3PYJA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant protein
molecule keywords Monellin chain B/Monellin chain A chimeric protein
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pyjA00
3PS8A 4N6NB 2OCTA 1IV7A 4EYCA 5LC7A 2O9UX 1YVBI 1DVCA 4N6LA 4LZIA 1DVDA 1MNLA 5LC6A 3L0RA 3SVAA 3GAXA 1GD4A 1M9GA 1G96A 4N6MA 1N9JA 3IMAB 1FA3A 4N6OB 1KWIA 1STFI 1TIJA 3K9MC 1NB3I 1RN7A 2BO9B 3MWZA 2KXGA 1GD3A 5ELUA 4N6UA 3UL5A 1CYVA 1A67A 4IT7A 1CEWI 5EQLA 1NB5I 4N6TA 4CCVA 3Q2PA 1IV9A 2W9QA 3KFQC 3QRDA 1A90A 1WNHA 1ROAA 5ELJA 1R4CA 3KSED 3LH4A 1PFPA 4ZM8A 3NX0A 3S67A 1CYUA 4N6V0 1LXEA 3UL6A 2CH9A 4TX4A 1EQKA 3PXMA 1MOLA 1FUWA 1N5PA 5A0OB 1N5HA 2W9PA 3PYJA
chains in the Genus database with same CATH superfamily
2CFDA 3D5GA 3PS8A 1O7GB 2JDIH 3HIIA 1AR0A 3GRDA 1B2SA 5JPPA 1N8QA 1Q864 4EYCA 1G0TA 1JB2A 2Y74A 1GY5A 2UUGC 2O9UX 1AY7A 1BNEA 3D9RA 2STDA 3DZLA 5HOHA 4WYKA 2D42A 1W2B2 1G02A 2WOHA 3EN1B 4XB5A 1OHOA 7RNTA 3L0RA 1QMAA 4L8PA 3U1WA 1IT8A 4EV2A 5KP4A 1M9GA 2C10A 3LTDA 5FGOA 1VQQA 1L5GB 1RGCA 1I70A 3IMAB 4CPKA 1NDOB 5G1KA 4HM2B 1FA3A 1FW7A 1E3VA 3NBJA 3CCV3 3S5CA 2KF6A 1U5OA 3N54B 3SXXA 3CCL3 1STDA 1STFI 3CCQ3 3STDA 3T8UA 5EEOA 1EKMA 4H61A 1TIJA 3O8YA 1BSBA 1AVKA 3DH2A 4XBTA 1RN1A 1V74A 3K63A 2QGUA 1F8NA 1SIIA 3OWYA 1NB3I 6GSPA 3LTBA 1IK3A 1AQZA 1RLSA 2P09A 2BO9B 3X3XA 1ISKA 1ULJB 2C11A 1IQXA 5AIHA 3G4S3 3BU4A 4KVHA 1JKGB 4BL3A 1B21A 2CFWA 1WMPA 3PCRA 3B4OA 1OHSA 3CPOA 5IF6A 1D6ZA 3ZG0A 1YI23 4HM7B 1BSEA 2HMOB 4LGQA 4O02B 4MMYB 2KRTA 4X2OA 3FZWA 3S27A 3AMOB 2OOVC 5BXQA 1TJDA 2OOVA 3KIIA 3B8LA 4CCVA 4K90B 1SIHA 4LYLB 1HKXA 3OWSA 2W9QA 5D83A 4GHOA 2I9WA 3DY5A 1K8A4 1A2VA 1BSAA 1ASKA 1GOUA 2CC3A 1OACA 2Q07A 3RGRA 2J8XB 4HM8B 2AADA 3OV4A 1RCKA 3V92A 4DKIA 2WGQA 1UDII 2YFIB 3EJVA 4OVMA 1W6YA 1W02A 4HM4B 7GSPA 2Z77A 1BRSA 1UCIA 2CFLA 4GL6A 1T2IA 5HGRA 2LYXA 4N6V0 1LXEA 1RGEA 3GZBA 3BLZA 2W6JH 5M1AA 3BNBA 4HM3B 3MG3A 1BIRA 4WFOA 2CFGA 5IG4A 4HM6B 1W00A 3UNLA 1LOVA 1CH0A 5AYSC 1RGAA 4R80A 1BNSA 2L1SA 5IERA 1FUWA 1N5PA 1Q7HA 4HM0B 5KP1A 1UW1A 1R4YA 1FGQA 1RGHA 3JUOA 3X3YA 4QWTA 2OTL3 4EV5A 4K1UA 2W04A 1X1XA 3FSDA 1MNLA 3F40A 1B2ZA 1W4NA 4XBYA 3G0KA 1E97A 2XH9A 3NQYA 5D81A 3ZG5A 1O7PB 1ZX2A 1MGWA 2CHCA 1DVCA 3NBBA 1B3SA 3AGOA 3OWUA 1OH0A 4N6LA 2XR8B 4R9KA 1W5ZA 2OQEA 2XGLA 3DGMA 1D6YA 1LOYA 3FG4A 4FCMA 2XFTA 2Z6BA 6RNTA 1C54A 1TRPA 1Q40A 2GU1A 3LT8A 3LXUX 3JUMA 5CF1A 3X40A 1GD4A 3FF2A 4FMDA 2F86B 1G96A 1MWRA 1UI7A 2RGQA 3FGYA 4N6MA 1VQM3 1RCLA 1X1WA 3WDGB 1YGEA 2P0XA 3NM7A 3CCR3 3NM2A 3NXJA 4X2HA 1IVXA 3K5TA 4HBRA 1QVF2 5AIGA 3BIRA 1GY6A 4WWUC 1IU7A 1DE3A 3DXOA 3M8CA 3JVCA 3NBRA 2L4VA 3K9MC 3ALAA 3FCSB 3B4PA 1DYUA 2INXA 4OK0A 1YJW3 1RDSA 2B1XB 2GEYA 1FGMA 1O7MB 2D1WA 1GOVA 1DMQA 1Q9EA 1EG9B 3LT9A 1BNIA 1OUNA 3H51A 4MMZB 2K54A 2XGNA 2Z7AA 1MWUA 1M1XB 3MWZA 1UUWB 1VQ53 2KXGA 4HM1B 1NO3A 2HMMB 1UCLA 1FYSA 3UB1A 1OF5B 1YIJ3 3IJEB 4HZ9B 1FGTA 3UL5A 1B2UA 3WA3A 1YJ93 1K28A 1TFKA 1RGKA 3MG1A 2OWPA 1RHLA 1I3FA 3G8ZA 1RSNA 1A67A 1VZZA 1W7CA 3CC73 2ML6A 3D4AA 5CF2A 3T8NA 1T2HA 1BRIA 2W56B 3NV0B 1JZOA 1NB5I 1M904 2XSOB 1GOYA 1BNGA 2K3DA 1ROVA 4BL2A 1TP6A 3CNMA 1S723 4EW5A 4EC6A 3Q2PA 1IV9A 1V57A 2PZVA 3EX9A 4XBXA 1GS3A 3IPTA 5IG3A 1ZS7A 4MMXB 4I4KA 3K0ZA 1Q42A 4RBNA 4L8OA 1BGSA 3D3LA 1CQSA 3EBTA 3FKAA 3F8XA 4RNYA 6STDA 1A90A 2Y73A 1B27A 1BVIA 3WR2A 1NU3A 1W2ZA 1ROAA 2CWVA 5ELJA 1T3BA 1YVSA 3DGLA 1PFPA 4ZM8A 1Q814 3JUPA 4XDWA 5IG0A 1Q824 3RDEA 3MSOA 4JF8A 2KF4A 1IQ8A 4O2HA 5EVHA 5JBSA 5M18A 5M19A 1B2XA 1EQKA 3PCSA 1TUHA 1IVVA 2KF3A 1X1UA 1IT7A 2FXTA 3D5IA 4HKVB 2P38A 1OGXA 3Q3FA 3J7Yd 2HMKB 2W2CA 4U13A 1TU5A 1I0XA 1AV4A 1JB4A 2F4YA 1Q7Y4 2RBIA 5STDA 2CK3H 1O7NB 2OTJ3 4HZBB 1JRQA 5IENA 1JKGA 2ZL8A 1IYYA 1JV2B 3LTCA 4RZMA 3CNXA 1E3RA 2W9PA 3AGNA 1PU4A 3T0UA 1UCJA 4N6NB 1IV7A 3JUQA 2CX1A 1D6UA 1OCVA 1RKYA 2IY2A 5AIFA 1PYLA 2E2VA 1BNRA 3DGYA 3LTAA 5RNTA 2RCDA 2K0MA 2M7OA 3AMOA 3MPHA 1J2BA 3CC43 4LZIA 1LNHA 2CG0A 3KZTA 2YFLB 3MYTA 2BT3A 2FGTA 3EF8A 5JPUA 5LC6A 2RNTA 1V58A 2HMLB 1OGZA 5DREA 8CHOA 3I553 1RGLA 4FMCA 4L7KA 1GSPA 1MWSA 2CW9A 1IQYA 3GAXA 1A2PA 3SVAA 1JB5A 3KN4A 5GSPA 2UX0A 2WOFA 3CXC2 4MJDA 4O3VA 2C4BA 4FCZA 1N9JA 4EBGA 1I3IA 3HZPA 2BMQB 4LMIA 5AEUB 4STDA 1W01A 3F7SA 3EB8A 4HYZA 3HK4A 1KWIA 4MEIA 1K734 1WMOA 3NQZA 1LNIA 5IG5A 2F99A 4H3UA 3URPA 3N8BA 3V99A 2KF5A 3Q1CA 3F7XA 2MC8A 1RNTA 4J5KA 3WOEB 3F14A 1YHQ3 3HIGA 2ZHXB 4WHAA 1ZO2A 5BU4A 3DGOA 3NHXA 3PGBA 3OW22 2JQ5A 4I5QA 3WMDA 1B2MA 1GMRA 5I97A 3A5EA 2O3OA 4BU4A 8RNTA 5CK6A 2QA43 1GD3A 1K41A 2W03A 4ILFA 5ELUA 4KT3B 3X42A 2GSPA 1BOXA 3I0YA 3H3HA 1QJGA 2H0GA 1JN5B 2H0HA 5FW5A 3VF1A 3CCS3 2MF7A 2AAEA 4KZ1A 1FGOA 1AVLA 2E2TA 1CYVA 2KAAA 4IT7A 4AKZA 4GB5A 3EBYA 3KE7A 1MWTA 1KSIA 1NNVA 1LOWA 4WYKB 1VQ73 4N6TA 1X1YA 3OXAA 4KFFA 1HYFA 5KP3A 2SBLA 2CX0A 2CWTA 2HOHA 2F98A 1VQ83 2QIYA 4N3VA 2V1LA 3GZRA 4IPBA 1VQN3 4R1KA 3X41A 2BMRB 3SX1A 4LSOA 3DMCA 1BANA 1BRGA 2BNGA 5DRVA 3WOFB 3RNTA 4O8SA 3CCE3 3QK9A 5IEPA 1UI8A 2P05A 2R41A 4NHFA 1UUGB 4K1VA 3TDGA 3KFQC 1TFOA 2IUKA 1QALA 1WNHA 1RGGA 2XF3A 2F5MA 4FCJA 1HU9A 4WP5A 3BNCA 1R4CA 3KSED 5G1LA 1JBSA 1EEJA 2CFKA 1DMNA 1JN5A 1RGFA 3A76A 3NX0A 1Y4KA 3KKGA 2IUJA 3S67A 2ZA4A 2HMJB 3LZAA 3JUNA 7STDA 3GWRA 1I2FA 1RTUA 4FMBA 3UL6A 2CH9A 1I0VA 4TX4A 3HX8A 2A15A 1FZUA 1BRKA 3GZXB 3VSYA 1WMNA 3WODG 3PXMA 1BSCA 1LRAA 1MOLA 2BMOB 2CWUA 5AI1A 3CCM3 1VQL3 1JBRA 1K9M4 1RRLA 2FNQA 3WA2X 1BRHA 3KSPA 4HM5B 1SQWA 1OHPA 4AKYA 1YIT3 5A0OB 4CJNA 1GY7A 1NJI4 3EE1A 2YX9A 3GSPA 3MKIA 2R4IA 1IVWA 3PYJA 2WGOA 1RMSA 2XSHB 1GMQA 1OF5A 3DUKA 5TGNA 3SOYA 4AEQA 2OCTA 3K7CA 1VQ43 3ROBA 1RRHA 4G1MB 1I2GA 1LVNA 1LQMB 5LC7A 3I563 3BNEA 2GU3A 3UJMA 1QVG2 2F5WA 1YVBI 1UCKA 1UGIA 3S29A 2CIUA 1N8R4 3CD63 3CC23 1PY3A 2W56A 4IIAA 3NV0A 4J8TA 1SARA 4NPBA 4RNZA 1W6GA 3F9SA 1LOXA 1BNJA 3S28A 1DVDA 5BVBA 1EA2A 3CU3A 3WHOA 4JRFA 4K61A 4FR9A 1FGRA 2YFJB 1M1K4 4FMAA 1RJOA 1TRQA 5IEOA 9RNTA 4LEHA 1W6CA 1NWWA 2XFSA 3AHSA 1DMMA 3Q90A 4NREA 1BUJA 1GMPA 5BIRA 4R9LA 4HJLB 4XM4A 3DM8A 5CXOA 2BU4A 4Q53A 5D82A 1VQO3 4N6OB 1YNVX 3V98A 1JZDA 2IMJA 1MGRA 1N9EA 3N9HA 3ECFA 3E99A 2GXFA 2RFRA 3MHEA 3CPW2 1FUTA 3CCJ3 3LOYA 2XEPA 3NUVA 4OUQA 1VQ63 1DETA 3EN8A 2P0MA 1A2KA 3B7CA 1EUIC 5AEWB 2GBXB 3U97A 2SARA 3BNDA 2IYJA 1RN7A 2QEX3 1US1A 4HAAA 3OX9A 1I2EA 1SJWA 2GBWB 4ORLA 4BTWA 1UGHI 1BUQA 1KC84 2W0QA 2RSXA 5IW9A 3EQQB 3VGNA 3PZWA 3G16A 1T5YA 4N6UA 3ER7A 3SEDA 1JNQA 1WQLB 1IDPA 1UUVB 4BTXA 1YJN3 2ZDJA 1KD14 3CMA3 3F8HA 1C7HA 4GSPA 1CEWI 3CME3 4R4KA 1BAOA 3AHWA 5EQLA 1WTHA 3MG2A 2ML5A 3G6E3 1ULIB 4CDLA 3SLUA 3FF0A 2CG1A 3LYGA 1Q40B 1JBTA 2IA7A 1LQGC 2Z76A 1FUSA 4HOHA 1BNFA 1VQP3 1IVUA 5G2GA 1VQK3 3FG1A 2H0IA 4XDVA 4RNTA 3RGAA 2E2UA 1QAKA 3SOAA 1BSDA 3QRDA 2GEXA 3GZYB 3EC9A 1YGWA 3LMLA 4KFDA 1O7WB 5AIIA 1SPUA 3LH4A 3X3ZA 5CLKA 1BRNL 3HI7A 1I8VA 1OPYA 1Z1SA 4BTYA 1CYUA 3FG3A 1O7HB 3G713 3EHCA 3FH1A 1ZGXA 3CCU3 2WO0A 3DGNA 2OQEC 1BU4A 2XRXB 4BIRA 2BIRA 1GYBA 2B24B 1RNBA 1KQS2 4EXRA 2CKFB 4J5GA 2LQVA 2HMNB 2PNCA 5AYRB 4J9AA 1BRJA 3KCHA 1VQ93 4KFEA 4HVNA 1B20A 2KCDA 2UGIA 3SYUA 3FLJA 1JJ22 1S5AA 3D79A 4PEJA 2BHMA 1HZ1A 3BB9A 1TTOA 2F56A 3HOHA 3ZFZA 1N5HA 1U8CB 1QAFA 1RN4A
chains in the Genus database with same CATH topology
2CFDA 3PS8A 1O7GB 2JDIH 3HIIA 1AR0A 3GRDA 5JPPA 1N8QA 1Q864 4EYCA 1JB2A 2Y74A 1GY5A 2O9UX 3D9RA 2STDA 3DZLA 4WYKA 2D42A 1W2B2 2WOHA 3EN1B 4XB5A 1OHOA 3L0RA 1QMAA 4L8PA 3U1WA 1IT8A 4EV2A 5KP4A 1M9GA 2C10A 3LTDA 5FGOA 1L5GB 3IMAB 1NDOB 4HM2B 1FA3A 1E3VA 3NBJA 3CCV3 3S5CA 3CCL3 1U5OA 3N54B 3SXXA 1STDA 1STFI 3CCQ3 3STDA 3T8UA 5EEOA 1EKMA 4H61A 1TIJA 3O8YA 4XBTA 1AVKA 1V74A 3K63A 2QGUA 1F8NA 1SIIA 3OWYA 1NB3I 3LTBA 1IK3A 2P09A 2BO9B 3X3XA 1ISKA 1ULJB 2C11A 1IQXA 5AIHA 3G4S3 4KVHA 1JKGB 2CFWA 1WMPA 3PCRA 3B4OA 1OHSA 3CPOA 5IF6A 1D6ZA 1YI23 4HM7B 2HMOB 4LGQA 4O02B 4MMYB 2KRTA 4X2OA 3FZWA 3S27A 3AMOB 2OOVC 5BXQA 2OOVA 3KIIA 3B8LA 4CCVA 4K90B 1SIHA 1HKXA 3OWSA 2W9QA 5D83A 2I9WA 3DY5A 1K8A4 1A2VA 1ASKA 2CC3A 1OACA 2Q07A 3RGRA 4HM8B 3OV4A 3V92A 2YFIB 3EJVA 4OVMA 1W6YA 1W02A 4HM4B 2Z77A 2CFLA 4GL6A 5HGRA 2LYXA 4N6V0 1LXEA 3GZBA 3BLZA 2W6JH 3BNBA 4HM3B 3MG3A 4WFOA 2CFGA 5IG4A 4HM6B 1W00A 3UNLA 5AYSC 4R80A 5IERA 1FUWA 1N5PA 4HM0B 5KP1A 1UW1A 1FGQA 3X3YA 3JUOA 4QWTA 1U8CB 2OTL3 4EV5A 4K1UA 2W04A 3FSDA 1MNLA 3F40A 1W4NA 4XBYA 3G0KA 1E97A 2XH9A 3NQYA 5D81A 1O7PB 1ZX2A 2CHCA 1DVCA 3NBBA 3OWUA 1OH0A 4N6LA 2XR8B 4R9KA 1W5ZA 2OQEA 2XGLA 3DGMA 1D6YA 3FG4A 4FCMA 2XFTA 2Z6BA 1Q40A 2GU1A 3LT8A 3LXUX 3JUMA 5CF1A 3X40A 1GD4A 3FF2A 4FMDA 2F86B 1G96A 1UI7A 2RGQA 3FGYA 4N6MA 1VQM3 3WDGB 1YGEA 2P0XA 3NM7A 3CCR3 3NM2A 4X2HA 1IVXA 3K5TA 4HBRA 1QVF2 5AIGA 1GY6A 4WWUC 1IU7A 3DXOA 3M8CA 3JVCA 3NBRA 2L4VA 3K9MC 3ALAA 3FCSB 3B4PA 1DYUA 2INXA 4OK0A 1YJW3 2B1XB 2GEYA 1FGMA 1O7MB 2D1WA 1DMQA 1EG9B 3LT9A 1OUNA 3H51A 4MMZB 2K54A 2XGNA 2Z7AA 1M1XB 3MWZA 1UUWB 1VQ53 2KXGA 4HM1B 1NO3A 2HMMB 3UB1A 1OF5B 1YIJ3 3IJEB 4HZ9B 1FGTA 3UL5A 3WA3A 1YJ93 1K28A 1TFKA 3MG1A 2OWPA 3G8ZA 1A67A 1VZZA 1W7CA 3CC73 2ML6A 5CF2A 3T8NA 2W56B 3NV0B 1NB5I 1M904 2XSOB 1ROVA 1TP6A 3CNMA 1S723 4EC6A 3Q2PA 1IV9A 3EX9A 2PZVA 5IG3A 4XBXA 1GS3A 3IPTA 4MMXB 4I4KA 3K0ZA 1Q42A 4RBNA 4L8OA 3D3LA 1CQSA 3EBTA 3FKAA 3F8XA 4RNYA 6STDA 1A90A 2Y73A 1NU3A 1W2ZA 1ROAA 2CWVA 5ELJA 3DGLA 1PFPA 4ZM8A 1Q814 3JUPA 4XDWA 5IG0A 1Q824 3RDEA 3MSOA 4JF8A 1IQ8A 4O2HA 5EVHA 5JBSA 1EQKA 3PCSA 1TUHA 1IVVA 1IT7A 2FXTA 4HKVB 2P38A 1OGXA 3J7Yd 2HMKB 2W2CA 4U13A 1TU5A 1AV4A 1JB4A 1Q7Y4 5STDA 2CK3H 1O7NB 2OTJ3 4HZBB 1JRQA 5IENA 1JKGA 2ZL8A 1JV2B 3LTCA 4RZMA 3CNXA 1E3RA 2W9PA 1PU4A 3T0UA 4N6NB 1IV7A 3JUQA 1D6UA 1OCVA 1RKYA 5AIFA 2E2VA 3LTAA 2RCDA 2K0MA 2M7OA 3AMOA 3MPHA 1J2BA 3CC43 4LZIA 1LNHA 2CG0A 3KZTA 2YFLB 3MYTA 2BT3A 2FGTA 3EF8A 5JPUA 5LC6A 3I553 2HMLB 1OGZA 5DREA 8CHOA 4FMCA 4L7KA 2CW9A 3SVAA 3GAXA 1IQYA 1JB5A 3KN4A 3CXC2 2UX0A 2WOFA 4MJDA 4O3VA 4FCZA 1N9JA 4EBGA 3HZPA 2BMQB 4LMIA 5AEUB 4STDA 1W01A 3F7SA 3EB8A 4HYZA 3HK4A 1KWIA 4MEIA 1K734 1WMOA 3NQZA 5IG5A 2F99A 4H3UA 3N8BA 3Q1CA 3F7XA 2MC8A 3WOEB 1YHQ3 3F14A 3HIGA 4WHAA 1ZO2A 3DGOA 3NHXA 3PGBA 3OW22 2JQ5A 3WMDA 5I97A 2O3OA 5CK6A 2QA43 1GD3A 1K41A 2W03A 5ELUA 3X42A 3I0YA 3H3HA 1QJGA 5FW5A 1JN5B 3VF1A 3CCS3 2MF7A 4KZ1A 1FGOA 1AVLA 2E2TA 1CYVA 4IT7A 4AKZA 4GB5A 3EBYA 3KE7A 1KSIA 4WYKB 1VQ73 4N6TA 3OXAA 4KFFA 5KP3A 2SBLA 2CWTA 1VQ83 2F98A 2QIYA 4N3VA 2V1LA 3GZRA 4IPBA 1VQN3 4R1KA 3X41A 2BMRB 3SX1A 4LSOA 3DMCA 2BNGA 3WOFB 5DRVA 3CCE3 4O8SA 3QK9A 5IEPA 1UI8A 2P05A 4NHFA 4K1VA 3TDGA 3KFQC 1TFOA 2IUKA 1QALA 1WNHA 2XF3A 4FCJA 1HU9A 4WP5A 3BNCA 1R4CA 3KSED 2CFKA 1DMNA 1JN5A 3A76A 2IUJA 3NX0A 1Y4KA 3KKGA 3S67A 7STDA 3LZAA 2HMJB 3JUNA 3GWRA 4FMBA 3UL6A 2CH9A 4TX4A 3HX8A 2A15A 3GZXB 3VSYA 1WMNA 3WODG 3PXMA 5AI1A 2CWUA 1MOLA 2BMOB 3CCM3 1VQL3 1K9M4 1RRLA 2FNQA 3WA2X 3KSPA 4HM5B 1SQWA 1OHPA 4AKYA 1YIT3 5A0OB 1GY7A 1NJI4 3EE1A 2YX9A 3MKIA 2R4IA 1IVWA 3PYJA 2WGOA 3V99A 2XSHB 1OF5A 3DUKA 5TGNA 3SOYA 4AEQA 2OCTA 3K7CA 1VQ43 3ROBA 1RRHA 4G1MB 1LVNA 5LC7A 3I563 3BNEA 2GU3A 3UJMA 1QVG2 1YVBI 3S29A 3CD63 2CIUA 1N8R4 3CC23 2W56A 4IIAA 3NV0A 4J8TA 4RNZA 3S28A 1W6GA 3F9SA 1LOXA 1DVDA 5BVBA 1EA2A 3CU3A 4JRFA 4K61A 4FR9A 1FGRA 2YFJB 1M1K4 4FMAA 1RJOA 5IEOA 4LEHA 1W6CA 1NWWA 2XFSA 3Q90A 1DMMA 4NREA 4R9LA 4HJLB 4XM4A 3DM8A 5CXOA 4Q53A 5D82A 1VQO3 4N6OB 3V98A 2IMJA 1N9EA 3N9HA 3ECFA 3E99A 2GXFA 2RFRA 3MHEA 3CPW2 3CCJ3 1VQ63 3LOYA 2XEPA 3NUVA 4OUQA 3EN8A 2P0MA 1A2KA 3B7CA 5AEWB 2GBXB 3U97A 3BNDA 1RN7A 2QEX3 1US1A 3OX9A 1SJWA 2GBWB 4ORLA 4BTWA 1BUQA 1KC84 2W0QA 2RSXA 5IW9A 3EQQB 3VGNA 3PZWA 3G16A 1T5YA 4N6UA 3ER7A 3SEDA 1JNQA 1WQLB 1IDPA 1UUVB 4BTXA 1YJN3 2ZDJA 1KD14 3CMA3 3F8HA 1C7HA 1CEWI 3CME3 4R4KA 5EQLA 1WTHA 3MG2A 2ML5A 3G6E3 1ULIB 4CDLA 3SLUA 3FF0A 2CG1A 3LYGA 1Q40B 2IA7A 2Z76A 1VQP3 1IVUA 5G2GA 1VQK3 3FG1A 4XDVA 3RGAA 2E2UA 1QAKA 3SOAA 3QRDA 2GEXA 3GZYB 3EC9A 3LMLA 4KFDA 1O7WB 5AIIA 1SPUA 3LH4A 3X3ZA 5CLKA 3HI7A 1OPYA 1Z1SA 4BTYA 1CYUA 3FG3A 1O7HB 3G713 3EHCA 3FH1A 3CCU3 2WO0A 3DGNA 2OQEC 2XRXB 1GYBA 2B24B 1KQS2 4EXRA 2CKFB 2LQVA 2HMNB 2PNCA 5AYRB 4J9AA 1VQ93 4KFEA 4HVNA 2KCDA 3FLJA 1JJ22 1S5AA 4PEJA 2BHMA 3BB9A 1N5HA 2WGQA 1QAFA 3NXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PS8 A;  4N6N B;  2OCT A;  1IV7 A;  4EYC A;  5LC7 A;  2O9U X;  1YVB I;  1DVC A;  4N6L A;  4LZI A;  1DVD A;  1MNL A;  5LC6 A;  3L0R A;  3SVA A;  3GAX A;  1GD4 A;  1M9G A;  1G96 A;  4N6M A;  1N9J A;  3IMA B;  1FA3 A;  4N6O B;  1KWI A;  1STF I;  1TIJ A;  3K9M C;  1NB3 I;  1RN7 A;  2BO9 B;  3MWZ A;  2KXG A;  1GD3 A;  5ELU A;  4N6U A;  3UL5 A;  1CYV A;  1A67 A;  4IT7 A;  1CEW I;  5EQL A;  1NB5 I;  4N6T A;  4CCV A;  3Q2P A;  1IV9 A;  2W9Q A;  3KFQ C;  3QRD A;  1A90 A;  1WNH A;  1ROA A;  5ELJ A;  1R4C A;  3KSE D;  3LH4 A;  1PFP A;  4ZM8 A;  3NX0 A;  3S67 A;  1CYU A;  4N6V 0;  1LXE A;  3UL6 A;  2CH9 A;  4TX4 A;  1EQK A;  3PXM A;  1MOL A;  1FUW A;  1N5P A;  5A0O B;  1N5H A;  2W9P A;  3PYJ A; 
#chains in the Genus database with same CATH topology
 2CFD A;  3D5G A;  3PS8 A;  1O7G B;  2JDI H;  3HII A;  1AR0 A;  3GRD A;  1B2S A;  5JPP A;  1N8Q A;  1Q86 4;  4EYC A;  1G0T A;  1JB2 A;  2Y74 A;  1GY5 A;  2UUG C;  2O9U X;  1AY7 A;  1BNE A;  3D9R A;  2STD A;  3DZL A;  5HOH A;  4WYK A;  2D42 A;  1W2B 2;  1G02 A;  2WOH A;  3EN1 B;  4XB5 A;  1OHO A;  7RNT A;  3L0R A;  1QMA A;  4L8P A;  3U1W A;  1IT8 A;  4EV2 A;  5KP4 A;  1M9G A;  2C10 A;  3LTD A;  5FGO A;  1VQQ A;  1L5G B;  1RGC A;  1I70 A;  3IMA B;  4CPK A;  1NDO B;  5G1K A;  4HM2 B;  1FA3 A;  1FW7 A;  1E3V A;  3NBJ A;  3CCV 3;  3S5C A;  2KF6 A;  1U5O A;  3N54 B;  3SXX A;  3CCL 3;  1STD A;  1STF I;  3CCQ 3;  3STD A;  3T8U A;  5EEO A;  1EKM A;  4H61 A;  1TIJ A;  3O8Y A;  1BSB A;  1AVK A;  3DH2 A;  4XBT A;  1RN1 A;  1V74 A;  3K63 A;  2QGU A;  1F8N A;  1SII A;  3OWY A;  1NB3 I;  6GSP A;  3LTB A;  1IK3 A;  1AQZ A;  1RLS A;  2P09 A;  2BO9 B;  3X3X A;  1ISK A;  1ULJ B;  2C11 A;  1IQX A;  5AIH A;  3G4S 3;  3BU4 A;  4KVH A;  1JKG B;  4BL3 A;  1B21 A;  2CFW A;  1WMP A;  3PCR A;  3B4O A;  1OHS A;  3CPO A;  5IF6 A;  1D6Z A;  3ZG0 A;  1YI2 3;  4HM7 B;  1BSE A;  2HMO B;  4LGQ A;  4O02 B;  4MMY B;  2KRT A;  4X2O A;  3FZW A;  3S27 A;  3AMO B;  2OOV C;  5BXQ A;  1TJD A;  2OOV A;  3KII A;  3B8L A;  4CCV A;  4K90 B;  1SIH A;  4LYL B;  1HKX A;  3OWS A;  2W9Q A;  5D83 A;  4GHO A;  2I9W A;  3DY5 A;  1K8A 4;  1A2V A;  1BSA A;  1ASK A;  1GOU A;  2CC3 A;  1OAC A;  2Q07 A;  3RGR A;  2J8X B;  4HM8 B;  2AAD A;  3OV4 A;  1RCK A;  3V92 A;  4DKI A;  2WGQ A;  1UDI I;  2YFI B;  3EJV A;  4OVM A;  1W6Y A;  1W02 A;  4HM4 B;  7GSP A;  2Z77 A;  1BRS A;  1UCI A;  2CFL A;  4GL6 A;  1T2I A;  5HGR A;  2LYX A;  4N6V 0;  1LXE A;  1RGE A;  3GZB A;  3BLZ A;  2W6J H;  5M1A A;  3BNB A;  4HM3 B;  3MG3 A;  1BIR A;  4WFO A;  2CFG A;  5IG4 A;  4HM6 B;  1W00 A;  3UNL A;  1LOV A;  1CH0 A;  5AYS C;  1RGA A;  4R80 A;  1BNS A;  2L1S A;  5IER A;  1FUW A;  1N5P A;  1Q7H A;  4HM0 B;  5KP1 A;  1UW1 A;  1R4Y A;  1FGQ A;  1RGH A;  3JUO A;  3X3Y A;  4QWT A;  2OTL 3;  4EV5 A;  4K1U A;  2W04 A;  1X1X A;  3FSD A;  1MNL A;  3F40 A;  1B2Z A;  1W4N A;  4XBY A;  3G0K A;  1E97 A;  2XH9 A;  3NQY A;  5D81 A;  3ZG5 A;  1O7P B;  1ZX2 A;  1MGW A;  2CHC A;  1DVC A;  3NBB A;  1B3S A;  3AGO A;  3OWU A;  1OH0 A;  4N6L A;  2XR8 B;  4R9K A;  1W5Z A;  2OQE A;  2XGL A;  3DGM A;  1D6Y A;  1LOY A;  3FG4 A;  4FCM A;  2XFT A;  2Z6B A;  6RNT A;  1C54 A;  1TRP A;  1Q40 A;  2GU1 A;  3LT8 A;  3LXU X;  3JUM A;  5CF1 A;  3X40 A;  1GD4 A;  3FF2 A;  4FMD A;  2F86 B;  1G96 A;  1MWR A;  1UI7 A;  2RGQ A;  3FGY A;  4N6M A;  1VQM 3;  1RCL A;  1X1W A;  3WDG B;  1YGE A;  2P0X A;  3NM7 A;  3CCR 3;  3NM2 A;  3NXJ A;  4X2H A;  1IVX A;  3K5T A;  4HBR A;  1QVF 2;  5AIG A;  3BIR A;  1GY6 A;  4WWU C;  1IU7 A;  1DE3 A;  3DXO A;  3M8C A;  3JVC A;  3NBR A;  2L4V A;  3K9M C;  3ALA A;  3FCS B;  3B4P A;  1DYU A;  2INX A;  4OK0 A;  1YJW 3;  1RDS A;  2B1X B;  2GEY A;  1FGM A;  1O7M B;  2D1W A;  1GOV A;  1DMQ A;  1Q9E A;  1EG9 B;  3LT9 A;  1BNI A;  1OUN A;  3H51 A;  4MMZ B;  2K54 A;  2XGN A;  2Z7A A;  1MWU A;  1M1X B;  3MWZ A;  1UUW B;  1VQ5 3;  2KXG A;  4HM1 B;  1NO3 A;  2HMM B;  1UCL A;  1FYS A;  3UB1 A;  1OF5 B;  1YIJ 3;  3IJE B;  4HZ9 B;  1FGT A;  3UL5 A;  1B2U A;  3WA3 A;  1YJ9 3;  1K28 A;  1TFK A;  1RGK A;  3MG1 A;  2OWP A;  1RHL A;  1I3F A;  3G8Z A;  1RSN A;  1A67 A;  1VZZ A;  1W7C A;  3CC7 3;  2ML6 A;  3D4A A;  5CF2 A;  3T8N A;  1T2H A;  1BRI A;  2W56 B;  3NV0 B;  1JZO A;  1NB5 I;  1M90 4;  2XSO B;  1GOY A;  1BNG A;  2K3D A;  1ROV A;  4BL2 A;  1TP6 A;  3CNM A;  1S72 3;  4EW5 A;  4EC6 A;  3Q2P A;  1IV9 A;  1V57 A;  2PZV A;  3EX9 A;  4XBX A;  1GS3 A;  3IPT A;  5IG3 A;  1ZS7 A;  4MMX B;  4I4K A;  3K0Z A;  1Q42 A;  4RBN A;  4L8O A;  1BGS A;  3D3L A;  1CQS A;  3EBT A;  3FKA A;  3F8X A;  4RNY A;  6STD A;  1A90 A;  2Y73 A;  1B27 A;  1BVI A;  3WR2 A;  1NU3 A;  1W2Z A;  1ROA A;  2CWV A;  5ELJ A;  1T3B A;  1YVS A;  3DGL A;  1PFP A;  4ZM8 A;  1Q81 4;  3JUP A;  4XDW A;  5IG0 A;  1Q82 4;  3RDE A;  3MSO A;  4JF8 A;  2KF4 A;  1IQ8 A;  4O2H A;  5EVH A;  5JBS A;  5M18 A;  5M19 A;  1B2X A;  1EQK A;  3PCS A;  1TUH A;  1IVV A;  2KF3 A;  1X1U A;  1IT7 A;  2FXT A;  3D5I A;  4HKV B;  2P38 A;  1OGX A;  3Q3F A;  3J7Y d;  2HMK B;  2W2C A;  4U13 A;  1TU5 A;  1I0X A;  1AV4 A;  1JB4 A;  2F4Y A;  1Q7Y 4;  2RBI A;  5STD A;  2CK3 H;  1O7N B;  2OTJ 3;  4HZB B;  1JRQ A;  5IEN A;  1JKG A;  2ZL8 A;  1IYY A;  1JV2 B;  3LTC A;  4RZM A;  3CNX A;  1E3R A;  2W9P A;  3AGN A;  1PU4 A;  3T0U A;  1UCJ A;  4N6N B;  1IV7 A;  3JUQ A;  2CX1 A;  1D6U A;  1OCV A;  1RKY A;  2IY2 A;  5AIF A;  1PYL A;  2E2V A;  1BNR A;  3DGY A;  3LTA A;  5RNT A;  2RCD A;  2K0M A;  2M7O A;  3AMO A;  3MPH A;  1J2B A;  3CC4 3;  4LZI A;  1LNH A;  2CG0 A;  3KZT A;  2YFL B;  3MYT A;  2BT3 A;  2FGT A;  3EF8 A;  5JPU A;  5LC6 A;  2RNT A;  1V58 A;  2HML B;  1OGZ A;  5DRE A;  8CHO A;  3I55 3;  1RGL A;  4FMC A;  4L7K A;  1GSP A;  1MWS A;  2CW9 A;  1IQY A;  3GAX A;  1A2P A;  3SVA A;  1JB5 A;  3KN4 A;  5GSP A;  2UX0 A;  2WOF A;  3CXC 2;  4MJD A;  4O3V A;  2C4B A;  4FCZ A;  1N9J A;  4EBG A;  1I3I A;  3HZP A;  2BMQ B;  4LMI A;  5AEU B;  4STD A;  1W01 A;  3F7S A;  3EB8 A;  4HYZ A;  3HK4 A;  1KWI A;  4MEI A;  1K73 4;  1WMO A;  3NQZ A;  1LNI A;  5IG5 A;  2F99 A;  4H3U A;  3URP A;  3N8B A;  3V99 A;  2KF5 A;  3Q1C A;  3F7X A;  2MC8 A;  1RNT A;  4J5K A;  3WOE B;  3F14 A;  1YHQ 3;  3HIG A;  2ZHX B;  4WHA A;  1ZO2 A;  5BU4 A;  3DGO A;  3NHX A;  3PGB A;  3OW2 2;  2JQ5 A;  4I5Q A;  3WMD A;  1B2M A;  1GMR A;  5I97 A;  3A5E A;  2O3O A;  4BU4 A;  8RNT A;  5CK6 A;  2QA4 3;  1GD3 A;  1K41 A;  2W03 A;  4ILF A;  5ELU A;  4KT3 B;  3X42 A;  2GSP A;  1BOX A;  3I0Y A;  3H3H A;  1QJG A;  2H0G A;  1JN5 B;  2H0H A;  5FW5 A;  3VF1 A;  3CCS 3;  2MF7 A;  2AAE A;  4KZ1 A;  1FGO A;  1AVL A;  2E2T A;  1CYV A;  2KAA A;  4IT7 A;  4AKZ A;  4GB5 A;  3EBY A;  3KE7 A;  1MWT A;  1KSI A;  1NNV A;  1LOW A;  4WYK B;  1VQ7 3;  4N6T A;  1X1Y A;  3OXA A;  4KFF A;  1HYF A;  5KP3 A;  2SBL A;  2CX0 A;  2CWT A;  2HOH A;  2F98 A;  1VQ8 3;  2QIY A;  4N3V A;  2V1L A;  3GZR A;  4IPB A;  1VQN 3;  4R1K A;  3X41 A;  2BMR B;  3SX1 A;  4LSO A;  3DMC A;  1BAN A;  1BRG A;  2BNG A;  5DRV A;  3WOF B;  3RNT A;  4O8S A;  3CCE 3;  3QK9 A;  5IEP A;  1UI8 A;  2P05 A;  2R41 A;  4NHF A;  1UUG B;  4K1V A;  3TDG A;  3KFQ C;  1TFO A;  2IUK A;  1QAL A;  1WNH A;  1RGG A;  2XF3 A;  2F5M A;  4FCJ A;  1HU9 A;  4WP5 A;  3BNC A;  1R4C A;  3KSE D;  5G1L A;  1JBS A;  1EEJ A;  2CFK A;  1DMN A;  1JN5 A;  1RGF A;  3A76 A;  3NX0 A;  1Y4K A;  3KKG A;  2IUJ A;  3S67 A;  2ZA4 A;  2HMJ B;  3LZA A;  3JUN A;  7STD A;  3GWR A;  1I2F A;  1RTU A;  4FMB A;  3UL6 A;  2CH9 A;  1I0V A;  4TX4 A;  3HX8 A;  2A15 A;  1FZU A;  1BRK A;  3GZX B;  3VSY A;  1WMN A;  3WOD G;  3PXM A;  1BSC A;  1LRA A;  1MOL A;  2BMO B;  2CWU A;  5AI1 A;  3CCM 3;  1VQL 3;  1JBR A;  1K9M 4;  1RRL A;  2FNQ A;  3WA2 X;  1BRH A;  3KSP A;  4HM5 B;  1SQW A;  1OHP A;  4AKY A;  1YIT 3;  5A0O B;  4CJN A;  1GY7 A;  1NJI 4;  3EE1 A;  2YX9 A;  3GSP A;  3MKI A;  2R4I A;  1IVW A;  3PYJ A;  2WGO A;  1RMS A;  2XSH B;  1GMQ A;  1OF5 A;  3DUK A;  5TGN A;  3SOY A;  4AEQ A;  2OCT A;  3K7C A;  1VQ4 3;  3ROB A;  1RRH A;  4G1M B;  1I2G A;  1LVN A;  1LQM B;  5LC7 A;  3I56 3;  3BNE A;  2GU3 A;  3UJM A;  1QVG 2;  2F5W A;  1YVB I;  1UCK A;  1UGI A;  3S29 A;  2CIU A;  1N8R 4;  3CD6 3;  3CC2 3;  1PY3 A;  2W56 A;  4IIA A;  3NV0 A;  4J8T A;  1SAR A;  4NPB A;  4RNZ A;  1W6G A;  3F9S A;  1LOX A;  1BNJ A;  3S28 A;  1DVD A;  5BVB A;  1EA2 A;  3CU3 A;  3WHO A;  4JRF A;  4K61 A;  4FR9 A;  1FGR A;  2YFJ B;  1M1K 4;  4FMA A;  1RJO A;  1TRQ A;  5IEO A;  9RNT A;  4LEH A;  1W6C A;  1NWW A;  2XFS A;  3AHS A;  1DMM A;  3Q90 A;  4NRE A;  1BUJ A;  1GMP A;  5BIR A;  4R9L A;  4HJL B;  4XM4 A;  3DM8 A;  5CXO A;  2BU4 A;  4Q53 A;  5D82 A;  1VQO 3;  4N6O B;  1YNV X;  3V98 A;  1JZD A;  2IMJ A;  1MGR A;  1N9E A;  3N9H A;  3ECF A;  3E99 A;  2GXF A;  2RFR A;  3MHE A;  3CPW 2;  1FUT A;  3CCJ 3;  3LOY A;  2XEP A;  3NUV A;  4OUQ A;  1VQ6 3;  1DET A;  3EN8 A;  2P0M A;  1A2K A;  3B7C A;  1EUI C;  5AEW B;  2GBX B;  3U97 A;  2SAR A;  3BND A;  2IYJ A;  1RN7 A;  2QEX 3;  1US1 A;  4HAA A;  3OX9 A;  1I2E A;  1SJW A;  2GBW B;  4ORL A;  4BTW A;  1UGH I;  1BUQ A;  1KC8 4;  2W0Q A;  2RSX A;  5IW9 A;  3EQQ B;  3VGN A;  3PZW A;  3G16 A;  1T5Y A;  4N6U A;  3ER7 A;  3SED A;  1JNQ A;  1WQL B;  1IDP A;  1UUV B;  4BTX A;  1YJN 3;  2ZDJ A;  1KD1 4;  3CMA 3;  3F8H A;  1C7H A;  4GSP A;  1CEW I;  3CME 3;  4R4K A;  1BAO A;  3AHW A;  5EQL A;  1WTH A;  3MG2 A;  2ML5 A;  3G6E 3;  1ULI B;  4CDL A;  3SLU A;  3FF0 A;  2CG1 A;  3LYG A;  1Q40 B;  1JBT A;  2IA7 A;  1LQG C;  2Z76 A;  1FUS A;  4HOH A;  1BNF A;  1VQP 3;  1IVU A;  5G2G A;  1VQK 3;  3FG1 A;  2H0I A;  4XDV A;  4RNT A;  3RGA A;  2E2U A;  1QAK A;  3SOA A;  1BSD A;  3QRD A;  2GEX A;  3GZY B;  3EC9 A;  1YGW A;  3LML A;  4KFD A;  1O7W B;  5AII A;  1SPU A;  3LH4 A;  3X3Z A;  5CLK A;  1BRN L;  3HI7 A;  1I8V A;  1OPY A;  1Z1S A;  4BTY A;  1CYU A;  3FG3 A;  1O7H B;  3G71 3;  3EHC A;  3FH1 A;  1ZGX A;  3CCU 3;  2WO0 A;  3DGN A;  2OQE C;  1BU4 A;  2XRX B;  4BIR A;  2BIR A;  1GYB A;  2B24 B;  1RNB A;  1KQS 2;  4EXR A;  2CKF B;  4J5G A;  2LQV A;  2HMN B;  2PNC A;  5AYR B;  4J9A A;  1BRJ A;  3KCH A;  1VQ9 3;  4KFE A;  4HVN A;  1B20 A;  2KCD A;  2UGI A;  3SYU A;  3FLJ A;  1JJ2 2;  1S5A A;  3D79 A;  4PEJ A;  2BHM A;  1HZ1 A;  3BB9 A;  1TTO A;  2F56 A;  3HOH A;  3ZFZ A;  1N5H A;  1U8C B;  1QAF A;  1RN4 A; 
#chains in the Genus database with same CATH homology
 2CFD A;  3PS8 A;  1O7G B;  2JDI H;  3HII A;  1AR0 A;  3GRD A;  5JPP A;  1N8Q A;  1Q86 4;  4EYC A;  1JB2 A;  2Y74 A;  1GY5 A;  2O9U X;  3D9R A;  2STD A;  3DZL A;  4WYK A;  2D42 A;  1W2B 2;  2WOH A;  3EN1 B;  4XB5 A;  1OHO A;  3L0R A;  1QMA A;  4L8P A;  3U1W A;  1IT8 A;  4EV2 A;  5KP4 A;  1M9G A;  2C10 A;  3LTD A;  5FGO A;  1L5G B;  3IMA B;  1NDO B;  4HM2 B;  1FA3 A;  1E3V A;  3NBJ A;  3CCV 3;  3S5C A;  3CCL 3;  1U5O A;  3N54 B;  3SXX A;  1STD A;  1STF I;  3CCQ 3;  3STD A;  3T8U A;  5EEO A;  1EKM A;  4H61 A;  1TIJ A;  3O8Y A;  4XBT A;  1AVK A;  1V74 A;  3K63 A;  2QGU A;  1F8N A;  1SII A;  3OWY A;  1NB3 I;  3LTB A;  1IK3 A;  2P09 A;  2BO9 B;  3X3X A;  1ISK A;  1ULJ B;  2C11 A;  1IQX A;  5AIH A;  3G4S 3;  4KVH A;  1JKG B;  2CFW A;  1WMP A;  3PCR A;  3B4O A;  1OHS A;  3CPO A;  5IF6 A;  1D6Z A;  1YI2 3;  4HM7 B;  2HMO B;  4LGQ A;  4O02 B;  4MMY B;  2KRT A;  4X2O A;  3FZW A;  3S27 A;  3AMO B;  2OOV C;  5BXQ A;  2OOV A;  3KII A;  3B8L A;  4CCV A;  4K90 B;  1SIH A;  1HKX A;  3OWS A;  2W9Q A;  5D83 A;  2I9W A;  3DY5 A;  1K8A 4;  1A2V A;  1ASK A;  2CC3 A;  1OAC A;  2Q07 A;  3RGR A;  4HM8 B;  3OV4 A;  3V92 A;  2YFI B;  3EJV A;  4OVM A;  1W6Y A;  1W02 A;  4HM4 B;  2Z77 A;  2CFL A;  4GL6 A;  5HGR A;  2LYX A;  4N6V 0;  1LXE A;  3GZB A;  3BLZ A;  2W6J H;  3BNB A;  4HM3 B;  3MG3 A;  4WFO A;  2CFG A;  5IG4 A;  4HM6 B;  1W00 A;  3UNL A;  5AYS C;  4R80 A;  5IER A;  1FUW A;  1N5P A;  4HM0 B;  5KP1 A;  1UW1 A;  1FGQ A;  3X3Y A;  3JUO A;  4QWT A;  1U8C B;  2OTL 3;  4EV5 A;  4K1U A;  2W04 A;  3FSD A;  1MNL A;  3F40 A;  1W4N A;  4XBY A;  3G0K A;  1E97 A;  2XH9 A;  3NQY A;  5D81 A;  1O7P B;  1ZX2 A;  2CHC A;  1DVC A;  3NBB A;  3OWU A;  1OH0 A;  4N6L A;  2XR8 B;  4R9K A;  1W5Z A;  2OQE A;  2XGL A;  3DGM A;  1D6Y A;  3FG4 A;  4FCM A;  2XFT A;  2Z6B A;  1Q40 A;  2GU1 A;  3LT8 A;  3LXU X;  3JUM A;  5CF1 A;  3X40 A;  1GD4 A;  3FF2 A;  4FMD A;  2F86 B;  1G96 A;  1UI7 A;  2RGQ A;  3FGY A;  4N6M A;  1VQM 3;  3WDG B;  1YGE A;  2P0X A;  3NM7 A;  3CCR 3;  3NM2 A;  4X2H A;  1IVX A;  3K5T A;  4HBR A;  1QVF 2;  5AIG A;  1GY6 A;  4WWU C;  1IU7 A;  3DXO A;  3M8C A;  3JVC A;  3NBR A;  2L4V A;  3K9M C;  3ALA A;  3FCS B;  3B4P A;  1DYU A;  2INX A;  4OK0 A;  1YJW 3;  2B1X B;  2GEY A;  1FGM A;  1O7M B;  2D1W A;  1DMQ A;  1EG9 B;  3LT9 A;  1OUN A;  3H51 A;  4MMZ B;  2K54 A;  2XGN A;  2Z7A A;  1M1X B;  3MWZ A;  1UUW B;  1VQ5 3;  2KXG A;  4HM1 B;  1NO3 A;  2HMM B;  3UB1 A;  1OF5 B;  1YIJ 3;  3IJE B;  4HZ9 B;  1FGT A;  3UL5 A;  3WA3 A;  1YJ9 3;  1K28 A;  1TFK A;  3MG1 A;  2OWP A;  3G8Z A;  1A67 A;  1VZZ A;  1W7C A;  3CC7 3;  2ML6 A;  5CF2 A;  3T8N A;  2W56 B;  3NV0 B;  1NB5 I;  1M90 4;  2XSO B;  1ROV A;  1TP6 A;  3CNM A;  1S72 3;  4EC6 A;  3Q2P A;  1IV9 A;  3EX9 A;  2PZV A;  5IG3 A;  4XBX A;  1GS3 A;  3IPT A;  4MMX B;  4I4K A;  3K0Z A;  1Q42 A;  4RBN A;  4L8O A;  3D3L A;  1CQS A;  3EBT A;  3FKA A;  3F8X A;  4RNY A;  6STD A;  1A90 A;  2Y73 A;  1NU3 A;  1W2Z A;  1ROA A;  2CWV A;  5ELJ A;  3DGL A;  1PFP A;  4ZM8 A;  1Q81 4;  3JUP A;  4XDW A;  5IG0 A;  1Q82 4;  3RDE A;  3MSO A;  4JF8 A;  1IQ8 A;  4O2H A;  5EVH A;  5JBS A;  1EQK A;  3PCS A;  1TUH A;  1IVV A;  1IT7 A;  2FXT A;  4HKV B;  2P38 A;  1OGX A;  3J7Y d;  2HMK B;  2W2C A;  4U13 A;  1TU5 A;  1AV4 A;  1JB4 A;  1Q7Y 4;  5STD A;  2CK3 H;  1O7N B;  2OTJ 3;  4HZB B;  1JRQ A;  5IEN A;  1JKG A;  2ZL8 A;  1JV2 B;  3LTC A;  4RZM A;  3CNX A;  1E3R A;  2W9P A;  1PU4 A;  3T0U A;  4N6N B;  1IV7 A;  3JUQ A;  1D6U A;  1OCV A;  1RKY A;  5AIF A;  2E2V A;  3LTA A;  2RCD A;  2K0M A;  2M7O A;  3AMO A;  3MPH A;  1J2B A;  3CC4 3;  4LZI A;  1LNH A;  2CG0 A;  3KZT A;  2YFL B;  3MYT A;  2BT3 A;  2FGT A;  3EF8 A;  5JPU A;  5LC6 A;  3I55 3;  2HML B;  1OGZ A;  5DRE A;  8CHO A;  4FMC A;  4L7K A;  2CW9 A;  3SVA A;  3GAX A;  1IQY A;  1JB5 A;  3KN4 A;  3CXC 2;  2UX0 A;  2WOF A;  4MJD A;  4O3V A;  4FCZ A;  1N9J A;  4EBG A;  3HZP A;  2BMQ B;  4LMI A;  5AEU B;  4STD A;  1W01 A;  3F7S A;  3EB8 A;  4HYZ A;  3HK4 A;  1KWI A;  4MEI A;  1K73 4;  1WMO A;  3NQZ A;  5IG5 A;  2F99 A;  4H3U A;  3N8B A;  3Q1C A;  3F7X A;  2MC8 A;  3WOE B;  1YHQ 3;  3F14 A;  3HIG A;  4WHA A;  1ZO2 A;  3DGO A;  3NHX A;  3PGB A;  3OW2 2;  2JQ5 A;  3WMD A;  5I97 A;  2O3O A;  5CK6 A;  2QA4 3;  1GD3 A;  1K41 A;  2W03 A;  5ELU A;  3X42 A;  3I0Y A;  3H3H A;  1QJG A;  5FW5 A;  1JN5 B;  3VF1 A;  3CCS 3;  2MF7 A;  4KZ1 A;  1FGO A;  1AVL A;  2E2T A;  1CYV A;  4IT7 A;  4AKZ A;  4GB5 A;  3EBY A;  3KE7 A;  1KSI A;  4WYK B;  1VQ7 3;  4N6T A;  3OXA A;  4KFF A;  5KP3 A;  2SBL A;  2CWT A;  1VQ8 3;  2F98 A;  2QIY A;  4N3V A;  2V1L A;  3GZR A;  4IPB A;  1VQN 3;  4R1K A;  3X41 A;  2BMR B;  3SX1 A;  4LSO A;  3DMC A;  2BNG A;  3WOF B;  5DRV A;  3CCE 3;  4O8S A;  3QK9 A;  5IEP A;  1UI8 A;  2P05 A;  4NHF A;  4K1V A;  3TDG A;  3KFQ C;  1TFO A;  2IUK A;  1QAL A;  1WNH A;  2XF3 A;  4FCJ A;  1HU9 A;  4WP5 A;  3BNC A;  1R4C A;  3KSE D;  2CFK A;  1DMN A;  1JN5 A;  3A76 A;  2IUJ A;  3NX0 A;  1Y4K A;  3KKG A;  3S67 A;  7STD A;  3LZA A;  2HMJ B;  3JUN A;  3GWR A;  4FMB A;  3UL6 A;  2CH9 A;  4TX4 A;  3HX8 A;  2A15 A;  3GZX B;  3VSY A;  1WMN A;  3WOD G;  3PXM A;  5AI1 A;  2CWU A;  1MOL A;  2BMO B;  3CCM 3;  1VQL 3;  1K9M 4;  1RRL A;  2FNQ A;  3WA2 X;  3KSP A;  4HM5 B;  1SQW A;  1OHP A;  4AKY A;  1YIT 3;  5A0O B;  1GY7 A;  1NJI 4;  3EE1 A;  2YX9 A;  3MKI A;  2R4I A;  1IVW A;  3PYJ A;  2WGO A;  3V99 A;  2XSH B;  1OF5 A;  3DUK A;  5TGN A;  3SOY A;  4AEQ A;  2OCT A;  3K7C A;  1VQ4 3;  3ROB A;  1RRH A;  4G1M B;  1LVN A;  5LC7 A;  3I56 3;  3BNE A;  2GU3 A;  3UJM A;  1QVG 2;  1YVB I;  3S29 A;  3CD6 3;  2CIU A;  1N8R 4;  3CC2 3;  2W56 A;  4IIA A;  3NV0 A;  4J8T A;  4RNZ A;  3S28 A;  1W6G A;  3F9S A;  1LOX A;  1DVD A;  5BVB A;  1EA2 A;  3CU3 A;  4JRF A;  4K61 A;  4FR9 A;  1FGR A;  2YFJ B;  1M1K 4;  4FMA A;  1RJO A;  5IEO A;  4LEH A;  1W6C A;  1NWW A;  2XFS A;  3Q90 A;  1DMM A;  4NRE A;  4R9L A;  4HJL B;  4XM4 A;  3DM8 A;  5CXO A;  4Q53 A;  5D82 A;  1VQO 3;  4N6O B;  3V98 A;  2IMJ A;  1N9E A;  3N9H A;  3ECF A;  3E99 A;  2GXF A;  2RFR A;  3MHE A;  3CPW 2;  3CCJ 3;  1VQ6 3;  3LOY A;  2XEP A;  3NUV A;  4OUQ A;  3EN8 A;  2P0M A;  1A2K A;  3B7C A;  5AEW B;  2GBX B;  3U97 A;  3BND A;  1RN7 A;  2QEX 3;  1US1 A;  3OX9 A;  1SJW A;  2GBW B;  4ORL A;  4BTW A;  1BUQ A;  1KC8 4;  2W0Q A;  2RSX A;  5IW9 A;  3EQQ B;  3VGN A;  3PZW A;  3G16 A;  1T5Y A;  4N6U A;  3ER7 A;  3SED A;  1JNQ A;  1WQL B;  1IDP A;  1UUV B;  4BTX A;  1YJN 3;  2ZDJ A;  1KD1 4;  3CMA 3;  3F8H A;  1C7H A;  1CEW I;  3CME 3;  4R4K A;  5EQL A;  1WTH A;  3MG2 A;  2ML5 A;  3G6E 3;  1ULI B;  4CDL A;  3SLU A;  3FF0 A;  2CG1 A;  3LYG A;  1Q40 B;  2IA7 A;  2Z76 A;  1VQP 3;  1IVU A;  5G2G A;  1VQK 3;  3FG1 A;  4XDV A;  3RGA A;  2E2U A;  1QAK A;  3SOA A;  3QRD A;  2GEX A;  3GZY B;  3EC9 A;  3LML A;  4KFD A;  1O7W B;  5AII A;  1SPU A;  3LH4 A;  3X3Z A;  5CLK A;  3HI7 A;  1OPY A;  1Z1S A;  4BTY A;  1CYU A;  3FG3 A;  1O7H B;  3G71 3;  3EHC A;  3FH1 A;  3CCU 3;  2WO0 A;  3DGN A;  2OQE C;  2XRX B;  1GYB A;  2B24 B;  1KQS 2;  4EXR A;  2CKF B;  2LQV A;  2HMN B;  2PNC A;  5AYR B;  4J9A A;  1VQ9 3;  4KFE A;  4HVN A;  2KCD A;  3FLJ A;  1JJ2 2;  1S5A A;  4PEJ A;  2BHM A;  3BB9 A;  1N5H A;  2WGQ A;  1QAF A;  3NXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...