5BIRA

Disecting histidine interactions in ribonuclease t1 using asn and gln mutations
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endonuclease
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5birA00
1RGLA 2F4YA 2HOHA 3HOHA 3AGNA 2F5MA 1TRPA 1UCLA 1BU4A 2KF3A 3KCHA 1TTOA 1FUTA 1I70A 2F5WA 3D5IA 1BNRA 3SYUA 7RNTA 1SARA 1I3FA 2BU4A 2SARA 4BU4A 2KAAA 3URPA 2RNTA 4J5GA 1RGFA 5BIRA 1B20A 1RNBA 1R4YA 1B2XA 5RNTA 1RGCA 1B21A 7GSPA 1I2EA 5BU4A 5GSPA 2AAEA 1RSNA 1YGWA 1JBSA 3AGOA 1FZUA 1RGAA 1RN1A 2GSPA 1TRQA 1I2GA 6GSPA 1BAOA 1I3IA 1YVSA 1RHLA 1RTUA 2C4BA 1A2PA 1RCKA 2KF6A 1RLSA 1BNFA 3D5GA 1BRJA 4J5KA 1JBTA 1BSEA 1BANA 1B27A 1GOUA 1YNVX 1RN4A 1DE3A 1DETA 1BNSA 4BIRA 3AHWA 1I0XA 1I2FA 1CH0A 1I0VA 1RMSA 1BRIA 1BRSA 1BSBA 1RCLA 1GMPA 1LOWA 3DGYA 2KF5A 1B3SA 1AQZA 1X1UA 1B2UA 1RGHA 2BIRA 1IYYA 1LOYA 1B2MA 8RNTA 1UCKA 1BRGA 3GSPA 3WHOA 3A5EA 2F56A 1G02A 1MGWA 9RNTA 1GMRA 1BNEA 4HOHA 1AY7A 1RGKA 2RBIA 1GOVA 4RNTA 1BVIA 1FYSA 1LOVA 2KF4A 1UCJA 1BGSA 3AHSA 1BSAA 1BSDA 1T2IA 1BRKA 2AADA 1C54A 1LNIA 3BIRA 1BOXA 1RDSA 1X1YA 1FUSA 4GSPA 1B2SA 1B2ZA 1ZGXA 1BRNL 1BNIA 1I8VA 1RNTA 1UCIA 1X1WA 1X1XA 3BU4A 1JBRA 1GMQA 1FW7A 2ZA4A 4HAAA 3DH2A 6RNTA 1BUJA 3D4AA 1BNGA 1Q9EA 1BSCA 1BNJA 1HYFA 1BRHA 1RGEA 4GHOA 3RNTA 1GSPA 1BIRA 1T2HA 5HOHA 1PY3A 1PYLA 3Q3FA 1MGRA 1GOYA 1RGGA 1HZ1A 1LRAA 3WR2A
chains in the Genus database with same CATH superfamily
1UDII 1RGLA 1QVG2 3D79A 2IA7A 3T8UA 3MYTA 1TRPA 4IT7A 1UCLA 3X3XA 2XFSA 1HKXA 2ZHXB 2W03A 5HGRA 2CX0A 1QMAA 4MMYB 3MG1A 1FUTA 1O7WB 2W2CA 1TFOA 1N8QA 1WTHA 3FKAA 3STDA 3G4S3 4FMDA 1VQ63 5CK6A 4LZIA 3SYUA 1NJI4 2SARA 5DREA 4IPBA 2HMLB 1W2ZA 2RNTA 5LC6A 4XBYA 1Y4KA 4KFEA 4WWUC 3RGRA 3I563 1GD4A 4HM6B 2JDIH 1B21A 3V92A 1I2EA 4FCMA 4PEJA 5AYSC 1M1K4 5DRVA 1KQS2 4N3VA 4XBTA 3GWRA 3AGOA 3VF1A 3I553 2LYXA 3BNCA 4XDVA 5A0OB 1YHQ3 2E2UA 5FW5A 4NHFA 3LT9A 2K3DA 4KVHA 1N5HA 1V58A 1RHLA 2R41A 4AKYA 1RTUA 1A2PA 1MOLA 2KF6A 1NDOB 2UUGC 3NHXA 3CC43 1K28A 3D5GA 2XF3A 1BSEA 1D6UA 1OACA 1TP6A 2GXFA 2P0XA 1CQSA 3CNXA 3F14A 5JPPA 1Q824 5IERA 1YNVX 5D82A 5AIIA 1Q814 1DE3A 3LYGA 2WGOA 4MMZB 3CC73 1VQN3 4KFDA 3AHWA 3IMAB 1I0XA 3F8XA 4GL6A 3BNEA 4O02B 1CH0A 1RMSA 2CX1A 1QAKA 1A2KA 2CFLA 3BNDA 3HX8A 2GBWB 2MC8A 3CPOA 3IJEB 3UB1A 1G96A 5EVHA 1D6YA 2KF5A 3T0UA 1JZDA 2INXA 3NBBA 1IV9A 5CF1A 3CCR3 3MKIA 5IG4A 4DKIA 1VQQA 1B2MA 1QJGA 2QIYA 1YIJ3 1W6YA 2W9QA 3DM8A 4HM5B 1JB4A 1ASKA 1MWSA 4HOHA 1UW1A 4KFFA 4L7KA 1JZOA 3X40A 4ORLA 1JN5B 3E99A 4RNTA 1ZO2A 3JVCA 5FGOA 1IU7A 2JQ5A 3BNBA 3LTCA 3OWUA 2OQEA 2K0MA 1TU5A 3CXC2 1JJ22 3MSOA 1OHPA 1T3BA 2AADA 1IT7A 1LNIA 1C54A 5AI1A 5CXOA 1LXEA 2HMMB 1FUSA 2GU1A 1YJN3 4GSPA 3D3LA 3D9RA 3PGBA 2CFGA 4K61A 1W6CA 1YJ93 4AEQA 4HM8B 5TGNA 3RDEA 1ZGXA 2OQEC 1GYBA 2CK3H 2P05A 3KKGA 4WYKB 3SVAA 3WA3A 1VQ43 1NB3I 3BLZA 2BMQB 3NX0A 1E97A 5AIGA 1X1XA 1GMQA 1G0TA 2HMJB 2ZA4A 3DY5A 1K9M4 1NU3A 5STDA 1FGOA 3EQQB 1GD3A 2A15A 4FCZA 1Q9EA 1GS3A 3FF2A 2RSXA 3OW22 1BSCA 4EC6A 3SX1A 1HYFA 1RGEA 4GHOA 4O3VA 4HM4B 1GSPA 1T2HA 2CC3A 1A90A 1EQKA 3NV0B 5AEWB 4U13A 3DGOA 2ML6A 2KXGA 1RGGA 2FNQA 1NO3A 2CFKA 3OV4A 3WR2A 1RJOA 2F4YA 3V99A 1EA2A 3AGNA 3KN4A 4MMXB 3TDGA 2F5MA 1CYUA 1JB5A 2GU3A 2XGLA 5IEOA 1TIJA 2W56B 5G2GA 3I0YA 1V57A 1OGZA 3LT8A 1I70A 5JBSA 1UUGB 2C11A 1W2B2 1AVKA 2OTJ3 1PFPA 3CPW2 4HM1B 4N6NB 1BNRA 1TUHA 3HK4A 4H61A 5KP3A 4BU4A 1C7HA 2CWUA 2GBXB 3URPA 3EHCA 3OWYA 3SOAA 1RGFA 2Z7AA 5BIRA 1Q864 1LQGC 1OHOA 2XGNA 4OUQA 4NPBA 3ZFZA 5M18A 1OF5A 1SJWA 1YIT3 4CDLA 4EXRA 4R80A 3X42A 1AVLA 5BU4A 3N8BA 7GSPA 3CCE3 3CMA3 1RN1A 3N9HA 1VQP3 4X2HA 1CYVA 1TRQA 1I2GA 5KP1A 3CU3A 3OWSA 1BAOA 1LOXA 1E3RA 3MHEA 2BO9B 3H3HA 1NWWA 3CCM3 4R9KA 3ZG0A 1WNHA 4J9AA 4KT3B 3U97A 3NBJA 3K63A 2STDA 3HIIA 3K7CA 1BANA 1JKGB 4CJNA 1GOUA 3SXXA 4CPKA 3CC23 1QVF2 2OWPA 1BUQA 3CCQ3 1AV4A 1DETA 4WHAA 1OGXA 4HBRA 3FG4A 1GY7A 1QAFA 3K0ZA 5AYRB 2J8XB 1BRIA 4EV5A 1GMPA 3DGYA 1GY5A 2LQVA 1AQZA 2IY2A 1B2UA 3KFQC 1RGHA 1U5OA 4QWTA 1Q40A 3KE7A 2WO0A 1IYYA 6STDA 4K90B 1WMPA 1US1A 5LC7A 3GAXA 1A2VA 4ZM8A 4BL2A 2YFIB 3LTBA 3WHOA 2F56A 4XBXA 3CCS3 3DXOA 3NXJA 3GRDA 1AY7A 1RGKA 3AMOB 1LOVA 3JUPA 2KF4A 2YX9A 4LEHA 2M7OA 1UCJA 1ZS7A 1J2BA 1IT8A 1K41A 2XR8B 4AKZA 2SBLA 3B8LA 3T8NA 1F8NA 4HJLB 1GY6A 3N54B 3S67A 4BL3A 1RDSA 3FF0A 1FGRA 1N9JA 3PCSA 4RNZA 1O7MB 1VQ93 1IQXA 5IW9A 3V98A 1UUVB 4HM2B 2HMOB 1V74A 3WOEB 4EV2A 1B2ZA 4RNYA 4RBNA 2Z76A 3KZTA 4HM7B 3GZRA 1BNIA 1FGTA 1ZX2A 3F7XA 3WOFB 1RNTA 3BB9A 3EBTA 3FZWA 5IF6A 1JBRA 5M1AA 3HZPA 1LVNA 1UI7A 2Y74A 3OXAA 6RNTA 3FG3A 3D4AA 1M9GA 4HZBB 1KD14 5G1LA 2ZL8A 3NQZA 4MEIA 1RRHA 1BNJA 1IVUA 3HIGA 3EJVA 3K5TA 2CWTA 3MPHA 3RNTA 1BIRA 3Q2PA 3CNMA 1PY3A 2YFJB 1DMNA 2FGTA 1IDPA 3LOYA 3CCL3 1UGHI 3JUNA 1VQM3 1W02A 1NNVA 2HOHA 1IVVA 3PCRA 2CFWA 2RCDA 2HMNB 3JUMA 1BU4A 1CEWI 1Z1SA 1O7PB 1JV2B 2KF3A 2WOFA 4I5QA 2IMJA 3ROBA 2WOHA 3VGNA 2F5WA 3D5IA 4IIAA 1VQ73 1N8R4 1SARA 2BU4A 3DGLA 2KAAA 3PXMA 3NBRA 3NQYA 1B20A 2B1XB 2P38A 2W04A 3S29A 3WDGB 1YJW3 1RNBA 2UGIA 2QA43 5RNTA 4FMAA 4N6TA 5IEPA 1RGCA 2RFRA 2PZVA 1JRQA 5KP4A 1JBSA 3MG3A 1SPUA 1DYUA 1W4NA 1RGAA 2GSPA 4HKVB 2QGUA 1T5YA 2P09A 3DUKA 5IENA 3M8CA 1I3IA 1SIIA 1YVSA 2KCDA 3G6E3 1FA3A 1OUNA 3LXUX 2CFDA 3QRDA 1KWIA 3LH4A 2K54A 3UL6A 3X3ZA 2ZDJA 1VQL3 3UL5A 1LNHA 1W6GA 1BRJA 3WMDA 1R4CA 2D42A 5G1KA 1K8A4 1AR0A 3QK9A 1B27A 3IPTA 3CCV3 2XEPA 2XSHB 4FCJA 4K1VA 1VZZA 1BNSA 3B4OA 1L5GB 1VQ83 3PYJA 1A67A 2Z77A 3WODG 2W6JH 1I0VA 1BRSA 1BSBA 1RCLA 2OTL3 1MWUA 1LOWA 2I9WA 1TJDA 3KSED 1JN5A 1X1UA 2D1WA 4HM0B 2L1SA 3PS8A 3G713 1W5ZA 4EW5A 1YI23 2IYJA 2CIUA 1UGIA 1W7CA 1RN7A 1UCKA 4XM4A 1G02A 1MGWA 3EN8A 7STDA 9RNTA 1GMRA 3HI7A 1BNEA 4JF8A 2RBIA 5IG0A 1GOVA 1STFI 1RKYA 1OPYA 2H0IA 3ER7A 5ELUA 3A76A 1BGSA 4R1KA 3AHSA 4WYKA 1BSAA 1BSDA 1T2IA 1IVWA 1BRKA 3ZG5A 3S28A 1FUWA 4N6OB 2CW9A 4Q53A 1LQMB 1UI8A 3BIRA 2GEXA 1WQLB 1IVXA 2Q07A 5CF2A 3EX9A 1K734 3LTAA 4FMBA 1B2SA 1SQWA 2C10A 2BT3A 1ISKA 1JB2A 2F86B 3LTDA 5AIHA 2XFTA 4LMIA 3NM2A 2V1LA 2Y73A 2BMOB 2F98A 2W0QA 3LMLA 1IQ8A 1I8VA 5BVBA 3DGNA 3NV0A 1X1WA 4R9LA 3BU4A 3JUOA 1FW7A 3K9MC 4WFOA 3DH2A 2Z6BA 1SIHA 4OVMA 1EEJA 4HVNA 4EYCA 2W56A 1ULIB 1UUWB 1STDA 4N6UA 1PYLA 3Q3FA 4HZ9B 2IUJA 4HYZA 3F40A 3FSDA 3ALAA 5AEUB 4N6MA 1HZ1A 1LRAA 3EN1B 1EUIC 4ILFA 2CWVA 2CG0A 2XRXB 3LZAA 5M19A 2BNGA 3HOHA 3F9SA 3CCJ3 2W9PA 3KCHA 1TTOA 1OHSA 5I97A 3Q90A 2IUKA 1JNQA 1MWRA 3O8YA 3NUVA 5EEOA 4EBGA 7RNTA 2QEX3 1I3FA 1WMOA 3EE1A 3F8HA 4BTYA 2L4VA 4CCVA 4J5GA 4X2OA 3G0KA 1VQ53 3FG1A 4HM3B 3WA2X 1YVBI 1R4YA 1B2XA 1OCVA 1VQO3 4L8OA 4KZ1A 2KRTA 3B7CA 1O7HB 3F7SA 2AAEA 5GSPA 1PU4A 1RSNA 1YGWA 3S5CA 1FZUA 1S5AA 3G8ZA 1JKGA 2E2VA 6GSPA 1M904 2RGQA 1W01A 3GZBA 1O7GB 2BMRB 2R4IA 1Q7HA 3H51A 2C4BA 1OF5B 1RCKA 1FGQA 1Q42A 1RLSA 1BNFA 2E2TA 2XH9A 2YFLB 4J8TA 4STDA 4J5KA 5IG5A 1JBTA 4BTWA 1ROVA 4XB5A 3NM7A 2UX0A 1EKMA 2CKFB 2OCTA 3DMCA 3SEDA 3Q1CA 3FLJA 2WGQA 1VQK3 4RZMA 3EC9A 1RN4A 2OOVA 3UJMA 1IK3A 3SOYA 3GZXB 4XDWA 2XSOB 1DMMA 1WMNA 4BIRA 1KSIA 1I2FA 2H0HA 4N6V0 3EB8A 1DVDA 2MF7A 2FXTA 3DZLA 3S27A 3AMOA 3B4PA 4I4KA 1B3SA 1N9EA 3JUQA 1FGMA 1E3VA 1OH0A 3MWZA 2OOVC 1TFKA 2BIRA 5ELJA 5JPUA 5D81A 3GZYB 1LOYA 1MNLA 2B24B 4FR9A 3KSPA 8RNTA 5D83A 1BRGA 3GSPA 1YGEA 3A5EA 1MWTA 3RGAA 3UNLA 5IG3A 1IV7A 2HMKB 2ML5A 3FGYA 1KC84 4H3UA 3X41A 3PZWA 2F99A 3SLUA 3CME3 2BHMA 4L8PA 1BVIA 1FYSA 5EQLA 1HU9A 3VSYA 5CLKA 2O9UX 4BTXA 1Q40B 1ULJB 4FMCA 1N5PA 3EF8A 1BOXA 1X1YA 4JRFA 1S723 2P0MA 1DVCA 4NREA 8CHOA 3FH1A 3OX9A 2GEYA 3FCSB 2O3OA 3CD63 1BRNL 4LGQA 1QALA 1U8CB 4WP5A 4MJDA 1UCIA 3MG2A 5AIFA 1Q7Y4 2PNCA 4HAAA 1BUJA 3L0RA 3U1WA 1BNGA 1RRLA 1DMQA 1M1XB 4G1MB 3ECFA 4GB5A 3G16A 4O2HA 2CG1A 1BRHA 1IQYA 2CH9A 1EG9B 3EBYA 1W00A 4LYLB 3DGMA 4K1UA 1O7NB 5BXQA 5HOHA 3J7Yd 1NB5I 1ROAA 2H0GA 4N6LA 3KIIA 4O8SA 4OK0A 4R4KA 4LSOA 1MGRA 1D6ZA 1GOYA 3CCU3 2CHCA 4TX4A 3X3YA
chains in the Genus database with same CATH topology
1RGLA 2F4YA 2HOHA 3HOHA 3AGNA 2F5MA 1TRPA 1UCLA 1BU4A 2KF3A 3KCHA 1TTOA 1FUTA 1I70A 2F5WA 3D5IA 1BNRA 3SYUA 7RNTA 1SARA 1I3FA 2BU4A 2SARA 4BU4A 2KAAA 3URPA 2RNTA 4J5GA 1RGFA 5BIRA 1B20A 1RNBA 1R4YA 1B2XA 5RNTA 1RGCA 1B21A 7GSPA 1I2EA 5BU4A 5GSPA 2AAEA 1RSNA 1YGWA 1JBSA 3AGOA 1FZUA 1RGAA 1RN1A 2GSPA 1TRQA 1I2GA 6GSPA 1BAOA 1I3IA 1YVSA 1RHLA 1RTUA 2C4BA 1A2PA 1RCKA 2KF6A 1RLSA 1BNFA 3D5GA 1BRJA 4J5KA 1JBTA 1BSEA 1BANA 1B27A 1GOUA 1YNVX 1RN4A 1DE3A 1DETA 1BNSA 4BIRA 3AHWA 1I0XA 1I2FA 1CH0A 1I0VA 1RMSA 1BRIA 1BRSA 1BSBA 1RCLA 1GMPA 1LOWA 3DGYA 2KF5A 1B3SA 1AQZA 1X1UA 1B2UA 1RGHA 2BIRA 1IYYA 1LOYA 1B2MA 8RNTA 1UCKA 1BRGA 3GSPA 3WHOA 3A5EA 2F56A 1G02A 1MGWA 9RNTA 1GMRA 1BNEA 4HOHA 1AY7A 1RGKA 2RBIA 1GOVA 4RNTA 1BVIA 1FYSA 1LOVA 2KF4A 1UCJA 1BGSA 3AHSA 1BSAA 1BSDA 1T2IA 1BRKA 2AADA 1C54A 1LNIA 3BIRA 1BOXA 1RDSA 1X1YA 1FUSA 4GSPA 1B2SA 1B2ZA 1ZGXA 1BRNL 1BNIA 1I8VA 1RNTA 1UCIA 1X1WA 1X1XA 3BU4A 1JBRA 1GMQA 1FW7A 2ZA4A 4HAAA 3DH2A 6RNTA 1BUJA 3D4AA 1BNGA 1Q9EA 1BSCA 1BNJA 1HYFA 1BRHA 1RGEA 4GHOA 3RNTA 1GSPA 1BIRA 1T2HA 5HOHA 1PY3A 1PYLA 3Q3FA 1MGRA 1GOYA 1RGGA 1HZ1A 1LRAA 3WR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGL A;  2F4Y A;  2HOH A;  3HOH A;  3AGN A;  2F5M A;  1TRP A;  1UCL A;  1BU4 A;  2KF3 A;  3KCH A;  1TTO A;  1FUT A;  1I70 A;  2F5W A;  3D5I A;  1BNR A;  3SYU A;  7RNT A;  1SAR A;  1I3F A;  2BU4 A;  2SAR A;  4BU4 A;  2KAA A;  3URP A;  2RNT A;  4J5G A;  1RGF A;  5BIR A;  1B20 A;  1RNB A;  1R4Y A;  1B2X A;  5RNT A;  1RGC A;  1B21 A;  7GSP A;  1I2E A;  5BU4 A;  5GSP A;  2AAE A;  1RSN A;  1YGW A;  1JBS A;  3AGO A;  1FZU A;  1RGA A;  1RN1 A;  2GSP A;  1TRQ A;  1I2G A;  6GSP A;  1BAO A;  1I3I A;  1YVS A;  1RHL A;  1RTU A;  2C4B A;  1A2P A;  1RCK A;  2KF6 A;  1RLS A;  1BNF A;  3D5G A;  1BRJ A;  4J5K A;  1JBT A;  1BSE A;  1BAN A;  1B27 A;  1GOU A;  1YNV X;  1RN4 A;  1DE3 A;  1DET A;  1BNS A;  4BIR A;  3AHW A;  1I0X A;  1I2F A;  1CH0 A;  1I0V A;  1RMS A;  1BRI A;  1BRS A;  1BSB A;  1RCL A;  1GMP A;  1LOW A;  3DGY A;  2KF5 A;  1B3S A;  1AQZ A;  1X1U A;  1B2U A;  1RGH A;  2BIR A;  1IYY A;  1LOY A;  1B2M A;  8RNT A;  1UCK A;  1BRG A;  3GSP A;  3WHO A;  3A5E A;  2F56 A;  1G02 A;  1MGW A;  9RNT A;  1GMR A;  1BNE A;  4HOH A;  1AY7 A;  1RGK A;  2RBI A;  1GOV A;  4RNT A;  1BVI A;  1FYS A;  1LOV A;  2KF4 A;  1UCJ A;  1BGS A;  3AHS A;  1BSA A;  1BSD A;  1T2I A;  1BRK A;  2AAD A;  1C54 A;  1LNI A;  3BIR A;  1BOX A;  1RDS A;  1X1Y A;  1FUS A;  4GSP A;  1B2S A;  1B2Z A;  1ZGX A;  1BRN L;  1BNI A;  1I8V A;  1RNT A;  1UCI A;  1X1W A;  1X1X A;  3BU4 A;  1JBR A;  1GMQ A;  1FW7 A;  2ZA4 A;  4HAA A;  3DH2 A;  6RNT A;  1BUJ A;  3D4A A;  1BNG A;  1Q9E A;  1BSC A;  1BNJ A;  1HYF A;  1BRH A;  1RGE A;  4GHO A;  3RNT A;  1GSP A;  1BIR A;  1T2H A;  5HOH A;  1PY3 A;  1PYL A;  3Q3F A;  1MGR A;  1GOY A;  1RGG A;  1HZ1 A;  1LRA A;  3WR2 A; 
#chains in the Genus database with same CATH topology
 1UDI I;  1RGL A;  1QVG 2;  3D79 A;  2IA7 A;  3T8U A;  3MYT A;  1TRP A;  4IT7 A;  1UCL A;  3X3X A;  2XFS A;  1HKX A;  2ZHX B;  2W03 A;  5HGR A;  2CX0 A;  1QMA A;  4MMY B;  3MG1 A;  1FUT A;  1O7W B;  2W2C A;  1TFO A;  1N8Q A;  1WTH A;  3FKA A;  3STD A;  3G4S 3;  4FMD A;  1VQ6 3;  5CK6 A;  4LZI A;  3SYU A;  1NJI 4;  2SAR A;  5DRE A;  4IPB A;  2HML B;  1W2Z A;  2RNT A;  5LC6 A;  4XBY A;  1Y4K A;  4KFE A;  4WWU C;  3RGR A;  3I56 3;  1GD4 A;  4HM6 B;  2JDI H;  1B21 A;  3V92 A;  1I2E A;  4FCM A;  4PEJ A;  5AYS C;  1M1K 4;  5DRV A;  1KQS 2;  4N3V A;  4XBT A;  3GWR A;  3AGO A;  3VF1 A;  3I55 3;  2LYX A;  3BNC A;  4XDV A;  5A0O B;  1YHQ 3;  2E2U A;  5FW5 A;  4NHF A;  3LT9 A;  2K3D A;  4KVH A;  1N5H A;  1V58 A;  1RHL A;  2R41 A;  4AKY A;  1RTU A;  1A2P A;  1MOL A;  2KF6 A;  1NDO B;  2UUG C;  3NHX A;  3CC4 3;  1K28 A;  3D5G A;  2XF3 A;  1BSE A;  1D6U A;  1OAC A;  1TP6 A;  2GXF A;  2P0X A;  1CQS A;  3CNX A;  3F14 A;  5JPP A;  1Q82 4;  5IER A;  1YNV X;  5D82 A;  5AII A;  1Q81 4;  1DE3 A;  3LYG A;  2WGO A;  4MMZ B;  3CC7 3;  1VQN 3;  4KFD A;  3AHW A;  3IMA B;  1I0X A;  3F8X A;  4GL6 A;  3BNE A;  4O02 B;  1CH0 A;  1RMS A;  2CX1 A;  1QAK A;  1A2K A;  2CFL A;  3BND A;  3HX8 A;  2GBW B;  2MC8 A;  3CPO A;  3IJE B;  3UB1 A;  1G96 A;  5EVH A;  1D6Y A;  2KF5 A;  3T0U A;  1JZD A;  2INX A;  3NBB A;  1IV9 A;  5CF1 A;  3CCR 3;  3MKI A;  5IG4 A;  4DKI A;  1VQQ A;  1B2M A;  1QJG A;  2QIY A;  1YIJ 3;  1W6Y A;  2W9Q A;  3DM8 A;  4HM5 B;  1JB4 A;  1ASK A;  1MWS A;  4HOH A;  1UW1 A;  4KFF A;  4L7K A;  1JZO A;  3X40 A;  4ORL A;  1JN5 B;  3E99 A;  4RNT A;  1ZO2 A;  3JVC A;  5FGO A;  1IU7 A;  2JQ5 A;  3BNB A;  3LTC A;  3OWU A;  2OQE A;  2K0M A;  1TU5 A;  3CXC 2;  1JJ2 2;  3MSO A;  1OHP A;  1T3B A;  2AAD A;  1IT7 A;  1LNI A;  1C54 A;  5AI1 A;  5CXO A;  1LXE A;  2HMM B;  1FUS A;  2GU1 A;  1YJN 3;  4GSP A;  3D3L A;  3D9R A;  3PGB A;  2CFG A;  4K61 A;  1W6C A;  1YJ9 3;  4AEQ A;  4HM8 B;  5TGN A;  3RDE A;  1ZGX A;  2OQE C;  1GYB A;  2CK3 H;  2P05 A;  3KKG A;  4WYK B;  3SVA A;  3WA3 A;  1VQ4 3;  1NB3 I;  3BLZ A;  2BMQ B;  3NX0 A;  1E97 A;  5AIG A;  1X1X A;  1GMQ A;  1G0T A;  2HMJ B;  2ZA4 A;  3DY5 A;  1K9M 4;  1NU3 A;  5STD A;  1FGO A;  3EQQ B;  1GD3 A;  2A15 A;  4FCZ A;  1Q9E A;  1GS3 A;  3FF2 A;  2RSX A;  3OW2 2;  1BSC A;  4EC6 A;  3SX1 A;  1HYF A;  1RGE A;  4GHO A;  4O3V A;  4HM4 B;  1GSP A;  1T2H A;  2CC3 A;  1A90 A;  1EQK A;  3NV0 B;  5AEW B;  4U13 A;  3DGO A;  2ML6 A;  2KXG A;  1RGG A;  2FNQ A;  1NO3 A;  2CFK A;  3OV4 A;  3WR2 A;  1RJO A;  2F4Y A;  3V99 A;  1EA2 A;  3AGN A;  3KN4 A;  4MMX B;  3TDG A;  2F5M A;  1CYU A;  1JB5 A;  2GU3 A;  2XGL A;  5IEO A;  1TIJ A;  2W56 B;  5G2G A;  3I0Y A;  1V57 A;  1OGZ A;  3LT8 A;  1I70 A;  5JBS A;  1UUG B;  2C11 A;  1W2B 2;  1AVK A;  2OTJ 3;  1PFP A;  3CPW 2;  4HM1 B;  4N6N B;  1BNR A;  1TUH A;  3HK4 A;  4H61 A;  5KP3 A;  4BU4 A;  1C7H A;  2CWU A;  2GBX B;  3URP A;  3EHC A;  3OWY A;  3SOA A;  1RGF A;  2Z7A A;  5BIR A;  1Q86 4;  1LQG C;  1OHO A;  2XGN A;  4OUQ A;  4NPB A;  3ZFZ A;  5M18 A;  1OF5 A;  1SJW A;  1YIT 3;  4CDL A;  4EXR A;  4R80 A;  3X42 A;  1AVL A;  5BU4 A;  3N8B A;  7GSP A;  3CCE 3;  3CMA 3;  1RN1 A;  3N9H A;  1VQP 3;  4X2H A;  1CYV A;  1TRQ A;  1I2G A;  5KP1 A;  3CU3 A;  3OWS A;  1BAO A;  1LOX A;  1E3R A;  3MHE A;  2BO9 B;  3H3H A;  1NWW A;  3CCM 3;  4R9K A;  3ZG0 A;  1WNH A;  4J9A A;  4KT3 B;  3U97 A;  3NBJ A;  3K63 A;  2STD A;  3HII A;  3K7C A;  1BAN A;  1JKG B;  4CJN A;  1GOU A;  3SXX A;  4CPK A;  3CC2 3;  1QVF 2;  2OWP A;  1BUQ A;  3CCQ 3;  1AV4 A;  1DET A;  4WHA A;  1OGX A;  4HBR A;  3FG4 A;  1GY7 A;  1QAF A;  3K0Z A;  5AYR B;  2J8X B;  1BRI A;  4EV5 A;  1GMP A;  3DGY A;  1GY5 A;  2LQV A;  1AQZ A;  2IY2 A;  1B2U A;  3KFQ C;  1RGH A;  1U5O A;  4QWT A;  1Q40 A;  3KE7 A;  2WO0 A;  1IYY A;  6STD A;  4K90 B;  1WMP A;  1US1 A;  5LC7 A;  3GAX A;  1A2V A;  4ZM8 A;  4BL2 A;  2YFI B;  3LTB A;  3WHO A;  2F56 A;  4XBX A;  3CCS 3;  3DXO A;  3NXJ A;  3GRD A;  1AY7 A;  1RGK A;  3AMO B;  1LOV A;  3JUP A;  2KF4 A;  2YX9 A;  4LEH A;  2M7O A;  1UCJ A;  1ZS7 A;  1J2B A;  1IT8 A;  1K41 A;  2XR8 B;  4AKZ A;  2SBL A;  3B8L A;  3T8N A;  1F8N A;  4HJL B;  1GY6 A;  3N54 B;  3S67 A;  4BL3 A;  1RDS A;  3FF0 A;  1FGR A;  1N9J A;  3PCS A;  4RNZ A;  1O7M B;  1VQ9 3;  1IQX A;  5IW9 A;  3V98 A;  1UUV B;  4HM2 B;  2HMO B;  1V74 A;  3WOE B;  4EV2 A;  1B2Z A;  4RNY A;  4RBN A;  2Z76 A;  3KZT A;  4HM7 B;  3GZR A;  1BNI A;  1FGT A;  1ZX2 A;  3F7X A;  3WOF B;  1RNT A;  3BB9 A;  3EBT A;  3FZW A;  5IF6 A;  1JBR A;  5M1A A;  3HZP A;  1LVN A;  1UI7 A;  2Y74 A;  3OXA A;  6RNT A;  3FG3 A;  3D4A A;  1M9G A;  4HZB B;  1KD1 4;  5G1L A;  2ZL8 A;  3NQZ A;  4MEI A;  1RRH A;  1BNJ A;  1IVU A;  3HIG A;  3EJV A;  3K5T A;  2CWT A;  3MPH A;  3RNT A;  1BIR A;  3Q2P A;  3CNM A;  1PY3 A;  2YFJ B;  1DMN A;  2FGT A;  1IDP A;  3LOY A;  3CCL 3;  1UGH I;  3JUN A;  1VQM 3;  1W02 A;  1NNV A;  2HOH A;  1IVV A;  3PCR A;  2CFW A;  2RCD A;  2HMN B;  3JUM A;  1BU4 A;  1CEW I;  1Z1S A;  1O7P B;  1JV2 B;  2KF3 A;  2WOF A;  4I5Q A;  2IMJ A;  3ROB A;  2WOH A;  3VGN A;  2F5W A;  3D5I A;  4IIA A;  1VQ7 3;  1N8R 4;  1SAR A;  2BU4 A;  3DGL A;  2KAA A;  3PXM A;  3NBR A;  3NQY A;  1B20 A;  2B1X B;  2P38 A;  2W04 A;  3S29 A;  3WDG B;  1YJW 3;  1RNB A;  2UGI A;  2QA4 3;  5RNT A;  4FMA A;  4N6T A;  5IEP A;  1RGC A;  2RFR A;  2PZV A;  1JRQ A;  5KP4 A;  1JBS A;  3MG3 A;  1SPU A;  1DYU A;  1W4N A;  1RGA A;  2GSP A;  4HKV B;  2QGU A;  1T5Y A;  2P09 A;  3DUK A;  5IEN A;  3M8C A;  1I3I A;  1SII A;  1YVS A;  2KCD A;  3G6E 3;  1FA3 A;  1OUN A;  3LXU X;  2CFD A;  3QRD A;  1KWI A;  3LH4 A;  2K54 A;  3UL6 A;  3X3Z A;  2ZDJ A;  1VQL 3;  3UL5 A;  1LNH A;  1W6G A;  1BRJ A;  3WMD A;  1R4C A;  2D42 A;  5G1K A;  1K8A 4;  1AR0 A;  3QK9 A;  1B27 A;  3IPT A;  3CCV 3;  2XEP A;  2XSH B;  4FCJ A;  4K1V A;  1VZZ A;  1BNS A;  3B4O A;  1L5G B;  1VQ8 3;  3PYJ A;  1A67 A;  2Z77 A;  3WOD G;  2W6J H;  1I0V A;  1BRS A;  1BSB A;  1RCL A;  2OTL 3;  1MWU A;  1LOW A;  2I9W A;  1TJD A;  3KSE D;  1JN5 A;  1X1U A;  2D1W A;  4HM0 B;  2L1S A;  3PS8 A;  3G71 3;  1W5Z A;  4EW5 A;  1YI2 3;  2IYJ A;  2CIU A;  1UGI A;  1W7C A;  1RN7 A;  1UCK A;  4XM4 A;  1G02 A;  1MGW A;  3EN8 A;  7STD A;  9RNT A;  1GMR A;  3HI7 A;  1BNE A;  4JF8 A;  2RBI A;  5IG0 A;  1GOV A;  1STF I;  1RKY A;  1OPY A;  2H0I A;  3ER7 A;  5ELU A;  3A76 A;  1BGS A;  4R1K A;  3AHS A;  4WYK A;  1BSA A;  1BSD A;  1T2I A;  1IVW A;  1BRK A;  3ZG5 A;  3S28 A;  1FUW A;  4N6O B;  2CW9 A;  4Q53 A;  1LQM B;  1UI8 A;  3BIR A;  2GEX A;  1WQL B;  1IVX A;  2Q07 A;  5CF2 A;  3EX9 A;  1K73 4;  3LTA A;  4FMB A;  1B2S A;  1SQW A;  2C10 A;  2BT3 A;  1ISK A;  1JB2 A;  2F86 B;  3LTD A;  5AIH A;  2XFT A;  4LMI A;  3NM2 A;  2V1L A;  2Y73 A;  2BMO B;  2F98 A;  2W0Q A;  3LML A;  1IQ8 A;  1I8V A;  5BVB A;  3DGN A;  3NV0 A;  1X1W A;  4R9L A;  3BU4 A;  3JUO A;  1FW7 A;  3K9M C;  4WFO A;  3DH2 A;  2Z6B A;  1SIH A;  4OVM A;  1EEJ A;  4HVN A;  4EYC A;  2W56 A;  1ULI B;  1UUW B;  1STD A;  4N6U A;  1PYL A;  3Q3F A;  4HZ9 B;  2IUJ A;  4HYZ A;  3F40 A;  3FSD A;  3ALA A;  5AEU B;  4N6M A;  1HZ1 A;  1LRA A;  3EN1 B;  1EUI C;  4ILF A;  2CWV A;  2CG0 A;  2XRX B;  3LZA A;  5M19 A;  2BNG A;  3HOH A;  3F9S A;  3CCJ 3;  2W9P A;  3KCH A;  1TTO A;  1OHS A;  5I97 A;  3Q90 A;  2IUK A;  1JNQ A;  1MWR A;  3O8Y A;  3NUV A;  5EEO A;  4EBG A;  7RNT A;  2QEX 3;  1I3F A;  1WMO A;  3EE1 A;  3F8H A;  4BTY A;  2L4V A;  4CCV A;  4J5G A;  4X2O A;  3G0K A;  1VQ5 3;  3FG1 A;  4HM3 B;  3WA2 X;  1YVB I;  1R4Y A;  1B2X A;  1OCV A;  1VQO 3;  4L8O A;  4KZ1 A;  2KRT A;  3B7C A;  1O7H B;  3F7S A;  2AAE A;  5GSP A;  1PU4 A;  1RSN A;  1YGW A;  3S5C A;  1FZU A;  1S5A A;  3G8Z A;  1JKG A;  2E2V A;  6GSP A;  1M90 4;  2RGQ A;  1W01 A;  3GZB A;  1O7G B;  2BMR B;  2R4I A;  1Q7H A;  3H51 A;  2C4B A;  1OF5 B;  1RCK A;  1FGQ A;  1Q42 A;  1RLS A;  1BNF A;  2E2T A;  2XH9 A;  2YFL B;  4J8T A;  4STD A;  4J5K A;  5IG5 A;  1JBT A;  4BTW A;  1ROV A;  4XB5 A;  3NM7 A;  2UX0 A;  1EKM A;  2CKF B;  2OCT A;  3DMC A;  3SED A;  3Q1C A;  3FLJ A;  2WGQ A;  1VQK 3;  4RZM A;  3EC9 A;  1RN4 A;  2OOV A;  3UJM A;  1IK3 A;  3SOY A;  3GZX B;  4XDW A;  2XSO B;  1DMM A;  1WMN A;  4BIR A;  1KSI A;  1I2F A;  2H0H A;  4N6V 0;  3EB8 A;  1DVD A;  2MF7 A;  2FXT A;  3DZL A;  3S27 A;  3AMO A;  3B4P A;  4I4K A;  1B3S A;  1N9E A;  3JUQ A;  1FGM A;  1E3V A;  1OH0 A;  3MWZ A;  2OOV C;  1TFK A;  2BIR A;  5ELJ A;  5JPU A;  5D81 A;  3GZY B;  1LOY A;  1MNL A;  2B24 B;  4FR9 A;  3KSP A;  8RNT A;  5D83 A;  1BRG A;  3GSP A;  1YGE A;  3A5E A;  1MWT A;  3RGA A;  3UNL A;  5IG3 A;  1IV7 A;  2HMK B;  2ML5 A;  3FGY A;  1KC8 4;  4H3U A;  3X41 A;  3PZW A;  2F99 A;  3SLU A;  3CME 3;  2BHM A;  4L8P A;  1BVI A;  1FYS A;  5EQL A;  1HU9 A;  3VSY A;  5CLK A;  2O9U X;  4BTX A;  1Q40 B;  1ULJ B;  4FMC A;  1N5P A;  3EF8 A;  1BOX A;  1X1Y A;  4JRF A;  1S72 3;  2P0M A;  1DVC A;  4NRE A;  8CHO A;  3FH1 A;  3OX9 A;  2GEY A;  3FCS B;  2O3O A;  3CD6 3;  1BRN L;  4LGQ A;  1QAL A;  1U8C B;  4WP5 A;  4MJD A;  1UCI A;  3MG2 A;  5AIF A;  1Q7Y 4;  2PNC A;  4HAA A;  1BUJ A;  3L0R A;  3U1W A;  1BNG A;  1RRL A;  1DMQ A;  1M1X B;  4G1M B;  3ECF A;  4GB5 A;  3G16 A;  4O2H A;  2CG1 A;  1BRH A;  1IQY A;  2CH9 A;  1EG9 B;  3EBY A;  1W00 A;  4LYL B;  3DGM A;  4K1U A;  1O7N B;  5BXQ A;  5HOH A;  3J7Y d;  1NB5 I;  1ROA A;  2H0G A;  4N6L A;  3KII A;  4O8S A;  4OK0 A;  4R4K A;  4LSO A;  1MGR A;  1D6Z A;  1GOY A;  3CCU 3;  2CHC A;  4TX4 A;  3X3Y A; 
#chains in the Genus database with same CATH homology
 1RGL A;  2F4Y A;  2HOH A;  3HOH A;  3AGN A;  2F5M A;  1TRP A;  1UCL A;  1BU4 A;  2KF3 A;  3KCH A;  1TTO A;  1FUT A;  1I70 A;  2F5W A;  3D5I A;  1BNR A;  3SYU A;  7RNT A;  1SAR A;  1I3F A;  2BU4 A;  2SAR A;  4BU4 A;  2KAA A;  3URP A;  2RNT A;  4J5G A;  1RGF A;  5BIR A;  1B20 A;  1RNB A;  1R4Y A;  1B2X A;  5RNT A;  1RGC A;  1B21 A;  7GSP A;  1I2E A;  5BU4 A;  5GSP A;  2AAE A;  1RSN A;  1YGW A;  1JBS A;  3AGO A;  1FZU A;  1RGA A;  1RN1 A;  2GSP A;  1TRQ A;  1I2G A;  6GSP A;  1BAO A;  1I3I A;  1YVS A;  1RHL A;  1RTU A;  2C4B A;  1A2P A;  1RCK A;  2KF6 A;  1RLS A;  1BNF A;  3D5G A;  1BRJ A;  4J5K A;  1JBT A;  1BSE A;  1BAN A;  1B27 A;  1GOU A;  1YNV X;  1RN4 A;  1DE3 A;  1DET A;  1BNS A;  4BIR A;  3AHW A;  1I0X A;  1I2F A;  1CH0 A;  1I0V A;  1RMS A;  1BRI A;  1BRS A;  1BSB A;  1RCL A;  1GMP A;  1LOW A;  3DGY A;  2KF5 A;  1B3S A;  1AQZ A;  1X1U A;  1B2U A;  1RGH A;  2BIR A;  1IYY A;  1LOY A;  1B2M A;  8RNT A;  1UCK A;  1BRG A;  3GSP A;  3WHO A;  3A5E A;  2F56 A;  1G02 A;  1MGW A;  9RNT A;  1GMR A;  1BNE A;  4HOH A;  1AY7 A;  1RGK A;  2RBI A;  1GOV A;  4RNT A;  1BVI A;  1FYS A;  1LOV A;  2KF4 A;  1UCJ A;  1BGS A;  3AHS A;  1BSA A;  1BSD A;  1T2I A;  1BRK A;  2AAD A;  1C54 A;  1LNI A;  3BIR A;  1BOX A;  1RDS A;  1X1Y A;  1FUS A;  4GSP A;  1B2S A;  1B2Z A;  1ZGX A;  1BRN L;  1BNI A;  1I8V A;  1RNT A;  1UCI A;  1X1W A;  1X1X A;  3BU4 A;  1JBR A;  1GMQ A;  1FW7 A;  2ZA4 A;  4HAA A;  3DH2 A;  6RNT A;  1BUJ A;  3D4A A;  1BNG A;  1Q9E A;  1BSC A;  1BNJ A;  1HYF A;  1BRH A;  1RGE A;  4GHO A;  3RNT A;  1GSP A;  1BIR A;  1T2H A;  5HOH A;  1PY3 A;  1PYL A;  3Q3F A;  1MGR A;  1GOY A;  1RGG A;  1HZ1 A;  1LRA A;  3WR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...