5BIRA

Disecting histidine interactions in ribonuclease t1 using asn and gln mutations
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endonuclease
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5birA00
1GMQA 1Q9EA 3RNTA 1RN1A 1BRJA 1UCLA 4HAAA 1I3FA 1I3IA 1T2HA 1RGFA 1RMSA 1JBRA 6GSPA 1BSCA 1BNFA 1GMPA 1TTOA 2RNTA 8RNTA 1B2MA 4J5GA 6RNTA 1UCKA 1AQZA 1IYYA 4GHOA 4RNTA 1RGEA 3BIRA 1DE3A 1BANA 2F5WA 1FUSA 4HOHA 1BNEA 1BRSA 2F5MA 1JBTA 1B20A 1YVSA 1GOYA 3AGNA 1UCJA 1FYSA 1BNSA 2ZA4A 1BOXA 1BNIA 1GOUA 1GOVA 2F56A 2SARA 1RGHA 9RNTA 1BRGA 1RTUA 1RSNA 1BIRA 4BIRA 4J5KA 1BSBA 1TRQA 1B2SA 1I8VA 1I2GA 1X1UA 3GSPA 1B3SA 7RNTA 1I0VA 3DH2A 1RNBA 3AHSA 1RDSA 2KF5A 2GSPA 1RN4A 2RBIA 1LRAA 1PYLA 1MGRA 1RHLA 2HOHA 1CH0A 3HOHA 1I0XA 1A2PA 1BRIA 5BIRA 1BRNL 1BGSA 3BU4A 1YGWA 1RNTA 1LNIA 1G02A 1X1YA 1B2XA 1HYFA 1MGWA 2AAEA 3KCHA 2BU4A 1BAOA 3AGOA 1RGAA 2AADA 1YNVX 3D5GA 3A5EA 1BU4A 5BU4A 1BNGA 1UCIA 5HOHA 1RGKA 1RCLA 1RGLA 1B2UA 1BNRA 5GSPA 1BRHA 3SYUA 1BNJA 1RCKA 2KAAA 3URPA 1GMRA 1TRPA 1B21A 1I2FA 4BU4A 3WR2A 1FUTA 1DETA 3Q3FA 1GSPA 1R4YA 1JBSA 2F4YA 1RLSA 7GSPA 1BSEA 1HZ1A 2C4BA 1C54A 1LOVA 3DGYA 3AHWA 1BUJA 1PY3A 1BSDA 1LOWA 1SARA 1AY7A 1ZGXA 2BIRA 1T2IA 1B2ZA 1BRKA 1FZUA 1BVIA 5RNTA 1RGCA 1I2EA 3D5IA 4GSPA 2KF3A 1LOYA 1B27A 1X1XA 1X1WA 2KF4A 3WHOA 1FW7A 1BSAA 2KF6A 1I70A 1RGGA 3D4AA
chains in the Genus database with same CATH superfamily
2P0XA 3CCS3 1RN1A 2JDIH 4KFEA 4KFFA 4HAAA 3CCQ3 2CH9A 1IK3A 3E99A 1RGFA 1FUWA 4LMIA 2P38A 1LVNA 1YVBI 2WGOA 3VGNA 1BNFA 1GMPA 2CX0A 2RNTA 3MG3A 6GSPA 8RNTA 1STFI 4J5GA 1W00A 4KVHA 5CF2A 6RNTA 2QIYA 1IYYA 3NX0A 3CCV3 3LT8A 4GHOA 1UW1A 4N6V0 4O2HA 3SXXA 1DE3A 2CWTA 5AIIA 1MWTA 3G713 3KSED 1OGXA 1WMPA 5AIFA 4EYCA 4LGQA 2CWVA 3Q2PA 3FF0A 4HM6B 4L8OA 2F5MA 5M18A 2HMOB 1SJWA 3WOFB 1YJW3 1UGHI 3X42A 3Q90A 1YVSA 4WHAA 3D79A 1UCJA 4BTYA 2OCTA 3F7SA 4O02B 1BOXA 3FZWA 1VQO3 1Y4KA 4R80A 5JPPA 3AMOA 4OK0A 4ILFA 4AKZA 4HBRA 2C10A 5KP3A 3S5CA 2IYJA 4I4KA 3B4PA 3JVCA 3SEDA 1D6YA 4HJLB 4HM3B 5LC6A 1TFKA 2BO9B 3N9HA 1IT8A 4CPKA 1GY6A 1WMNA 2GU3A 3LH4A 1OH0A 2IUKA 2E2TA 2W03A 3K63A 1FGMA 2QA43 2CFDA 2ZDJA 3DM8A 3S67A 3CCE3 2CFWA 1IV9A 3G6E3 4O8SA 1NU3A 1ROVA 2RBIA 5IEPA 3OW22 2IUJA 1BUQA 4N6OB 2CX1A 2HOHA 1GD4A 2GXFA 3DGOA 3HI7A 3WMDA 1HKXA 1LQMB 1T5YA 2CK3H 3EN1B 3RGAA 3KE7A 1NJI4 1A2PA 3OV4A 3I553 3FG3A 1RRLA 2GU1A 2W6JH 1YGWA 3LMLA 1Q7HA 4EBGA 1WQLB 5LC7A 1G02A 2L4VA 1U5OA 1HU9A 1UUWB 1B2XA 1MGWA 2C11A 4LSOA 2HMKB 1BAOA 1CEWI 4HM8B 1TUHA 1WTHA 3EQQB 3KIIA 4HM4B 3D5GA 3JUMA 3LTAA 1VQK3 3GZXB 2D42A 4HZBB 1QAKA 5BU4A 3FGYA 3S27A 5IG3A 3F40A 2CG0A 4J8TA 3VF1A 5FGOA 3OWUA 3KKGA 4FMBA 1YGEA 5GSPA 3LZAA 4JF8A 2KAAA 3SYUA 1JRQA 1AVKA 1MWRA 1MWSA 1ULIB 1TRPA 2MF7A 3FG1A 3K7CA 1I2FA 1NO3A 4H3UA 3U97A 1FUTA 3GZRA 5CLKA 1SIIA 3NM7A 3DUKA 1ZS7A 3T8NA 2XSOB 2KXGA 1BSEA 3PXMA 1KC84 1DVDA 2HMJB 1Q40B 1EEJA 3MKIA 4CDLA 1SARA 5AEWB 1JN5B 5AIHA 3DGLA 3HZPA 2BIRA 1FZUA 1OCVA 2J8XB 3FG4A 5IG5A 2WOFA 1JZDA 2W56B 4NREA 1E97A 3OWYA 1E3VA 1IVWA 1EA2A 1RJOA 4HM2B 1A2VA 1ULJB 2KF6A 1VQ93 3B7CA 1I70A 3NBRA 2RCDA 3NV0A 2XF3A 1GY5A 3UL6A 1W01A 2B1XB 1V57A 3LOYA 2ZHXB 4X2OA 1IQXA 1IV7A 1UGIA 3ECFA 3FCSB 1BRJA 1W02A 1W2ZA 3DGMA 1ROAA 3HIIA 4G1MB 1I3IA 1JJ22 3CMA3 1RMSA 3FSDA 1JBRA 3NUVA 1BSCA 1FGOA 4BL2A 1JB4A 1OF5A 5DRVA 4L8PA 4XB5A 2RSXA 2Z7AA 3S28A 2QEX3 1MNLA 3J7Yd 2XH9A 1M904 1OHPA 2XFTA 3JUPA 1QVG2 1K8A4 2F5WA 2W04A 1D6UA 3LYGA 5AI1A 4WYKA 5D83A 4BL3A 3I563 1W2B2 1BRSA 4KZ1A 2IMJA 3GRDA 1JKGB 2Z76A 4HVNA 2D1WA 3ROBA 3WA3A 1OPYA 1V58A 1B20A 2BNGA 3IMAB 4R9LA 1GOYA 3DGNA 1FYSA 3EF8A 1LXEA 2ZA4A 2K54A 2GBXB 5BXQA 1U8CB 1Q814 1GOUA 1GOVA 1RRHA 2F56A 1RGHA 5AYRB 4IT7A 3CPOA 1O7NB 1FGQA 3CC43 1BIRA 1QVF2 3NXJA 1NNVA 3EX9A 4J5KA 2CG1A 5D82A 2XSHB 1I2GA 4K61A 1N9EA 5STDA 1W5ZA 2XR8B 1A90A 5G1KA 1MGRA 3CME3 1OGZA 2CW9A 4L7KA 1DVCA 2SBLA 1A67A 1CH0A 2IA7A 3HOHA 5ELJA 3SVAA 3UB1A 1GY7A 5BIRA 1BRNL 1S723 4N3VA 2A15A 3BU4A 5FW5A 4N6LA 3PYJA 2YFJB 5IG0A 3N54B 1YJN3 1S5AA 1HYFA 2AAEA 3NHXA 3KCHA 5EQLA 2LYXA 1AR0A 1DMNA 1RGAA 4J9AA 4RBNA 3EBYA 2BMRB 3A76A 2OTL3 1M1XB 1YNVX 3ER7A 2ML6A 4FCJA 1UUGB 1IVUA 2R4IA 3CD63 1UCIA 5HOHA 3STDA 5A0OB 1TFOA 5CXOA 1RCLA 1RGLA 2HMLB 3BNCA 1JB2A 2M7OA 2GEYA 3EN8A 3F14A 3GAXA 1A2KA 8CHOA 3ZG0A 4WWUC 1RCKA 1GS3A 3U1WA 3CC23 1PFPA 1F8NA 4U13A 1OHSA 3G8ZA 4XBXA 4BTXA 1B21A 1QJGA 4BU4A 3WR2A 1MWUA 3CPW2 5JPUA 1N9JA 4DKIA 1CYUA 3BNDA 1L5GB 2F4YA 1N5HA 1RLSA 3AMOB 7GSPA 1Z1SA 3VSYA 1VQM3 1C54A 1YJ93 3KFQC 3NBJA 3FH1A 1BUJA 1BSDA 1JNQA 2F98A 4CJNA 1AY7A 4N6TA 1YIT3 2UUGC 1B2ZA 5RNTA 3LTCA 3Q1CA 1I2EA 3QK9A 4EC6A 2H0HA 2YX9A 2KF3A 3WHOA 1B27A 1X1XA 4ZM8A 4R1KA 2OQEA 1FGTA 1IU7A 4HM5B 3ZG5A 2CWUA 1GMQA 1FA3A 4OVMA 3RNTA 3TDGA 2STDA 4FCMA 1M9GA 1I3FA 2BHMA 2H0IA 3H3HA 1W6CA 2FGTA 3WA2X 5IF6A 1J2BA 5HGRA 4XDVA 1JN5A 2V1LA 4LEHA 3OX9A 3CNMA 3T0UA 3CCU3 3EHCA 1EUIC 2W0QA 3ALAA 1UI7A 3EB8A 1UCKA 1AQZA 3H51A 3JUOA 3MYTA 2Q07A 4RNTA 2OOVA 1RGEA 3DMCA 3OXAA 3X41A 1N8R4 5AEUB 1VQQA 2F99A 1BANA 2BT3A 2HMMB 4HOHA 1KSIA 1BNEA 4O3VA 3FKAA 3MPHA 1R4CA 3EJVA 1YIJ3 2O9UX 3BB9A 1LOXA 1DMMA 2XFSA 3HK4A 1O7GB 5IG4A 2YFIB 4K1VA 3GZYB 4R4KA 4TX4A 2R41A 1BNIA 3PZWA 2SARA 9RNTA 2GEXA 1TJDA 3F9SA 1YI23 1O7PB 2P09A 3CXC2 1BRGA 3D3LA 2RFRA 4HM1B 3IJEB 1SQWA 2UX0A 5AYSC 4I5QA 5M1AA 1BSBA 1K28A 2I9WA 3DZLA 2W9PA 5EVHA 1O7MB 1OHOA 5D81A 1X1UA 3T8UA 1OUNA 2IY2A 3OWSA 3SOYA 3B8LA 3DH2A 1M1K4 3V92A 1RNBA 1RDSA 3V99A 1KWIA 2KF5A 4K1UA 3IPTA 4GB5A 4H61A 4KFDA 2CC3A 3NQZA 1GYBA 1I0XA 4FR9A 5EEOA 3G4S3 4XBYA 2FXTA 2FNQA 3NV0B 2B24B 3ZFZA 4MJDA 1N8QA 1LNIA 4NPBA 3FLJA 3UL5A 2BU4A 2E2VA 2ML5A 3AGOA 1NDOB 1W4NA 1IDPA 2Y74A 4RNZA 2LQVA 4AKYA 1DMQA 1GD3A 1OF5B 1W6YA 2GBWB 5M19A 1BNGA 3GWRA 2CIUA 1K9M4 1ZO2A 1K41A 1B2UA 1WMOA 3N8BA 4RZMA 5JBSA 3F7XA 2HMNB 1BRHA 1BNJA 1VQ73 1VQL3 3MSOA 3EC9A 3PCRA 1NWWA 4IPBA 4GL6A 1FGRA 5CK6A 5CF1A 2UGIA 4IIAA 1QAFA 7STDA 4ORLA 1Q864 5KP4A 1DETA 4Q53A 4X2HA 3F8XA 5G1LA 1IVVA 1GSPA 1V74A 4N6MA 4CCVA 3BNBA 3PGBA 1PU4A 3WOEB 2W2CA 2WGQA 1TP6A 1ISKA 3DXOA 1HZ1A 2C4BA 1DYUA 1EG9B 2W9QA 2WOHA 3MG1A 1K734 3AHWA 1T3BA 1TU5A 3BLZA 2JQ5A 1RKYA 3RDEA 1ZGXA 1RN7A 4FMCA 4KT3B 1RGCA 3G0KA 4PEJA 3D9RA 1X1WA 1FW7A 2L1SA 3NM2A 3PCSA 1BSAA 3EBTA 3QRDA 4R9KA 5KP1A 4FMDA 3D4AA 3K0ZA 7RNTA 4N6NB 3M8CA 2CFKA 1VQ63 3K5TA 1Q9EA 3G16A 4HM7B 2XGLA 1UCLA 2KCDA 2O3OA 1SIHA 1JZOA 1T2HA 2P0MA 1AV4A 1QALA 3LTDA 1G96A 1VQN3 2OWPA 3CCR3 1TTOA 3NQYA 1B2MA 1MOLA 2CHCA 3O8YA 1SPUA 2OQEC 5ELUA 1UUVB 3RGRA 2PNCA 1IVXA 3BIRA 2XEPA 5I97A 4EW5A 5IERA 1VQ83 3CC73 2CKFB 4NHFA 5BVBA 4AEQA 5IW9A 1Q7Y4 1FUSA 2PZVA 3CU3A 4XM4A 1LNHA 3K9MC 1VQ53 1JV2B 1CYVA 2KRTA 2Z6BA 1Q824 1E3RA 1KD14 3V98A 1JBTA 3AGNA 4K90B 4HM0B 3JUQA 1VZZA 4MMYB 1BNSA 3NBBA 3EE1A 2OOVC 4XDWA 1US1A 3F8HA 2F86B 1VQ43 2E2UA 4EXRA 1RTUA 1Q40A 1RSNA 3L0RA 4BIRA 5AIGA 3MHEA 3WDGB 3KSPA 1IQYA 1TRQA 3DY5A 1B2SA 1I8VA 2W56A 3GSPA 1B3SA 1I0VA 3B4OA 3BNEA 1IQ8A 3HIGA 2QGUA 2CFLA 4QWTA 2BMQB 2P05A 3AHSA 2GSPA 2XRXB 1RN4A 4LZIA 1LRAA 1PYLA 1RHLA 1CQSA 1UI8A 3CCL3 4OUQA 4FCZA 3FF2A 3KN4A 3X40A 4FMAA 1OACA 1D6ZA 4STDA 1BRIA 5IENA 1BGSA 4MMZB 2YFLB 2Y73A 3LT9A 1QMAA 1RNTA 4WFOA 3S29A 5TGNA 2Z77A 1X1YA 4HYZA 1IT7A 1G0TA 5IEOA 2AADA 3X3XA 1NB5I 4XBTA 3X3ZA 1O7WB 3A5EA 1BU4A 1STDA 1WNHA 3SOAA 6STDA 1JKGA 1RGKA 1BNRA 2K0MA 3KZTA 1O7HB 2INXA 5G2GA 4JRFA 1C7HA 1JB5A 3CCJ3 3URPA 2XGNA 1EKMA 1GMRA 3CCM3 1AVLA 1KQS2 1Q42A 3JUNA 1ZX2A 3Q3FA 4EV2A 1R4YA 1JBSA 5DREA 1NB3I 3GZBA 3HX8A 4HKVB 3UJMA 3I0YA 4EV5A 1LOVA 3CNXA 1VQP3 3DGYA 1N5PA 1PY3A 1LOWA 4RNYA 1YHQ3 3MWZA 4LYLB 1T2IA 1TIJA 1BRKA 4N6UA 1BVIA 2WO0A 3PS8A 3UNLA 3D5IA 4GSPA 2K3DA 2BMOB 1LOYA 1UDII 1LQGC 2KF4A 4WP5A 2OTJ3 1EQKA 3MG2A 4HZ9B 3SX1A 2CFGA 1W6GA 3LXUX 2ZL8A 2MC8A 3LTBA 2RGQA 3SLUA 3WODG 1RGGA 4BTWA 1W7CA 4MMXB 4MEIA 4WYKB 1ASKA 3X3YA 2H0GA
chains in the Genus database with same CATH topology
1GMQA 1Q9EA 3RNTA 1RN1A 1BRJA 1UCLA 4HAAA 1I3FA 1I3IA 1T2HA 1RGFA 1RMSA 1JBRA 6GSPA 1BSCA 1BNFA 1GMPA 1TTOA 2RNTA 8RNTA 1B2MA 4J5GA 6RNTA 1UCKA 1AQZA 1IYYA 4GHOA 4RNTA 1RGEA 3BIRA 1DE3A 1BANA 2F5WA 1FUSA 4HOHA 1BNEA 1BRSA 2F5MA 1JBTA 1B20A 1YVSA 1GOYA 3AGNA 1UCJA 1FYSA 1BNSA 2ZA4A 1BOXA 1BNIA 1GOUA 1GOVA 2F56A 2SARA 1RGHA 9RNTA 1BRGA 1RTUA 1RSNA 1BIRA 4BIRA 4J5KA 1BSBA 1TRQA 1B2SA 1I8VA 1I2GA 1X1UA 3GSPA 1B3SA 7RNTA 1I0VA 3DH2A 1RNBA 3AHSA 1RDSA 2KF5A 2GSPA 1RN4A 2RBIA 1LRAA 1PYLA 1MGRA 1RHLA 2HOHA 1CH0A 3HOHA 1I0XA 1A2PA 1BRIA 5BIRA 1BRNL 1BGSA 3BU4A 1YGWA 1RNTA 1LNIA 1G02A 1X1YA 1B2XA 1HYFA 1MGWA 2AAEA 3KCHA 2BU4A 1BAOA 3AGOA 1RGAA 2AADA 1YNVX 3D5GA 3A5EA 1BU4A 5BU4A 1BNGA 1UCIA 5HOHA 1RGKA 1RCLA 1RGLA 1B2UA 1BNRA 5GSPA 1BRHA 3SYUA 1BNJA 1RCKA 2KAAA 3URPA 1GMRA 1TRPA 1B21A 1I2FA 4BU4A 3WR2A 1FUTA 1DETA 3Q3FA 1GSPA 1R4YA 1JBSA 2F4YA 1RLSA 7GSPA 1BSEA 1HZ1A 2C4BA 1C54A 1LOVA 3DGYA 3AHWA 1BUJA 1PY3A 1BSDA 1LOWA 1SARA 1AY7A 1ZGXA 2BIRA 1T2IA 1B2ZA 1BRKA 1FZUA 1BVIA 5RNTA 1RGCA 1I2EA 3D5IA 4GSPA 2KF3A 1LOYA 1B27A 1X1XA 1X1WA 2KF4A 3WHOA 1FW7A 1BSAA 2KF6A 1I70A 1RGGA 3D4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMQ A;  1Q9E A;  3RNT A;  1RN1 A;  1BRJ A;  1UCL A;  4HAA A;  1I3F A;  1I3I A;  1T2H A;  1RGF A;  1RMS A;  1JBR A;  6GSP A;  1BSC A;  1BNF A;  1GMP A;  1TTO A;  2RNT A;  8RNT A;  1B2M A;  4J5G A;  6RNT A;  1UCK A;  1AQZ A;  1IYY A;  4GHO A;  4RNT A;  1RGE A;  3BIR A;  1DE3 A;  1BAN A;  2F5W A;  1FUS A;  4HOH A;  1BNE A;  1BRS A;  2F5M A;  1JBT A;  1B20 A;  1YVS A;  1GOY A;  3AGN A;  1UCJ A;  1FYS A;  1BNS A;  2ZA4 A;  1BOX A;  1BNI A;  1GOU A;  1GOV A;  2F56 A;  2SAR A;  1RGH A;  9RNT A;  1BRG A;  1RTU A;  1RSN A;  1BIR A;  4BIR A;  4J5K A;  1BSB A;  1TRQ A;  1B2S A;  1I8V A;  1I2G A;  1X1U A;  3GSP A;  1B3S A;  7RNT A;  1I0V A;  3DH2 A;  1RNB A;  3AHS A;  1RDS A;  2KF5 A;  2GSP A;  1RN4 A;  2RBI A;  1LRA A;  1PYL A;  1MGR A;  1RHL A;  2HOH A;  1CH0 A;  3HOH A;  1I0X A;  1A2P A;  1BRI A;  5BIR A;  1BRN L;  1BGS A;  3BU4 A;  1YGW A;  1RNT A;  1LNI A;  1G02 A;  1X1Y A;  1B2X A;  1HYF A;  1MGW A;  2AAE A;  3KCH A;  2BU4 A;  1BAO A;  3AGO A;  1RGA A;  2AAD A;  1YNV X;  3D5G A;  3A5E A;  1BU4 A;  5BU4 A;  1BNG A;  1UCI A;  5HOH A;  1RGK A;  1RCL A;  1RGL A;  1B2U A;  1BNR A;  5GSP A;  1BRH A;  3SYU A;  1BNJ A;  1RCK A;  2KAA A;  3URP A;  1GMR A;  1TRP A;  1B21 A;  1I2F A;  4BU4 A;  3WR2 A;  1FUT A;  1DET A;  3Q3F A;  1GSP A;  1R4Y A;  1JBS A;  2F4Y A;  1RLS A;  7GSP A;  1BSE A;  1HZ1 A;  2C4B A;  1C54 A;  1LOV A;  3DGY A;  3AHW A;  1BUJ A;  1PY3 A;  1BSD A;  1LOW A;  1SAR A;  1AY7 A;  1ZGX A;  2BIR A;  1T2I A;  1B2Z A;  1BRK A;  1FZU A;  1BVI A;  5RNT A;  1RGC A;  1I2E A;  3D5I A;  4GSP A;  2KF3 A;  1LOY A;  1B27 A;  1X1X A;  1X1W A;  2KF4 A;  3WHO A;  1FW7 A;  1BSA A;  2KF6 A;  1I70 A;  1RGG A;  3D4A A; 
#chains in the Genus database with same CATH topology
 2P0X A;  3CCS 3;  1RN1 A;  2JDI H;  4KFE A;  4KFF A;  4HAA A;  3CCQ 3;  2CH9 A;  1IK3 A;  3E99 A;  1RGF A;  1FUW A;  4LMI A;  2P38 A;  1LVN A;  1YVB I;  2WGO A;  3VGN A;  1BNF A;  1GMP A;  2CX0 A;  2RNT A;  3MG3 A;  6GSP A;  8RNT A;  1STF I;  4J5G A;  1W00 A;  4KVH A;  5CF2 A;  6RNT A;  2QIY A;  1IYY A;  3NX0 A;  3CCV 3;  3LT8 A;  4GHO A;  1UW1 A;  4N6V 0;  4O2H A;  3SXX A;  1DE3 A;  2CWT A;  5AII A;  1MWT A;  3G71 3;  3KSE D;  1OGX A;  1WMP A;  5AIF A;  4EYC A;  4LGQ A;  2CWV A;  3Q2P A;  3FF0 A;  4HM6 B;  4L8O A;  2F5M A;  5M18 A;  2HMO B;  1SJW A;  3WOF B;  1YJW 3;  1UGH I;  3X42 A;  3Q90 A;  1YVS A;  4WHA A;  3D79 A;  1UCJ A;  4BTY A;  2OCT A;  3F7S A;  4O02 B;  1BOX A;  3FZW A;  1VQO 3;  1Y4K A;  4R80 A;  5JPP A;  3AMO A;  4OK0 A;  4ILF A;  4AKZ A;  4HBR A;  2C10 A;  5KP3 A;  3S5C A;  2IYJ A;  4I4K A;  3B4P A;  3JVC A;  3SED A;  1D6Y A;  4HJL B;  4HM3 B;  5LC6 A;  1TFK A;  2BO9 B;  3N9H A;  1IT8 A;  4CPK A;  1GY6 A;  1WMN A;  2GU3 A;  3LH4 A;  1OH0 A;  2IUK A;  2E2T A;  2W03 A;  3K63 A;  1FGM A;  2QA4 3;  2CFD A;  2ZDJ A;  3DM8 A;  3S67 A;  3CCE 3;  2CFW A;  1IV9 A;  3G6E 3;  4O8S A;  1NU3 A;  1ROV A;  2RBI A;  5IEP A;  3OW2 2;  2IUJ A;  1BUQ A;  4N6O B;  2CX1 A;  2HOH A;  1GD4 A;  2GXF A;  3DGO A;  3HI7 A;  3WMD A;  1HKX A;  1LQM B;  1T5Y A;  2CK3 H;  3EN1 B;  3RGA A;  3KE7 A;  1NJI 4;  1A2P A;  3OV4 A;  3I55 3;  3FG3 A;  1RRL A;  2GU1 A;  2W6J H;  1YGW A;  3LML A;  1Q7H A;  4EBG A;  1WQL B;  5LC7 A;  1G02 A;  2L4V A;  1U5O A;  1HU9 A;  1UUW B;  1B2X A;  1MGW A;  2C11 A;  4LSO A;  2HMK B;  1BAO A;  1CEW I;  4HM8 B;  1TUH A;  1WTH A;  3EQQ B;  3KII A;  4HM4 B;  3D5G A;  3JUM A;  3LTA A;  1VQK 3;  3GZX B;  2D42 A;  4HZB B;  1QAK A;  5BU4 A;  3FGY A;  3S27 A;  5IG3 A;  3F40 A;  2CG0 A;  4J8T A;  3VF1 A;  5FGO A;  3OWU A;  3KKG A;  4FMB A;  1YGE A;  5GSP A;  3LZA A;  4JF8 A;  2KAA A;  3SYU A;  1JRQ A;  1AVK A;  1MWR A;  1MWS A;  1ULI B;  1TRP A;  2MF7 A;  3FG1 A;  3K7C A;  1I2F A;  1NO3 A;  4H3U A;  3U97 A;  1FUT A;  3GZR A;  5CLK A;  1SII A;  3NM7 A;  3DUK A;  1ZS7 A;  3T8N A;  2XSO B;  2KXG A;  1BSE A;  3PXM A;  1KC8 4;  1DVD A;  2HMJ B;  1Q40 B;  1EEJ A;  3MKI A;  4CDL A;  1SAR A;  5AEW B;  1JN5 B;  5AIH A;  3DGL A;  3HZP A;  2BIR A;  1FZU A;  1OCV A;  2J8X B;  3FG4 A;  5IG5 A;  2WOF A;  1JZD A;  2W56 B;  4NRE A;  1E97 A;  3OWY A;  1E3V A;  1IVW A;  1EA2 A;  1RJO A;  4HM2 B;  1A2V A;  1ULJ B;  2KF6 A;  1VQ9 3;  3B7C A;  1I70 A;  3NBR A;  2RCD A;  3NV0 A;  2XF3 A;  1GY5 A;  3UL6 A;  1W01 A;  2B1X B;  1V57 A;  3LOY A;  2ZHX B;  4X2O A;  1IQX A;  1IV7 A;  1UGI A;  3ECF A;  3FCS B;  1BRJ A;  1W02 A;  1W2Z A;  3DGM A;  1ROA A;  3HII A;  4G1M B;  1I3I A;  1JJ2 2;  3CMA 3;  1RMS A;  3FSD A;  1JBR A;  3NUV A;  1BSC A;  1FGO A;  4BL2 A;  1JB4 A;  1OF5 A;  5DRV A;  4L8P A;  4XB5 A;  2RSX A;  2Z7A A;  3S28 A;  2QEX 3;  1MNL A;  3J7Y d;  2XH9 A;  1M90 4;  1OHP A;  2XFT A;  3JUP A;  1QVG 2;  1K8A 4;  2F5W A;  2W04 A;  1D6U A;  3LYG A;  5AI1 A;  4WYK A;  5D83 A;  4BL3 A;  3I56 3;  1W2B 2;  1BRS A;  4KZ1 A;  2IMJ A;  3GRD A;  1JKG B;  2Z76 A;  4HVN A;  2D1W A;  3ROB A;  3WA3 A;  1OPY A;  1V58 A;  1B20 A;  2BNG A;  3IMA B;  4R9L A;  1GOY A;  3DGN A;  1FYS A;  3EF8 A;  1LXE A;  2ZA4 A;  2K54 A;  2GBX B;  5BXQ A;  1U8C B;  1Q81 4;  1GOU A;  1GOV A;  1RRH A;  2F56 A;  1RGH A;  5AYR B;  4IT7 A;  3CPO A;  1O7N B;  1FGQ A;  3CC4 3;  1BIR A;  1QVF 2;  3NXJ A;  1NNV A;  3EX9 A;  4J5K A;  2CG1 A;  5D82 A;  2XSH B;  1I2G A;  4K61 A;  1N9E A;  5STD A;  1W5Z A;  2XR8 B;  1A90 A;  5G1K A;  1MGR A;  3CME 3;  1OGZ A;  2CW9 A;  4L7K A;  1DVC A;  2SBL A;  1A67 A;  1CH0 A;  2IA7 A;  3HOH A;  5ELJ A;  3SVA A;  3UB1 A;  1GY7 A;  5BIR A;  1BRN L;  1S72 3;  4N3V A;  2A15 A;  3BU4 A;  5FW5 A;  4N6L A;  3PYJ A;  2YFJ B;  5IG0 A;  3N54 B;  1YJN 3;  1S5A A;  1HYF A;  2AAE A;  3NHX A;  3KCH A;  5EQL A;  2LYX A;  1AR0 A;  1DMN A;  1RGA A;  4J9A A;  4RBN A;  3EBY A;  2BMR B;  3A76 A;  2OTL 3;  1M1X B;  1YNV X;  3ER7 A;  2ML6 A;  4FCJ A;  1UUG B;  1IVU A;  2R4I A;  3CD6 3;  1UCI A;  5HOH A;  3STD A;  5A0O B;  1TFO A;  5CXO A;  1RCL A;  1RGL A;  2HML B;  3BNC A;  1JB2 A;  2M7O A;  2GEY A;  3EN8 A;  3F14 A;  3GAX A;  1A2K A;  8CHO A;  3ZG0 A;  4WWU C;  1RCK A;  1GS3 A;  3U1W A;  3CC2 3;  1PFP A;  1F8N A;  4U13 A;  1OHS A;  3G8Z A;  4XBX A;  4BTX A;  1B21 A;  1QJG A;  4BU4 A;  3WR2 A;  1MWU A;  3CPW 2;  5JPU A;  1N9J A;  4DKI A;  1CYU A;  3BND A;  1L5G B;  2F4Y A;  1N5H A;  1RLS A;  3AMO B;  7GSP A;  1Z1S A;  3VSY A;  1VQM 3;  1C54 A;  1YJ9 3;  3KFQ C;  3NBJ A;  3FH1 A;  1BUJ A;  1BSD A;  1JNQ A;  2F98 A;  4CJN A;  1AY7 A;  4N6T A;  1YIT 3;  2UUG C;  1B2Z A;  5RNT A;  3LTC A;  3Q1C A;  1I2E A;  3QK9 A;  4EC6 A;  2H0H A;  2YX9 A;  2KF3 A;  3WHO A;  1B27 A;  1X1X A;  4ZM8 A;  4R1K A;  2OQE A;  1FGT A;  1IU7 A;  4HM5 B;  3ZG5 A;  2CWU A;  1GMQ A;  1FA3 A;  4OVM A;  3RNT A;  3TDG A;  2STD A;  4FCM A;  1M9G A;  1I3F A;  2BHM A;  2H0I A;  3H3H A;  1W6C A;  2FGT A;  3WA2 X;  5IF6 A;  1J2B A;  5HGR A;  4XDV A;  1JN5 A;  2V1L A;  4LEH A;  3OX9 A;  3CNM A;  3T0U A;  3CCU 3;  3EHC A;  1EUI C;  2W0Q A;  3ALA A;  1UI7 A;  3EB8 A;  1UCK A;  1AQZ A;  3H51 A;  3JUO A;  3MYT A;  2Q07 A;  4RNT A;  2OOV A;  1RGE A;  3DMC A;  3OXA A;  3X41 A;  1N8R 4;  5AEU B;  1VQQ A;  2F99 A;  1BAN A;  2BT3 A;  2HMM B;  4HOH A;  1KSI A;  1BNE A;  4O3V A;  3FKA A;  3MPH A;  1R4C A;  3EJV A;  1YIJ 3;  2O9U X;  3BB9 A;  1LOX A;  1DMM A;  2XFS A;  3HK4 A;  1O7G B;  5IG4 A;  2YFI B;  4K1V A;  3GZY B;  4R4K A;  4TX4 A;  2R41 A;  1BNI A;  3PZW A;  2SAR A;  9RNT A;  2GEX A;  1TJD A;  3F9S A;  1YI2 3;  1O7P B;  2P09 A;  3CXC 2;  1BRG A;  3D3L A;  2RFR A;  4HM1 B;  3IJE B;  1SQW A;  2UX0 A;  5AYS C;  4I5Q A;  5M1A A;  1BSB A;  1K28 A;  2I9W A;  3DZL A;  2W9P A;  5EVH A;  1O7M B;  1OHO A;  5D81 A;  1X1U A;  3T8U A;  1OUN A;  2IY2 A;  3OWS A;  3SOY A;  3B8L A;  3DH2 A;  1M1K 4;  3V92 A;  1RNB A;  1RDS A;  3V99 A;  1KWI A;  2KF5 A;  4K1U A;  3IPT A;  4GB5 A;  4H61 A;  4KFD A;  2CC3 A;  3NQZ A;  1GYB A;  1I0X A;  4FR9 A;  5EEO A;  3G4S 3;  4XBY A;  2FXT A;  2FNQ A;  3NV0 B;  2B24 B;  3ZFZ A;  4MJD A;  1N8Q A;  1LNI A;  4NPB A;  3FLJ A;  3UL5 A;  2BU4 A;  2E2V A;  2ML5 A;  3AGO A;  1NDO B;  1W4N A;  1IDP A;  2Y74 A;  4RNZ A;  2LQV A;  4AKY A;  1DMQ A;  1GD3 A;  1OF5 B;  1W6Y A;  2GBW B;  5M19 A;  1BNG A;  3GWR A;  2CIU A;  1K9M 4;  1ZO2 A;  1K41 A;  1B2U A;  1WMO A;  3N8B A;  4RZM A;  5JBS A;  3F7X A;  2HMN B;  1BRH A;  1BNJ A;  1VQ7 3;  1VQL 3;  3MSO A;  3EC9 A;  3PCR A;  1NWW A;  4IPB A;  4GL6 A;  1FGR A;  5CK6 A;  5CF1 A;  2UGI A;  4IIA A;  1QAF A;  7STD A;  4ORL A;  1Q86 4;  5KP4 A;  1DET A;  4Q53 A;  4X2H A;  3F8X A;  5G1L A;  1IVV A;  1GSP A;  1V74 A;  4N6M A;  4CCV A;  3BNB A;  3PGB A;  1PU4 A;  3WOE B;  2W2C A;  2WGQ A;  1TP6 A;  1ISK A;  3DXO A;  1HZ1 A;  2C4B A;  1DYU A;  1EG9 B;  2W9Q A;  2WOH A;  3MG1 A;  1K73 4;  3AHW A;  1T3B A;  1TU5 A;  3BLZ A;  2JQ5 A;  1RKY A;  3RDE A;  1ZGX A;  1RN7 A;  4FMC A;  4KT3 B;  1RGC A;  3G0K A;  4PEJ A;  3D9R A;  1X1W A;  1FW7 A;  2L1S A;  3NM2 A;  3PCS A;  1BSA A;  3EBT A;  3QRD A;  4R9K A;  5KP1 A;  4FMD A;  3D4A A;  3K0Z A;  7RNT A;  4N6N B;  3M8C A;  2CFK A;  1VQ6 3;  3K5T A;  1Q9E A;  3G16 A;  4HM7 B;  2XGL A;  1UCL A;  2KCD A;  2O3O A;  1SIH A;  1JZO A;  1T2H A;  2P0M A;  1AV4 A;  1QAL A;  3LTD A;  1G96 A;  1VQN 3;  2OWP A;  3CCR 3;  1TTO A;  3NQY A;  1B2M A;  1MOL A;  2CHC A;  3O8Y A;  1SPU A;  2OQE C;  5ELU A;  1UUV B;  3RGR A;  2PNC A;  1IVX A;  3BIR A;  2XEP A;  5I97 A;  4EW5 A;  5IER A;  1VQ8 3;  3CC7 3;  2CKF B;  4NHF A;  5BVB A;  4AEQ A;  5IW9 A;  1Q7Y 4;  1FUS A;  2PZV A;  3CU3 A;  4XM4 A;  1LNH A;  3K9M C;  1VQ5 3;  1JV2 B;  1CYV A;  2KRT A;  2Z6B A;  1Q82 4;  1E3R A;  1KD1 4;  3V98 A;  1JBT A;  3AGN A;  4K90 B;  4HM0 B;  3JUQ A;  1VZZ A;  4MMY B;  1BNS A;  3NBB A;  3EE1 A;  2OOV C;  4XDW A;  1US1 A;  3F8H A;  2F86 B;  1VQ4 3;  2E2U A;  4EXR A;  1RTU A;  1Q40 A;  1RSN A;  3L0R A;  4BIR A;  5AIG A;  3MHE A;  3WDG B;  3KSP A;  1IQY A;  1TRQ A;  3DY5 A;  1B2S A;  1I8V A;  2W56 A;  3GSP A;  1B3S A;  1I0V A;  3B4O A;  3BNE A;  1IQ8 A;  3HIG A;  2QGU A;  2CFL A;  4QWT A;  2BMQ B;  2P05 A;  3AHS A;  2GSP A;  2XRX B;  1RN4 A;  4LZI A;  1LRA A;  1PYL A;  1RHL A;  1CQS A;  1UI8 A;  3CCL 3;  4OUQ A;  4FCZ A;  3FF2 A;  3KN4 A;  3X40 A;  4FMA A;  1OAC A;  1D6Z A;  4STD A;  1BRI A;  5IEN A;  1BGS A;  4MMZ B;  2YFL B;  2Y73 A;  3LT9 A;  1QMA A;  1RNT A;  4WFO A;  3S29 A;  5TGN A;  2Z77 A;  1X1Y A;  4HYZ A;  1IT7 A;  1G0T A;  5IEO A;  2AAD A;  3X3X A;  1NB5 I;  4XBT A;  3X3Z A;  1O7W B;  3A5E A;  1BU4 A;  1STD A;  1WNH A;  3SOA A;  6STD A;  1JKG A;  1RGK A;  1BNR A;  2K0M A;  3KZT A;  1O7H B;  2INX A;  5G2G A;  4JRF A;  1C7H A;  1JB5 A;  3CCJ 3;  3URP A;  2XGN A;  1EKM A;  1GMR A;  3CCM 3;  1AVL A;  1KQS 2;  1Q42 A;  3JUN A;  1ZX2 A;  3Q3F A;  4EV2 A;  1R4Y A;  1JBS A;  5DRE A;  1NB3 I;  3GZB A;  3HX8 A;  4HKV B;  3UJM A;  3I0Y A;  4EV5 A;  1LOV A;  3CNX A;  1VQP 3;  3DGY A;  1N5P A;  1PY3 A;  1LOW A;  4RNY A;  1YHQ 3;  3MWZ A;  4LYL B;  1T2I A;  1TIJ A;  1BRK A;  4N6U A;  1BVI A;  2WO0 A;  3PS8 A;  3UNL A;  3D5I A;  4GSP A;  2K3D A;  2BMO B;  1LOY A;  1UDI I;  1LQG C;  2KF4 A;  4WP5 A;  2OTJ 3;  1EQK A;  3MG2 A;  4HZ9 B;  3SX1 A;  2CFG A;  1W6G A;  3LXU X;  2ZL8 A;  2MC8 A;  3LTB A;  2RGQ A;  3SLU A;  3WOD G;  1RGG A;  4BTW A;  1W7C A;  4MMX B;  4MEI A;  4WYK B;  1ASK A;  3X3Y A;  2H0G A; 
#chains in the Genus database with same CATH homology
 1GMQ A;  1Q9E A;  3RNT A;  1RN1 A;  1BRJ A;  1UCL A;  4HAA A;  1I3F A;  1I3I A;  1T2H A;  1RGF A;  1RMS A;  1JBR A;  6GSP A;  1BSC A;  1BNF A;  1GMP A;  1TTO A;  2RNT A;  8RNT A;  1B2M A;  4J5G A;  6RNT A;  1UCK A;  1AQZ A;  1IYY A;  4GHO A;  4RNT A;  1RGE A;  3BIR A;  1DE3 A;  1BAN A;  2F5W A;  1FUS A;  4HOH A;  1BNE A;  1BRS A;  2F5M A;  1JBT A;  1B20 A;  1YVS A;  1GOY A;  3AGN A;  1UCJ A;  1FYS A;  1BNS A;  2ZA4 A;  1BOX A;  1BNI A;  1GOU A;  1GOV A;  2F56 A;  2SAR A;  1RGH A;  9RNT A;  1BRG A;  1RTU A;  1RSN A;  1BIR A;  4BIR A;  4J5K A;  1BSB A;  1TRQ A;  1B2S A;  1I8V A;  1I2G A;  1X1U A;  3GSP A;  1B3S A;  7RNT A;  1I0V A;  3DH2 A;  1RNB A;  3AHS A;  1RDS A;  2KF5 A;  2GSP A;  1RN4 A;  2RBI A;  1LRA A;  1PYL A;  1MGR A;  1RHL A;  2HOH A;  1CH0 A;  3HOH A;  1I0X A;  1A2P A;  1BRI A;  5BIR A;  1BRN L;  1BGS A;  3BU4 A;  1YGW A;  1RNT A;  1LNI A;  1G02 A;  1X1Y A;  1B2X A;  1HYF A;  1MGW A;  2AAE A;  3KCH A;  2BU4 A;  1BAO A;  3AGO A;  1RGA A;  2AAD A;  1YNV X;  3D5G A;  3A5E A;  1BU4 A;  5BU4 A;  1BNG A;  1UCI A;  5HOH A;  1RGK A;  1RCL A;  1RGL A;  1B2U A;  1BNR A;  5GSP A;  1BRH A;  3SYU A;  1BNJ A;  1RCK A;  2KAA A;  3URP A;  1GMR A;  1TRP A;  1B21 A;  1I2F A;  4BU4 A;  3WR2 A;  1FUT A;  1DET A;  3Q3F A;  1GSP A;  1R4Y A;  1JBS A;  2F4Y A;  1RLS A;  7GSP A;  1BSE A;  1HZ1 A;  2C4B A;  1C54 A;  1LOV A;  3DGY A;  3AHW A;  1BUJ A;  1PY3 A;  1BSD A;  1LOW A;  1SAR A;  1AY7 A;  1ZGX A;  2BIR A;  1T2I A;  1B2Z A;  1BRK A;  1FZU A;  1BVI A;  5RNT A;  1RGC A;  1I2E A;  3D5I A;  4GSP A;  2KF3 A;  1LOY A;  1B27 A;  1X1X A;  1X1W A;  2KF4 A;  3WHO A;  1FW7 A;  1BSA A;  2KF6 A;  1I70 A;  1RGG A;  3D4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...