  3CPW 2;  3CC7 3;  3LTC A;  3SX1 A;  2XSO B;  2Z76 A;  2L4V A;  4GL6 A;  4MMZ B;  2LQV A;  3L0R A;  2JDI H;  1J2B A;  1QAL A;  2E2U A;  1SPU A;  1LOX A;  4HJL B;  3FF2 A;  1FGT A;  1IU7 A;  1SIH A;  3X40 A;  3G0K A;  3NX0 A;  2W9P A;  4HM6 B;  3EBY A;  1IQ8 A;  2P0M A;  3FF0 A;  4R80 A;  5IER A;  5IW9 A;  3F40 A;  3EC9 A;  1VQN 3;  4FCM A;  1S5A A;  1FGQ A;  1O7P B;  4K61 A;  3CC2 3;  3X3Y A;  1IVX A;  3G71 3;  3Q2P A;  4WYK B;  3CU3 A;  3EE1 A;  2V1L A;  3ECF A;  5G2G A;  5CK6 A;  3UL6 A;  2Y73 A;  4K1U A;  1M1X B;  3DGM A;  1D6Y A;  1K8A 4;  4FMD A;  1FUW A;  2A15 A;  3EF8 A;  1TU5 A;  1N8Q A;  2Z7A A;  3D9R A;  1G96 A;  3G6E 3;  1ROA A;  4H61 A;  2C10 A;  3PCS A;  4HBR A;  1BUQ A;  1QAF A;  1IVU A;  3EB8 A;  2CIU A;  3GWR A;  1O7W B;  3LT8 A;  5JBS A;  3BNC A;  3S5C A;  4HM1 B;  4O2H A;  3KN4 A;  3HZP A;  4XBT A;  3NM2 A;  3RGR A;  4AKY A;  1JKG B;  4KFE A;  5IG5 A;  4BTW A;  1WMO A;  1YI2 3;  4HYZ A;  1AV4 A;  3F14 A;  4K1V A;  3LXU X;  1IV9 A;  4QWT A;  3IMA B;  1HKX A;  4LEH A;  5AIG A;  1O7N B;  3SXX A;  1GY5 A;  4HM0 B;  4EC6 A;  1W6C A;  1VQM 3;  4XM4 A;  1U8C B;  4LGQ A;  4R9K A;  2CKF B;  5CF1 A;  5HGR A;  2SBL A;  3G8Z A;  3NBR A;  3BNE A;  3RDE A;  3NBJ A;  1KWI A;  1WNH A;  2FXT A;  3BND A;  3ER7 A;  1QVG 2;  1FGR A;  3LTB A;  3MWZ A;  1TP6 A;  1IT7 A;  3U1W A;  3MG1 A;  5EEO A;  2BHM A;  4RZM A;  3JUP A;  5IG0 A;  4CDL A;  5IG3 A;  1TUH A;  2WGQ A;  1OHP A;  3JVC A;  2XSH B;  4K90 B;  4JRF A;  3EJV A;  3EHC A;  1IK3 A;  3BNB A;  2P05 A;  1N5P A;  1RKY A;  3DMC A;  1K28 A;  2KXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...