3PYJA

Reduced sweetness of a monellin (mnei) mutant results from increased protein flexibility and disruption of a distant poly-(l-proline) ii helix
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
GEWEIIDIGPFTQNLAKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reduced Sweetness of a Monellin (MNEI) Mutant Results from Increased Protein Flexibility and Disruption of a Distant Poly-(L-Proline) II Helix.
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
molecule keywords Monellin chain B/Monellin chain A chimeric protein
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09200 Monellin Monellin
A PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3pyjA00
4N6TA 1DVCA 1NB5I 1MNLA 4CCVA 3UL5A 1YVBI 4TX4A 1KWIA 5EQLA 3KSED 3MWZA 1ROAA 3UL6A 2W9PA 1MOLA 4EYCA 3IMAB 1CYUA 3PS8A 1EQKA 1N5PA 4N6NB 1RN7A 2CH9A 4N6UA 5ELJA 3GAXA 3SVAA 3QRDA 1FUWA 4ZM8A 1CEWI 3PYJA 4N6V0 4N6OB 4N6LA 1N9JA 2O9UX 2BO9B 1A90A 1IV7A 1GD4A 3S67A 1LXEA 1CYVA 4N6MA 2OCTA 1FA3A 1GD3A 3L0RA 5ELUA 5LC6A 1M9GA 1WNHA 1IV9A 2W9QA 1G96A 3K9MC 1R4CA 3NX0A 4LZIA 5LC7A 2KXGA 3LH4A 1DVDA 1PFPA 1TIJA 3Q2PA 1STFI 1NB3I 3KFQC 4IT7A 5A0OB 1N5HA 3PXMA 1A67A
chains in the Genus database with same CATH superfamily
2HMMB 3CC73 1GYBA 1B21A 3LYGA 1IYYA 3DZLA 3V99A 2SARA 4U13A 5TGNA 1IT8A 1OCVA 2D42A 2F5WA 2ZDJA 1E97A 3ER7A 5FGOA 2C11A 1T2IA 1N5PA 2RSXA 4GL6A 1CYUA 2XF3A 1B2ZA 4N6V0 2O3OA 6RNTA 1W5ZA 2CWTA 3J7Yd 1CH0A 2KRTA 2OWPA 5D82A 4EV5A 3G713 3ZG0A 3WDGB 5LC7A 1WNHA 3LT9A 2J8XB 3AMOA 1MGRA 2A15A 2W04A 1V74A 4LMIA 5IG0A 1RJOA 4WYKB 5M1AA 1IVWA 4HJLB 4FMCA 4WWUC 4RBNA 2FGTA 1RKYA 2P05A 3O8YA 1RNBA 1U8CB 1PU4A 2HMKB 1JV2B 1AVLA 4CPKA 1VQ63 5AIGA 1TFKA 1AR0A 2BNGA 2IMJA 2STDA 5AYSC 1NDOB 4LGQA 3G6E3 5JPUA 2CFKA 4AKYA 4BTYA 5IG5A 2QA43 1LVNA 2FNQA 4AKZA 1RN7A 2BIRA 3JUQA 3AHWA 1VZZA 1FUTA 4MEIA 1DMMA 2E2TA 2RGQA 4XDVA 4XBTA 1RGCA 6GSPA 2O9UX 1IQ8A 4GSPA 1M1K4 1B2XA 1GD3A 1KQS2 1OF5A 1OF5B 1I3IA 1YI23 2JQ5A 2KXGA 2C4BA 3CCL3 1U5OA 3I0YA 4G1MB 3X3YA 3D9RA 1K9M4 2WGQA 1FW7A 5FW5A 3GWRA 1TUHA 1RGFA 3MSOA 5D83A 5STDA 1W7CA 1I2EA 1ULIB 3X40A 1VQ73 1MOLA 4KZ1A 3WODG 1A2PA 3N8BA 2GU3A 4H3UA 2P0MA 4ZM8A 1KD14 1Q40B 3CCM3 3I563 4MMXB 1K8A4 4KFDA 3LOYA 3ECFA 1GS3A 2Z6BA 4K1UA 3T8NA 5IG3A 1UI8A 1JB4A 3NV0B 1JB5A 2H0HA 3NM2A 3OWUA 1NB3I 3BIRA 1RCLA 1VQQA 4HM7B 1R4YA 2IUKA 1MWSA 2Z76A 3EJVA 4HKVB 1YJW3 3CD63 1NNVA 1RGGA 4HOHA 3E99A 2CK3H 4HM2B 4K90B 3U97A 3UL6A 4L8PA 2P0XA 4BL3A 1YIJ3 2FXTA 1BRNL 4WYKA 2JDIH 2KF5A 3GZBA 3OX9A 4N6NB 4N6UA 3KN4A 2L4VA 2WO0A 3S29A 3CCQ3 1FUWA 2HMLB 2SBLA 1W4NA 1FGOA 3EE1A 4N6OB 1RGAA 7RNTA 2F98A 1GOVA 1GD4A 3EQQB 3S67A 1TU5A 1CYVA 1W00A 4N3VA 1NWWA 3HZPA 3NM7A 3D5IA 5AIHA 5HGRA 1W6CA 5KP1A 3IPTA 1LOYA 1JZDA 2GBWB 5M19A 1EUIC 1ZGXA 1EG9B 2RCDA 5IG4A 3ALAA 2BMOB 3CME3 1W2B2 4RNZA 1DVCA 1NJI4 3MG2A 3NQZA 1QVF2 5AYRB 1BANA 2XR8B 1I70A 1WQLB 1YVBI 2BT3A 4K1VA 1IVVA 1OH0A 3PZWA 5IW9A 4EC6A 1UW1A 3OWSA 4GB5A 3UJMA 2CIUA 8RNTA 1VQ83 2XSHB 3K7CA 3QRDA 4MJDA 1GMPA 1HKXA 3CCV3 3EBYA 3FSDA 3KKGA 2OOVA 5M18A 3SXXA 4WFOA 1BOXA 1DE3A 3L0RA 1IT7A 1RN1A 1HZ1A 1E3VA 1WMOA 2IYJA 3DGOA 3HOHA 4CDLA 3NBRA 3NQYA 5IF6A 1B27A 1Q40A 2GU1A 1EKMA 3D79A 1GMRA 1JKGA 4KFFA 1NB5I 2CWVA 1AVKA 3K5TA 1HU9A 3KSPA 2OQEA 5BIRA 1SIIA 4GHOA 5G1KA 1M904 3KSED 1IVUA 3CPOA 3OWYA 1D6UA 3LTAA 1GY6A 1O7PB 1BRGA 3G0KA 1FGRA 2UGIA 3MHEA 3HIGA 4CJNA 1LRAA 3GAXA 2D1WA 2PNCA 4L8OA 3PYJA 1YGEA 3BNDA 1IDPA 2BO9B 2OOVC 3H3HA 3CCE3 1FA3A 2PZVA 5CK6A 1FYSA 4J9AA 1Q864 1AY7A 2K54A 1EEJA 5ELUA 2W9QA 3LZAA 4DKIA 3M8CA 2MF7A 1K734 2IUJA 1SARA 2MC8A 1BIRA 1UDII 1N5HA 1RGKA 1RRLA 3EN8A 4EW5A 4MMZB 1W01A 5G2GA 1Q7Y4 2INXA 3T0UA 4FMDA 1QAFA 1ROVA 5EQLA 1RMSA 2GSPA 3FG3A 4ORLA 3FZWA 5RNTA 2LQVA 4EYCA 4NHFA 3FF0A 1OHOA 3VF1A 3ZFZA 1BNRA 4BU4A 4NPBA 3OW22 2CH9A 1T5YA 4X2OA 3DY5A 1V57A 1YNVX 2HOHA 1STDA 3ROBA 1PYLA 2GEYA 1GOYA 5AEUB 5GSPA 1JZOA 2HMJB 3DGLA 4HZ9B 1YHQ3 1IV9A 1RDSA 3BLZA 1B2SA 2YFJB 3AMOB 1UGHI 3LH4A 4FCJA 1RHLA 2LYXA 1TIJA 4FMAA 4K61A 5IEPA 1VQO3 1GY5A 5AI1A 1UUVB 3LTDA 1A2VA 3B8LA 1YGWA 3JUMA 2C10A 4JRFA 3WOFB 1T2HA 3DMCA 5DREA 2CX0A 3LTBA 4STDA 1V58A 2HMNB 1I3FA 3MWZA 4HM0B 1D6ZA 1VQ43 3D4AA 1RTUA 3EX9A 1DMQA 1IVXA 2RBIA 2XRXB 3FKAA 3GSPA 3NBJA 2ZL8A 1O7NB 1EQKA 3FGYA 3EN1B 1BRIA 1BSBA 1ISKA 2RNTA 1N9JA 1RGHA 1UUWB 2KCDA 2WOHA 1A90A 5AIIA 1NO3A 2OCTA 2ML6A 1RSNA 3MPHA 5LC6A 3FF2A 2GEXA 1IU7A 1UCJA 4HM6B 3RDEA 4BL2A 1MWRA 1VQ53 3Q3FA 2ML5A 3MKIA 2Y74A 1RNTA 3WHOA 3KE7A 4N6TA 3H51A 1US1A 2YFLB 1B2MA 2ZA4A 5I97A 3PGBA 3VGNA 1N8R4 3U1WA 2HMOB 3Q1CA 1WMPA 1ZO2A 2CFGA 3VSYA 4QWTA 3EF8A 1QVG2 1T3BA 3IMAB 4OUQA 1BSEA 1B3SA 2XFSA 1M1XB 2XEPA 1OPYA 1N8QA 3GZRA 3HIIA 7GSPA 4NREA 3IJEB 2KF6A 2P38A 3N9HA 1VQK3 2L1SA 1TJDA 1X1YA 1IK3A 2F86B 1LOWA 1BRKA 1YJN3 4O8SA 1LNHA 5AEWB 1X1XA 2E2UA 1GSPA 1ULJB 4R9LA 1G02A 1W6GA 1N9EA 4R80A 3WOEB 4KT3B 2KF4A 1FUSA 9RNTA 1EA2A 2QGUA 2W0QA 3F8XA 4BIRA 2E2VA 3PXMA 2OTJ3 3UB1A 2IY2A 1BUJA 3B4OA 3F8HA 1BUQA 1JJ22 1WMNA 3B7CA 3GRDA 3HK4A 1IQYA 2W9PA 2F56A 1ZS7A 3WR2A 1SIHA 4I4KA 2W03A 4HM5B 4OVMA 5D81A 3SLUA 1FZUA 3WA2X 1K41A 1K28A 2CW9A 2P09A 2YX9A 3X41A 1RLSA 1AQZA 3FG1A 1BRSA 1NU3A 1IQXA 3MG3A 3K9MC 1C54A 1LOXA 1Z1SA 2F5MA 2K0MA 1Q814 1JN5B 1VQ93 5IEOA 1Q9EA 1UGIA 3RNTA 1J2BA 3HI7A 1YJ93 5BU4A 1A67A 1B2UA 1BNEA 1LQMB 4Q53A 1MNLA 4CCVA 1JBSA 2XFTA 1C7HA 2AADA 1KWIA 2CFWA 4LYLB 1YIT3 4EXRA 1ROAA 3CCR3 3PCRA 3DM8A 4HM8B 4JF8A 1W6YA 5EEOA 1KC84 1JB2A 3JUNA 3DH2A 3X42A 3LT8A 1SQWA 5G1LA 2XGNA 4FMBA 4KVHA 3CMA3 1UI7A 3DGYA 3NUVA 1IV7A 4J5GA 1RGEA 4FCZA 2R41A 3JUPA 4AEQA 3SYUA 1M9GA 1BRHA 1TRPA 1QALA 1R4CA 4LZIA 1OHSA 5KP4A 3D5GA 4EBGA 3TDGA 1BGSA 1RN4A 4XBYA 3V92A 2ZHXB 1MGWA 2CX1A 1GY7A 1SJWA 5CF1A 6STDA 4R9KA 3X3ZA 1ASKA 1OHPA 1Y4KA 2CHCA 1BNGA 2OQEC 3HX8A 4HVNA 5BXQA 3CNXA 1I8VA 3FH1A 1KSIA 2WGOA 4HM4B 2BHMA 3LXUX 5JPPA 3URPA 1CEWI 4ILFA 3NBBA 3PCSA 2CG1A 2CFLA 4R4KA 5AIFA 1I0XA 3S5CA 1RRHA 3CCU3 3AHSA 2F4YA 2H0IA 5EVHA 4XM4A 1L5GB 1YVSA 3CXC2 1VQM3 2I9WA 1A2KA 4BTXA 1O7WB 5CXOA 4IT7A 5A0OB 5IENA 4R1KA 3EB8A 4IPBA 1QAKA 1S5AA 3LMLA 1OGXA 1VQL3 3UL5A 2CFDA 2XH9A 3SEDA 1G0TA 3DXOA 4H61A 3GZYB 4HZBB 1JN5A 1O7GB 1X1WA 1TTOA 2CG0A 4XB5A 3F40A 3ZG5A 4FR9A 2Y73A 1BNJA 1D6YA 4WP5A 2KF3A 4EV2A 1BNIA 1S723 1LQGC 3NHXA 4RNYA 4RZMA 3KCHA 1BSCA 3CCJ3 5KP3A 1G96A 4WHAA 1Q42A 1BU4A 3RGRA 3EHCA 4XBXA 3I553 1DVDA 1PFPA 3Q2PA 3CNMA 1VQP3 1QMAA 1TFOA 1LOVA 3NXJA 5BVBA 1Q824 1UUGB 3DGNA 1DETA 2RFRA 4IIAA 3WMDA 2CWUA 3G8ZA 1X1UA 3EC9A 3S27A 7STDA 5JBSA 1JNQA 3A76A 2Z77A 3AGOA 3CPW2 3F9SA 1O7MB 4J5KA 1VQN3 1DYUA 2W6JH 2AAEA 2CKFB 1CQSA 2WOFA 4L7KA 1WTHA 3A5EA 4O3VA 3CC43 1TP6A 1W2ZA 1OACA 4LSOA 2H0GA 1BRJA 1RCKA 1B20A 1W02A 1BVIA 3G16A 4OK0A 3AGNA 1I2FA 4HAAA 3STDA 1DMNA 3GZXB 1LXEA 3BNEA 2GXFA 2KAAA 1BNFA 3BNCA 2B1XB 3SOYA 3RGAA 3NX0A 3BB9A 2CC3A 3FCSB 5CF2A 2BMRB 3CU3A 3F7SA 1E3RA 5HOHA 2OTL3 2K3DA 4J8TA 3F7XA 3CC23 1AV4A 3SOAA 3FLJA 1JRQA 2XSOB 3B4PA 1MWUA 1BSDA 4TX4A 5IERA 2BU4A 2IA7A 3QK9A 4HM1B 2W2CA 1JBRA 2UUGC 3X3XA 3V98A 2UX0A 3BU4A 3FG4A 4FCMA 1LNIA 3PS8A 4O02B 3JUOA 1FGQA 1UCKA 2YFIB 3EBTA 5ELJA 3LTCA 4BTWA 4KFEA 1Q7HA 1I0VA 1O7HB 2Q07A 4MMYB 4X2HA 4RNTA 4N6MA 1TRQA 1UCLA 2W56B 4PEJA 3MYTA 2W56A 1PY3A 3F14A 3DGMA 1MWTA 2GBXB 3DUKA 3N54B 2B24B 1STFI 1JBTA 4HM3B 1FGMA 3S28A 4LEHA 2V1LA 3MG1A 1JKGB 3KIIA 2R4IA 5DRVA 1QJGA 1HYFA 2Z7AA 1UCIA 1BSAA 3D3LA 3NV0A 2QEX3 1GOUA 2QIYA 4O2HA 2F99A 3BNBA 1BNSA 1ZX2A 4I5QA 3SVAA 1OGZA 3SX1A 3UNLA 3CCS3 3KZTA 4N6LA 3K0ZA 2BMQB 3OV4A 5CLKA 8CHOA 1GMQA 1I2GA 3T8UA 1F8NA 3OXAA 1SPUA 2M7OA 3Q90A 1OUNA 1RGLA 4HBRA 1FGTA 4XDWA 4HYZA 3KFQC 3WA3A 3JVCA 3K63A 3G4S3 2XGLA 1BAOA
chains in the Genus database with same CATH topology
2HMMB 3CC73 1GYBA 3LYGA 3DZLA 3V99A 4U13A 5TGNA 1IT8A 1OCVA 2D42A 2ZDJA 1E97A 3ER7A 5FGOA 2C11A 2RSXA 1N5PA 1CYUA 4GL6A 2XF3A 4N6V0 2O3OA 1W5ZA 2CWTA 3J7Yd 2KRTA 5D82A 2OWPA 4EV5A 3G713 3WDGB 5LC7A 1WNHA 3LT9A 3AMOA 4LMIA 2A15A 2W04A 1V74A 5IG0A 1RJOA 4WYKB 1IVWA 4HJLB 4FMCA 4WWUC 4RBNA 2FGTA 1RKYA 2P05A 3O8YA 1U8CB 1PU4A 2HMKB 1JV2B 1AVLA 1VQ63 5AIGA 1TFKA 1AR0A 2BNGA 2IMJA 2STDA 5AYSC 1NDOB 4LGQA 3G6E3 5JPUA 2CFKA 4AKYA 4BTYA 5IG5A 2QA43 1LVNA 2FNQA 4AKZA 1RN7A 3JUQA 1VZZA 4MEIA 1DMMA 2E2TA 2RGQA 4XDVA 4XBTA 2O9UX 1IQ8A 1M1K4 1GD3A 1KQS2 1OF5A 1OF5B 1YI23 2JQ5A 2KXGA 3CCL3 1U5OA 3I0YA 4G1MB 3X3YA 3D9RA 1K9M4 2WGQA 5FW5A 3GWRA 1TUHA 5D83A 3MSOA 5STDA 1W7CA 1ULIB 3X40A 1VQ73 1MOLA 4KZ1A 3WODG 3N8BA 2GU3A 4H3UA 2P0MA 4ZM8A 1KD14 1Q40B 3CCM3 3I563 4MMXB 1K8A4 4KFDA 3LOYA 3ECFA 1GS3A 2Z6BA 4K1UA 3T8NA 5IG3A 1UI8A 1JB4A 3NV0B 1JB5A 3NM2A 3OWUA 1NB3I 4HM7B 2IUKA 4HKVB 2Z76A 3EJVA 1YJW3 3CD63 4K90B 3E99A 2CK3H 4HM2B 3U97A 3UL6A 4L8PA 2P0XA 1YIJ3 2FXTA 4WYKA 2JDIH 3GZBA 3OX9A 4N6NB 4N6UA 3KN4A 2L4VA 2WO0A 3S29A 3CCQ3 1FUWA 2HMLB 2SBLA 1W4NA 1FGOA 3EE1A 4N6OB 2F98A 3EQQB 1GD4A 1TU5A 3S67A 1CYVA 1W00A 4N3VA 1NWWA 3HZPA 3NM7A 5AIHA 5HGRA 1W6CA 5KP1A 3IPTA 2GBWB 5IG4A 2RCDA 1EG9B 3ALAA 2BMOB 3CME3 1W2B2 4RNZA 1DVCA 1NJI4 3MG2A 3NQZA 1QVF2 5AYRB 2XR8B 1WQLB 1YVBI 2BT3A 4K1VA 1IVVA 1OH0A 3PZWA 5IW9A 4EC6A 1UW1A 3OWSA 4GB5A 3UJMA 2CIUA 1VQ83 2XSHB 3K7CA 3QRDA 4MJDA 1HKXA 3CCV3 3EBYA 3FSDA 3KKGA 2OOVA 3SXXA 4WFOA 3L0RA 1IT7A 1E3VA 1WMOA 3DGOA 4CDLA 3NBRA 3NQYA 5IF6A 1Q40A 2GU1A 1EKMA 1JKGA 4KFFA 1NB5I 2CWVA 1AVKA 3K5TA 1HU9A 3KSPA 2OQEA 1M904 1SIIA 3KSED 1IVUA 3CPOA 3OWYA 1D6UA 3LTAA 1GY6A 1O7PB 3G0KA 1FGRA 3MHEA 3HIGA 3GAXA 2D1WA 2PNCA 4L8OA 3PYJA 1YGEA 3BNDA 1IDPA 2BO9B 2OOVC 3H3HA 3CCE3 1FA3A 2PZVA 5CK6A 4J9AA 1Q864 2K54A 5ELUA 2W9QA 3LZAA 3M8CA 2MF7A 1K734 2IUJA 2MC8A 1N5HA 1RRLA 3EN8A 4MMZB 1W01A 5G2GA 1Q7Y4 2INXA 3T0UA 4FMDA 1QAFA 1ROVA 5EQLA 3FG3A 4ORLA 3FZWA 2LQVA 4EYCA 4NHFA 3FF0A 1OHOA 3VF1A 3OW22 2CH9A 1T5YA 4X2OA 3DY5A 1STDA 3ROBA 2GEYA 5AEUB 3DGLA 2HMJB 4HZ9B 1YHQ3 1IV9A 3BLZA 4FCJA 2YFJB 3AMOB 3LH4A 1JJ22 4K61A 2LYXA 5IEPA 1TIJA 4FMAA 1VQO3 1GY5A 5AI1A 1UUVB 3LTDA 1A2VA 3B8LA 3JUMA 2C10A 4JRFA 3WOFB 3DMCA 5DREA 3LTBA 4STDA 2HMNB 3MWZA 4HM0B 1D6ZA 1VQ43 3EX9A 1DMQA 1IVXA 2XRXB 3FKAA 3NBJA 1EQKA 2ZL8A 1O7NB 3FGYA 3EN1B 1ISKA 1N9JA 1UUWB 2KCDA 2WOHA 1A90A 5AIIA 1NO3A 2OCTA 2ML6A 3MPHA 5LC6A 3FF2A 2GEXA 1IU7A 4HM6B 1VQ53 3RDEA 2ML5A 3MKIA 2Y74A 3KE7A 4N6TA 3H51A 1US1A 2YFLB 5I97A 3PGBA 3VGNA 1N8R4 3U1WA 2HMOB 3Q1CA 1WMPA 1ZO2A 2CFGA 3VSYA 4QWTA 3EF8A 1QVG2 3IMAB 4OUQA 2XFSA 1M1XB 2XEPA 1OPYA 1N8QA 3GZRA 3HIIA 4NREA 3IJEB 2P38A 3N9HA 1VQK3 1IK3A 2F86B 1YJN3 4O8SA 1LNHA 5AEWB 2E2UA 1ULJB 4R9LA 3WOEB 1W6GA 1N9EA 4R80A 1EA2A 2QGUA 2W0QA 3F8XA 2E2VA 3PXMA 2OTJ3 3UB1A 3B4OA 3F8HA 1BUQA 1WMNA 3B7CA 3GRDA 3HK4A 1IQYA 2W9PA 1SIHA 4I4KA 2W03A 4HM5B 4OVMA 5D81A 3SLUA 3WA2X 1K41A 1K28A 2CW9A 2P09A 2YX9A 3X41A 3FG1A 3MG3A 1NU3A 1IQXA 3K9MC 1LOXA 1Z1SA 2K0MA 1Q814 1JN5B 1VQ93 5IEOA 1J2BA 3HI7A 1YJ93 1A67A 4Q53A 1MNLA 4CCVA 2XFTA 1C7HA 1KWIA 2CFWA 1YIT3 4EXRA 1ROAA 3CCR3 3PCRA 3DM8A 4HM8B 4JF8A 1W6YA 5EEOA 1KC84 1JB2A 3JUNA 3X42A 3LT8A 1SQWA 2XGNA 4FMBA 4KVHA 3CMA3 1UI7A 3NUVA 1IV7A 4FCZA 3JUPA 4AEQA 1M9GA 1QALA 1R4CA 4LZIA 1OHSA 5KP4A 4EBGA 3TDGA 4XBYA 3V92A 1GY7A 1SJWA 5CF1A 6STDA 4R9KA 3X3ZA 1ASKA 1OHPA 1Y4KA 2CHCA 2OQEC 3HX8A 4HVNA 5BXQA 3CNXA 3FH1A 1KSIA 2WGOA 4HM4B 2BHMA 3LXUX 5JPPA 1CEWI 3NBBA 3PCSA 2CG1A 2CFLA 4R4KA 5AIFA 3S5CA 3CCU3 1RRHA 5EVHA 4XM4A 1L5GB 3CXC2 1VQM3 2I9WA 1A2KA 4BTXA 1O7WB 5CXOA 4IT7A 5A0OB 5IENA 4R1KA 3EB8A 4IPBA 1QAKA 1S5AA 3LMLA 1OGXA 1VQL3 3UL5A 2CFDA 2XH9A 3SEDA 3DXOA 4H61A 3GZYB 4HZBB 1JN5A 1O7GB 2CG0A 4XB5A 3F40A 4FR9A 2Y73A 1D6YA 4WP5A 4EV2A 1S723 3NHXA 4RNYA 4RZMA 3CCJ3 5KP3A 1G96A 4WHAA 1Q42A 3RGRA 3EHCA 4XBXA 3I553 1DVDA 1PFPA 3Q2PA 3CNMA 1VQP3 1QMAA 1TFOA 3NXJA 5BVBA 1Q824 3DGNA 4IIAA 2RFRA 3WMDA 2CWUA 3G8ZA 3EC9A 3S27A 7STDA 5JBSA 1JNQA 3A76A 2Z77A 3CPW2 1VQN3 3F9SA 1O7MB 1DYUA 2W6JH 2CKFB 1CQSA 2WOFA 4L7KA 1WTHA 4O3VA 3CC43 1TP6A 1W2ZA 1OACA 4LSOA 1W02A 3G16A 4OK0A 3STDA 1DMNA 3GZXB 1LXEA 3BNEA 2GXFA 3BNCA 2B1XB 3SOYA 3RGAA 3NX0A 3BB9A 2CC3A 3FCSB 5CF2A 2BMRB 3CU3A 3F7SA 1E3RA 2OTL3 4J8TA 3F7XA 3CC23 1AV4A 3SOAA 3FLJA 1JRQA 2XSOB 3B4PA 4TX4A 5IERA 2IA7A 3QK9A 4HM1B 2W2CA 3X3XA 3V98A 2UX0A 3FG4A 4FCMA 3PS8A 4O02B 3JUOA 1FGQA 2YFIB 3EBTA 5ELJA 3LTCA 4BTWA 4KFEA 4MMYB 4X2HA 1O7HB 2Q07A 4N6MA 4PEJA 2W56B 3MYTA 2W56A 3F14A 3DGMA 2GBXB 3DUKA 3N54B 2B24B 1STFI 4HM3B 1FGMA 3S28A 4LEHA 2V1LA 3MG1A 1JKGB 3KIIA 2R4IA 5DRVA 1QJGA 2Z7AA 3D3LA 2QEX3 3NV0A 2QIYA 4O2HA 2F99A 3BNBA 1ZX2A 3SVAA 1OGZA 3SX1A 3UNLA 3CCS3 3KZTA 4N6LA 3K0ZA 2BMQB 3OV4A 5CLKA 8CHOA 3T8UA 1F8NA 3OXAA 1SPUA 2M7OA 3Q90A 1OUNA 4HBRA 1FGTA 4XDWA 4HYZA 3KFQC 3WA3A 3JVCA 3K63A 3G4S3 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6T A;  1DVC A;  1NB5 I;  1MNL A;  4CCV A;  3UL5 A;  1YVB I;  4TX4 A;  1KWI A;  5EQL A;  3KSE D;  3MWZ A;  1ROA A;  3UL6 A;  2W9P A;  1MOL A;  4EYC A;  3IMA B;  1CYU A;  3PS8 A;  1EQK A;  1N5P A;  4N6N B;  1RN7 A;  2CH9 A;  4N6U A;  5ELJ A;  3GAX A;  3SVA A;  3QRD A;  1FUW A;  4ZM8 A;  1CEW I;  3PYJ A;  4N6V 0;  4N6O B;  4N6L A;  1N9J A;  2O9U X;  2BO9 B;  1A90 A;  1IV7 A;  1GD4 A;  3S67 A;  1LXE A;  1CYV A;  4N6M A;  2OCT A;  1FA3 A;  1GD3 A;  3L0R A;  5ELU A;  5LC6 A;  1M9G A;  1WNH A;  1IV9 A;  2W9Q A;  1G96 A;  3K9M C;  1R4C A;  3NX0 A;  4LZI A;  5LC7 A;  2KXG A;  3LH4 A;  1DVD A;  1PFP A;  1TIJ A;  3Q2P A;  1STF I;  1NB3 I;  3KFQ C;  4IT7 A;  5A0O B;  1N5H A;  3PXM A;  1A67 A; 
#chains in the Genus database with same CATH topology
 2HMM B;  3CC7 3;  1GYB A;  1B21 A;  3LYG A;  1IYY A;  3DZL A;  3V99 A;  2SAR A;  4U13 A;  5TGN A;  1IT8 A;  1OCV A;  2D42 A;  2F5W A;  2ZDJ A;  1E97 A;  3ER7 A;  5FGO A;  2C11 A;  1T2I A;  1N5P A;  2RSX A;  4GL6 A;  1CYU A;  2XF3 A;  1B2Z A;  4N6V 0;  2O3O A;  6RNT A;  1W5Z A;  2CWT A;  3J7Y d;  1CH0 A;  2KRT A;  2OWP A;  5D82 A;  4EV5 A;  3G71 3;  3ZG0 A;  3WDG B;  5LC7 A;  1WNH A;  3LT9 A;  2J8X B;  3AMO A;  1MGR A;  2A15 A;  2W04 A;  1V74 A;  4LMI A;  5IG0 A;  1RJO A;  4WYK B;  5M1A A;  1IVW A;  4HJL B;  4FMC A;  4WWU C;  4RBN A;  2FGT A;  1RKY A;  2P05 A;  3O8Y A;  1RNB A;  1U8C B;  1PU4 A;  2HMK B;  1JV2 B;  1AVL A;  4CPK A;  1VQ6 3;  5AIG A;  1TFK A;  1AR0 A;  2BNG A;  2IMJ A;  2STD A;  5AYS C;  1NDO B;  4LGQ A;  3G6E 3;  5JPU A;  2CFK A;  4AKY A;  4BTY A;  5IG5 A;  2QA4 3;  1LVN A;  2FNQ A;  4AKZ A;  1RN7 A;  2BIR A;  3JUQ A;  3AHW A;  1VZZ A;  1FUT A;  4MEI A;  1DMM A;  2E2T A;  2RGQ A;  4XDV A;  4XBT A;  1RGC A;  6GSP A;  2O9U X;  1IQ8 A;  4GSP A;  1M1K 4;  1B2X A;  1GD3 A;  1KQS 2;  1OF5 A;  1OF5 B;  1I3I A;  1YI2 3;  2JQ5 A;  2KXG A;  2C4B A;  3CCL 3;  1U5O A;  3I0Y A;  4G1M B;  3X3Y A;  3D9R A;  1K9M 4;  2WGQ A;  1FW7 A;  5FW5 A;  3GWR A;  1TUH A;  1RGF A;  3MSO A;  5D83 A;  5STD A;  1W7C A;  1I2E A;  1ULI B;  3X40 A;  1VQ7 3;  1MOL A;  4KZ1 A;  3WOD G;  1A2P A;  3N8B A;  2GU3 A;  4H3U A;  2P0M A;  4ZM8 A;  1KD1 4;  1Q40 B;  3CCM 3;  3I56 3;  4MMX B;  1K8A 4;  4KFD A;  3LOY A;  3ECF A;  1GS3 A;  2Z6B A;  4K1U A;  3T8N A;  5IG3 A;  1UI8 A;  1JB4 A;  3NV0 B;  1JB5 A;  2H0H A;  3NM2 A;  3OWU A;  1NB3 I;  3BIR A;  1RCL A;  1VQQ A;  4HM7 B;  1R4Y A;  2IUK A;  1MWS A;  2Z76 A;  3EJV A;  4HKV B;  1YJW 3;  3CD6 3;  1NNV A;  1RGG A;  4HOH A;  3E99 A;  2CK3 H;  4HM2 B;  4K90 B;  3U97 A;  3UL6 A;  4L8P A;  2P0X A;  4BL3 A;  1YIJ 3;  2FXT A;  1BRN L;  4WYK A;  2JDI H;  2KF5 A;  3GZB A;  3OX9 A;  4N6N B;  4N6U A;  3KN4 A;  2L4V A;  2WO0 A;  3S29 A;  3CCQ 3;  1FUW A;  2HML B;  2SBL A;  1W4N A;  1FGO A;  3EE1 A;  4N6O B;  1RGA A;  7RNT A;  2F98 A;  1GOV A;  1GD4 A;  3EQQ B;  3S67 A;  1TU5 A;  1CYV A;  1W00 A;  4N3V A;  1NWW A;  3HZP A;  3NM7 A;  3D5I A;  5AIH A;  5HGR A;  1W6C A;  5KP1 A;  3IPT A;  1LOY A;  1JZD A;  2GBW B;  5M19 A;  1EUI C;  1ZGX A;  1EG9 B;  2RCD A;  5IG4 A;  3ALA A;  2BMO B;  3CME 3;  1W2B 2;  4RNZ A;  1DVC A;  1NJI 4;  3MG2 A;  3NQZ A;  1QVF 2;  5AYR B;  1BAN A;  2XR8 B;  1I70 A;  1WQL B;  1YVB I;  2BT3 A;  4K1V A;  1IVV A;  1OH0 A;  3PZW A;  5IW9 A;  4EC6 A;  1UW1 A;  3OWS A;  4GB5 A;  3UJM A;  2CIU A;  8RNT A;  1VQ8 3;  2XSH B;  3K7C A;  3QRD A;  4MJD A;  1GMP A;  1HKX A;  3CCV 3;  3EBY A;  3FSD A;  3KKG A;  2OOV A;  5M18 A;  3SXX A;  4WFO A;  1BOX A;  1DE3 A;  3L0R A;  1IT7 A;  1RN1 A;  1HZ1 A;  1E3V A;  1WMO A;  2IYJ A;  3DGO A;  3HOH A;  4CDL A;  3NBR A;  3NQY A;  5IF6 A;  1B27 A;  1Q40 A;  2GU1 A;  1EKM A;  3D79 A;  1GMR A;  1JKG A;  4KFF A;  1NB5 I;  2CWV A;  1AVK A;  3K5T A;  1HU9 A;  3KSP A;  2OQE A;  5BIR A;  1SII A;  4GHO A;  5G1K A;  1M90 4;  3KSE D;  1IVU A;  3CPO A;  3OWY A;  1D6U A;  3LTA A;  1GY6 A;  1O7P B;  1BRG A;  3G0K A;  1FGR A;  2UGI A;  3MHE A;  3HIG A;  4CJN A;  1LRA A;  3GAX A;  2D1W A;  2PNC A;  4L8O A;  3PYJ A;  1YGE A;  3BND A;  1IDP A;  2BO9 B;  2OOV C;  3H3H A;  3CCE 3;  1FA3 A;  2PZV A;  5CK6 A;  1FYS A;  4J9A A;  1Q86 4;  1AY7 A;  2K54 A;  1EEJ A;  5ELU A;  2W9Q A;  3LZA A;  4DKI A;  3M8C A;  2MF7 A;  1K73 4;  2IUJ A;  1SAR A;  2MC8 A;  1BIR A;  1UDI I;  1N5H A;  1RGK A;  1RRL A;  3EN8 A;  4EW5 A;  4MMZ B;  1W01 A;  5G2G A;  1Q7Y 4;  2INX A;  3T0U A;  4FMD A;  1QAF A;  1ROV A;  5EQL A;  1RMS A;  2GSP A;  3FG3 A;  4ORL A;  3FZW A;  5RNT A;  2LQV A;  4EYC A;  4NHF A;  3FF0 A;  1OHO A;  3VF1 A;  3ZFZ A;  1BNR A;  4BU4 A;  4NPB A;  3OW2 2;  2CH9 A;  1T5Y A;  4X2O A;  3DY5 A;  1V57 A;  1YNV X;  2HOH A;  1STD A;  3ROB A;  1PYL A;  2GEY A;  1GOY A;  5AEU B;  5GSP A;  1JZO A;  2HMJ B;  3DGL A;  4HZ9 B;  1YHQ 3;  1IV9 A;  1RDS A;  3BLZ A;  1B2S A;  2YFJ B;  3AMO B;  1UGH I;  3LH4 A;  4FCJ A;  1RHL A;  2LYX A;  1TIJ A;  4FMA A;  4K61 A;  5IEP A;  1VQO 3;  1GY5 A;  5AI1 A;  1UUV B;  3LTD A;  1A2V A;  3B8L A;  1YGW A;  3JUM A;  2C10 A;  4JRF A;  3WOF B;  1T2H A;  3DMC A;  5DRE A;  2CX0 A;  3LTB A;  4STD A;  1V58 A;  2HMN B;  1I3F A;  3MWZ A;  4HM0 B;  1D6Z A;  1VQ4 3;  3D4A A;  1RTU A;  3EX9 A;  1DMQ A;  1IVX A;  2RBI A;  2XRX B;  3FKA A;  3GSP A;  3NBJ A;  2ZL8 A;  1O7N B;  1EQK A;  3FGY A;  3EN1 B;  1BRI A;  1BSB A;  1ISK A;  2RNT A;  1N9J A;  1RGH A;  1UUW B;  2KCD A;  2WOH A;  1A90 A;  5AII A;  1NO3 A;  2OCT A;  2ML6 A;  1RSN A;  3MPH A;  5LC6 A;  3FF2 A;  2GEX A;  1IU7 A;  1UCJ A;  4HM6 B;  3RDE A;  4BL2 A;  1MWR A;  1VQ5 3;  3Q3F A;  2ML5 A;  3MKI A;  2Y74 A;  1RNT A;  3WHO A;  3KE7 A;  4N6T A;  3H51 A;  1US1 A;  2YFL B;  1B2M A;  2ZA4 A;  5I97 A;  3PGB A;  3VGN A;  1N8R 4;  3U1W A;  2HMO B;  3Q1C A;  1WMP A;  1ZO2 A;  2CFG A;  3VSY A;  4QWT A;  3EF8 A;  1QVG 2;  1T3B A;  3IMA B;  4OUQ A;  1BSE A;  1B3S A;  2XFS A;  1M1X B;  2XEP A;  1OPY A;  1N8Q A;  3GZR A;  3HII A;  7GSP A;  4NRE A;  3IJE B;  2KF6 A;  2P38 A;  3N9H A;  1VQK 3;  2L1S A;  1TJD A;  1X1Y A;  1IK3 A;  2F86 B;  1LOW A;  1BRK A;  1YJN 3;  4O8S A;  1LNH A;  5AEW B;  1X1X A;  2E2U A;  1GSP A;  1ULJ B;  4R9L A;  1G02 A;  1W6G A;  1N9E A;  4R80 A;  3WOE B;  4KT3 B;  2KF4 A;  1FUS A;  9RNT A;  1EA2 A;  2QGU A;  2W0Q A;  3F8X A;  4BIR A;  2E2V A;  3PXM A;  2OTJ 3;  3UB1 A;  2IY2 A;  1BUJ A;  3B4O A;  3F8H A;  1BUQ A;  1JJ2 2;  1WMN A;  3B7C A;  3GRD A;  3HK4 A;  1IQY A;  2W9P A;  2F56 A;  1ZS7 A;  3WR2 A;  1SIH A;  4I4K A;  2W03 A;  4HM5 B;  4OVM A;  5D81 A;  3SLU A;  1FZU A;  3WA2 X;  1K41 A;  1K28 A;  2CW9 A;  2P09 A;  2YX9 A;  3X41 A;  1RLS A;  1AQZ A;  3FG1 A;  1BRS A;  1NU3 A;  1IQX A;  3MG3 A;  3K9M C;  1C54 A;  1LOX A;  1Z1S A;  2F5M A;  2K0M A;  1Q81 4;  1JN5 B;  1VQ9 3;  5IEO A;  1Q9E A;  1UGI A;  3RNT A;  1J2B A;  3HI7 A;  1YJ9 3;  5BU4 A;  1A67 A;  1B2U A;  1BNE A;  1LQM B;  4Q53 A;  1MNL A;  4CCV A;  1JBS A;  2XFT A;  1C7H A;  2AAD A;  1KWI A;  2CFW A;  4LYL B;  1YIT 3;  4EXR A;  1ROA A;  3CCR 3;  3PCR A;  3DM8 A;  4HM8 B;  4JF8 A;  1W6Y A;  5EEO A;  1KC8 4;  1JB2 A;  3JUN A;  3DH2 A;  3X42 A;  3LT8 A;  1SQW A;  5G1L A;  2XGN A;  4FMB A;  4KVH A;  3CMA 3;  1UI7 A;  3DGY A;  3NUV A;  1IV7 A;  4J5G A;  1RGE A;  4FCZ A;  2R41 A;  3JUP A;  4AEQ A;  3SYU A;  1M9G A;  1BRH A;  1TRP A;  1QAL A;  1R4C A;  4LZI A;  1OHS A;  5KP4 A;  3D5G A;  4EBG A;  3TDG A;  1BGS A;  1RN4 A;  4XBY A;  3V92 A;  2ZHX B;  1MGW A;  2CX1 A;  1GY7 A;  1SJW A;  5CF1 A;  6STD A;  4R9K A;  3X3Z A;  1ASK A;  1OHP A;  1Y4K A;  2CHC A;  1BNG A;  2OQE C;  3HX8 A;  4HVN A;  5BXQ A;  3CNX A;  1I8V A;  3FH1 A;  1KSI A;  2WGO A;  4HM4 B;  2BHM A;  3LXU X;  5JPP A;  3URP A;  1CEW I;  4ILF A;  3NBB A;  3PCS A;  2CG1 A;  2CFL A;  4R4K A;  5AIF A;  1I0X A;  3S5C A;  1RRH A;  3CCU 3;  3AHS A;  2F4Y A;  2H0I A;  5EVH A;  4XM4 A;  1L5G B;  1YVS A;  3CXC 2;  1VQM 3;  2I9W A;  1A2K A;  4BTX A;  1O7W B;  5CXO A;  4IT7 A;  5A0O B;  5IEN A;  4R1K A;  3EB8 A;  4IPB A;  1QAK A;  1S5A A;  3LML A;  1OGX A;  1VQL 3;  3UL5 A;  2CFD A;  2XH9 A;  3SED A;  1G0T A;  3DXO A;  4H61 A;  3GZY B;  4HZB B;  1JN5 A;  1O7G B;  1X1W A;  1TTO A;  2CG0 A;  4XB5 A;  3F40 A;  3ZG5 A;  4FR9 A;  2Y73 A;  1BNJ A;  1D6Y A;  4WP5 A;  2KF3 A;  4EV2 A;  1BNI A;  1S72 3;  1LQG C;  3NHX A;  4RNY A;  4RZM A;  3KCH A;  1BSC A;  3CCJ 3;  5KP3 A;  1G96 A;  4WHA A;  1Q42 A;  1BU4 A;  3RGR A;  3EHC A;  4XBX A;  3I55 3;  1DVD A;  1PFP A;  3Q2P A;  3CNM A;  1VQP 3;  1QMA A;  1TFO A;  1LOV A;  3NXJ A;  5BVB A;  1Q82 4;  1UUG B;  3DGN A;  1DET A;  2RFR A;  4IIA A;  3WMD A;  2CWU A;  3G8Z A;  1X1U A;  3EC9 A;  3S27 A;  7STD A;  5JBS A;  1JNQ A;  3A76 A;  2Z77 A;  3AGO A;  3CPW 2;  3F9S A;  1O7M B;  4J5K A;  1VQN 3;  1DYU A;  2W6J H;  2AAE A;  2CKF B;  1CQS A;  2WOF A;  4L7K A;  1WTH A;  3A5E A;  4O3V A;  3CC4 3;  1TP6 A;  1W2Z A;  1OAC A;  4LSO A;  2H0G A;  1BRJ A;  1RCK A;  1B20 A;  1W02 A;  1BVI A;  3G16 A;  4OK0 A;  3AGN A;  1I2F A;  4HAA A;  3STD A;  1DMN A;  3GZX B;  1LXE A;  3BNE A;  2GXF A;  2KAA A;  1BNF A;  3BNC A;  2B1X B;  3SOY A;  3RGA A;  3NX0 A;  3BB9 A;  2CC3 A;  3FCS B;  5CF2 A;  2BMR B;  3CU3 A;  3F7S A;  1E3R A;  5HOH A;  2OTL 3;  2K3D A;  4J8T A;  3F7X A;  3CC2 3;  1AV4 A;  3SOA A;  3FLJ A;  1JRQ A;  2XSO B;  3B4P A;  1MWU A;  1BSD A;  4TX4 A;  5IER A;  2BU4 A;  2IA7 A;  3QK9 A;  4HM1 B;  2W2C A;  1JBR A;  2UUG C;  3X3X A;  3V98 A;  2UX0 A;  3BU4 A;  3FG4 A;  4FCM A;  1LNI A;  3PS8 A;  4O02 B;  3JUO A;  1FGQ A;  1UCK A;  2YFI B;  3EBT A;  5ELJ A;  3LTC A;  4BTW A;  4KFE A;  1Q7H A;  1I0V A;  1O7H B;  2Q07 A;  4MMY B;  4X2H A;  4RNT A;  4N6M A;  1TRQ A;  1UCL A;  2W56 B;  4PEJ A;  3MYT A;  2W56 A;  1PY3 A;  3F14 A;  3DGM A;  1MWT A;  2GBX B;  3DUK A;  3N54 B;  2B24 B;  1STF I;  1JBT A;  4HM3 B;  1FGM A;  3S28 A;  4LEH A;  2V1L A;  3MG1 A;  1JKG B;  3KII A;  2R4I A;  5DRV A;  1QJG A;  1HYF A;  2Z7A A;  1UCI A;  1BSA A;  3D3L A;  3NV0 A;  2QEX 3;  1GOU A;  2QIY A;  4O2H A;  2F99 A;  3BNB A;  1BNS A;  1ZX2 A;  4I5Q A;  3SVA A;  1OGZ A;  3SX1 A;  3UNL A;  3CCS 3;  3KZT A;  4N6L A;  3K0Z A;  2BMQ B;  3OV4 A;  5CLK A;  8CHO A;  1GMQ A;  1I2G A;  3T8U A;  1F8N A;  3OXA A;  1SPU A;  2M7O A;  3Q90 A;  1OUN A;  1RGL A;  4HBR A;  1FGT A;  4XDW A;  4HYZ A;  3KFQ C;  3WA3 A;  3JVC A;  3K63 A;  3G4S 3;  2XGL A;  1BAO A; 
#chains in the Genus database with same CATH homology
 2HMM B;  3CC7 3;  1GYB A;  3LYG A;  3DZL A;  3V99 A;  4U13 A;  5TGN A;  1IT8 A;  1OCV A;  2D42 A;  2ZDJ A;  1E97 A;  3ER7 A;  5FGO A;  2C11 A;  2RSX A;  1N5P A;  1CYU A;  4GL6 A;  2XF3 A;  4N6V 0;  2O3O A;  1W5Z A;  2CWT A;  3J7Y d;  2KRT A;  5D82 A;  2OWP A;  4EV5 A;  3G71 3;  3WDG B;  5LC7 A;  1WNH A;  3LT9 A;  3AMO A;  4LMI A;  2A15 A;  2W04 A;  1V74 A;  5IG0 A;  1RJO A;  4WYK B;  1IVW A;  4HJL B;  4FMC A;  4WWU C;  4RBN A;  2FGT A;  1RKY A;  2P05 A;  3O8Y A;  1U8C B;  1PU4 A;  2HMK B;  1JV2 B;  1AVL A;  1VQ6 3;  5AIG A;  1TFK A;  1AR0 A;  2BNG A;  2IMJ A;  2STD A;  5AYS C;  1NDO B;  4LGQ A;  3G6E 3;  5JPU A;  2CFK A;  4AKY A;  4BTY A;  5IG5 A;  2QA4 3;  1LVN A;  2FNQ A;  4AKZ A;  1RN7 A;  3JUQ A;  1VZZ A;  4MEI A;  1DMM A;  2E2T A;  2RGQ A;  4XDV A;  4XBT A;  2O9U X;  1IQ8 A;  1M1K 4;  1GD3 A;  1KQS 2;  1OF5 A;  1OF5 B;  1YI2 3;  2JQ5 A;  2KXG A;  3CCL 3;  1U5O A;  3I0Y A;  4G1M B;  3X3Y A;  3D9R A;  1K9M 4;  2WGQ A;  5FW5 A;  3GWR A;  1TUH A;  5D83 A;  3MSO A;  5STD A;  1W7C A;  1ULI B;  3X40 A;  1VQ7 3;  1MOL A;  4KZ1 A;  3WOD G;  3N8B A;  2GU3 A;  4H3U A;  2P0M A;  4ZM8 A;  1KD1 4;  1Q40 B;  3CCM 3;  3I56 3;  4MMX B;  1K8A 4;  4KFD A;  3LOY A;  3ECF A;  1GS3 A;  2Z6B A;  4K1U A;  3T8N A;  5IG3 A;  1UI8 A;  1JB4 A;  3NV0 B;  1JB5 A;  3NM2 A;  3OWU A;  1NB3 I;  4HM7 B;  2IUK A;  4HKV B;  2Z76 A;  3EJV A;  1YJW 3;  3CD6 3;  4K90 B;  3E99 A;  2CK3 H;  4HM2 B;  3U97 A;  3UL6 A;  4L8P A;  2P0X A;  1YIJ 3;  2FXT A;  4WYK A;  2JDI H;  3GZB A;  3OX9 A;  4N6N B;  4N6U A;  3KN4 A;  2L4V A;  2WO0 A;  3S29 A;  3CCQ 3;  1FUW A;  2HML B;  2SBL A;  1W4N A;  1FGO A;  3EE1 A;  4N6O B;  2F98 A;  3EQQ B;  1GD4 A;  1TU5 A;  3S67 A;  1CYV A;  1W00 A;  4N3V A;  1NWW A;  3HZP A;  3NM7 A;  5AIH A;  5HGR A;  1W6C A;  5KP1 A;  3IPT A;  2GBW B;  5IG4 A;  2RCD A;  1EG9 B;  3ALA A;  2BMO B;  3CME 3;  1W2B 2;  4RNZ A;  1DVC A;  1NJI 4;  3MG2 A;  3NQZ A;  1QVF 2;  5AYR B;  2XR8 B;  1WQL B;  1YVB I;  2BT3 A;  4K1V A;  1IVV A;  1OH0 A;  3PZW A;  5IW9 A;  4EC6 A;  1UW1 A;  3OWS A;  4GB5 A;  3UJM A;  2CIU A;  1VQ8 3;  2XSH B;  3K7C A;  3QRD A;  4MJD A;  1HKX A;  3CCV 3;  3EBY A;  3FSD A;  3KKG A;  2OOV A;  3SXX A;  4WFO A;  3L0R A;  1IT7 A;  1E3V A;  1WMO A;  3DGO A;  4CDL A;  3NBR A;  3NQY A;  5IF6 A;  1Q40 A;  2GU1 A;  1EKM A;  1JKG A;  4KFF A;  1NB5 I;  2CWV A;  1AVK A;  3K5T A;  1HU9 A;  3KSP A;  2OQE A;  1M90 4;  1SII A;  3KSE D;  1IVU A;  3CPO A;  3OWY A;  1D6U A;  3LTA A;  1GY6 A;  1O7P B;  3G0K A;  1FGR A;  3MHE A;  3HIG A;  3GAX A;  2D1W A;  2PNC A;  4L8O A;  3PYJ A;  1YGE A;  3BND A;  1IDP A;  2BO9 B;  2OOV C;  3H3H A;  3CCE 3;  1FA3 A;  2PZV A;  5CK6 A;  4J9A A;  1Q86 4;  2K54 A;  5ELU A;  2W9Q A;  3LZA A;  3M8C A;  2MF7 A;  1K73 4;  2IUJ A;  2MC8 A;  1N5H A;  1RRL A;  3EN8 A;  4MMZ B;  1W01 A;  5G2G A;  1Q7Y 4;  2INX A;  3T0U A;  4FMD A;  1QAF A;  1ROV A;  5EQL A;  3FG3 A;  4ORL A;  3FZW A;  2LQV A;  4EYC A;  4NHF A;  3FF0 A;  1OHO A;  3VF1 A;  3OW2 2;  2CH9 A;  1T5Y A;  4X2O A;  3DY5 A;  1STD A;  3ROB A;  2GEY A;  5AEU B;  3DGL A;  2HMJ B;  4HZ9 B;  1YHQ 3;  1IV9 A;  3BLZ A;  4FCJ A;  2YFJ B;  3AMO B;  3LH4 A;  1JJ2 2;  4K61 A;  2LYX A;  5IEP A;  1TIJ A;  4FMA A;  1VQO 3;  1GY5 A;  5AI1 A;  1UUV B;  3LTD A;  1A2V A;  3B8L A;  3JUM A;  2C10 A;  4JRF A;  3WOF B;  3DMC A;  5DRE A;  3LTB A;  4STD A;  2HMN B;  3MWZ A;  4HM0 B;  1D6Z A;  1VQ4 3;  3EX9 A;  1DMQ A;  1IVX A;  2XRX B;  3FKA A;  3NBJ A;  1EQK A;  2ZL8 A;  1O7N B;  3FGY A;  3EN1 B;  1ISK A;  1N9J A;  1UUW B;  2KCD A;  2WOH A;  1A90 A;  5AII A;  1NO3 A;  2OCT A;  2ML6 A;  3MPH A;  5LC6 A;  3FF2 A;  2GEX A;  1IU7 A;  4HM6 B;  1VQ5 3;  3RDE A;  2ML5 A;  3MKI A;  2Y74 A;  3KE7 A;  4N6T A;  3H51 A;  1US1 A;  2YFL B;  5I97 A;  3PGB A;  3VGN A;  1N8R 4;  3U1W A;  2HMO B;  3Q1C A;  1WMP A;  1ZO2 A;  2CFG A;  3VSY A;  4QWT A;  3EF8 A;  1QVG 2;  3IMA B;  4OUQ A;  2XFS A;  1M1X B;  2XEP A;  1OPY A;  1N8Q A;  3GZR A;  3HII A;  4NRE A;  3IJE B;  2P38 A;  3N9H A;  1VQK 3;  1IK3 A;  2F86 B;  1YJN 3;  4O8S A;  1LNH A;  5AEW B;  2E2U A;  1ULJ B;  4R9L A;  3WOE B;  1W6G A;  1N9E A;  4R80 A;  1EA2 A;  2QGU A;  2W0Q A;  3F8X A;  2E2V A;  3PXM A;  2OTJ 3;  3UB1 A;  3B4O A;  3F8H A;  1BUQ A;  1WMN A;  3B7C A;  3GRD A;  3HK4 A;  1IQY A;  2W9P A;  1SIH A;  4I4K A;  2W03 A;  4HM5 B;  4OVM A;  5D81 A;  3SLU A;  3WA2 X;  1K41 A;  1K28 A;  2CW9 A;  2P09 A;  2YX9 A;  3X41 A;  3FG1 A;  3MG3 A;  1NU3 A;  1IQX A;  3K9M C;  1LOX A;  1Z1S A;  2K0M A;  1Q81 4;  1JN5 B;  1VQ9 3;  5IEO A;  1J2B A;  3HI7 A;  1YJ9 3;  1A67 A;  4Q53 A;  1MNL A;  4CCV A;  2XFT A;  1C7H A;  1KWI A;  2CFW A;  1YIT 3;  4EXR A;  1ROA A;  3CCR 3;  3PCR A;  3DM8 A;  4HM8 B;  4JF8 A;  1W6Y A;  5EEO A;  1KC8 4;  1JB2 A;  3JUN A;  3X42 A;  3LT8 A;  1SQW A;  2XGN A;  4FMB A;  4KVH A;  3CMA 3;  1UI7 A;  3NUV A;  1IV7 A;  4FCZ A;  3JUP A;  4AEQ A;  1M9G A;  1QAL A;  1R4C A;  4LZI A;  1OHS A;  5KP4 A;  4EBG A;  3TDG A;  4XBY A;  3V92 A;  1GY7 A;  1SJW A;  5CF1 A;  6STD A;  4R9K A;  3X3Z A;  1ASK A;  1OHP A;  1Y4K A;  2CHC A;  2OQE C;  3HX8 A;  4HVN A;  5BXQ A;  3CNX A;  3FH1 A;  1KSI A;  2WGO A;  4HM4 B;  2BHM A;  3LXU X;  5JPP A;  1CEW I;  3NBB A;  3PCS A;  2CG1 A;  2CFL A;  4R4K A;  5AIF A;  3S5C A;  3CCU 3;  1RRH A;  5EVH A;  4XM4 A;  1L5G B;  3CXC 2;  1VQM 3;  2I9W A;  1A2K A;  4BTX A;  1O7W B;  5CXO A;  4IT7 A;  5A0O B;  5IEN A;  4R1K A;  3EB8 A;  4IPB A;  1QAK A;  1S5A A;  3LML A;  1OGX A;  1VQL 3;  3UL5 A;  2CFD A;  2XH9 A;  3SED A;  3DXO A;  4H61 A;  3GZY B;  4HZB B;  1JN5 A;  1O7G B;  2CG0 A;  4XB5 A;  3F40 A;  4FR9 A;  2Y73 A;  1D6Y A;  4WP5 A;  4EV2 A;  1S72 3;  3NHX A;  4RNY A;  4RZM A;  3CCJ 3;  5KP3 A;  1G96 A;  4WHA A;  1Q42 A;  3RGR A;  3EHC A;  4XBX A;  3I55 3;  1DVD A;  1PFP A;  3Q2P A;  3CNM A;  1VQP 3;  1QMA A;  1TFO A;  3NXJ A;  5BVB A;  1Q82 4;  3DGN A;  4IIA A;  2RFR A;  3WMD A;  2CWU A;  3G8Z A;  3EC9 A;  3S27 A;  7STD A;  5JBS A;  1JNQ A;  3A76 A;  2Z77 A;  3CPW 2;  1VQN 3;  3F9S A;  1O7M B;  1DYU A;  2W6J H;  2CKF B;  1CQS A;  2WOF A;  4L7K A;  1WTH A;  4O3V A;  3CC4 3;  1TP6 A;  1W2Z A;  1OAC A;  4LSO A;  1W02 A;  3G16 A;  4OK0 A;  3STD A;  1DMN A;  3GZX B;  1LXE A;  3BNE A;  2GXF A;  3BNC A;  2B1X B;  3SOY A;  3RGA A;  3NX0 A;  3BB9 A;  2CC3 A;  3FCS B;  5CF2 A;  2BMR B;  3CU3 A;  3F7S A;  1E3R A;  2OTL 3;  4J8T A;  3F7X A;  3CC2 3;  1AV4 A;  3SOA A;  3FLJ A;  1JRQ A;  2XSO B;  3B4P A;  4TX4 A;  5IER A;  2IA7 A;  3QK9 A;  4HM1 B;  2W2C A;  3X3X A;  3V98 A;  2UX0 A;  3FG4 A;  4FCM A;  3PS8 A;  4O02 B;  3JUO A;  1FGQ A;  2YFI B;  3EBT A;  5ELJ A;  3LTC A;  4BTW A;  4KFE A;  4MMY B;  4X2H A;  1O7H B;  2Q07 A;  4N6M A;  4PEJ A;  2W56 B;  3MYT A;  2W56 A;  3F14 A;  3DGM A;  2GBX B;  3DUK A;  3N54 B;  2B24 B;  1STF I;  4HM3 B;  1FGM A;  3S28 A;  4LEH A;  2V1L A;  3MG1 A;  1JKG B;  3KII A;  2R4I A;  5DRV A;  1QJG A;  2Z7A A;  3D3L A;  2QEX 3;  3NV0 A;  2QIY A;  4O2H A;  2F99 A;  3BNB A;  1ZX2 A;  3SVA A;  1OGZ A;  3SX1 A;  3UNL A;  3CCS 3;  3KZT A;  4N6L A;  3K0Z A;  2BMQ B;  3OV4 A;  5CLK A;  8CHO A;  3T8U A;  1F8N A;  3OXA A;  1SPU A;  2M7O A;  3Q90 A;  1OUN A;  4HBR A;  1FGT A;  4XDW A;  4HYZ A;  3KFQ C;  3WA3 A;  3JVC A;  3K63 A;  3G4S 3;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...