2HMLB

Crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
INIQEDKLVSAHDAEEILRFFNCHDSALQQEATTLLTQEAHLLDIQAYRAWLEHCVGSEVQYQVISRELRAASERRYKLNEAMNVYNENFQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAMDVNDKELLHIRSNVILHRARRGNQVDVFYAAREDKWKRGEGGVRKLVQRFVDYPERILQTHNLMVFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Naphthalene 1,2-dioxygenase alpha subunit
publication title Structural basis for regioselectivity and stereoselectivity of product formation by naphthalene 1,2-dioxygenase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00866 Ring_hydroxyl_B Ring hydroxylating beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2hmlB00
3F9SA 5D81A 5CLKA 3GZXB 2W2CA 2B1XB 3JUPA 5G2GA 5D83A 2HMOB 1W02A 4MJDA 3FF0A 3MG2A 4L8PA 5KP1A 3EBTA 3DZLA 3IPTA 2R4IA 1OGZA 1BUQA 5IEOA 5CF2A 2Z77A 4XDWA 5IG4A 3VSYA 1OGXA 2BNGA 2BMOB 2GEYA 4HM2B 3WMDA 2BMQB 3DMCA 4XB5A 5AIHA 4I4KA 2OWPA 3LZAA 3NHXA 1OUNA 3CU3A 3OXAA 2IMJA 2JQ5A 3Q90A 3K0ZA 3KSPA 5JPUA 3FZWA 2YFLB 2HMNB 2GEXA 4FCMA 5IG0A 5AI1A 1ISKA 2YFIB 1JB2A 4GB5A 5STDA 1ASKA 1JB4A 2PZVA 1OF5B 3FF2A 3T8UA 1VZZA 4U13A 2I9WA 4OUQA 3NBRA 5AIFA 2BMRB 2RGQA 1S5AA 3KKGA 3EN8A 1TUHA 1OHPA 1ZO2A 5FW5A 1OHOA 1ZX2A 1OF5A 2YFJB 4STDA 3F8HA 3NV0B 4HM1B 4HVNA 3EN1B 3B7CA 3G16A 4PEJA 2INXA 3MG3A 4XDVA 4KVHA 3A76A 3OWYA 3GZBA 1E3VA 3SEDA 4IIAA 1O7HB 3NV0A 3FGYA 2B24B 3EBYA 2GBXB 2XR8B 3EX9A 5KP4A 3B4OA 1GS3A 5IF6A 2RFRA 1QMAA 4WP5A 3F40A 4K1UA 4FCJA 5CXOA 3DUKA 5IG5A 1NDOB 4R9KA 1GYBA 1EG9B 5AEWB 1EA2A 3I0YA 3CNMA 3EHCA 5AIGA 3OV4A 3GRDA 4J9AA 5CF1A 4L7KA 3JUMA 4HZ9B 1ULIB 3E99A 5EVHA 3H3HA 3GZYB 3STDA 2HMLB 4WYKB 2F86B 3SOYA 3HK4A 3EJVA 4ORLA 3FKAA 1O7PB 3FH1A 5AIIA 3BB9A 3CPOA 3DXOA 3K7CA 3MKIA 2QIYA 4HM6B 4CDLA 4L8OA 4LGQA 1OPYA 2GXFA 4HM4B 1QJGA 4J8TA 1E3RA 1CQSA 1O7NB 1NWWA 3G8ZA 4H3UA 4WWUC 4WYKA 3MSOA 1JB5A 1Q40B 1ULJB 2GBWB 5HGRA 4R9LA 3H51A 2F98A 4XBTA 4HKVB 3NUVA 4HJLB 1O7GB 2CHCA 5DREA 1E97A 4HM5B 3EQQB 1K41A 5D82A 5IEPA 1JN5B 1HKXA 1TP6A 1JKGB 4Q53A 3VGNA 2HMKB 4HZBB 1Q42A 1UUWB 3OWUA 3ER7A 2XSHB 3FSDA 1DMNA 5JPPA 2RCDA 2F99A 1STDA 3MG1A 1GY6A 3EF8A 3HX8A 3BLZA 5AEUB 1OH0A 4XBYA 1JN5A 3KE7A 3UJMA 3JUNA 1JKGA 1W01A 3OX9A 4HM3B 4K1VA 2QGUA 1GY5A 7STDA 1WQLB 1IDPA 1DMMA 1DMQA 3ECFA 3JUQA 3CNXA 2XRXB 6STDA 1W00A 5CK6A 3DM8A 2XSOB 5IG3A 2UX0A 2CKFB 3MYTA 1AR0A 4N3VA 3JUOA 4HM7B 3GZRA 3FLJA 5TGNA 5BVBA 4X2OA 1SJWA 3GWRA 4LMIA 4LEHA 1NU3A 1A2KA 3F7SA 3SOAA 2Z76A 2HMJB 3KZTA 1O7WB 8CHOA 5IERA 1U5OA 1W6YA 3F7XA 1C7HA 1OHSA 5DRVA 3T8NA 3NM2A 3NXJA 4RZMA 1Z1SA 1UUVB 3B8LA 1O7MB 3RGRA 3B4PA 3M8CA 4OVMA 3OWSA 3HZPA 4R1KA 5BXQA 4XBXA 2K54A 3F8XA 2A15A 3F14A 3S5CA 3ROBA 3G0KA 2STDA 3D9RA 1Q40A 4XM4A 3EC9A 1GY7A 3UNLA 2Z7AA 4HM8B 5KP3A 2HMMB 3LYGA 1OCVA 4X2HA 3RGAA 3MHEA 5IENA 4HM0B
chains in the Genus database with same CATH superfamily
1T3BA 4FMBA 1RDSA 1JNQA 4IPBA 3OW22 3N9HA 1VQN3 3F9SA 2CW9A 5D81A 5CLKA 5BU4A 1BRJA 2ZA4A 1MWUA 1STFI 2J8XB 2CH9A 3X3ZA 3GZXB 2W2CA 1BIRA 1RKYA 2B1XB 1LNIA 3JUPA 1FYSA 5G2GA 4LYLB 1VQM3 1B21A 1BSCA 1T5YA 1TRPA 5D83A 2HMOB 1KSIA 1NB5I 1WMOA 3ALAA 1W02A 2L4VA 1AVKA 4MJDA 4MMZB 3N8BA 4O8SA 3FF0A 1JZOA 2BIRA 2OOVC 3MG2A 4L8PA 5KP1A 1J2BA 3EBTA 3V99A 1IV9A 2O3OA 3DGLA 3DZLA 3PYJA 1TIJA 2XGNA 2R4IA 1OGZA 2XFSA 1AQZA 3IPTA 1C54A 3CCQ3 3S67A 1IU7A 2CFKA 1G0TA 1BUQA 1YVBI 1VQP3 3CCE3 3UB1A 2H0GA 3HIGA 5IEOA 5CF2A 1EKMA 1VQK3 4KFFA 4FCZA 1MGRA 4TX4A 1W6CA 1W7CA 1RCKA 3CCR3 4EBGA 4ZM8A 2IYJA 2AADA 2WOFA 2Z77A 3I553 4XDWA 3WA2X 1N8R4 1VQ83 1FUTA 5IG4A 1RGCA 3VSYA 1OGXA 2BNGA 2V1LA 1LQMB 2BMOB 2GEYA 1WMPA 4HM2B 3WMDA 3HIIA 1B20A 2BMQB 3U97A 1YHQ3 1R4YA 3DMCA 4XB5A 1RSNA 1I2GA 3Q3FA 4BTXA 5AIHA 4I4KA 1MWSA 2OWPA 3LZAA 1RNBA 3NHXA 1I0XA 1OUNA 1PFPA 3CU3A 3OXAA 4BTWA 3IJEB 1BNFA 1JRQA 2CFLA 2WO0A 2IMJA 1YGWA 2W56B 2JQ5A 2W0QA 2OQEA 3Q90A 1D6UA 4OK0A 3K0ZA 3KSPA 2LYXA 3G713 1BVIA 2CG0A 5JPUA 1VQ63 1LNHA 3FZWA 2GSPA 2YFLB 4KT3B 2F56A 2HMNB 4N6NB 2GEXA 2LQVA 4FCMA 1IQYA 3LOYA 1BRNL 5LC6A 1IVWA 5IG0A 1JV2B 2R41A 5AI1A 1ISKA 2YFIB 5M1AA 1JB2A 3WOFB 2Y73A 1T2HA 3K9MC 3ZG5A 4GB5A 2F5MA 4J5KA 5STDA 3BNCA 3LTDA 3CME3 1ASKA 1JB4A 1K28A 2PZVA 4N6MA 4EYCA 1OF5B 3FF2A 3T8UA 3D5GA 2XEPA 3NQZA 1RRHA 1VZZA 5G1LA 1TFOA 4U13A 9RNTA 2I9WA 1NO3A 4OUQA 3NBRA 2BT3A 2BHMA 3PS8A 2W56A 5AIFA 2BMRB 2KCDA 1A90A 4N6TA 3CC43 1RGLA 4WHAA 1M1K4 1RGAA 4N6LA 1N5HA 2RGQA 2BO9B 1M904 2P09A 1BRIA 1I3FA 1TJDA 1S5AA 3URPA 1RTUA 5EQLA 1GMRA 1Q824 3KKGA 5AYRB 4MMXB 2E2TA 4R80A 2CFDA 3EN8A 1TUHA 4DKIA 1HU9A 1K9M4 1V57A 3QRDA 1OHPA 1ZO2A 4LSOA 2ZDJA 3SVAA 5FW5A 4HAAA 5EEOA 2KRTA 1WMNA 1KWIA 3WODG 1B2SA 1OHOA 1PYLA 1OF5A 1ZX2A 2YFJB 4STDA 1MOLA 1DE3A 3F8HA 4IT7A 3NV0B 2KF4A 1B2ZA 3ZG0A 2GU3A 1UCIA 1NJI4 4FMAA 4HM1B 3CXC2 1AY7A 4HVNA 3EN1B 3LTBA 3WHOA 3B7CA 3G16A 1KQS2 4PEJA 1BNSA 2AAEA 2CX1A 3X3XA 3GSPA 2INXA 2E2UA 3MG3A 4XDVA 4FR9A 2OQEC 4O02B 1M9GA 4KVHA 1Q7HA 3A76A 3UL5A 3AGNA 3BNEA 2CK3H 1KC84 2SBLA 1G96A 3OWYA 2C4BA 5IW9A 3DY5A 1I8VA 1RGGA 2W03A 1E3VA 3AMOB 3GZBA 1YJN3 1L5GB 3SEDA 1U8CB 4IIAA 1RNTA 3D5IA 1O7HB 1UI8A 5HOHA 3NV0A 1LVNA 3FGYA 1UGIA 1BU4A 2B24B 3SXXA 1FA3A 1RGKA 3Q2PA 2PNCA 1V58A 3NM7A 3RNTA 1D6ZA 5G1KA 1Q864 4LZIA 3EBYA 3WOEB 1BSBA 1FUWA 1W2B2 2JDIH 6RNTA 1UCLA 2GBXB 4MMYB 2MF7A 2XR8B 2Q07A 1LOXA 4H61A 3K5TA 1BRSA 3EX9A 5KP4A 1RLSA 4AKYA 5FGOA 3B4OA 1GS3A 3BNDA 1S723 5IF6A 1YI23 3AMOA 1YIJ3 1JZDA 2RFRA 5AYSC 2HOHA 3K63A 1SIHA 1I3IA 1QMAA 2W9QA 2WOHA 3BNBA 3LT8A 2IA7A 4N6OB 1VQ53 1W6GA 4WP5A 3MWZA 4GL6A 4EW5A 3CC23 2XGLA 1IT7A 3KFQC 1GSPA 3F40A 4K1UA 4FCJA 5CXOA 1BNEA 2IUJA 1YNVX 3X3YA 4JRFA 1TRQA 3DUKA 2ZHXB 3L0RA 2P0XA 1QALA 3AHWA 4FMCA 4KFDA 8RNTA 5IG5A 1B2MA 2Z6BA 1NDOB 1GYBA 4R9KA 1JBTA 1EG9B 5AEWB 1EA2A 3I0YA 1PY3A 2CWVA 3CNMA 3FG3A 1BGSA 3EHCA 5AIGA 1IVUA 4BL3A 3OV4A 1IVVA 1W2ZA 1UCKA 1K734 2CX0A 3GRDA 4J9AA 5CF1A 3LH4A 1MWTA 1KD14 3EB8A 4EXRA 1YIT3 4AEQA 4L7KA 3JUMA 1CEWI 1IVXA 4HZ9B 1ULIB 3E99A 3A5EA 5EVHA 3H3HA 3PGBA 2CWUA 2P05A 3GZYB 3STDA 1BSAA 1TFKA 2H0HA 2HMLB 4WYKB 2F86B 1FGMA 3SOYA 2F4YA 2F5WA 3DGNA 3EJVA 3HK4A 1GOUA 4NREA 3FKAA 1O7PB 3FH1A 4ORLA 5AIIA 3S28A 3BB9A 1TU5A 3LXUX 2GU1A 2IUKA 3CPOA 2OTJ3 2ML5A 2W6JH 1UUGB 3DXOA 2XF3A 3PCRA 1VQ93 3K7CA 2KF5A 1GMPA 4K90B 7RNTA 3MKIA 2QIYA 1BNIA 1RRLA 4HM6B 1RCLA 1ROVA 3LTAA 4CDLA 1BOXA 2BU4A 4HOHA 4EC6A 4L8OA 4LGQA 1OPYA 2GXFA 4HM4B 3X42A 1QJGA 3IMAB 4J8TA 4O2HA 1E3RA 1CQSA 4RNTA 1O7NB 1ZS7A 4NPBA 2QEX3 1WNHA 1B27A 1BNGA 1N5PA 1NWWA 2ZL8A 3BU4A 4BIRA 3G8ZA 1Q814 4H3UA 4WWUC 1RGHA 4WYKA 1YJ93 3MSOA 1N8QA 4KFEA 1FZUA 4RBNA 7GSPA 1JB5A 1Q40B 2UUGC 3MPHA 1X1XA 4N6UA 1LXEA 3PXMA 2D1WA 1ULJB 1FUSA 2W04A 5RNTA 3I563 2GBWB 4CPKA 5HGRA 2XFTA 4R9LA 1A2VA 3G4S3 3H51A 1SPUA 2F98A 1M1XB 2CFWA 4XBTA 4HKVB 3NUVA 4HJLB 4EV5A 1O7GB 1X1WA 3GAXA 1US1A 3LMLA 2CHCA 5DREA 1UDII 1RHLA 1E97A 2P0MA 4G1MB 1G02A 1DVDA 4HM5B 1SIIA 1LOWA 3EQQB 1K41A 5D82A 5IEPA 4HBRA 3ZFZA 1YJW3 3D3LA 1JN5B 1HKXA 1TP6A 3CMA3 1BRHA 3T0UA 1K8A4 1JKGB 4Q53A 3VGNA 2HMKB 4HZBB 1Q42A 1RN1A 5M19A 3CCS3 4FMDA 3UL6A 1UUWB 1BANA 4J5GA 3OWUA 3ER7A 3J7Yd 2XSHB 3FSDA 1DMNA 2UGIA 3KSED 1QAFA 1LQGC 5JPPA 2E2VA 3D4AA 2RCDA 2F99A 2KAAA 2YX9A 1STDA 3MG1A 1GY6A 1SQWA 3EF8A 3KIIA 3HX8A 2K3DA 3RDEA 1YVSA 3U1WA 1QVF2 3BIRA 3BLZA 5AEUB 6GSPA 5M18A 1RGEA 1OH0A 1RMSA 4AKZA 4XBYA 1JN5A 1CH0A 1MGWA 2RNTA 3JVCA 3QK9A 1BAOA 3N54B 3DH2A 1FGQA 3KE7A 1GD3A 3PZWA 1RN7A 1N9JA 3UJMA 1A2PA 1IQXA 1CYVA 1JKGA 1MNLA 3JUNA 3NQYA 3FG4A 1EQKA 4CJNA 1W01A 1B3SA 3AGOA 4EV2A 3OX9A 4HM3B 4K1VA 3NBJA 2QGUA 1B2UA 4O3VA 2RBIA 3FCSB 1GY5A 1D6YA 7STDA 1WQLB 1W4NA 2W9PA 1ROAA 1IDPA 3KN4A 1IYYA 1DMMA 1DMQA 3VF1A 3X40A 3ECFA 3CPW2 1F8NA 3JUQA 1RN4A 3CNXA 3V92A 3DGYA 1X1YA 2XRXB 6STDA 2SARA 2CFGA 1W00A 4BL2A 5CK6A 2MC8A 2RSXA 2Y74A 4N6V0 3DM8A 5JBSA 2CIUA 2CWTA 2C10A 2XSOB 2IY2A 1AVLA 1JBRA 1IQ8A 1BNJA 2KF3A 1VQ43 5IG3A 1NB3I 2FGTA 1UCJA 2UX0A 2CKFB 3MYTA 1AR0A 2H0IA 5BIRA 4I5QA 4MEIA 4N3VA 3JUOA 4HM7B 1FGOA 4BTYA 3GZRA 5I97A 3FLJA 1DYUA 3O8YA 4RNYA 5TGNA 3DGMA 4QWTA 5BVBA 1IT8A 1B2XA 1SARA 1Y4KA 4JF8A 3SLUA 1I70A 4X2OA 1RGFA 3S29A 1SJWA 1JBSA 3GWRA 4LMIA 3SYUA 4LEHA 3TDGA 1NU3A 1A2KA 3F7SA 3SOAA 4R4KA 2CC3A 2Z76A 3CD63 4GSPA 1FGRA 3EE1A 2HMJB 3KZTA 2OTL3 1W5ZA 1PU4A 1RJOA 1YGEA 1AV4A 2WGOA 2C11A 1GD4A 3SX1A 1O7WB 2P38A 4KZ1A 1I0VA 8CHOA 5IERA 1T2IA 1U5OA 1W6YA 1VQ73 3KCHA 3F7XA 1C7HA 1VQQA 1OHSA 5DRVA 3T8NA 3WA3A 3CCL3 3CC73 3NM2A 4BU4A 3X41A 1DETA 3NBBA 3NXJA 5ELUA 4RZMA 5A0OB 1Z1SA 1ZGXA 1UUVB 1FGTA 1NNVA 1QAKA 1R4CA 1BRKA 3B8LA 1DVCA 4WFOA 3HOHA 1I2EA 2OOVA 1O7MB 2FNQA 3Q1CA 1JJ22 1N9EA 2CG1A 1GMQA 3RGRA 2L1SA 3CCU3 1BNRA 2FXTA 2KF6A 3B4PA 3M8CA 4OVMA 3WDGB 1IV7A 4ILFA 4HYZA 4RNZA 1LOVA 3OWSA 3PCSA 3V98A 1X1UA 1EUIC 3AHSA 3LTCA 5GSPA 1GOYA 3HZPA 4R1KA 1BRGA 3NX0A 1OACA 1BSEA 5BXQA 3CCM3 3WR2A 1HZ1A 4GHOA 3FG1A 4XBXA 2XH9A 2K54A 2KXGA 2A15A 3F14A 3F8XA 3S5CA 5ELJA 1GOVA 3HI7A 3ROBA 1V74A 3G0KA 4NHFA 1BUJA 1LRAA 2STDA 3D9RA 1Q40A 1UGHI 3D79A 4XM4A 3CCV3 1UI7A 2K0MA 3EC9A 1GY7A 3UNLA 2QA43 1BSDA 2Z7AA 2M7OA 1EEJA 4CCVA 2ML6A 3LT9A 4K61A 1FW7A 3CCJ3 4HM8B 2D42A 1Q7Y4 1HYFA 3S27A 5KP3A 3G6E3 1LOYA 2HMMB 2O9UX 3DGOA 1MWRA 1TTOA 2WGQA 1Q9EA 1VQL3 3LYGA 1CYUA 1OCVA 1IK3A 4X2HA 1I2FA 3RGAA 2OCTA 3MHEA 5IENA 4HM0B 1VQO3 1UW1A 1QVG2 1A67A 1WTHA 5LC7A
chains in the Genus database with same CATH topology
4FMBA 1JNQA 4IPBA 3OW22 3N9HA 1VQN3 3F9SA 2CW9A 5D81A 5CLKA 1STFI 2CH9A 3X3ZA 3GZXB 2W2CA 1RKYA 2B1XB 3JUPA 5G2GA 1VQM3 1T5YA 5D83A 2HMOB 1KSIA 1NB5I 1WMOA 3ALAA 1W02A 2L4VA 1AVKA 4MJDA 4MMZB 3N8BA 4O8SA 3FF0A 2OOVC 3MG2A 4L8PA 5KP1A 1J2BA 3EBTA 3V99A 1IV9A 2O3OA 3DGLA 3DZLA 3PYJA 1TIJA 2XGNA 2R4IA 1OGZA 2XFSA 3IPTA 3CCQ3 3S67A 1IU7A 2CFKA 1BUQA 1YVBI 1VQP3 3CCE3 3UB1A 3HIGA 5IEOA 1VQK3 5CF2A 1EKMA 4KFFA 4FCZA 4TX4A 1W6CA 1W7CA 3CCR3 4EBGA 4ZM8A 2WOFA 3I553 2Z77A 4XDWA 3WA2X 1N8R4 1VQ83 5IG4A 3VSYA 1OGXA 2BNGA 2V1LA 2BMOB 2GEYA 1WMPA 4HM2B 3WMDA 3HIIA 2BMQB 3U97A 1YHQ3 3DMCA 4XB5A 4BTXA 5AIHA 4I4KA 2OWPA 3LZAA 3NHXA 1OUNA 1PFPA 3CU3A 3OXAA 4BTWA 3IJEB 1JRQA 2CFLA 2WO0A 2IMJA 2W56B 2JQ5A 2W0QA 2OQEA 3Q90A 1D6UA 4OK0A 3K0ZA 3KSPA 2LYXA 3G713 2CG0A 5JPUA 1VQ63 1LNHA 3FZWA 2YFLB 2HMNB 4N6NB 2GEXA 2LQVA 4FCMA 1IQYA 3LOYA 5LC6A 1IVWA 5IG0A 1JV2B 5AI1A 1ISKA 2YFIB 1JB2A 3WOFB 2Y73A 3K9MC 4GB5A 5STDA 3BNCA 3LTDA 3CME3 1ASKA 1JB4A 1K28A 2PZVA 4N6MA 4EYCA 1OF5B 3FF2A 3T8UA 3NQZA 2XEPA 1RRHA 1VZZA 1TFOA 4U13A 2I9WA 1NO3A 4OUQA 3NBRA 2BT3A 2BHMA 3PS8A 2W56A 5AIFA 2BMRB 2KCDA 1A90A 4N6TA 3CC43 4WHAA 1M1K4 4N6LA 1N5HA 2RGQA 2BO9B 1M904 2P09A 1S5AA 5EQLA 1Q824 3KKGA 5AYRB 4MMXB 2E2TA 4R80A 2CFDA 3EN8A 1TUHA 1K9M4 1HU9A 3QRDA 1OHPA 1ZO2A 4LSOA 2ZDJA 3SVAA 5FW5A 5EEOA 2KRTA 1WMNA 1KWIA 3WODG 1OHOA 1ZX2A 1OF5A 2YFJB 4STDA 1MOLA 3F8HA 4IT7A 3NV0B 2GU3A 1NJI4 4FMAA 4HM1B 3CXC2 4HVNA 3EN1B 3LTBA 3B7CA 3G16A 1KQS2 4PEJA 3X3XA 2INXA 2E2UA 3MG3A 4XDVA 4FR9A 2OQEC 4O02B 1M9GA 4KVHA 3A76A 3UL5A 3BNEA 2CK3H 1KC84 2SBLA 1G96A 3OWYA 5IW9A 3DY5A 3GZBA 2W03A 3AMOB 1E3VA 1YJN3 1L5GB 3SEDA 1U8CB 4IIAA 1O7HB 1UI8A 3NV0A 1LVNA 3FGYA 2B24B 3SXXA 1FA3A 3Q2PA 2PNCA 3NM7A 1D6ZA 1Q864 4LZIA 3EBYA 3WOEB 1FUWA 1W2B2 2JDIH 2GBXB 4MMYB 2MF7A 2XR8B 2Q07A 1LOXA 4H61A 3K5TA 3EX9A 5KP4A 4AKYA 5FGOA 3B4OA 1GS3A 3BNDA 1S723 5IF6A 1YI23 3AMOA 1YIJ3 2RFRA 5AYSC 3K63A 1SIHA 2WOHA 1QMAA 2W9QA 3BNBA 3LT8A 1VQ53 2IA7A 4N6OB 1W6GA 4WP5A 3MWZA 4GL6A 3CC23 2XGLA 1IT7A 3KFQC 3F40A 4K1UA 4FCJA 5CXOA 2IUJA 3X3YA 4JRFA 3DUKA 3L0RA 2P0XA 1QALA 4FMCA 4KFDA 5IG5A 2Z6BA 1NDOB 1GYBA 4R9KA 1EG9B 5AEWB 1EA2A 3I0YA 2CWVA 3CNMA 3FG3A 3EHCA 5AIGA 1IVUA 3OV4A 1IVVA 1W2ZA 1K734 3GRDA 4J9AA 5CF1A 3LH4A 1KD14 3EB8A 4EXRA 1YIT3 4AEQA 4L7KA 3JUMA 1CEWI 1IVXA 4HZ9B 1ULIB 3E99A 5EVHA 3H3HA 3PGBA 2CWUA 2P05A 3GZYB 3STDA 1TFKA 2HMLB 4WYKB 2F86B 1FGMA 3SOYA 3HK4A 3DGNA 3EJVA 4ORLA 4NREA 3FKAA 1O7PB 3FH1A 1TU5A 5AIIA 3S28A 3BB9A 3LXUX 2GU1A 2IUKA 3CPOA 2OTJ3 2ML5A 2W6JH 3DXOA 2XF3A 3PCRA 1VQ93 3K7CA 4K90B 3MKIA 2QIYA 1RRLA 4HM6B 1ROVA 3LTAA 4CDLA 4EC6A 4L8OA 4LGQA 1OPYA 2GXFA 4HM4B 3X42A 1QJGA 3IMAB 4J8TA 4O2HA 1E3RA 1CQSA 1O7NB 2QEX3 1WNHA 1NWWA 1N5PA 2ZL8A 1Q814 3G8ZA 4H3UA 4WWUC 4WYKA 1YJ93 3MSOA 1N8QA 4KFEA 4RBNA 1JB5A 1Q40B 3MPHA 4N6UA 1LXEA 3PXMA 2D1WA 1ULJB 2W04A 3I563 2GBWB 5HGRA 2XFTA 4R9LA 1A2VA 3G4S3 3H51A 1SPUA 2F98A 1M1XB 2CFWA 4XBTA 4HKVB 3NUVA 4HJLB 4EV5A 1O7GB 3GAXA 1US1A 3LMLA 2CHCA 5DREA 1E97A 2P0MA 4G1MB 1DVDA 4HM5B 1SIIA 3EQQB 1K41A 5D82A 5IEPA 4HBRA 1YJW3 3D3LA 1JN5B 1HKXA 1TP6A 3CMA3 3T0UA 1K8A4 1JKGB 4Q53A 3VGNA 2HMKB 4HZBB 1Q42A 3CCS3 4FMDA 3UL6A 1UUWB 3OWUA 3ER7A 3J7Yd 2XSHB 3FSDA 1DMNA 3KSED 1QAFA 5JPPA 2E2VA 2RCDA 2F99A 2YX9A 1STDA 3MG1A 1GY6A 1SQWA 3EF8A 3KIIA 3HX8A 3RDEA 3U1WA 1QVF2 3BLZA 5AEUB 1OH0A 4AKZA 4XBYA 1JN5A 3JVCA 3QK9A 3N54B 1FGQA 3KE7A 1GD3A 3PZWA 1RN7A 1N9JA 3UJMA 3JUNA 1IQXA 1CYVA 1JKGA 1MNLA 3NQYA 3FG4A 1EQKA 1W01A 4EV2A 3OX9A 4HM3B 4K1VA 3NBJA 2QGUA 4O3VA 3FCSB 1GY5A 1D6YA 7STDA 1WQLB 1W4NA 2W9PA 1ROAA 1IDPA 3KN4A 1DMMA 1DMQA 3VF1A 3X40A 3ECFA 3CPW2 1F8NA 3JUQA 3CNXA 3V92A 2XRXB 6STDA 2CFGA 1W00A 5CK6A 2MC8A 2RSXA 2Y74A 4N6V0 3DM8A 5JBSA 2CIUA 2CWTA 2C10A 2XSOB 1AVLA 1IQ8A 1VQ43 5IG3A 1NB3I 2FGTA 2UX0A 2CKFB 3MYTA 1AR0A 4MEIA 4N3VA 3JUOA 4HM7B 1FGOA 4BTYA 3GZRA 5I97A 3FLJA 1DYUA 3O8YA 4RNYA 5TGNA 3DGMA 4QWTA 5BVBA 1IT8A 1Y4KA 4JF8A 3SLUA 4X2OA 3S29A 1SJWA 3GWRA 4LMIA 4LEHA 3TDGA 1NU3A 1A2KA 3F7SA 3SOAA 4R4KA 2CC3A 2Z76A 3CD63 1FGRA 3EE1A 2HMJB 3KZTA 2OTL3 1W5ZA 1PU4A 1RJOA 1YGEA 1AV4A 2WGOA 2C11A 1GD4A 3SX1A 1O7WB 2P38A 4KZ1A 8CHOA 5IERA 1U5OA 1W6YA 1VQ73 3F7XA 1C7HA 1OHSA 5DRVA 3T8NA 3WA3A 3CCL3 3CC73 3NM2A 3X41A 5ELUA 3NBBA 3NXJA 5A0OB 4RZMA 1Z1SA 1UUVB 1FGTA 1QAKA 1R4CA 3B8LA 4WFOA 1DVCA 2OOVA 1O7MB 2FNQA 3Q1CA 1JJ22 1N9EA 2CG1A 3RGRA 3CCU3 2FXTA 3B4PA 3M8CA 4OVMA 3WDGB 1IV7A 4HYZA 4RNZA 3OWSA 3PCSA 3V98A 3LTCA 3HZPA 4R1KA 3NX0A 1OACA 5BXQA 3CCM3 3FG1A 4XBXA 2XH9A 2K54A 2KXGA 2A15A 3F14A 3F8XA 3S5CA 5ELJA 3HI7A 3ROBA 1V74A 3G0KA 4NHFA 2STDA 3D9RA 1Q40A 4XM4A 3CCV3 1UI7A 2K0MA 3EC9A 1GY7A 3UNLA 2QA43 2Z7AA 2M7OA 4CCVA 2ML6A 3LT9A 4K61A 3CCJ3 4HM8B 2D42A 1Q7Y4 3S27A 5KP3A 3G6E3 2HMMB 2O9UX 3DGOA 2WGQA 1VQL3 3LYGA 1CYUA 1OCVA 1IK3A 4X2HA 3RGAA 2OCTA 3MHEA 5IENA 4HM0B 1VQO3 1UW1A 1QVG2 1A67A 1WTHA 5LC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9S A;  5D81 A;  5CLK A;  3GZX B;  2W2C A;  2B1X B;  3JUP A;  5G2G A;  5D83 A;  2HMO B;  1W02 A;  4MJD A;  3FF0 A;  3MG2 A;  4L8P A;  5KP1 A;  3EBT A;  3DZL A;  3IPT A;  2R4I A;  1OGZ A;  1BUQ A;  5IEO A;  5CF2 A;  2Z77 A;  4XDW A;  5IG4 A;  3VSY A;  1OGX A;  2BNG A;  2BMO B;  2GEY A;  4HM2 B;  3WMD A;  2BMQ B;  3DMC A;  4XB5 A;  5AIH A;  4I4K A;  2OWP A;  3LZA A;  3NHX A;  1OUN A;  3CU3 A;  3OXA A;  2IMJ A;  2JQ5 A;  3Q90 A;  3K0Z A;  3KSP A;  5JPU A;  3FZW A;  2YFL B;  2HMN B;  2GEX A;  4FCM A;  5IG0 A;  5AI1 A;  1ISK A;  2YFI B;  1JB2 A;  4GB5 A;  5STD A;  1ASK A;  1JB4 A;  2PZV A;  1OF5 B;  3FF2 A;  3T8U A;  1VZZ A;  4U13 A;  2I9W A;  4OUQ A;  3NBR A;  5AIF A;  2BMR B;  2RGQ A;  1S5A A;  3KKG A;  3EN8 A;  1TUH A;  1OHP A;  1ZO2 A;  5FW5 A;  1OHO A;  1ZX2 A;  1OF5 A;  2YFJ B;  4STD A;  3F8H A;  3NV0 B;  4HM1 B;  4HVN A;  3EN1 B;  3B7C A;  3G16 A;  4PEJ A;  2INX A;  3MG3 A;  4XDV A;  4KVH A;  3A76 A;  3OWY A;  3GZB A;  1E3V A;  3SED A;  4IIA A;  1O7H B;  3NV0 A;  3FGY A;  2B24 B;  3EBY A;  2GBX B;  2XR8 B;  3EX9 A;  5KP4 A;  3B4O A;  1GS3 A;  5IF6 A;  2RFR A;  1QMA A;  4WP5 A;  3F40 A;  4K1U A;  4FCJ A;  5CXO A;  3DUK A;  5IG5 A;  1NDO B;  4R9K A;  1GYB A;  1EG9 B;  5AEW B;  1EA2 A;  3I0Y A;  3CNM A;  3EHC A;  5AIG A;  3OV4 A;  3GRD A;  4J9A A;  5CF1 A;  4L7K A;  3JUM A;  4HZ9 B;  1ULI B;  3E99 A;  5EVH A;  3H3H A;  3GZY B;  3STD A;  2HML B;  4WYK B;  2F86 B;  3SOY A;  3HK4 A;  3EJV A;  4ORL A;  3FKA A;  1O7P B;  3FH1 A;  5AII A;  3BB9 A;  3CPO A;  3DXO A;  3K7C A;  3MKI A;  2QIY A;  4HM6 B;  4CDL A;  4L8O A;  4LGQ A;  1OPY A;  2GXF A;  4HM4 B;  1QJG A;  4J8T A;  1E3R A;  1CQS A;  1O7N B;  1NWW A;  3G8Z A;  4H3U A;  4WWU C;  4WYK A;  3MSO A;  1JB5 A;  1Q40 B;  1ULJ B;  2GBW B;  5HGR A;  4R9L A;  3H51 A;  2F98 A;  4XBT A;  4HKV B;  3NUV A;  4HJL B;  1O7G B;  2CHC A;  5DRE A;  1E97 A;  4HM5 B;  3EQQ B;  1K41 A;  5D82 A;  5IEP A;  1JN5 B;  1HKX A;  1TP6 A;  1JKG B;  4Q53 A;  3VGN A;  2HMK B;  4HZB B;  1Q42 A;  1UUW B;  3OWU A;  3ER7 A;  2XSH B;  3FSD A;  1DMN A;  5JPP A;  2RCD A;  2F99 A;  1STD A;  3MG1 A;  1GY6 A;  3EF8 A;  3HX8 A;  3BLZ A;  5AEU B;  1OH0 A;  4XBY A;  1JN5 A;  3KE7 A;  3UJM A;  3JUN A;  1JKG A;  1W01 A;  3OX9 A;  4HM3 B;  4K1V A;  2QGU A;  1GY5 A;  7STD A;  1WQL B;  1IDP A;  1DMM A;  1DMQ A;  3ECF A;  3JUQ A;  3CNX A;  2XRX B;  6STD A;  1W00 A;  5CK6 A;  3DM8 A;  2XSO B;  5IG3 A;  2UX0 A;  2CKF B;  3MYT A;  1AR0 A;  4N3V A;  3JUO A;  4HM7 B;  3GZR A;  3FLJ A;  5TGN A;  5BVB A;  4X2O A;  1SJW A;  3GWR A;  4LMI A;  4LEH A;  1NU3 A;  1A2K A;  3F7S A;  3SOA A;  2Z76 A;  2HMJ B;  3KZT A;  1O7W B;  8CHO A;  5IER A;  1U5O A;  1W6Y A;  3F7X A;  1C7H A;  1OHS A;  5DRV A;  3T8N A;  3NM2 A;  3NXJ A;  4RZM A;  1Z1S A;  1UUV B;  3B8L A;  1O7M B;  3RGR A;  3B4P A;  3M8C A;  4OVM A;  3OWS A;  3HZP A;  4R1K A;  5BXQ A;  4XBX A;  2K54 A;  3F8X A;  2A15 A;  3F14 A;  3S5C A;  3ROB A;  3G0K A;  2STD A;  3D9R A;  1Q40 A;  4XM4 A;  3EC9 A;  1GY7 A;  3UNL A;  2Z7A A;  4HM8 B;  5KP3 A;  2HMM B;  3LYG A;  1OCV A;  4X2H A;  3RGA A;  3MHE A;  5IEN A;  4HM0 B; 
#chains in the Genus database with same CATH topology
 1T3B A;  4FMB A;  1RDS A;  1JNQ A;  4IPB A;  3OW2 2;  3N9H A;  1VQN 3;  3F9S A;  2CW9 A;  5D81 A;  5CLK A;  5BU4 A;  1BRJ A;  2ZA4 A;  1MWU A;  1STF I;  2J8X B;  2CH9 A;  3X3Z A;  3GZX B;  2W2C A;  1BIR A;  1RKY A;  2B1X B;  1LNI A;  3JUP A;  1FYS A;  5G2G A;  4LYL B;  1VQM 3;  1B21 A;  1BSC A;  1T5Y A;  1TRP A;  5D83 A;  2HMO B;  1KSI A;  1NB5 I;  1WMO A;  3ALA A;  1W02 A;  2L4V A;  1AVK A;  4MJD A;  4MMZ B;  3N8B A;  4O8S A;  3FF0 A;  1JZO A;  2BIR A;  2OOV C;  3MG2 A;  4L8P A;  5KP1 A;  1J2B A;  3EBT A;  3V99 A;  1IV9 A;  2O3O A;  3DGL A;  3DZL A;  3PYJ A;  1TIJ A;  2XGN A;  2R4I A;  1OGZ A;  2XFS A;  1AQZ A;  3IPT A;  1C54 A;  3CCQ 3;  3S67 A;  1IU7 A;  2CFK A;  1G0T A;  1BUQ A;  1YVB I;  1VQP 3;  3CCE 3;  3UB1 A;  2H0G A;  3HIG A;  5IEO A;  5CF2 A;  1EKM A;  1VQK 3;  4KFF A;  4FCZ A;  1MGR A;  4TX4 A;  1W6C A;  1W7C A;  1RCK A;  3CCR 3;  4EBG A;  4ZM8 A;  2IYJ A;  2AAD A;  2WOF A;  2Z77 A;  3I55 3;  4XDW A;  3WA2 X;  1N8R 4;  1VQ8 3;  1FUT A;  5IG4 A;  1RGC A;  3VSY A;  1OGX A;  2BNG A;  2V1L A;  1LQM B;  2BMO B;  2GEY A;  1WMP A;  4HM2 B;  3WMD A;  3HII A;  1B20 A;  2BMQ B;  3U97 A;  1YHQ 3;  1R4Y A;  3DMC A;  4XB5 A;  1RSN A;  1I2G A;  3Q3F A;  4BTX A;  5AIH A;  4I4K A;  1MWS A;  2OWP A;  3LZA A;  1RNB A;  3NHX A;  1I0X A;  1OUN A;  1PFP A;  3CU3 A;  3OXA A;  4BTW A;  3IJE B;  1BNF A;  1JRQ A;  2CFL A;  2WO0 A;  2IMJ A;  1YGW A;  2W56 B;  2JQ5 A;  2W0Q A;  2OQE A;  3Q90 A;  1D6U A;  4OK0 A;  3K0Z A;  3KSP A;  2LYX A;  3G71 3;  1BVI A;  2CG0 A;  5JPU A;  1VQ6 3;  1LNH A;  3FZW A;  2GSP A;  2YFL B;  4KT3 B;  2F56 A;  2HMN B;  4N6N B;  2GEX A;  2LQV A;  4FCM A;  1IQY A;  3LOY A;  1BRN L;  5LC6 A;  1IVW A;  5IG0 A;  1JV2 B;  2R41 A;  5AI1 A;  1ISK A;  2YFI B;  5M1A A;  1JB2 A;  3WOF B;  2Y73 A;  1T2H A;  3K9M C;  3ZG5 A;  4GB5 A;  2F5M A;  4J5K A;  5STD A;  3BNC A;  3LTD A;  3CME 3;  1ASK A;  1JB4 A;  1K28 A;  2PZV A;  4N6M A;  4EYC A;  1OF5 B;  3FF2 A;  3T8U A;  3D5G A;  2XEP A;  3NQZ A;  1RRH A;  1VZZ A;  5G1L A;  1TFO A;  4U13 A;  9RNT A;  2I9W A;  1NO3 A;  4OUQ A;  3NBR A;  2BT3 A;  2BHM A;  3PS8 A;  2W56 A;  5AIF A;  2BMR B;  2KCD A;  1A90 A;  4N6T A;  3CC4 3;  1RGL A;  4WHA A;  1M1K 4;  1RGA A;  4N6L A;  1N5H A;  2RGQ A;  2BO9 B;  1M90 4;  2P09 A;  1BRI A;  1I3F A;  1TJD A;  1S5A A;  3URP A;  1RTU A;  5EQL A;  1GMR A;  1Q82 4;  3KKG A;  5AYR B;  4MMX B;  2E2T A;  4R80 A;  2CFD A;  3EN8 A;  1TUH A;  4DKI A;  1HU9 A;  1K9M 4;  1V57 A;  3QRD A;  1OHP A;  1ZO2 A;  4LSO A;  2ZDJ A;  3SVA A;  5FW5 A;  4HAA A;  5EEO A;  2KRT A;  1WMN A;  1KWI A;  3WOD G;  1B2S A;  1OHO A;  1PYL A;  1OF5 A;  1ZX2 A;  2YFJ B;  4STD A;  1MOL A;  1DE3 A;  3F8H A;  4IT7 A;  3NV0 B;  2KF4 A;  1B2Z A;  3ZG0 A;  2GU3 A;  1UCI A;  1NJI 4;  4FMA A;  4HM1 B;  3CXC 2;  1AY7 A;  4HVN A;  3EN1 B;  3LTB A;  3WHO A;  3B7C A;  3G16 A;  1KQS 2;  4PEJ A;  1BNS A;  2AAE A;  2CX1 A;  3X3X A;  3GSP A;  2INX A;  2E2U A;  3MG3 A;  4XDV A;  4FR9 A;  2OQE C;  4O02 B;  1M9G A;  4KVH A;  1Q7H A;  3A76 A;  3UL5 A;  3AGN A;  3BNE A;  2CK3 H;  1KC8 4;  2SBL A;  1G96 A;  3OWY A;  2C4B A;  5IW9 A;  3DY5 A;  1I8V A;  1RGG A;  2W03 A;  1E3V A;  3AMO B;  3GZB A;  1YJN 3;  1L5G B;  3SED A;  1U8C B;  4IIA A;  1RNT A;  3D5I A;  1O7H B;  1UI8 A;  5HOH A;  3NV0 A;  1LVN A;  3FGY A;  1UGI A;  1BU4 A;  2B24 B;  3SXX A;  1FA3 A;  1RGK A;  3Q2P A;  2PNC A;  1V58 A;  3NM7 A;  3RNT A;  1D6Z A;  5G1K A;  1Q86 4;  4LZI A;  3EBY A;  3WOE B;  1BSB A;  1FUW A;  1W2B 2;  2JDI H;  6RNT A;  1UCL A;  2GBX B;  4MMY B;  2MF7 A;  2XR8 B;  2Q07 A;  1LOX A;  4H61 A;  3K5T A;  1BRS A;  3EX9 A;  5KP4 A;  1RLS A;  4AKY A;  5FGO A;  3B4O A;  1GS3 A;  3BND A;  1S72 3;  5IF6 A;  1YI2 3;  3AMO A;  1YIJ 3;  1JZD A;  2RFR A;  5AYS C;  2HOH A;  3K63 A;  1SIH A;  1I3I A;  1QMA A;  2W9Q A;  2WOH A;  3BNB A;  3LT8 A;  2IA7 A;  4N6O B;  1VQ5 3;  1W6G A;  4WP5 A;  3MWZ A;  4GL6 A;  4EW5 A;  3CC2 3;  2XGL A;  1IT7 A;  3KFQ C;  1GSP A;  3F40 A;  4K1U A;  4FCJ A;  5CXO A;  1BNE A;  2IUJ A;  1YNV X;  3X3Y A;  4JRF A;  1TRQ A;  3DUK A;  2ZHX B;  3L0R A;  2P0X A;  1QAL A;  3AHW A;  4FMC A;  4KFD A;  8RNT A;  5IG5 A;  1B2M A;  2Z6B A;  1NDO B;  1GYB A;  4R9K A;  1JBT A;  1EG9 B;  5AEW B;  1EA2 A;  3I0Y A;  1PY3 A;  2CWV A;  3CNM A;  3FG3 A;  1BGS A;  3EHC A;  5AIG A;  1IVU A;  4BL3 A;  3OV4 A;  1IVV A;  1W2Z A;  1UCK A;  1K73 4;  2CX0 A;  3GRD A;  4J9A A;  5CF1 A;  3LH4 A;  1MWT A;  1KD1 4;  3EB8 A;  4EXR A;  1YIT 3;  4AEQ A;  4L7K A;  3JUM A;  1CEW I;  1IVX A;  4HZ9 B;  1ULI B;  3E99 A;  3A5E A;  5EVH A;  3H3H A;  3PGB A;  2CWU A;  2P05 A;  3GZY B;  3STD A;  1BSA A;  1TFK A;  2H0H A;  2HML B;  4WYK B;  2F86 B;  1FGM A;  3SOY A;  2F4Y A;  2F5W A;  3DGN A;  3EJV A;  3HK4 A;  1GOU A;  4NRE A;  3FKA A;  1O7P B;  3FH1 A;  4ORL A;  5AII A;  3S28 A;  3BB9 A;  1TU5 A;  3LXU X;  2GU1 A;  2IUK A;  3CPO A;  2OTJ 3;  2ML5 A;  2W6J H;  1UUG B;  3DXO A;  2XF3 A;  3PCR A;  1VQ9 3;  3K7C A;  2KF5 A;  1GMP A;  4K90 B;  7RNT A;  3MKI A;  2QIY A;  1BNI A;  1RRL A;  4HM6 B;  1RCL A;  1ROV A;  3LTA A;  4CDL A;  1BOX A;  2BU4 A;  4HOH A;  4EC6 A;  4L8O A;  4LGQ A;  1OPY A;  2GXF A;  4HM4 B;  3X42 A;  1QJG A;  3IMA B;  4J8T A;  4O2H A;  1E3R A;  1CQS A;  4RNT A;  1O7N B;  1ZS7 A;  4NPB A;  2QEX 3;  1WNH A;  1B27 A;  1BNG A;  1N5P A;  1NWW A;  2ZL8 A;  3BU4 A;  4BIR A;  3G8Z A;  1Q81 4;  4H3U A;  4WWU C;  1RGH A;  4WYK A;  1YJ9 3;  3MSO A;  1N8Q A;  4KFE A;  1FZU A;  4RBN A;  7GSP A;  1JB5 A;  1Q40 B;  2UUG C;  3MPH A;  1X1X A;  4N6U A;  1LXE A;  3PXM A;  2D1W A;  1ULJ B;  1FUS A;  2W04 A;  5RNT A;  3I56 3;  2GBW B;  4CPK A;  5HGR A;  2XFT A;  4R9L A;  1A2V A;  3G4S 3;  3H51 A;  1SPU A;  2F98 A;  1M1X B;  2CFW A;  4XBT A;  4HKV B;  3NUV A;  4HJL B;  4EV5 A;  1O7G B;  1X1W A;  3GAX A;  1US1 A;  3LML A;  2CHC A;  5DRE A;  1UDI I;  1RHL A;  1E97 A;  2P0M A;  4G1M B;  1G02 A;  1DVD A;  4HM5 B;  1SII A;  1LOW A;  3EQQ B;  1K41 A;  5D82 A;  5IEP A;  4HBR A;  3ZFZ A;  1YJW 3;  3D3L A;  1JN5 B;  1HKX A;  1TP6 A;  3CMA 3;  1BRH A;  3T0U A;  1K8A 4;  1JKG B;  4Q53 A;  3VGN A;  2HMK B;  4HZB B;  1Q42 A;  1RN1 A;  5M19 A;  3CCS 3;  4FMD A;  3UL6 A;  1UUW B;  1BAN A;  4J5G A;  3OWU A;  3ER7 A;  3J7Y d;  2XSH B;  3FSD A;  1DMN A;  2UGI A;  3KSE D;  1QAF A;  1LQG C;  5JPP A;  2E2V A;  3D4A A;  2RCD A;  2F99 A;  2KAA A;  2YX9 A;  1STD A;  3MG1 A;  1GY6 A;  1SQW A;  3EF8 A;  3KII A;  3HX8 A;  2K3D A;  3RDE A;  1YVS A;  3U1W A;  1QVF 2;  3BIR A;  3BLZ A;  5AEU B;  6GSP A;  5M18 A;  1RGE A;  1OH0 A;  1RMS A;  4AKZ A;  4XBY A;  1JN5 A;  1CH0 A;  1MGW A;  2RNT A;  3JVC A;  3QK9 A;  1BAO A;  3N54 B;  3DH2 A;  1FGQ A;  3KE7 A;  1GD3 A;  3PZW A;  1RN7 A;  1N9J A;  3UJM A;  1A2P A;  1IQX A;  1CYV A;  1JKG A;  1MNL A;  3JUN A;  3NQY A;  3FG4 A;  1EQK A;  4CJN A;  1W01 A;  1B3S A;  3AGO A;  4EV2 A;  3OX9 A;  4HM3 B;  4K1V A;  3NBJ A;  2QGU A;  1B2U A;  4O3V A;  2RBI A;  3FCS B;  1GY5 A;  1D6Y A;  7STD A;  1WQL B;  1W4N A;  2W9P A;  1ROA A;  1IDP A;  3KN4 A;  1IYY A;  1DMM A;  1DMQ A;  3VF1 A;  3X40 A;  3ECF A;  3CPW 2;  1F8N A;  3JUQ A;  1RN4 A;  3CNX A;  3V92 A;  3DGY A;  1X1Y A;  2XRX B;  6STD A;  2SAR A;  2CFG A;  1W00 A;  4BL2 A;  5CK6 A;  2MC8 A;  2RSX A;  2Y74 A;  4N6V 0;  3DM8 A;  5JBS A;  2CIU A;  2CWT A;  2C10 A;  2XSO B;  2IY2 A;  1AVL A;  1JBR A;  1IQ8 A;  1BNJ A;  2KF3 A;  1VQ4 3;  5IG3 A;  1NB3 I;  2FGT A;  1UCJ A;  2UX0 A;  2CKF B;  3MYT A;  1AR0 A;  2H0I A;  5BIR A;  4I5Q A;  4MEI A;  4N3V A;  3JUO A;  4HM7 B;  1FGO A;  4BTY A;  3GZR A;  5I97 A;  3FLJ A;  1DYU A;  3O8Y A;  4RNY A;  5TGN A;  3DGM A;  4QWT A;  5BVB A;  1IT8 A;  1B2X A;  1SAR A;  1Y4K A;  4JF8 A;  3SLU A;  1I70 A;  4X2O A;  1RGF A;  3S29 A;  1SJW A;  1JBS A;  3GWR A;  4LMI A;  3SYU A;  4LEH A;  3TDG A;  1NU3 A;  1A2K A;  3F7S A;  3SOA A;  4R4K A;  2CC3 A;  2Z76 A;  3CD6 3;  4GSP A;  1FGR A;  3EE1 A;  2HMJ B;  3KZT A;  2OTL 3;  1W5Z A;  1PU4 A;  1RJO A;  1YGE A;  1AV4 A;  2WGO A;  2C11 A;  1GD4 A;  3SX1 A;  1O7W B;  2P38 A;  4KZ1 A;  1I0V A;  8CHO A;  5IER A;  1T2I A;  1U5O A;  1W6Y A;  1VQ7 3;  3KCH A;  3F7X A;  1C7H A;  1VQQ A;  1OHS A;  5DRV A;  3T8N A;  3WA3 A;  3CCL 3;  3CC7 3;  3NM2 A;  4BU4 A;  3X41 A;  1DET A;  3NBB A;  3NXJ A;  5ELU A;  4RZM A;  5A0O B;  1Z1S A;  1ZGX A;  1UUV B;  1FGT A;  1NNV A;  1QAK A;  1R4C A;  1BRK A;  3B8L A;  1DVC A;  4WFO A;  3HOH A;  1I2E A;  2OOV A;  1O7M B;  2FNQ A;  3Q1C A;  1JJ2 2;  1N9E A;  2CG1 A;  1GMQ A;  3RGR A;  2L1S A;  3CCU 3;  1BNR A;  2FXT A;  2KF6 A;  3B4P A;  3M8C A;  4OVM A;  3WDG B;  1IV7 A;  4ILF A;  4HYZ A;  4RNZ A;  1LOV A;  3OWS A;  3PCS A;  3V98 A;  1X1U A;  1EUI C;  3AHS A;  3LTC A;  5GSP A;  1GOY A;  3HZP A;  4R1K A;  1BRG A;  3NX0 A;  1OAC A;  1BSE A;  5BXQ A;  3CCM 3;  3WR2 A;  1HZ1 A;  4GHO A;  3FG1 A;  4XBX A;  2XH9 A;  2K54 A;  2KXG A;  2A15 A;  3F14 A;  3F8X A;  3S5C A;  5ELJ A;  1GOV A;  3HI7 A;  3ROB A;  1V74 A;  3G0K A;  4NHF A;  1BUJ A;  1LRA A;  2STD A;  3D9R A;  1Q40 A;  1UGH I;  3D79 A;  4XM4 A;  3CCV 3;  1UI7 A;  2K0M A;  3EC9 A;  1GY7 A;  3UNL A;  2QA4 3;  1BSD A;  2Z7A A;  2M7O A;  1EEJ A;  4CCV A;  2ML6 A;  3LT9 A;  4K61 A;  1FW7 A;  3CCJ 3;  4HM8 B;  2D42 A;  1Q7Y 4;  1HYF A;  3S27 A;  5KP3 A;  3G6E 3;  1LOY A;  2HMM B;  2O9U X;  3DGO A;  1MWR A;  1TTO A;  2WGQ A;  1Q9E A;  1VQL 3;  3LYG A;  1CYU A;  1OCV A;  1IK3 A;  4X2H A;  1I2F A;  3RGA A;  2OCT A;  3MHE A;  5IEN A;  4HM0 B;  1VQO 3;  1UW1 A;  1QVG 2;  1A67 A;  1WTH A;  5LC7 A; 
#chains in the Genus database with same CATH homology
 4FMB A;  1JNQ A;  4IPB A;  3OW2 2;  3N9H A;  1VQN 3;  3F9S A;  2CW9 A;  5D81 A;  5CLK A;  1STF I;  2CH9 A;  3X3Z A;  3GZX B;  2W2C A;  1RKY A;  2B1X B;  3JUP A;  5G2G A;  1VQM 3;  1T5Y A;  5D83 A;  2HMO B;  1KSI A;  1NB5 I;  1WMO A;  3ALA A;  1W02 A;  2L4V A;  1AVK A;  4MJD A;  4MMZ B;  3N8B A;  4O8S A;  3FF0 A;  2OOV C;  3MG2 A;  4L8P A;  5KP1 A;  1J2B A;  3EBT A;  3V99 A;  1IV9 A;  2O3O A;  3DGL A;  3DZL A;  3PYJ A;  1TIJ A;  2XGN A;  2R4I A;  1OGZ A;  2XFS A;  3IPT A;  3CCQ 3;  3S67 A;  1IU7 A;  2CFK A;  1BUQ A;  1YVB I;  1VQP 3;  3CCE 3;  3UB1 A;  3HIG A;  5IEO A;  1VQK 3;  5CF2 A;  1EKM A;  4KFF A;  4FCZ A;  4TX4 A;  1W6C A;  1W7C A;  3CCR 3;  4EBG A;  4ZM8 A;  2WOF A;  3I55 3;  2Z77 A;  4XDW A;  3WA2 X;  1N8R 4;  1VQ8 3;  5IG4 A;  3VSY A;  1OGX A;  2BNG A;  2V1L A;  2BMO B;  2GEY A;  1WMP A;  4HM2 B;  3WMD A;  3HII A;  2BMQ B;  3U97 A;  1YHQ 3;  3DMC A;  4XB5 A;  4BTX A;  5AIH A;  4I4K A;  2OWP A;  3LZA A;  3NHX A;  1OUN A;  1PFP A;  3CU3 A;  3OXA A;  4BTW A;  3IJE B;  1JRQ A;  2CFL A;  2WO0 A;  2IMJ A;  2W56 B;  2JQ5 A;  2W0Q A;  2OQE A;  3Q90 A;  1D6U A;  4OK0 A;  3K0Z A;  3KSP A;  2LYX A;  3G71 3;  2CG0 A;  5JPU A;  1VQ6 3;  1LNH A;  3FZW A;  2YFL B;  2HMN B;  4N6N B;  2GEX A;  2LQV A;  4FCM A;  1IQY A;  3LOY A;  5LC6 A;  1IVW A;  5IG0 A;  1JV2 B;  5AI1 A;  1ISK A;  2YFI B;  1JB2 A;  3WOF B;  2Y73 A;  3K9M C;  4GB5 A;  5STD A;  3BNC A;  3LTD A;  3CME 3;  1ASK A;  1JB4 A;  1K28 A;  2PZV A;  4N6M A;  4EYC A;  1OF5 B;  3FF2 A;  3T8U A;  3NQZ A;  2XEP A;  1RRH A;  1VZZ A;  1TFO A;  4U13 A;  2I9W A;  1NO3 A;  4OUQ A;  3NBR A;  2BT3 A;  2BHM A;  3PS8 A;  2W56 A;  5AIF A;  2BMR B;  2KCD A;  1A90 A;  4N6T A;  3CC4 3;  4WHA A;  1M1K 4;  4N6L A;  1N5H A;  2RGQ A;  2BO9 B;  1M90 4;  2P09 A;  1S5A A;  5EQL A;  1Q82 4;  3KKG A;  5AYR B;  4MMX B;  2E2T A;  4R80 A;  2CFD A;  3EN8 A;  1TUH A;  1K9M 4;  1HU9 A;  3QRD A;  1OHP A;  1ZO2 A;  4LSO A;  2ZDJ A;  3SVA A;  5FW5 A;  5EEO A;  2KRT A;  1WMN A;  1KWI A;  3WOD G;  1OHO A;  1ZX2 A;  1OF5 A;  2YFJ B;  4STD A;  1MOL A;  3F8H A;  4IT7 A;  3NV0 B;  2GU3 A;  1NJI 4;  4FMA A;  4HM1 B;  3CXC 2;  4HVN A;  3EN1 B;  3LTB A;  3B7C A;  3G16 A;  1KQS 2;  4PEJ A;  3X3X A;  2INX A;  2E2U A;  3MG3 A;  4XDV A;  4FR9 A;  2OQE C;  4O02 B;  1M9G A;  4KVH A;  3A76 A;  3UL5 A;  3BNE A;  2CK3 H;  1KC8 4;  2SBL A;  1G96 A;  3OWY A;  5IW9 A;  3DY5 A;  3GZB A;  2W03 A;  3AMO B;  1E3V A;  1YJN 3;  1L5G B;  3SED A;  1U8C B;  4IIA A;  1O7H B;  1UI8 A;  3NV0 A;  1LVN A;  3FGY A;  2B24 B;  3SXX A;  1FA3 A;  3Q2P A;  2PNC A;  3NM7 A;  1D6Z A;  1Q86 4;  4LZI A;  3EBY A;  3WOE B;  1FUW A;  1W2B 2;  2JDI H;  2GBX B;  4MMY B;  2MF7 A;  2XR8 B;  2Q07 A;  1LOX A;  4H61 A;  3K5T A;  3EX9 A;  5KP4 A;  4AKY A;  5FGO A;  3B4O A;  1GS3 A;  3BND A;  1S72 3;  5IF6 A;  1YI2 3;  3AMO A;  1YIJ 3;  2RFR A;  5AYS C;  3K63 A;  1SIH A;  2WOH A;  1QMA A;  2W9Q A;  3BNB A;  3LT8 A;  1VQ5 3;  2IA7 A;  4N6O B;  1W6G A;  4WP5 A;  3MWZ A;  4GL6 A;  3CC2 3;  2XGL A;  1IT7 A;  3KFQ C;  3F40 A;  4K1U A;  4FCJ A;  5CXO A;  2IUJ A;  3X3Y A;  4JRF A;  3DUK A;  3L0R A;  2P0X A;  1QAL A;  4FMC A;  4KFD A;  5IG5 A;  2Z6B A;  1NDO B;  1GYB A;  4R9K A;  1EG9 B;  5AEW B;  1EA2 A;  3I0Y A;  2CWV A;  3CNM A;  3FG3 A;  3EHC A;  5AIG A;  1IVU A;  3OV4 A;  1IVV A;  1W2Z A;  1K73 4;  3GRD A;  4J9A A;  5CF1 A;  3LH4 A;  1KD1 4;  3EB8 A;  4EXR A;  1YIT 3;  4AEQ A;  4L7K A;  3JUM A;  1CEW I;  1IVX A;  4HZ9 B;  1ULI B;  3E99 A;  5EVH A;  3H3H A;  3PGB A;  2CWU A;  2P05 A;  3GZY B;  3STD A;  1TFK A;  2HML B;  4WYK B;  2F86 B;  1FGM A;  3SOY A;  3HK4 A;  3DGN A;  3EJV A;  4ORL A;  4NRE A;  3FKA A;  1O7P B;  3FH1 A;  1TU5 A;  5AII A;  3S28 A;  3BB9 A;  3LXU X;  2GU1 A;  2IUK A;  3CPO A;  2OTJ 3;  2ML5 A;  2W6J H;  3DXO A;  2XF3 A;  3PCR A;  1VQ9 3;  3K7C A;  4K90 B;  3MKI A;  2QIY A;  1RRL A;  4HM6 B;  1ROV A;  3LTA A;  4CDL A;  4EC6 A;  4L8O A;  4LGQ A;  1OPY A;  2GXF A;  4HM4 B;  3X42 A;  1QJG A;  3IMA B;  4J8T A;  4O2H A;  1E3R A;  1CQS A;  1O7N B;  2QEX 3;  1WNH A;  1NWW A;  1N5P A;  2ZL8 A;  1Q81 4;  3G8Z A;  4H3U A;  4WWU C;  4WYK A;  1YJ9 3;  3MSO A;  1N8Q A;  4KFE A;  4RBN A;  1JB5 A;  1Q40 B;  3MPH A;  4N6U A;  1LXE A;  3PXM A;  2D1W A;  1ULJ B;  2W04 A;  3I56 3;  2GBW B;  5HGR A;  2XFT A;  4R9L A;  1A2V A;  3G4S 3;  3H51 A;  1SPU A;  2F98 A;  1M1X B;  2CFW A;  4XBT A;  4HKV B;  3NUV A;  4HJL B;  4EV5 A;  1O7G B;  3GAX A;  1US1 A;  3LML A;  2CHC A;  5DRE A;  1E97 A;  2P0M A;  4G1M B;  1DVD A;  4HM5 B;  1SII A;  3EQQ B;  1K41 A;  5D82 A;  5IEP A;  4HBR A;  1YJW 3;  3D3L A;  1JN5 B;  1HKX A;  1TP6 A;  3CMA 3;  3T0U A;  1K8A 4;  1JKG B;  4Q53 A;  3VGN A;  2HMK B;  4HZB B;  1Q42 A;  3CCS 3;  4FMD A;  3UL6 A;  1UUW B;  3OWU A;  3ER7 A;  3J7Y d;  2XSH B;  3FSD A;  1DMN A;  3KSE D;  1QAF A;  5JPP A;  2E2V A;  2RCD A;  2F99 A;  2YX9 A;  1STD A;  3MG1 A;  1GY6 A;  1SQW A;  3EF8 A;  3KII A;  3HX8 A;  3RDE A;  3U1W A;  1QVF 2;  3BLZ A;  5AEU B;  1OH0 A;  4AKZ A;  4XBY A;  1JN5 A;  3JVC A;  3QK9 A;  3N54 B;  1FGQ A;  3KE7 A;  1GD3 A;  3PZW A;  1RN7 A;  1N9J A;  3UJM A;  3JUN A;  1IQX A;  1CYV A;  1JKG A;  1MNL A;  3NQY A;  3FG4 A;  1EQK A;  1W01 A;  4EV2 A;  3OX9 A;  4HM3 B;  4K1V A;  3NBJ A;  2QGU A;  4O3V A;  3FCS B;  1GY5 A;  1D6Y A;  7STD A;  1WQL B;  1W4N A;  2W9P A;  1ROA A;  1IDP A;  3KN4 A;  1DMM A;  1DMQ A;  3VF1 A;  3X40 A;  3ECF A;  3CPW 2;  1F8N A;  3JUQ A;  3CNX A;  3V92 A;  2XRX B;  6STD A;  2CFG A;  1W00 A;  5CK6 A;  2MC8 A;  2RSX A;  2Y74 A;  4N6V 0;  3DM8 A;  5JBS A;  2CIU A;  2CWT A;  2C10 A;  2XSO B;  1AVL A;  1IQ8 A;  1VQ4 3;  5IG3 A;  1NB3 I;  2FGT A;  2UX0 A;  2CKF B;  3MYT A;  1AR0 A;  4MEI A;  4N3V A;  3JUO A;  4HM7 B;  1FGO A;  4BTY A;  3GZR A;  5I97 A;  3FLJ A;  1DYU A;  3O8Y A;  4RNY A;  5TGN A;  3DGM A;  4QWT A;  5BVB A;  1IT8 A;  1Y4K A;  4JF8 A;  3SLU A;  4X2O A;  3S29 A;  1SJW A;  3GWR A;  4LMI A;  4LEH A;  3TDG A;  1NU3 A;  1A2K A;  3F7S A;  3SOA A;  4R4K A;  2CC3 A;  2Z76 A;  3CD6 3;  1FGR A;  3EE1 A;  2HMJ B;  3KZT A;  2OTL 3;  1W5Z A;  1PU4 A;  1RJO A;  1YGE A;  1AV4 A;  2WGO A;  2C11 A;  1GD4 A;  3SX1 A;  1O7W B;  2P38 A;  4KZ1 A;  8CHO A;  5IER A;  1U5O A;  1W6Y A;  1VQ7 3;  3F7X A;  1C7H A;  1OHS A;  5DRV A;  3T8N A;  3WA3 A;  3CCL 3;  3CC7 3;  3NM2 A;  3X41 A;  5ELU A;  3NBB A;  3NXJ A;  5A0O B;  4RZM A;  1Z1S A;  1UUV B;  1FGT A;  1QAK A;  1R4C A;  3B8L A;  4WFO A;  1DVC A;  2OOV A;  1O7M B;  2FNQ A;  3Q1C A;  1JJ2 2;  1N9E A;  2CG1 A;  3RGR A;  3CCU 3;  2FXT A;  3B4P A;  3M8C A;  4OVM A;  3WDG B;  1IV7 A;  4HYZ A;  4RNZ A;  3OWS A;  3PCS A;  3V98 A;  3LTC A;  3HZP A;  4R1K A;  3NX0 A;  1OAC A;  5BXQ A;  3CCM 3;  3FG1 A;  4XBX A;  2XH9 A;  2K54 A;  2KXG A;  2A15 A;  3F14 A;  3F8X A;  3S5C A;  5ELJ A;  3HI7 A;  3ROB A;  1V74 A;  3G0K A;  4NHF A;  2STD A;  3D9R A;  1Q40 A;  4XM4 A;  3CCV 3;  1UI7 A;  2K0M A;  3EC9 A;  1GY7 A;  3UNL A;  2QA4 3;  2Z7A A;  2M7O A;  4CCV A;  2ML6 A;  3LT9 A;  4K61 A;  3CCJ 3;  4HM8 B;  2D42 A;  1Q7Y 4;  3S27 A;  5KP3 A;  3G6E 3;  2HMM B;  2O9U X;  3DGO A;  2WGQ A;  1VQL 3;  3LYG A;  1CYU A;  1OCV A;  1IK3 A;  4X2H A;  3RGA A;  2OCT A;  3MHE A;  5IEN A;  4HM0 B;  1VQO 3;  1UW1 A;  1QVG 2;  1A67 A;  1WTH A;  5LC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...