2HMLB

Crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmlB00
2IMJA 3JUOA 1EA2A 4LEHA 5AIIA 4K1VA 3H3HA 5IERA 2GBWB 1E3RA 5BVBA 3S5CA 1ZO2A 1DMMA 5AEWB 2HMMB 3FLJA 3EJVA 3EN8A 4Q53A 5D83A 3SOYA 4XBXA 1HKXA 1VZZA 3IPTA 4RZMA 4WWUC 1Z1SA 4GB5A 3EN1B 2XR8B 3CNXA 3MSOA 3D9RA 4LMIA 1K41A 4WP5A 3OV4A 3JUMA 4R1KA 3NBRA 3BLZA 2QGUA 3A76A 2GBXB 3FH1A 2INXA 2YFIB 4R9KA 5CF1A 4XB5A 3E99A 4ORLA 4L8PA 1Q40B 1NDOB 5IG5A 1O7GB 3KSPA 3ER7A 1OGXA 1ULJB 5CK6A 3F8XA 5CLKA 1NWWA 3NHXA 4HM3B 1W01A 4HJLB 3FF0A 1W6YA 3DXOA 1W00A 2K54A 3FF2A 1OHPA 5IG4A 1E97A 3NV0B 2STDA 3MG3A 4WYKA 3F8HA 1AR0A 3CU3A 1QJGA 1UUVB 1JB5A 5IG0A 4XDWA 3WMDA 5AIHA 1IDPA 1OF5A 3BB9A 4FCMA 4HM0B 4I4KA 2R4IA 5JPPA 1UUWB 3KE7A 3NUVA 4J9AA 4K1UA 2XSOB 1U5OA 3EBYA 5IEOA 3EHCA 4HM8B 2BMQB 1JN5B 4HKVB 3GZBA 1STDA 5DRVA 2F86B 4H3UA 4XM4A 4HM2B 3OWSA 1O7NB 3GWRA 5DREA 1W02A 1BUQA 1ULIB 2OWPA 3DMCA 4STDA 2F98A 2BMOB 3G16A 2Z76A 2BMRB 1ZX2A 3MG2A 3SEDA 3F7XA 4J8TA 2B1XB 3OXAA 1OCVA 3T8NA 4X2OA 3JUQA 1GYBA 3ROBA 2UX0A 4XBYA 3OWYA 4OVMA 2GEYA 3KKGA 3B4OA 1O7HB 1OPYA 3RGRA 3MYTA 5JPUA 2BNGA 4KVHA 1JB4A 1JKGB 3CPOA 3LYGA 5IENA 3ECFA 3F40A 7STDA 5IEPA 3DM8A 3H51A 5AIFA 2XRXB 1DMNA 1ISKA 3VSYA 2B24B 6STDA 3DUKA 5IF6A 3EBTA 3EF8A 3B7CA 5G2GA 2GEXA 3RGAA 3MG1A 5IG3A 3SOAA 4HM5B 4L7KA 3I0YA 3B4PA 3HK4A 2I9WA 1GY5A 3MHEA 1SJWA 4PEJA 2HMJB 3K0ZA 4WYKB 5D82A 5KP3A 3M8CA 3HZPA 5FW5A 1O7PB 4LGQA 1OF5B 3GZRA 2RGQA 1GY6A 3FSDA 1JB2A 1OHOA 2RFRA 2YFLB 2PZVA 2HMLB 5AIGA 2QIYA 5BXQA 4FCJA 1OUNA 1OH0A 3UNLA 5EVHA 3EX9A 4HZ9B 3HX8A 3JUPA 2CHCA 4X2HA 1GS3A 3FZWA 3JUNA 2JQ5A 1NU3A 5STDA 5D81A 4HVNA 3KZTA 4HM1B 4L8OA 1EG9B 1C7HA 1Q40A 5AEUB 2CKFB 5KP1A 1DMQA 1JKGA 3G8ZA 3STDA 3FGYA 5HGRA 3G0KA 3GRDA 2HMOB 1GY7A 4IIAA 2XSHB 5KP4A 4HM7B 4OUQA 4XDVA 1TUHA 4HZBB 1WQLB 1QMAA 3EQQB 3VGNA 1E3VA 4HM4B 3T8UA 1TP6A 1ASKA 2W2CA 4XBTA 1OGZA 1Q42A 4N3VA 1S5AA 4CDLA 3NV0A 4U13A 3NXJA 2F99A 3FKAA 1O7WB 1OHSA 5CF2A 3GZXB 3K7CA 2A15A 3MKIA 3OWUA 2Z77A 3B8LA 5CXOA 2RCDA 3OX9A 2YFJB 1CQSA 1O7MB 3DZLA 4MJDA 8CHOA 3GZYB 1JN5A 4R9LA 3F9SA 2HMKB 1A2KA 2Z7AA 5AI1A 3CNMA 4HM6B 3UJMA 3EC9A 3F7SA 3NM2A 3LZAA 5TGNA 3F14A 2HMNB 3Q90A 2GXFA
chains in the Genus database with same CATH superfamily
3SXXA 5A0OB 2IMJA 3JUOA 1EA2A 1BRJA 1RGKA 2F5WA 1A90A 4LEHA 2IA7A 3LT9A 3WR2A 5AIIA 3N54B 1EUIC 3X42A 3G4S3 1AY7A 1LVNA 3H3HA 3GSPA 4K1VA 1RRHA 1IK3A 3CXC2 5IERA 4CJNA 4EXRA 2GBWB 3UL5A 1I0VA 1JV2B 2UUGC 3CCS3 2OTL3 4N6MA 1E3RA 5BVBA 1YI23 3S5CA 1V57A 2IY2A 3PS8A 4JF8A 3X3ZA 1Q814 1BIRA 1ZO2A 3BNBA 3J7Yd 1DMMA 5AEWB 1I70A 2HMMB 4BTYA 1LXEA 3FLJA 2UGIA 3QK9A 3WODG 1DE3A 5BU4A 3EJVA 4FMBA 1RNTA 3EN8A 1T3BA 3T0UA 1KWIA 4LYLB 4Q53A 5D83A 3SOYA 1FUTA 1FGMA 2OOVA 1RGLA 1JRQA 1TTOA 4XBXA 1JBTA 1BRNL 1CYUA 3CCV3 3CCM3 1HKXA 1ZGXA 3QRDA 1VZZA 3V99A 1GD4A 4N6V0 3IPTA 3NQYA 3Q1CA 4RBNA 4RZMA 3OW22 4EV5A 2D42A 4WWUC 3FG3A 1FA3A 1Z1SA 1I3IA 4J5GA 1DETA 2ZDJA 3N9HA 1AVKA 1LNHA 4GB5A 3DGNA 2ZA4A 3SX1A 3EN1B 1B2XA 1IV9A 2XR8B 3EE1A 2CIUA 3CNXA 2Q07A 4KFDA 2ML5A 3BU4A 3MSOA 3D9RA 1JZOA 3HI7A 4LMIA 1BNEA 3FG1A 1K41A 3ZFZA 1BANA 1M9GA 2W03A 2W04A 4WP5A 1RJOA 1B2MA 1W5ZA 1Y4KA 3OV4A 4MEIA 4ILFA 4N6NB 1RCKA 3WA2X 3JUMA 3CCJ3 4R1KA 3PGBA 3NBRA 1YJW3 3BLZA 3V98A 1RGEA 1LQGC 1BSAA 2QGUA 3HIIA 2YX9A 4FMDA 2CX0A 3A76A 4I5QA 7RNTA 2GBXB 1N5PA 3LTAA 3FH1A 2INXA 2YFIB 4GSPA 2FXTA 1I2FA 2CFKA 4R9KA 5CF1A 2LQVA 1LOVA 1WMNA 4XB5A 3AHSA 1D6ZA 1LRAA 3E99A 4N6TA 4ORLA 3U97A 4L8PA 1TRQA 1Q40B 1C54A 3S28A 1NDOB 3HOHA 4BTXA 5IG5A 1O7GB 2P05A 1MOLA 1RGAA 3AHWA 1CH0A 3KSPA 3ER7A 1N9EA 1OGXA 3BNCA 1VQ93 2IUKA 1ULJB 2GSPA 1UGIA 1IU7A 5CK6A 3F8XA 4HBRA 1UGHI 5CLKA 3TDGA 1N5HA 1NWWA 3NHXA 1LNIA 4FCZA 4HM3B 2Y73A 1W01A 4HJLB 3FF0A 1W6YA 2XGLA 1JBRA 1NNVA 3DXOA 1W00A 1RN4A 2K54A 1RTUA 3ALAA 3EB8A 3FF2A 1SQWA 4TX4A 2F5MA 5M18A 1OHPA 4H61A 1IVUA 3A5EA 5IG4A 3BNEA 1E97A 2KRTA 5EQLA 1UI7A 1GMQA 3NV0B 4J5KA 2E2VA 1YJ93 1I8VA 2WOFA 3K63A 1V74A 2STDA 2CK3H 2ZL8A 3MG3A 4WYKA 1TFOA 2OTJ3 1FUWA 3F8HA 1AR0A 3CU3A 1WMOA 1N8QA 2XF3A 2RSXA 2KF6A 4ZM8A 3WOFB 2CFDA 1QJGA 1UUVB 2KF4A 3NBBA 1JB5A 5IG0A 4XDWA 3WMDA 3NM7A 5AIHA 1IDPA 1UW1A 1BSCA 1OF5A 3BB9A 4FCMA 4HM0B 1X1UA 4I4KA 2R4IA 1BRSA 1SIHA 1V58A 1WTHA 3LT8A 2LYXA 5JPPA 1UUWB 3KE7A 2Y74A 2W56B 1VQO3 1B2ZA 3JVCA 3MWZA 3NUVA 4J9AA 4K1UA 1A2PA 1ROAA 3WA3A 2XSOB 1U5OA 2W9PA 3EBYA 4OK0A 5IEOA 2CW9A 4EV2A 1YGWA 3IMAB 2CWTA 3EHCA 2RBIA 5AYRB 1VQ43 5IW9A 1FYSA 1QVF2 1R4YA 4HM8B 1U8CB 2BMQB 5ELJA 1BAOA 1HU9A 1JN5B 1SPUA 3KN4A 1D6UA 2QA43 3X40A 1BVIA 1GOVA 4EC6A 1BGSA 2H0IA 4HKVB 3ZG0A 1B2UA 1IVWA 3CC73 1ROVA 3GZBA 1STDA 5DRVA 1NO3A 2F86B 4H3UA 4O8SA 4KT3B 1D6YA 4XM4A 3KFQC 3S27A 4HM2B 2C11A 1GMPA 3WDGB 1I2EA 1AVLA 3OWSA 1RGCA 3CD63 1IQYA 1O7NB 3GWRA 5DREA 1W02A 1BUQA 1RRLA 3X3XA 1BSBA 1ULIB 4GL6A 1GOUA 1BSEA 2M7OA 2OWPA 3DMCA 4STDA 4WFOA 2F98A 4R4KA 2BMOB 3G16A 2FGTA 4AKYA 5G1KA 2Z76A 2BMRB 2OOVC 1B21A 1BRIA 1M1XB 3LTCA 3NX0A 1W4NA 1GD3A 1ZX2A 3KCHA 3MG2A 3PYJA 2CG0A 1W6GA 3SEDA 1PU4A 1BRGA 3FG4A 3D5IA 3F7XA 3AMOB 4N6LA 3X3YA 1IVXA 2K0MA 4J8TA 2B1XB 3OXAA 4HOHA 1OCVA 4FMCA 4N6UA 4X2OA 3T8NA 7GSPA 1K28A 1UCJA 3JUQA 1GYBA 3CCE3 1MGWA 1YHQ3 1VQ83 1EQKA 1MWTA 3ROBA 2UX0A 1IT8A 4XBYA 6GSPA 1VQM3 3OWYA 4MMZB 4LZIA 4NPBA 2L1SA 4OVMA 3G6E3 1IQXA 1BNJA 2GEYA 2OQEC 1HZ1A 3B4OA 1O7HB 2O9UX 1NB3I 1OPYA 3KKGA 1YVSA 2ZHXB 2CFWA 4RNTA 2MC8A 1BRKA 1FGOA 3RGRA 1UCLA 3MYTA 3G713 1BNSA 3LH4A 5JPUA 4MMYB 2L4VA 2BNGA 2F4YA 2WGOA 3AGOA 1IT7A 3D5GA 1AQZA 4KVHA 1I0XA 1TU5A 1JNQA 1JB4A 1QAFA 1JKGB 1US1A 3CPOA 1EEJA 1I2GA 3LYGA 3LXUX 1RGGA 5IENA 2H0GA 3ECFA 3F40A 3SYUA 1FGTA 1X1XA 1QVG2 7STDA 3FCSB 4EBGA 5IEPA 2KCDA 2W9QA 5JBSA 1UDII 1DVCA 1FGQA 1W7CA 3K9MC 3DM8A 4RNZA 3WOEB 1OACA 4HYZA 2BO9B 1Q9EA 4K61A 3H51A 5AIFA 2XRXB 1Q864 1DMNA 1F8NA 3CME3 4BIRA 1DYUA 2WO0A 1ISKA 1Q7Y4 3AGNA 3VSYA 2B24B 1K734 1RCLA 4O2HA 3D3LA 6STDA 2Z6BA 5ELUA 3DUKA 9RNTA 2RNTA 3CC43 1UUGB 5IF6A 4KZ1A 1RN7A 2WGQA 3EBTA 2CWUA 1S723 3EF8A 2QEX3 3B7CA 1YJN3 1VQ63 1VQ53 1IQ8A 1JBSA 2W56A 2OCTA 2CWVA 5LC7A 1YGEA 1T2HA 3N8BA 3CPW2 1QAKA 5G2GA 2GEXA 3RGAA 1N9JA 4BL2A 3MG1A 1IVVA 3V92A 3KSED 2KF3A 5IG3A 2IYJA 3SOAA 1WMPA 1A67A 4HM5B 4L7KA 3D79A 3I0YA 1YIJ3 2SBLA 4IPBA 3RNTA 3S29A 3U1WA 2CC3A 3B4PA 2PNCA 1LQMB 3HK4A 4HAAA 2I9WA 6RNTA 1GY5A 3KIIA 3MHEA 1KSIA 1SJWA 1YNVX 1KQS2 4PEJA 2HMJB 1STFI 1GOYA 3K0ZA 4WYKB 3DGOA 4WHAA 1VQ73 1TRPA 5D82A 1BNRA 1MWRA 5KP3A 3DY5A 4AKZA 5HOHA 1HYFA 3GAXA 1UCKA 3CCQ3 8RNTA 3IJEB 1EKMA 3M8CA 1X1WA 1YIT3 3HZPA 5FW5A 1NB5I 2W0QA 5M1AA 1GMRA 1O7PB 1VQQA 4LGQA 1OF5B 5BIRA 1YVBI 1K9M4 3GZRA 3PXMA 2RGQA 1RKYA 1GY6A 1BUJA 4NREA 1RN1A 2XFTA 3FSDA 1JB2A 1OHOA 1FGRA 1G02A 2D1WA 1BNGA 2RFRA 2YFLB 1W6CA 3PCRA 5M19A 1KD14 3I553 4EYCA 4KFFA 2PZVA 1TJDA 2HMLB 5AIGA 2R41A 2QIYA 3D4AA 2AAEA 1MWUA 5BXQA 4FCJA 5GSPA 1OUNA 1B3SA 1OH0A 3AMOA 3DGMA 3DGYA 5AYSC 3UNLA 5EVHA 3CCR3 3S67A 1NJI4 1T5YA 4MMXB 2BIRA 1BU4A 3EX9A 4HZ9B 4O02B 3LTDA 1FW7A 1X1YA 3HX8A 3JUPA 2K3DA 1VQN3 2O3OA 2GU1A 2CHCA 4RNYA 4JRFA 4X2HA 1BRHA 1GS3A 3X41A 3FZWA 1RDSA 5RNTA 2GU3A 3JUNA 4NHFA 1FZUA 1Q7HA 4O3VA 2JQ5A 1A2VA 1RNBA 2BU4A 4FMAA 2BHMA 3RDEA 1NU3A 1FUSA 3DH2A 2KF5A 3K5TA 5D81A 5STDA 4HVNA 3KZTA 4HM1B 1RSNA 1ZS7A 4L8OA 3CCU3 2P09A 4R80A 1VQL3 1EG9B 2C10A 2J8XB 1CEWI 1BSDA 1C7HA 1SIIA 1Q40A 2AADA 1DVDA 5AEUB 1G96A 1MWSA 2CKFB 3HIGA 5KP1A 1DMQA 1JKGA 1PFPA 1RGFA 3G8ZA 3NQZA 3STDA 3FGYA 1VQK3 5HGRA 1J2BA 3PCSA 1M904 2OQEA 3G0KA 3GRDA 1PY3A 3Q3FA 1TFKA 1L5GB 3SVAA 2HMOB 1GY7A 1UCIA 1LOXA 1RLSA 4IIAA 1WNHA 3UL6A 2XH9A 2C4BA 1Q824 2XSHB 1CYVA 2SARA 5KP4A 4HM7B 4G1MB 4OUQA 4XDVA 1TUHA 4HZBB 5LC6A 1WQLB 1QMAA 3EQQB 3MPHA 3VGNA 3UB1A 2KXGA 5G1LA 2F56A 1AV4A 1E3VA 4HM4B 1I3FA 3T8UA 1B27A 1TP6A 1ASKA 2W2CA 4XBTA 1R4CA 1OGZA 3Q2PA 4QWTA 4N6OB 1LOWA 3URPA 2BT3A 1Q42A 3BIRA 4N3VA 3CMA3 1S5AA 2V1LA 4CDLA 3NV0A 3I563 4AEQA 1T2IA 1PYLA 1W2B2 4U13A 3NXJA 2F99A 3FKAA 1O7WB 2CG1A 1OHSA 4CCVA 1M1K4 1RGHA 2P38A 5CF2A 3WHOA 3CCL3 2XFSA 1SARA 3BNDA 3L0RA 2IUJA 4BTWA 1RMSA 3GZXB 4IT7A 3PZWA 1B20A 3K7CA 2CFGA 2HOHA 2A15A 1UI8A 1KC84 2P0MA 2E2TA 1IYYA 5I97A 1JZDA 4BU4A 3LTBA 3MKIA 3OWUA 2P0XA 4EW5A 2XGNA 2Z77A 3B8LA 4KFEA 5CXOA 1BOXA 1G0TA 1RHLA 2WOHA 2RCDA 1TIJA 4FR9A 5FGOA 4LSOA 3OX9A 2YFJB 1CQSA 2MF7A 4K90B 3CC23 3SLUA 4DKIA 1MGRA 4BL3A 1BNIA 3DGLA 2JDIH 3LMLA 1O7MB 1GSPA 1B2SA 2ML6A 3DZLA 3O8YA 2H0HA 4MJDA 3ZG5A 2CH9A 1LOYA 2FNQA 2E2UA 1JJ22 1QALA 8CHOA 3GZYB 1IV7A 2CFLA 1JN5A 1MNLA 1K8A4 1N8R4 4R9LA 1W2ZA 3VF1A 4GHOA 2KAAA 1VQP3 2W6JH 3F9SA 2CX1A 3LOYA 2HMKB 1A2KA 2Z7AA 5AI1A 3CNMA 4HM6B 1BNFA 2XEPA 5EEOA 3UJMA 3NBJA 3EC9A 3F7SA 3NM2A 3LZAA 5TGNA 3F14A 4CPKA 2HMNB 3Q90A 2GXFA
chains in the Genus database with same CATH topology
3SXXA 5A0OB 2IMJA 3JUOA 1EA2A 1A90A 4LEHA 2IA7A 3LT9A 3G4S3 5AIIA 3N54B 3X42A 1LVNA 4K1VA 3H3HA 3CXC2 1RRHA 1IK3A 5IERA 4EXRA 2GBWB 3UL5A 1JV2B 2OTL3 3CCS3 4N6MA 1E3RA 5BVBA 1YI23 3S5CA 3X3ZA 3PS8A 4JF8A 1Q814 1ZO2A 3BNBA 3J7Yd 1DMMA 5AEWB 2HMMB 4BTYA 1LXEA 3FLJA 3QK9A 3WODG 3EJVA 4FMBA 3EN8A 3T0UA 1KWIA 4Q53A 5D83A 3SOYA 1FGMA 2OOVA 1JRQA 4XBXA 1CYUA 3CCV3 3CCM3 1HKXA 3QRDA 1VZZA 3V99A 1GD4A 4N6V0 3IPTA 3NQYA 3Q1CA 4RBNA 4RZMA 3OW22 4EV5A 2D42A 4WWUC 3FG3A 1FA3A 1Z1SA 3N9HA 2ZDJA 1AVKA 1LNHA 4GB5A 3DGNA 3SX1A 3EN1B 1IV9A 2XR8B 3EE1A 2CIUA 3CNXA 2Q07A 4KFDA 2ML5A 3MSOA 3D9RA 3HI7A 4LMIA 3FG1A 1K41A 2W03A 1M9GA 2W04A 4WP5A 1RJOA 1W5ZA 1Y4KA 3OV4A 4MEIA 4N6NB 3WA2X 3JUMA 3CCJ3 4R1KA 3PGBA 3NBRA 1YJW3 3BLZA 3V98A 3HIIA 2QGUA 2YX9A 4FMDA 3A76A 2GBXB 1N5PA 3LTAA 3FH1A 2INXA 2YFIB 2FXTA 4R9KA 2CFKA 5CF1A 2LQVA 1WMNA 4XB5A 1D6ZA 4N6TA 3E99A 4ORLA 3U97A 4L8PA 1Q40B 3S28A 1NDOB 4BTXA 5IG5A 1O7GB 2P05A 1MOLA 3KSPA 3ER7A 1N9EA 1OGXA 3BNCA 1VQ93 2IUKA 1ULJB 1IU7A 5CK6A 3F8XA 4HBRA 5CLKA 3TDGA 1N5HA 1NWWA 3NHXA 4HM3B 4FCZA 2Y73A 1W01A 4HJLB 3FF0A 1W6YA 2XGLA 3DXOA 1W00A 2K54A 3ALAA 3EB8A 3FF2A 1SQWA 4TX4A 1OHPA 4H61A 1IVUA 5IG4A 3BNEA 1E97A 2KRTA 5EQLA 1UI7A 3NV0B 1YJ93 2E2VA 2WOFA 3K63A 1V74A 2STDA 2CK3H 2ZL8A 3MG3A 4WYKA 1TFOA 2OTJ3 1FUWA 3F8HA 1AR0A 3CU3A 1WMOA 1N8QA 2XF3A 2RSXA 4ZM8A 3WOFB 2CFDA 1QJGA 1UUVB 3NBBA 1JB5A 5IG0A 4XDWA 3WMDA 3NM7A 5AIHA 1IDPA 1UW1A 1OF5A 3BB9A 4FCMA 4HM0B 4I4KA 2R4IA 1SIHA 1WTHA 3LT8A 2LYXA 5JPPA 1UUWB 3KE7A 2Y74A 2W56B 1VQO3 3MWZA 3JVCA 3NUVA 4J9AA 4K1UA 1ROAA 3WA3A 2XSOB 1U5OA 2W9PA 3EBYA 4OK0A 5IEOA 2CW9A 4EV2A 3IMAB 2CWTA 3EHCA 1VQ43 5AYRB 5IW9A 1QVF2 4HM8B 1U8CB 2BMQB 5ELJA 1HU9A 1JN5B 1SPUA 3KN4A 1D6UA 2QA43 3X40A 4EC6A 4HKVB 1IVWA 3CC73 1ROVA 3GZBA 1STDA 5DRVA 1NO3A 2F86B 4H3UA 4O8SA 1D6YA 4XM4A 3KFQC 3S27A 4HM2B 2C11A 3WDGB 1AVLA 3OWSA 3CD63 1IQYA 1O7NB 3GWRA 5DREA 1W02A 1BUQA 1RRLA 3X3XA 1ULIB 4GL6A 2OWPA 2M7OA 3DMCA 4STDA 4WFOA 2F98A 4R4KA 2BMOB 3G16A 2FGTA 4AKYA 2Z76A 2BMRB 2OOVC 1M1XB 3LTCA 3NX0A 1W4NA 1GD3A 1ZX2A 3MG2A 3PYJA 2CG0A 1W6GA 3SEDA 1PU4A 3FG4A 3F7XA 3AMOB 4N6LA 3X3YA 1IVXA 2K0MA 4J8TA 2B1XB 3OXAA 1OCVA 4FMCA 4N6UA 4X2OA 3T8NA 1K28A 3JUQA 1GYBA 3CCE3 1YHQ3 1VQ83 1EQKA 3ROBA 2UX0A 1IT8A 4XBYA 1VQM3 3OWYA 4MMZB 4LZIA 3G6E3 4OVMA 1IQXA 2GEYA 2OQEC 3KKGA 3B4OA 1O7HB 2O9UX 1NB3I 1OPYA 2CFWA 2MC8A 1FGOA 3RGRA 3MYTA 3G713 3LH4A 5JPUA 4MMYB 2L4VA 2BNGA 2WGOA 1IT7A 4KVHA 1TU5A 1JNQA 1JB4A 1QAFA 1JKGB 1US1A 3CPOA 3LYGA 3LXUX 5IENA 3ECFA 3F40A 1FGTA 1QVG2 7STDA 3FCSB 4EBGA 5IEPA 2KCDA 2W9QA 5JBSA 1DVCA 1FGQA 1W7CA 3K9MC 3DM8A 4RNZA 3WOEB 1OACA 4HYZA 2BO9B 4K61A 3H51A 5AIFA 2XRXB 1Q864 1DMNA 1F8NA 3CME3 1DYUA 2WO0A 1ISKA 1Q7Y4 3VSYA 2B24B 1K734 4O2HA 3D3LA 6STDA 2Z6BA 5ELUA 3DUKA 3CC43 5IF6A 4KZ1A 1RN7A 2WGQA 3EBTA 2CWUA 1S723 3EF8A 2QEX3 3B7CA 1YJN3 1VQ63 1VQ53 1IQ8A 2W56A 2OCTA 2CWVA 5LC7A 1YGEA 3CPW2 3N8BA 1QAKA 5G2GA 2GEXA 3RGAA 1N9JA 3MG1A 1IVVA 3V92A 3KSED 5IG3A 3SOAA 1WMPA 1A67A 4HM5B 4L7KA 3I0YA 1YIJ3 2SBLA 4IPBA 3S29A 3U1WA 2CC3A 3B4PA 2PNCA 3HK4A 2I9WA 1GY5A 3KIIA 3MHEA 1KSIA 1SJWA 1KQS2 4PEJA 2HMJB 1STFI 3K0ZA 4WYKB 3DGOA 4WHAA 1VQ73 5D82A 5KP3A 4AKZA 3DY5A 3CCQ3 3GAXA 3IJEB 1EKMA 3M8CA 1YIT3 3HZPA 5FW5A 1NB5I 2W0QA 1O7PB 4LGQA 1OF5B 1YVBI 1K9M4 3GZRA 3PXMA 2RGQA 1RKYA 1GY6A 4NREA 2XFTA 3FSDA 1JB2A 1OHOA 1FGRA 2RFRA 2D1WA 2YFLB 3PCRA 1W6CA 1KD14 3I553 4EYCA 4KFFA 2PZVA 2HMLB 5AIGA 2QIYA 5BXQA 4FCJA 1OUNA 1OH0A 3AMOA 3DGMA 5AYSC 3UNLA 5EVHA 3CCR3 3S67A 1NJI4 1T5YA 4MMXB 4O02B 3EX9A 4HZ9B 3LTDA 3HX8A 3JUPA 1VQN3 2O3OA 2GU1A 2CHCA 4RNYA 4JRFA 4X2HA 1GS3A 3X41A 3FZWA 2GU3A 3JUNA 4NHFA 4O3VA 2JQ5A 1A2VA 4FMAA 2BHMA 3RDEA 1NU3A 3K5TA 5D81A 5STDA 4HVNA 3KZTA 4HM1B 4L8OA 3CCU3 2P09A 4R80A 1VQL3 1EG9B 2C10A 1CEWI 1C7HA 1SIIA 1Q40A 1DVDA 5AEUB 1G96A 2CKFB 3HIGA 5KP1A 1DMQA 1JKGA 1PFPA 3G8ZA 3STDA 3NQZA 1VQK3 3FGYA 1J2BA 5HGRA 3PCSA 1M904 2OQEA 3G0KA 3GRDA 1TFKA 1L5GB 3SVAA 2HMOB 1GY7A 1LOXA 4IIAA 1WNHA 3UL6A 2XH9A 1Q824 2XSHB 1CYVA 5KP4A 4HM7B 4G1MB 4OUQA 4XDVA 1TUHA 4HZBB 5LC6A 1WQLB 1QMAA 3EQQB 3MPHA 3VGNA 3UB1A 2KXGA 1AV4A 1E3VA 4HM4B 3T8UA 1TP6A 1ASKA 2W2CA 4XBTA 1R4CA 1OGZA 3Q2PA 4QWTA 4N6OB 2BT3A 1Q42A 4N3VA 3CMA3 1S5AA 2V1LA 4CDLA 3NV0A 3I563 4AEQA 1W2B2 4U13A 3NXJA 2F99A 3FKAA 1O7WB 2CG1A 1OHSA 4CCVA 1M1K4 2P38A 5CF2A 3CCL3 2XFSA 3BNDA 3L0RA 2IUJA 4BTWA 3GZXB 4IT7A 3PZWA 3K7CA 2CFGA 2A15A 1UI8A 1KC84 2P0MA 2E2TA 5I97A 3LTBA 3MKIA 3OWUA 2P0XA 2XGNA 2Z77A 3B8LA 4KFEA 5CXOA 2WOHA 2RCDA 1TIJA 4FR9A 5FGOA 4LSOA 3OX9A 2YFJB 1CQSA 2MF7A 4K90B 3CC23 3SLUA 3DGLA 2JDIH 3LMLA 1O7MB 2ML6A 3DZLA 3O8YA 4MJDA 2CH9A 2FNQA 2E2UA 1JJ22 1QALA 8CHOA 3GZYB 1IV7A 2CFLA 1JN5A 1MNLA 1K8A4 1N8R4 4R9LA 1W2ZA 3VF1A 1VQP3 2W6JH 3F9SA 3LOYA 2HMKB 1A2KA 2Z7AA 5AI1A 3CNMA 4HM6B 2XEPA 5EEOA 3UJMA 3NBJA 3EC9A 3F7SA 3NM2A 3LZAA 5TGNA 3F14A 2HMNB 3Q90A 2GXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IMJ A;  3JUO A;  1EA2 A;  4LEH A;  5AII A;  4K1V A;  3H3H A;  5IER A;  2GBW B;  1E3R A;  5BVB A;  3S5C A;  1ZO2 A;  1DMM A;  5AEW B;  2HMM B;  3FLJ A;  3EJV A;  3EN8 A;  4Q53 A;  5D83 A;  3SOY A;  4XBX A;  1HKX A;  1VZZ A;  3IPT A;  4RZM A;  4WWU C;  1Z1S A;  4GB5 A;  3EN1 B;  2XR8 B;  3CNX A;  3MSO A;  3D9R A;  4LMI A;  1K41 A;  4WP5 A;  3OV4 A;  3JUM A;  4R1K A;  3NBR A;  3BLZ A;  2QGU A;  3A76 A;  2GBX B;  3FH1 A;  2INX A;  2YFI B;  4R9K A;  5CF1 A;  4XB5 A;  3E99 A;  4ORL A;  4L8P A;  1Q40 B;  1NDO B;  5IG5 A;  1O7G B;  3KSP A;  3ER7 A;  1OGX A;  1ULJ B;  5CK6 A;  3F8X A;  5CLK A;  1NWW A;  3NHX A;  4HM3 B;  1W01 A;  4HJL B;  3FF0 A;  1W6Y A;  3DXO A;  1W00 A;  2K54 A;  3FF2 A;  1OHP A;  5IG4 A;  1E97 A;  3NV0 B;  2STD A;  3MG3 A;  4WYK A;  3F8H A;  1AR0 A;  3CU3 A;  1QJG A;  1UUV B;  1JB5 A;  5IG0 A;  4XDW A;  3WMD A;  5AIH A;  1IDP A;  1OF5 A;  3BB9 A;  4FCM A;  4HM0 B;  4I4K A;  2R4I A;  5JPP A;  1UUW B;  3KE7 A;  3NUV A;  4J9A A;  4K1U A;  2XSO B;  1U5O A;  3EBY A;  5IEO A;  3EHC A;  4HM8 B;  2BMQ B;  1JN5 B;  4HKV B;  3GZB A;  1STD A;  5DRV A;  2F86 B;  4H3U A;  4XM4 A;  4HM2 B;  3OWS A;  1O7N B;  3GWR A;  5DRE A;  1W02 A;  1BUQ A;  1ULI B;  2OWP A;  3DMC A;  4STD A;  2F98 A;  2BMO B;  3G16 A;  2Z76 A;  2BMR B;  1ZX2 A;  3MG2 A;  3SED A;  3F7X A;  4J8T A;  2B1X B;  3OXA A;  1OCV A;  3T8N A;  4X2O A;  3JUQ A;  1GYB A;  3ROB A;  2UX0 A;  4XBY A;  3OWY A;  4OVM A;  2GEY A;  3KKG A;  3B4O A;  1O7H B;  1OPY A;  3RGR A;  3MYT A;  5JPU A;  2BNG A;  4KVH A;  1JB4 A;  1JKG B;  3CPO A;  3LYG A;  5IEN A;  3ECF A;  3F40 A;  7STD A;  5IEP A;  3DM8 A;  3H51 A;  5AIF A;  2XRX B;  1DMN A;  1ISK A;  3VSY A;  2B24 B;  6STD A;  3DUK A;  5IF6 A;  3EBT A;  3EF8 A;  3B7C A;  5G2G A;  2GEX A;  3RGA A;  3MG1 A;  5IG3 A;  3SOA A;  4HM5 B;  4L7K A;  3I0Y A;  3B4P A;  3HK4 A;  2I9W A;  1GY5 A;  3MHE A;  1SJW A;  4PEJ A;  2HMJ B;  3K0Z A;  4WYK B;  5D82 A;  5KP3 A;  3M8C A;  3HZP A;  5FW5 A;  1O7P B;  4LGQ A;  1OF5 B;  3GZR A;  2RGQ A;  1GY6 A;  3FSD A;  1JB2 A;  1OHO A;  2RFR A;  2YFL B;  2PZV A;  2HML B;  5AIG A;  2QIY A;  5BXQ A;  4FCJ A;  1OUN A;  1OH0 A;  3UNL A;  5EVH A;  3EX9 A;  4HZ9 B;  3HX8 A;  3JUP A;  2CHC A;  4X2H A;  1GS3 A;  3FZW A;  3JUN A;  2JQ5 A;  1NU3 A;  5STD A;  5D81 A;  4HVN A;  3KZT A;  4HM1 B;  4L8O A;  1EG9 B;  1C7H A;  1Q40 A;  5AEU B;  2CKF B;  5KP1 A;  1DMQ A;  1JKG A;  3G8Z A;  3STD A;  3FGY A;  5HGR A;  3G0K A;  3GRD A;  2HMO B;  1GY7 A;  4IIA A;  2XSH B;  5KP4 A;  4HM7 B;  4OUQ A;  4XDV A;  1TUH A;  4HZB B;  1WQL B;  1QMA A;  3EQQ B;  3VGN A;  1E3V A;  4HM4 B;  3T8U A;  1TP6 A;  1ASK A;  2W2C A;  4XBT A;  1OGZ A;  1Q42 A;  4N3V A;  1S5A A;  4CDL A;  3NV0 A;  4U13 A;  3NXJ A;  2F99 A;  3FKA A;  1O7W B;  1OHS A;  5CF2 A;  3GZX B;  3K7C A;  2A15 A;  3MKI A;  3OWU A;  2Z77 A;  3B8L A;  5CXO A;  2RCD A;  3OX9 A;  2YFJ B;  1CQS A;  1O7M B;  3DZL A;  4MJD A;  8CHO A;  3GZY B;  1JN5 A;  4R9L A;  3F9S A;  2HMK B;  1A2K A;  2Z7A A;  5AI1 A;  3CNM A;  4HM6 B;  3UJM A;  3EC9 A;  3F7S A;  3NM2 A;  3LZA A;  5TGN A;  3F14 A;  2HMN B;  3Q90 A;  2GXF A; 
#chains in the Genus database with same CATH topology
 3SXX A;  5A0O B;  2IMJ A;  3JUO A;  1EA2 A;  1BRJ A;  1RGK A;  2F5W A;  1A90 A;  4LEH A;  2IA7 A;  3LT9 A;  3WR2 A;  5AII A;  3N54 B;  1EUI C;  3X42 A;  3G4S 3;  1AY7 A;  1LVN A;  3H3H A;  3GSP A;  4K1V A;  1RRH A;  1IK3 A;  3CXC 2;  5IER A;  4CJN A;  4EXR A;  2GBW B;  3UL5 A;  1I0V A;  1JV2 B;  2UUG C;  3CCS 3;  2OTL 3;  4N6M A;  1E3R A;  5BVB A;  1YI2 3;  3S5C A;  1V57 A;  2IY2 A;  3PS8 A;  4JF8 A;  3X3Z A;  1Q81 4;  1BIR A;  1ZO2 A;  3BNB A;  3J7Y d;  1DMM A;  5AEW B;  1I70 A;  2HMM B;  4BTY A;  1LXE A;  3FLJ A;  2UGI A;  3QK9 A;  3WOD G;  1DE3 A;  5BU4 A;  3EJV A;  4FMB A;  1RNT A;  3EN8 A;  1T3B A;  3T0U A;  1KWI A;  4LYL B;  4Q53 A;  5D83 A;  3SOY A;  1FUT A;  1FGM A;  2OOV A;  1RGL A;  1JRQ A;  1TTO A;  4XBX A;  1JBT A;  1BRN L;  1CYU A;  3CCV 3;  3CCM 3;  1HKX A;  1ZGX A;  3QRD A;  1VZZ A;  3V99 A;  1GD4 A;  4N6V 0;  3IPT A;  3NQY A;  3Q1C A;  4RBN A;  4RZM A;  3OW2 2;  4EV5 A;  2D42 A;  4WWU C;  3FG3 A;  1FA3 A;  1Z1S A;  1I3I A;  4J5G A;  1DET A;  2ZDJ A;  3N9H A;  1AVK A;  1LNH A;  4GB5 A;  3DGN A;  2ZA4 A;  3SX1 A;  3EN1 B;  1B2X A;  1IV9 A;  2XR8 B;  3EE1 A;  2CIU A;  3CNX A;  2Q07 A;  4KFD A;  2ML5 A;  3BU4 A;  3MSO A;  3D9R A;  1JZO A;  3HI7 A;  4LMI A;  1BNE A;  3FG1 A;  1K41 A;  3ZFZ A;  1BAN A;  1M9G A;  2W03 A;  2W04 A;  4WP5 A;  1RJO A;  1B2M A;  1W5Z A;  1Y4K A;  3OV4 A;  4MEI A;  4ILF A;  4N6N B;  1RCK A;  3WA2 X;  3JUM A;  3CCJ 3;  4R1K A;  3PGB A;  3NBR A;  1YJW 3;  3BLZ A;  3V98 A;  1RGE A;  1LQG C;  1BSA A;  2QGU A;  3HII A;  2YX9 A;  4FMD A;  2CX0 A;  3A76 A;  4I5Q A;  7RNT A;  2GBX B;  1N5P A;  3LTA A;  3FH1 A;  2INX A;  2YFI B;  4GSP A;  2FXT A;  1I2F A;  2CFK A;  4R9K A;  5CF1 A;  2LQV A;  1LOV A;  1WMN A;  4XB5 A;  3AHS A;  1D6Z A;  1LRA A;  3E99 A;  4N6T A;  4ORL A;  3U97 A;  4L8P A;  1TRQ A;  1Q40 B;  1C54 A;  3S28 A;  1NDO B;  3HOH A;  4BTX A;  5IG5 A;  1O7G B;  2P05 A;  1MOL A;  1RGA A;  3AHW A;  1CH0 A;  3KSP A;  3ER7 A;  1N9E A;  1OGX A;  3BNC A;  1VQ9 3;  2IUK A;  1ULJ B;  2GSP A;  1UGI A;  1IU7 A;  5CK6 A;  3F8X A;  4HBR A;  1UGH I;  5CLK A;  3TDG A;  1N5H A;  1NWW A;  3NHX A;  1LNI A;  4FCZ A;  4HM3 B;  2Y73 A;  1W01 A;  4HJL B;  3FF0 A;  1W6Y A;  2XGL A;  1JBR A;  1NNV A;  3DXO A;  1W00 A;  1RN4 A;  2K54 A;  1RTU A;  3ALA A;  3EB8 A;  3FF2 A;  1SQW A;  4TX4 A;  2F5M A;  5M18 A;  1OHP A;  4H61 A;  1IVU A;  3A5E A;  5IG4 A;  3BNE A;  1E97 A;  2KRT A;  5EQL A;  1UI7 A;  1GMQ A;  3NV0 B;  4J5K A;  2E2V A;  1YJ9 3;  1I8V A;  2WOF A;  3K63 A;  1V74 A;  2STD A;  2CK3 H;  2ZL8 A;  3MG3 A;  4WYK A;  1TFO A;  2OTJ 3;  1FUW A;  3F8H A;  1AR0 A;  3CU3 A;  1WMO A;  1N8Q A;  2XF3 A;  2RSX A;  2KF6 A;  4ZM8 A;  3WOF B;  2CFD A;  1QJG A;  1UUV B;  2KF4 A;  3NBB A;  1JB5 A;  5IG0 A;  4XDW A;  3WMD A;  3NM7 A;  5AIH A;  1IDP A;  1UW1 A;  1BSC A;  1OF5 A;  3BB9 A;  4FCM A;  4HM0 B;  1X1U A;  4I4K A;  2R4I A;  1BRS A;  1SIH A;  1V58 A;  1WTH A;  3LT8 A;  2LYX A;  5JPP A;  1UUW B;  3KE7 A;  2Y74 A;  2W56 B;  1VQO 3;  1B2Z A;  3JVC A;  3MWZ A;  3NUV A;  4J9A A;  4K1U A;  1A2P A;  1ROA A;  3WA3 A;  2XSO B;  1U5O A;  2W9P A;  3EBY A;  4OK0 A;  5IEO A;  2CW9 A;  4EV2 A;  1YGW A;  3IMA B;  2CWT A;  3EHC A;  2RBI A;  5AYR B;  1VQ4 3;  5IW9 A;  1FYS A;  1QVF 2;  1R4Y A;  4HM8 B;  1U8C B;  2BMQ B;  5ELJ A;  1BAO A;  1HU9 A;  1JN5 B;  1SPU A;  3KN4 A;  1D6U A;  2QA4 3;  3X40 A;  1BVI A;  1GOV A;  4EC6 A;  1BGS A;  2H0I A;  4HKV B;  3ZG0 A;  1B2U A;  1IVW A;  3CC7 3;  1ROV A;  3GZB A;  1STD A;  5DRV A;  1NO3 A;  2F86 B;  4H3U A;  4O8S A;  4KT3 B;  1D6Y A;  4XM4 A;  3KFQ C;  3S27 A;  4HM2 B;  2C11 A;  1GMP A;  3WDG B;  1I2E A;  1AVL A;  3OWS A;  1RGC A;  3CD6 3;  1IQY A;  1O7N B;  3GWR A;  5DRE A;  1W02 A;  1BUQ A;  1RRL A;  3X3X A;  1BSB A;  1ULI B;  4GL6 A;  1GOU A;  1BSE A;  2M7O A;  2OWP A;  3DMC A;  4STD A;  4WFO A;  2F98 A;  4R4K A;  2BMO B;  3G16 A;  2FGT A;  4AKY A;  5G1K A;  2Z76 A;  2BMR B;  2OOV C;  1B21 A;  1BRI A;  1M1X B;  3LTC A;  3NX0 A;  1W4N A;  1GD3 A;  1ZX2 A;  3KCH A;  3MG2 A;  3PYJ A;  2CG0 A;  1W6G A;  3SED A;  1PU4 A;  1BRG A;  3FG4 A;  3D5I A;  3F7X A;  3AMO B;  4N6L A;  3X3Y A;  1IVX A;  2K0M A;  4J8T A;  2B1X B;  3OXA A;  4HOH A;  1OCV A;  4FMC A;  4N6U A;  4X2O A;  3T8N A;  7GSP A;  1K28 A;  1UCJ A;  3JUQ A;  1GYB A;  3CCE 3;  1MGW A;  1YHQ 3;  1VQ8 3;  1EQK A;  1MWT A;  3ROB A;  2UX0 A;  1IT8 A;  4XBY A;  6GSP A;  1VQM 3;  3OWY A;  4MMZ B;  4LZI A;  4NPB A;  2L1S A;  4OVM A;  3G6E 3;  1IQX A;  1BNJ A;  2GEY A;  2OQE C;  1HZ1 A;  3B4O A;  1O7H B;  2O9U X;  1NB3 I;  1OPY A;  3KKG A;  1YVS A;  2ZHX B;  2CFW A;  4RNT A;  2MC8 A;  1BRK A;  1FGO A;  3RGR A;  1UCL A;  3MYT A;  3G71 3;  1BNS A;  3LH4 A;  5JPU A;  4MMY B;  2L4V A;  2BNG A;  2F4Y A;  2WGO A;  3AGO A;  1IT7 A;  3D5G A;  1AQZ A;  4KVH A;  1I0X A;  1TU5 A;  1JNQ A;  1JB4 A;  1QAF A;  1JKG B;  1US1 A;  3CPO A;  1EEJ A;  1I2G A;  3LYG A;  3LXU X;  1RGG A;  5IEN A;  2H0G A;  3ECF A;  3F40 A;  3SYU A;  1FGT A;  1X1X A;  1QVG 2;  7STD A;  3FCS B;  4EBG A;  5IEP A;  2KCD A;  2W9Q A;  5JBS A;  1UDI I;  1DVC A;  1FGQ A;  1W7C A;  3K9M C;  3DM8 A;  4RNZ A;  3WOE B;  1OAC A;  4HYZ A;  2BO9 B;  1Q9E A;  4K61 A;  3H51 A;  5AIF A;  2XRX B;  1Q86 4;  1DMN A;  1F8N A;  3CME 3;  4BIR A;  1DYU A;  2WO0 A;  1ISK A;  1Q7Y 4;  3AGN A;  3VSY A;  2B24 B;  1K73 4;  1RCL A;  4O2H A;  3D3L A;  6STD A;  2Z6B A;  5ELU A;  3DUK A;  9RNT A;  2RNT A;  3CC4 3;  1UUG B;  5IF6 A;  4KZ1 A;  1RN7 A;  2WGQ A;  3EBT A;  2CWU A;  1S72 3;  3EF8 A;  2QEX 3;  3B7C A;  1YJN 3;  1VQ6 3;  1VQ5 3;  1IQ8 A;  1JBS A;  2W56 A;  2OCT A;  2CWV A;  5LC7 A;  1YGE A;  1T2H A;  3N8B A;  3CPW 2;  1QAK A;  5G2G A;  2GEX A;  3RGA A;  1N9J A;  4BL2 A;  3MG1 A;  1IVV A;  3V92 A;  3KSE D;  2KF3 A;  5IG3 A;  2IYJ A;  3SOA A;  1WMP A;  1A67 A;  4HM5 B;  4L7K A;  3D79 A;  3I0Y A;  1YIJ 3;  2SBL A;  4IPB A;  3RNT A;  3S29 A;  3U1W A;  2CC3 A;  3B4P A;  2PNC A;  1LQM B;  3HK4 A;  4HAA A;  2I9W A;  6RNT A;  1GY5 A;  3KII A;  3MHE A;  1KSI A;  1SJW A;  1YNV X;  1KQS 2;  4PEJ A;  2HMJ B;  1STF I;  1GOY A;  3K0Z A;  4WYK B;  3DGO A;  4WHA A;  1VQ7 3;  1TRP A;  5D82 A;  1BNR A;  1MWR A;  5KP3 A;  3DY5 A;  4AKZ A;  5HOH A;  1HYF A;  3GAX A;  1UCK A;  3CCQ 3;  8RNT A;  3IJE B;  1EKM A;  3M8C A;  1X1W A;  1YIT 3;  3HZP A;  5FW5 A;  1NB5 I;  2W0Q A;  5M1A A;  1GMR A;  1O7P B;  1VQQ A;  4LGQ A;  1OF5 B;  5BIR A;  1YVB I;  1K9M 4;  3GZR A;  3PXM A;  2RGQ A;  1RKY A;  1GY6 A;  1BUJ A;  4NRE A;  1RN1 A;  2XFT A;  3FSD A;  1JB2 A;  1OHO A;  1FGR A;  1G02 A;  2D1W A;  1BNG A;  2RFR A;  2YFL B;  1W6C A;  3PCR A;  5M19 A;  1KD1 4;  3I55 3;  4EYC A;  4KFF A;  2PZV A;  1TJD A;  2HML B;  5AIG A;  2R41 A;  2QIY A;  3D4A A;  2AAE A;  1MWU A;  5BXQ A;  4FCJ A;  5GSP A;  1OUN A;  1B3S A;  1OH0 A;  3AMO A;  3DGM A;  3DGY A;  5AYS C;  3UNL A;  5EVH A;  3CCR 3;  3S67 A;  1NJI 4;  1T5Y A;  4MMX B;  2BIR A;  1BU4 A;  3EX9 A;  4HZ9 B;  4O02 B;  3LTD A;  1FW7 A;  1X1Y A;  3HX8 A;  3JUP A;  2K3D A;  1VQN 3;  2O3O A;  2GU1 A;  2CHC A;  4RNY A;  4JRF A;  4X2H A;  1BRH A;  1GS3 A;  3X41 A;  3FZW A;  1RDS A;  5RNT A;  2GU3 A;  3JUN A;  4NHF A;  1FZU A;  1Q7H A;  4O3V A;  2JQ5 A;  1A2V A;  1RNB A;  2BU4 A;  4FMA A;  2BHM A;  3RDE A;  1NU3 A;  1FUS A;  3DH2 A;  2KF5 A;  3K5T A;  5D81 A;  5STD A;  4HVN A;  3KZT A;  4HM1 B;  1RSN A;  1ZS7 A;  4L8O A;  3CCU 3;  2P09 A;  4R80 A;  1VQL 3;  1EG9 B;  2C10 A;  2J8X B;  1CEW I;  1BSD A;  1C7H A;  1SII A;  1Q40 A;  2AAD A;  1DVD A;  5AEU B;  1G96 A;  1MWS A;  2CKF B;  3HIG A;  5KP1 A;  1DMQ A;  1JKG A;  1PFP A;  1RGF A;  3G8Z A;  3NQZ A;  3STD A;  3FGY A;  1VQK 3;  5HGR A;  1J2B A;  3PCS A;  1M90 4;  2OQE A;  3G0K A;  3GRD A;  1PY3 A;  3Q3F A;  1TFK A;  1L5G B;  3SVA A;  2HMO B;  1GY7 A;  1UCI A;  1LOX A;  1RLS A;  4IIA A;  1WNH A;  3UL6 A;  2XH9 A;  2C4B A;  1Q82 4;  2XSH B;  1CYV A;  2SAR A;  5KP4 A;  4HM7 B;  4G1M B;  4OUQ A;  4XDV A;  1TUH A;  4HZB B;  5LC6 A;  1WQL B;  1QMA A;  3EQQ B;  3MPH A;  3VGN A;  3UB1 A;  2KXG A;  5G1L A;  2F56 A;  1AV4 A;  1E3V A;  4HM4 B;  1I3F A;  3T8U A;  1B27 A;  1TP6 A;  1ASK A;  2W2C A;  4XBT A;  1R4C A;  1OGZ A;  3Q2P A;  4QWT A;  4N6O B;  1LOW A;  3URP A;  2BT3 A;  1Q42 A;  3BIR A;  4N3V A;  3CMA 3;  1S5A A;  2V1L A;  4CDL A;  3NV0 A;  3I56 3;  4AEQ A;  1T2I A;  1PYL A;  1W2B 2;  4U13 A;  3NXJ A;  2F99 A;  3FKA A;  1O7W B;  2CG1 A;  1OHS A;  4CCV A;  1M1K 4;  1RGH A;  2P38 A;  5CF2 A;  3WHO A;  3CCL 3;  2XFS A;  1SAR A;  3BND A;  3L0R A;  2IUJ A;  4BTW A;  1RMS A;  3GZX B;  4IT7 A;  3PZW A;  1B20 A;  3K7C A;  2CFG A;  2HOH A;  2A15 A;  1UI8 A;  1KC8 4;  2P0M A;  2E2T A;  1IYY A;  5I97 A;  1JZD A;  4BU4 A;  3LTB A;  3MKI A;  3OWU A;  2P0X A;  4EW5 A;  2XGN A;  2Z77 A;  3B8L A;  4KFE A;  5CXO A;  1BOX A;  1G0T A;  1RHL A;  2WOH A;  2RCD A;  1TIJ A;  4FR9 A;  5FGO A;  4LSO A;  3OX9 A;  2YFJ B;  1CQS A;  2MF7 A;  4K90 B;  3CC2 3;  3SLU A;  4DKI A;  1MGR A;  4BL3 A;  1BNI A;  3DGL A;  2JDI H;  3LML A;  1O7M B;  1GSP A;  1B2S A;  2ML6 A;  3DZL A;  3O8Y A;  2H0H A;  4MJD A;  3ZG5 A;  2CH9 A;  1LOY A;  2FNQ A;  2E2U A;  1JJ2 2;  1QAL A;  8CHO A;  3GZY B;  1IV7 A;  2CFL A;  1JN5 A;  1MNL A;  1K8A 4;  1N8R 4;  4R9L A;  1W2Z A;  3VF1 A;  4GHO A;  2KAA A;  1VQP 3;  2W6J H;  3F9S A;  2CX1 A;  3LOY A;  2HMK B;  1A2K A;  2Z7A A;  5AI1 A;  3CNM A;  4HM6 B;  1BNF A;  2XEP A;  5EEO A;  3UJM A;  3NBJ A;  3EC9 A;  3F7S A;  3NM2 A;  3LZA A;  5TGN A;  3F14 A;  4CPK A;  2HMN B;  3Q90 A;  2GXF A; 
#chains in the Genus database with same CATH homology
 3SXX A;  5A0O B;  2IMJ A;  3JUO A;  1EA2 A;  1A90 A;  4LEH A;  2IA7 A;  3LT9 A;  3G4S 3;  5AII A;  3N54 B;  3X42 A;  1LVN A;  4K1V A;  3H3H A;  3CXC 2;  1RRH A;  1IK3 A;  5IER A;  4EXR A;  2GBW B;  3UL5 A;  1JV2 B;  2OTL 3;  3CCS 3;  4N6M A;  1E3R A;  5BVB A;  1YI2 3;  3S5C A;  3X3Z A;  3PS8 A;  4JF8 A;  1Q81 4;  1ZO2 A;  3BNB A;  3J7Y d;  1DMM A;  5AEW B;  2HMM B;  4BTY A;  1LXE A;  3FLJ A;  3QK9 A;  3WOD G;  3EJV A;  4FMB A;  3EN8 A;  3T0U A;  1KWI A;  4Q53 A;  5D83 A;  3SOY A;  1FGM A;  2OOV A;  1JRQ A;  4XBX A;  1CYU A;  3CCV 3;  3CCM 3;  1HKX A;  3QRD A;  1VZZ A;  3V99 A;  1GD4 A;  4N6V 0;  3IPT A;  3NQY A;  3Q1C A;  4RBN A;  4RZM A;  3OW2 2;  4EV5 A;  2D42 A;  4WWU C;  3FG3 A;  1FA3 A;  1Z1S A;  3N9H A;  2ZDJ A;  1AVK A;  1LNH A;  4GB5 A;  3DGN A;  3SX1 A;  3EN1 B;  1IV9 A;  2XR8 B;  3EE1 A;  2CIU A;  3CNX A;  2Q07 A;  4KFD A;  2ML5 A;  3MSO A;  3D9R A;  3HI7 A;  4LMI A;  3FG1 A;  1K41 A;  2W03 A;  1M9G A;  2W04 A;  4WP5 A;  1RJO A;  1W5Z A;  1Y4K A;  3OV4 A;  4MEI A;  4N6N B;  3WA2 X;  3JUM A;  3CCJ 3;  4R1K A;  3PGB A;  3NBR A;  1YJW 3;  3BLZ A;  3V98 A;  3HII A;  2QGU A;  2YX9 A;  4FMD A;  3A76 A;  2GBX B;  1N5P A;  3LTA A;  3FH1 A;  2INX A;  2YFI B;  2FXT A;  4R9K A;  2CFK A;  5CF1 A;  2LQV A;  1WMN A;  4XB5 A;  1D6Z A;  4N6T A;  3E99 A;  4ORL A;  3U97 A;  4L8P A;  1Q40 B;  3S28 A;  1NDO B;  4BTX A;  5IG5 A;  1O7G B;  2P05 A;  1MOL A;  3KSP A;  3ER7 A;  1N9E A;  1OGX A;  3BNC A;  1VQ9 3;  2IUK A;  1ULJ B;  1IU7 A;  5CK6 A;  3F8X A;  4HBR A;  5CLK A;  3TDG A;  1N5H A;  1NWW A;  3NHX A;  4HM3 B;  4FCZ A;  2Y73 A;  1W01 A;  4HJL B;  3FF0 A;  1W6Y A;  2XGL A;  3DXO A;  1W00 A;  2K54 A;  3ALA A;  3EB8 A;  3FF2 A;  1SQW A;  4TX4 A;  1OHP A;  4H61 A;  1IVU A;  5IG4 A;  3BNE A;  1E97 A;  2KRT A;  5EQL A;  1UI7 A;  3NV0 B;  1YJ9 3;  2E2V A;  2WOF A;  3K63 A;  1V74 A;  2STD A;  2CK3 H;  2ZL8 A;  3MG3 A;  4WYK A;  1TFO A;  2OTJ 3;  1FUW A;  3F8H A;  1AR0 A;  3CU3 A;  1WMO A;  1N8Q A;  2XF3 A;  2RSX A;  4ZM8 A;  3WOF B;  2CFD A;  1QJG A;  1UUV B;  3NBB A;  1JB5 A;  5IG0 A;  4XDW A;  3WMD A;  3NM7 A;  5AIH A;  1IDP A;  1UW1 A;  1OF5 A;  3BB9 A;  4FCM A;  4HM0 B;  4I4K A;  2R4I A;  1SIH A;  1WTH A;  3LT8 A;  2LYX A;  5JPP A;  1UUW B;  3KE7 A;  2Y74 A;  2W56 B;  1VQO 3;  3MWZ A;  3JVC A;  3NUV A;  4J9A A;  4K1U A;  1ROA A;  3WA3 A;  2XSO B;  1U5O A;  2W9P A;  3EBY A;  4OK0 A;  5IEO A;  2CW9 A;  4EV2 A;  3IMA B;  2CWT A;  3EHC A;  1VQ4 3;  5AYR B;  5IW9 A;  1QVF 2;  4HM8 B;  1U8C B;  2BMQ B;  5ELJ A;  1HU9 A;  1JN5 B;  1SPU A;  3KN4 A;  1D6U A;  2QA4 3;  3X40 A;  4EC6 A;  4HKV B;  1IVW A;  3CC7 3;  1ROV A;  3GZB A;  1STD A;  5DRV A;  1NO3 A;  2F86 B;  4H3U A;  4O8S A;  1D6Y A;  4XM4 A;  3KFQ C;  3S27 A;  4HM2 B;  2C11 A;  3WDG B;  1AVL A;  3OWS A;  3CD6 3;  1IQY A;  1O7N B;  3GWR A;  5DRE A;  1W02 A;  1BUQ A;  1RRL A;  3X3X A;  1ULI B;  4GL6 A;  2OWP A;  2M7O A;  3DMC A;  4STD A;  4WFO A;  2F98 A;  4R4K A;  2BMO B;  3G16 A;  2FGT A;  4AKY A;  2Z76 A;  2BMR B;  2OOV C;  1M1X B;  3LTC A;  3NX0 A;  1W4N A;  1GD3 A;  1ZX2 A;  3MG2 A;  3PYJ A;  2CG0 A;  1W6G A;  3SED A;  1PU4 A;  3FG4 A;  3F7X A;  3AMO B;  4N6L A;  3X3Y A;  1IVX A;  2K0M A;  4J8T A;  2B1X B;  3OXA A;  1OCV A;  4FMC A;  4N6U A;  4X2O A;  3T8N A;  1K28 A;  3JUQ A;  1GYB A;  3CCE 3;  1YHQ 3;  1VQ8 3;  1EQK A;  3ROB A;  2UX0 A;  1IT8 A;  4XBY A;  1VQM 3;  3OWY A;  4MMZ B;  4LZI A;  3G6E 3;  4OVM A;  1IQX A;  2GEY A;  2OQE C;  3KKG A;  3B4O A;  1O7H B;  2O9U X;  1NB3 I;  1OPY A;  2CFW A;  2MC8 A;  1FGO A;  3RGR A;  3MYT A;  3G71 3;  3LH4 A;  5JPU A;  4MMY B;  2L4V A;  2BNG A;  2WGO A;  1IT7 A;  4KVH A;  1TU5 A;  1JNQ A;  1JB4 A;  1QAF A;  1JKG B;  1US1 A;  3CPO A;  3LYG A;  3LXU X;  5IEN A;  3ECF A;  3F40 A;  1FGT A;  1QVG 2;  7STD A;  3FCS B;  4EBG A;  5IEP A;  2KCD A;  2W9Q A;  5JBS A;  1DVC A;  1FGQ A;  1W7C A;  3K9M C;  3DM8 A;  4RNZ A;  3WOE B;  1OAC A;  4HYZ A;  2BO9 B;  4K61 A;  3H51 A;  5AIF A;  2XRX B;  1Q86 4;  1DMN A;  1F8N A;  3CME 3;  1DYU A;  2WO0 A;  1ISK A;  1Q7Y 4;  3VSY A;  2B24 B;  1K73 4;  4O2H A;  3D3L A;  6STD A;  2Z6B A;  5ELU A;  3DUK A;  3CC4 3;  5IF6 A;  4KZ1 A;  1RN7 A;  2WGQ A;  3EBT A;  2CWU A;  1S72 3;  3EF8 A;  2QEX 3;  3B7C A;  1YJN 3;  1VQ6 3;  1VQ5 3;  1IQ8 A;  2W56 A;  2OCT A;  2CWV A;  5LC7 A;  1YGE A;  3CPW 2;  3N8B A;  1QAK A;  5G2G A;  2GEX A;  3RGA A;  1N9J A;  3MG1 A;  1IVV A;  3V92 A;  3KSE D;  5IG3 A;  3SOA A;  1WMP A;  1A67 A;  4HM5 B;  4L7K A;  3I0Y A;  1YIJ 3;  2SBL A;  4IPB A;  3S29 A;  3U1W A;  2CC3 A;  3B4P A;  2PNC A;  3HK4 A;  2I9W A;  1GY5 A;  3KII A;  3MHE A;  1KSI A;  1SJW A;  1KQS 2;  4PEJ A;  2HMJ B;  1STF I;  3K0Z A;  4WYK B;  3DGO A;  4WHA A;  1VQ7 3;  5D82 A;  5KP3 A;  4AKZ A;  3DY5 A;  3CCQ 3;  3GAX A;  3IJE B;  1EKM A;  3M8C A;  1YIT 3;  3HZP A;  5FW5 A;  1NB5 I;  2W0Q A;  1O7P B;  4LGQ A;  1OF5 B;  1YVB I;  1K9M 4;  3GZR A;  3PXM A;  2RGQ A;  1RKY A;  1GY6 A;  4NRE A;  2XFT A;  3FSD A;  1JB2 A;  1OHO A;  1FGR A;  2RFR A;  2D1W A;  2YFL B;  3PCR A;  1W6C A;  1KD1 4;  3I55 3;  4EYC A;  4KFF A;  2PZV A;  2HML B;  5AIG A;  2QIY A;  5BXQ A;  4FCJ A;  1OUN A;  1OH0 A;  3AMO A;  3DGM A;  5AYS C;  3UNL A;  5EVH A;  3CCR 3;  3S67 A;  1NJI 4;  1T5Y A;  4MMX B;  4O02 B;  3EX9 A;  4HZ9 B;  3LTD A;  3HX8 A;  3JUP A;  1VQN 3;  2O3O A;  2GU1 A;  2CHC A;  4RNY A;  4JRF A;  4X2H A;  1GS3 A;  3X41 A;  3FZW A;  2GU3 A;  3JUN A;  4NHF A;  4O3V A;  2JQ5 A;  1A2V A;  4FMA A;  2BHM A;  3RDE A;  1NU3 A;  3K5T A;  5D81 A;  5STD A;  4HVN A;  3KZT A;  4HM1 B;  4L8O A;  3CCU 3;  2P09 A;  4R80 A;  1VQL 3;  1EG9 B;  2C10 A;  1CEW I;  1C7H A;  1SII A;  1Q40 A;  1DVD A;  5AEU B;  1G96 A;  2CKF B;  3HIG A;  5KP1 A;  1DMQ A;  1JKG A;  1PFP A;  3G8Z A;  3STD A;  3NQZ A;  1VQK 3;  3FGY A;  1J2B A;  5HGR A;  3PCS A;  1M90 4;  2OQE A;  3G0K A;  3GRD A;  1TFK A;  1L5G B;  3SVA A;  2HMO B;  1GY7 A;  1LOX A;  4IIA A;  1WNH A;  3UL6 A;  2XH9 A;  1Q82 4;  2XSH B;  1CYV A;  5KP4 A;  4HM7 B;  4G1M B;  4OUQ A;  4XDV A;  1TUH A;  4HZB B;  5LC6 A;  1WQL B;  1QMA A;  3EQQ B;  3MPH A;  3VGN A;  3UB1 A;  2KXG A;  1AV4 A;  1E3V A;  4HM4 B;  3T8U A;  1TP6 A;  1ASK A;  2W2C A;  4XBT A;  1R4C A;  1OGZ A;  3Q2P A;  4QWT A;  4N6O B;  2BT3 A;  1Q42 A;  4N3V A;  3CMA 3;  1S5A A;  2V1L A;  4CDL A;  3NV0 A;  3I56 3;  4AEQ A;  1W2B 2;  4U13 A;  3NXJ A;  2F99 A;  3FKA A;  1O7W B;  2CG1 A;  1OHS A;  4CCV A;  1M1K 4;  2P38 A;  5CF2 A;  3CCL 3;  2XFS A;  3BND A;  3L0R A;  2IUJ A;  4BTW A;  3GZX B;  4IT7 A;  3PZW A;  3K7C A;  2CFG A;  2A15 A;  1UI8 A;  1KC8 4;  2P0M A;  2E2T A;  5I97 A;  3LTB A;  3MKI A;  3OWU A;  2P0X A;  2XGN A;  2Z77 A;  3B8L A;  4KFE A;  5CXO A;  2WOH A;  2RCD A;  1TIJ A;  4FR9 A;  5FGO A;  4LSO A;  3OX9 A;  2YFJ B;  1CQS A;  2MF7 A;  4K90 B;  3CC2 3;  3SLU A;  3DGL A;  2JDI H;  3LML A;  1O7M B;  2ML6 A;  3DZL A;  3O8Y A;  4MJD A;  2CH9 A;  2FNQ A;  2E2U A;  1JJ2 2;  1QAL A;  8CHO A;  3GZY B;  1IV7 A;  2CFL A;  1JN5 A;  1MNL A;  1K8A 4;  1N8R 4;  4R9L A;  1W2Z A;  3VF1 A;  1VQP 3;  2W6J H;  3F9S A;  3LOY A;  2HMK B;  1A2K A;  2Z7A A;  5AI1 A;  3CNM A;  4HM6 B;  2XEP A;  5EEO A;  3UJM A;  3NBJ A;  3EC9 A;  3F7S A;  3NM2 A;  3LZA A;  5TGN A;  3F14 A;  2HMN B;  3Q90 A;  2GXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...