5BIRA

Disecting histidine interactions in ribonuclease t1 using asn and gln mutations
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
104
structure length
104
Chain Sequence
ACDYTCGSNCYSSSDVSTAQAAGYKLHEDGETVGSNSYPHKYNNYEGFDFSVSSPYYEWPILSSGDVYSGGSPGADRVVFNENNQLAGVITQTGASGNNFVECT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE T1
publication title Dissecting histidine interactions of ribonuclease T1 with asparagine and glutamine replacements: analysis of double mutant cycles at one position.
pubmed doi rcsb
source organism Aspergillus oryzae
molecule tags Endonuclease
total genus 26
structure length 104
sequence length 104
chains with identical sequence B
ec nomenclature ec 3.1.27.3: Ribonuclease T(1).
pdb deposition date 1997-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00545 Ribonuclease ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.30 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Microbial ribonucleases 5birA00
1GMPA 7RNTA 1RGFA 1LOVA 1LOYA 4BU4A 2SARA 1FW7A 2BU4A 1BRIA 1BNFA 1BANA 1RCKA 1B3SA 4GHOA 1GMQA 1BSCA 3WR2A 1CH0A 1TTOA 4J5KA 6RNTA 1SARA 3D4AA 1B2MA 1X1UA 1FUTA 1DETA 3D5GA 2GSPA 1HZ1A 1I3FA 5HOHA 1BVIA 1YNVX 1BU4A 1B20A 3AGNA 1TRQA 3BU4A 1B2SA 1BSEA 2KAAA 1RGAA 1LOWA 2KF4A 2RBIA 1FYSA 1BNGA 3SYUA 1RGGA 9RNTA 1AQZA 1RGHA 1ZGXA 1BGSA 1B21A 1JBRA 1BOXA 1X1YA 1GSPA 1UCLA 1BRKA 1I70A 4HOHA 1UCKA 2AAEA 3D5IA 1BNJA 5BU4A 1RNBA 1BNIA 1Q9EA 1RNTA 1BNRA 1BRGA 1RTUA 1I0VA 6GSPA 1GOYA 1UCIA 2KF3A 2HOHA 5RNTA 1BRNL 1JBTA 1RGCA 4BIRA 3AHWA 3DH2A 1RGEA 3BIRA 1BSAA 1B2UA 1BRHA 1BNEA 1RGLA 3HOHA 3KCHA 1MGWA 5GSPA 4RNTA 1IYYA 2AADA 2F4YA 1BAOA 3AHSA 1I0XA 1BSDA 3WHOA 1RSNA 1BRSA 1X1XA 1I8VA 1A2PA 1GMRA 1RN1A 1UCJA 2F5WA 3RNTA 1R4YA 1PY3A 1B2XA 1FUSA 1AY7A 1B2ZA 1T2HA 1T2IA 4GSPA 1JBSA 1I2EA 1DE3A 1TRPA 1RMSA 1GOVA 3AGOA 1RN4A 1YGWA 8RNTA 1BRJA 1LNIA 3A5EA 1I2GA 2F5MA 1B27A 1YVSA 1MGRA 2KF5A 3URPA 1RDSA 1G02A 1C54A 1BSBA 1BNSA 1PYLA 1I3IA 1RHLA 1HYFA 5BIRA 3Q3FA 4J5GA 1RGKA 2C4BA 4HAAA 1RLSA 1I2FA 1LRAA 2ZA4A 1GOUA 2F56A 3GSPA 3DGYA 7GSPA 2BIRA 1BUJA 1X1WA 1BIRA 2RNTA 2KF6A 1FZUA 1RCLA
chains in the Genus database with same CATH superfamily
2QEX3 3FF2A 1IQ8A 1YI23 1RGFA 1W00A 1JB5A 1LOVA 1VZZA 2XSHB 2L1SA 3NUVA 1CYUA 1MWSA 2CX0A 1DMQA 1BANA 4GHOA 1GMQA 3Q2PA 4LGQA 4NREA 1BSCA 2Y73A 1TP6A 1F8NA 3QK9A 1JKGA 2IUKA 4BL2A 3X41A 3I553 1WQLB 3FF0A 1YGEA 2PZVA 1Q864 5AIIA 1HZ1A 4RZMA 3U97A 1I3FA 5HOHA 3DGOA 1QJGA 1WMNA 2YFIB 1VQ53 2P38A 4KFFA 3OXAA 3MPHA 1MWUA 2JDIH 2STDA 2W2CA 4HKVB 4N6V0 1WMPA 1UUGB 2JQ5A 3NM2A 1FUWA 3D3LA 3MKIA 4KFDA 1O7NB 1ZGXA 2W6JH 3KN4A 1IV7A 3MSOA 4KZ1A 1X1YA 5JPUA 1AV4A 3WDGB 2O9UX 2E2UA 1UCLA 1K41A 1LXEA 1I70A 4HOHA 1UCKA 4TX4A 1UI7A 4PEJA 2R41A 1M1XB 3UL5A 1IDPA 1JZDA 1WMOA 3ER7A 3BNCA 2P09A 2XSOB 4OUQA 2WOHA 1W6CA 1GD4A 2KF3A 5JPPA 3CD63 1L5GB 3T8UA 3WA3A 2IY2A 3FZWA 2OCTA 5BVBA 1JN5A 3WOEB 1Q824 3BIRA 1OUNA 1BNEA 1BRHA 1B2UA 3HOHA 3LTCA 3KCHA 1OPYA 4R4KA 3BNDA 3CU3A 4HM3B 2OTJ3 1BAOA 1I0XA 3LYGA 3NM7A 3NBRA 5AIHA 1KWIA 1BRSA 3ROBA 2CG1A 3NV0A 3HZPA 2RCDA 4FMBA 1UCJA 5G1LA 1Q7Y4 2CWUA 2ZHXB 3SLUA 3NQYA 3PCRA 3V99A 1MWTA 1ZO2A 3S5CA 1B2XA 3NHXA 1FUSA 1AY7A 1GY7A 1T2HA 4GSPA 5M18A 4R9KA 3J7Yd 3T0UA 3CNXA 1PU4A 3V98A 1A90A 4XM4A 5LC6A 1RN4A 3VF1A 8CHOA 3UNLA 2SBLA 5D83A 1YGWA 1VQP3 8RNTA 3LTDA 2BMOB 5FW5A 6STDA 1MOLA 1SQWA 3BNEA 2D42A 1I2GA 3MG3A 3KSED 3SEDA 1ULJB 5DREA 3FG4A 3KE7A 2KCDA 3K5TA 1TU5A 1OACA 2KF5A 1RDSA 4Q53A 3CCQ3 2GEYA 3LOYA 1R4CA 3BNBA 3LZAA 3GWRA 1IVUA 1BNSA 3ZG5A 5BXQA 1STFI 1HYFA 1IQXA 2HMJB 4NHFA 5BIRA 2BT3A 4AEQA 3EBYA 3F14A 1S5AA 1FGRA 5STDA 2C4BA 4HAAA 1RLSA 1TFKA 1I2FA 2K0MA 4HYZA 1QAFA 4IIAA 4AKYA 3CC23 1GOUA 4GB5A 1T3BA 1LOXA 3EBTA 2W9QA 3UL6A 3WOFB 5DRVA 4DKIA 2BIRA 4STDA 1A67A 1BUJA 1X1WA 2BNGA 2RNTA 3NXJA 2KF6A 2W03A 4FMAA 1VQ83 1W4NA 3GZXB 4G1MB 3S28A 3X3XA 1RCLA 4O3VA 1LQMB 7RNTA 1LOYA 1TFOA 1Q7HA 4EW5A 5IG5A 1RCKA 1YJ93 2OQEC 2RFRA 3B8LA 1CH0A 1TTOA 4FCJA 5M1AA 3FG1A 3CME3 3Q1CA 4HZ9B 1AVLA 5CK6A 3Q90A 1FUTA 1DETA 4H3UA 4MMZB 1RJOA 3H3HA 4HZBB 3HK4A 1IK3A 4O02B 4L7KA 1RRHA 3D9RA 1CQSA 2F99A 3RGAA 1IQYA 4GL6A 4O8SA 1N9JA 2CX1A 5ELUA 2CWVA 4O2HA 4EBGA 1YJW3 2CFWA 5AI1A 1JZOA 4WHAA 1RGAA 1LOWA 2KF4A 2RBIA 3SYUA 3GAXA 5AYSC 3NV0B 1VQ93 1JBRA 3M8CA 3JUPA 5I97A 4BL3A 3G16A 4ZM8A 1N8R4 2XFTA 3D5IA 5BU4A 5CF2A 1Y4KA 1RNBA 1JB2A 1RN7A 3SX1A 3FCSB 4EYCA 3BLZA 4FR9A 1BRGA 3E99A 2OOVA 3X42A 5JBSA 1OCVA 1RTUA 2RSXA 3CMA3 3FG3A 1GOYA 2XRXB 2HOHA 4CDLA 3PCSA 1BRNL 2F86B 3JUMA 2GBWB 3DH2A 2BHMA 1EEJA 1ASKA 1MGWA 3DMCA 4LSOA 1YIT3 5A0OB 2F4YA 4EXRA 1HKXA 1BSDA 3FKAA 4R9LA 1ULIB 1S723 1VQ43 1DVDA 1X1XA 2FXTA 4HBRA 2HMNB 5AIFA 2F5WA 3RNTA 4KVHA 1N8QA 1NWWA 3UB1A 2K54A 1R4YA 4LMIA 1OHPA 1WTHA 4R80A 4K1VA 3SVAA 1PY3A 3CC43 1YVBI 3DUKA 1DMMA 1AVKA 1NDOB 4OVMA 1GOVA 4N6MA 1M1K4 2XGLA 4HVNA 4N3VA 2Z7AA 3QRDA 1BRJA 3I563 2BO9B 4K90B 3B7CA 2CFGA 3HIGA 1SJWA 2XFSA 4KFEA 2HMKB 2F5MA 4WP5A 5EVHA 7STDA 3EX9A 1J2BA 1B27A 2E2VA 4KT3B 2W04A 3OX9A 3MHEA 2XR8B 1VQO3 2ZL8A 4N6OB 1G02A 1SIIA 3L0RA 2CIUA 1N5PA 3CCR3 1A2KA 4FCZA 1W7CA 1C54A 3LMLA 4N6TA 4EC6A 2C11A 4AKZA 2CFKA 1UW1A 2P05A 2YFJB 3FGYA 1O7PB 2OWPA 3NBBA 3NBJA 3Q3FA 3MYTA 1RGKA 2MC8A 2B24B 2CK3H 5ELJA 2QA43 1LRAA 2ZA4A 2F56A 3KFQC 3EC9A 2I9WA 3DGYA 4HM2B 3S67A 2HMMB 5CF1A 1FZUA 1ROVA 2P0MA 3JUNA 3K7CA 3RGRA 2GU3A 4WFOA 2H0IA 5IEOA 2SARA 3IMAB 4R1KA 1FW7A 2CFDA 1EA2A 1BRIA 2CC3A 3EN1B 3MG2A 3VGNA 1NJI4 2Z76A 1V74A 4N6UA 2WGQA 3I0YA 1MWRA 3V92A 4N6LA 4I4KA 1IT8A 3F40A 5IG4A 1B2MA 3T8NA 3D5GA 3F9SA 1K9M4 1TUHA 3HX8A 3JUOA 2GSPA 1QMAA 1A2VA 1OHSA 2A15A 1UUVB 1B20A 3AGNA 3AMOA 3NQZA 1TRQA 4WWUC 5IERA 2W56B 1LVNA 1Z1SA 1B2SA 1JV2B 3DY5A 3K9MC 1VQN3 2FNQA 1BNGA 4RNYA 1TJDA 3DXOA 1RGGA 2IMJA 4HM0B 1AQZA 1O7GB 1RGHA 2W0QA 1B21A 2WO0A 2D1WA 1BOXA 3OWUA 4EV2A 1GSPA 3MWZA 2R4IA 1Q814 1W01A 2ZDJA 5IG3A 2OTL3 5CLKA 5G2GA 3STDA 2KXGA 3CCJ3 1NB5I 5IENA 2ML5A 4HJLB 1GY5A 4I5QA 2QGUA 1Q9EA 1TIJA 3KSPA 1E97A 3CCV3 1G0TA 2W9PA 1I0VA 3PS8A 2KRTA 4HM1B 1IT7A 1UCIA 3EQQB 1UGHI 3LXUX 3U1WA 5RNTA 1JBTA 4BIRA 1NO3A 3AHWA 2H0HA 4XDVA 2IUJA 2UGIA 1WNHA 1BSAA 3LH4A 2CKFB 5GSPA 2UUGC 5AEUB 4XB5A 1IYYA 2AADA 2OOVC 3MG1A 4HM8B 3WHOA 5FGOA 1RSNA 4LYLB 1GMRA 1IV9A 2GEXA 3LT9A 4XBXA 1Q42A 1BUQA 3EN8A 1UI8A 3JUQA 3TDGA 5IEPA 4RBNA 3LTBA 1T2IA 1B2ZA 3F7SA 3F7XA 3H51A 1QVF2 3CCS3 3PGBA 1MNLA 1FA3A 1IU7A 4HM4B 1NNVA 1SPUA 3UJMA 1ZS7A 1DVCA 1U8CB 4LEHA 2CW9A 1FGTA 2Z77A 3CCE3 1CYVA 2W56A 3F8XA 1D6YA 3ALAA 1GYBA 3ECFA 3EF8A 4NPBA 4WYKA 5M19A 5KP4A 3CPOA 5KP3A 3CCM3 1W5ZA 1BSBA 1K734 3DGMA 2GU1A 4CJNA 3DGNA 1KC84 3IPTA 1VQQA 3A76A 1CEWI 1W6GA 1UGIA 1D6UA 2XGNA 5AYRB 1KQS2 1HU9A 4MJDA 2O3OA 3AMOB 3GSPA 3K63A 4BTWA 1KD14 1W2ZA 1EUIC 3OW22 1U5OA 4EV5A 2L4VA 2CG0A 1OGXA 3GZYB 1NU3A 1BIRA 3GRDA 3CCL3 1US1A 1QAKA 4MMXB 2XH9A 3BB9A 2INXA 1OF5A 1QVG2 1FGQA 1STDA 1GMPA 2IA7A 4K1UA 4BU4A 2BU4A 2CHCA 3O8YA 1O7HB 1BNFA 3K0ZA 4ORLA 5IF6A 3IJEB 1W2B2 1B3SA 1M9GA 3N9HA 1UDII 3F8HA 3WR2A 5KP1A 6RNTA 4J5KA 1ISKA 1VQ73 1N5HA 1SARA 3D4AA 1C7HA 2Z6BA 4BTYA 1X1UA 3X3YA 2B1XB 1EQKA 5CXOA 4BTXA 2GBXB 2P0XA 3ZG0A 3DM8A 1RKYA 1O7WB 1BVIA 3G0KA 4HM6B 1YNVX 3CPW2 1IVXA 1V58A 1BU4A 3KKGA 3OWSA 1JJ22 2F98A 2GXFA 2MF7A 4J9AA 1DYUA 1SIHA 1ZX2A 1FGMA 3HI7A 3BU4A 4L8PA 2LYXA 2KAAA 1BSEA 1UUWB 4H61A 1IVWA 2CH9A 5EEOA 1FYSA 3SOYA 3D79A 1NB3I 2PNCA 1JNQA 3JVCA 5LC7A 9RNTA 1OHOA 1Q40B 2C10A 1BGSA 5IW9A 3EJVA 2XEPA 4JF8A 2HMOB 2BMRB 2LQVA 1W6YA 2WGOA 1FGOA 2V1LA 3EHCA 1BRKA 3S29A 3OV4A 1ROAA 1E3VA 4IPBA 2AAEA 1BNJA 1YIJ3 4CPKA 4FMDA 3X3ZA 1IVVA 1BNIA 3DGLA 1YHQ3 1RNTA 2M7OA 2WOFA 1BNRA 1VQ63 4HM5B 1E3RA 4FCMA 5D82A 1K8A4 4U13A 6GSPA 3FH1A 3WMDA 1OH0A 1JRQA 1QALA 3EB8A 4LZIA 3GZRA 3PXMA 5G1KA 1RGCA 5AEWB 1OGZA 1K28A 1RGEA 1RGLA 3RDEA 1YJN3 4WYKB 3FLJA 1D6ZA 1GY6A 4RNTA 4HM7B 5IG0A 3AHSA 5AIGA 3VSYA 2QIYA 3DZLA 4XDWA 2RGQA 1LQGC 3CNMA 1I8VA 3HIIA 4QWTA 1A2PA 1VQK3 1JKGB 3SXXA 1RN1A 4OK0A 1W02A 3CC73 2H0GA 3B4PA 3WODG 2CFLA 3LT8A 4XBYA 3G4S3 3FSDA 4J8TA 4MEIA 1JBSA 1I2EA 1GS3A 2CWTA 2J8XB 3KZTA 1DE3A 1TRPA 1JB4A 1RMSA 3CCU3 1KSIA 3AGOA 2XF3A 1VQM3 1DMNA 1N9EA 3G8ZA 3LTAA 1OF5B 2ML6A 4L8OA 1LNIA 3KIIA 4IT7A 5D81A 1O7MB 3A5EA 4FMCA 3S27A 3CXC2 1YVSA 5TGNA 1MGRA 2K3DA 2YFLB 2YX9A 3OWYA 3PZWA 3SOAA 3URPA 1T5YA 2BMQB 3N54B 4K61A 3EE1A 3X40A 2HMLB 4CCVA 1Q40A 4MMYB 1PYLA 1I3IA 4XBTA 3N8BA 5HGRA 1RHLA 3G6E3 1G96A 4X2HA 1M904 3G713 2Q07A 2IYJA 4J5GA 5EQLA 1RRLA 1V57A 2Y74A 4X2OA 3B4OA 2UX0A 4RNZA 1JN5B 4ILFA 4JRFA 2E2TA 4N6NB 7GSPA 1LNHA 1AR0A 3NX0A 1VQL3 3GZBA 2OQEA 1PFPA 2FGTA 1EG9B 3PYJA 1GD3A 3ZFZA 3WA2X 1EKMA
chains in the Genus database with same CATH topology
1GMPA 7RNTA 1RGFA 1LOVA 1LOYA 4BU4A 2SARA 1FW7A 2BU4A 1BRIA 1BNFA 1BANA 1RCKA 1B3SA 4GHOA 1GMQA 1BSCA 3WR2A 1CH0A 1TTOA 4J5KA 6RNTA 1SARA 3D4AA 1B2MA 1X1UA 1FUTA 1DETA 3D5GA 2GSPA 1HZ1A 1I3FA 5HOHA 1BVIA 1YNVX 1BU4A 1B20A 3AGNA 1TRQA 3BU4A 1B2SA 1BSEA 2KAAA 1RGAA 1LOWA 2KF4A 2RBIA 1FYSA 1BNGA 3SYUA 1RGGA 9RNTA 1AQZA 1RGHA 1ZGXA 1BGSA 1B21A 1JBRA 1BOXA 1X1YA 1GSPA 1UCLA 1BRKA 1I70A 4HOHA 1UCKA 2AAEA 3D5IA 1BNJA 5BU4A 1RNBA 1BNIA 1Q9EA 1RNTA 1BNRA 1BRGA 1RTUA 1I0VA 6GSPA 1GOYA 1UCIA 2KF3A 2HOHA 5RNTA 1BRNL 1JBTA 1RGCA 4BIRA 3AHWA 3DH2A 1RGEA 3BIRA 1BSAA 1B2UA 1BRHA 1BNEA 1RGLA 3HOHA 3KCHA 1MGWA 5GSPA 4RNTA 1IYYA 2AADA 2F4YA 1BAOA 3AHSA 1I0XA 1BSDA 3WHOA 1RSNA 1BRSA 1X1XA 1I8VA 1A2PA 1GMRA 1RN1A 1UCJA 2F5WA 3RNTA 1R4YA 1PY3A 1B2XA 1FUSA 1AY7A 1B2ZA 1T2HA 1T2IA 4GSPA 1JBSA 1I2EA 1DE3A 1TRPA 1RMSA 1GOVA 3AGOA 1RN4A 1YGWA 8RNTA 1BRJA 1LNIA 3A5EA 1I2GA 2F5MA 1B27A 1YVSA 1MGRA 2KF5A 3URPA 1RDSA 1G02A 1C54A 1BSBA 1BNSA 1PYLA 1I3IA 1RHLA 1HYFA 5BIRA 3Q3FA 4J5GA 1RGKA 2C4BA 4HAAA 1RLSA 1I2FA 1LRAA 2ZA4A 1GOUA 2F56A 3GSPA 3DGYA 7GSPA 2BIRA 1BUJA 1X1WA 1BIRA 2RNTA 2KF6A 1FZUA 1RCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GMP A;  7RNT A;  1RGF A;  1LOV A;  1LOY A;  4BU4 A;  2SAR A;  1FW7 A;  2BU4 A;  1BRI A;  1BNF A;  1BAN A;  1RCK A;  1B3S A;  4GHO A;  1GMQ A;  1BSC A;  3WR2 A;  1CH0 A;  1TTO A;  4J5K A;  6RNT A;  1SAR A;  3D4A A;  1B2M A;  1X1U A;  1FUT A;  1DET A;  3D5G A;  2GSP A;  1HZ1 A;  1I3F A;  5HOH A;  1BVI A;  1YNV X;  1BU4 A;  1B20 A;  3AGN A;  1TRQ A;  3BU4 A;  1B2S A;  1BSE A;  2KAA A;  1RGA A;  1LOW A;  2KF4 A;  2RBI A;  1FYS A;  1BNG A;  3SYU A;  1RGG A;  9RNT A;  1AQZ A;  1RGH A;  1ZGX A;  1BGS A;  1B21 A;  1JBR A;  1BOX A;  1X1Y A;  1GSP A;  1UCL A;  1BRK A;  1I70 A;  4HOH A;  1UCK A;  2AAE A;  3D5I A;  1BNJ A;  5BU4 A;  1RNB A;  1BNI A;  1Q9E A;  1RNT A;  1BNR A;  1BRG A;  1RTU A;  1I0V A;  6GSP A;  1GOY A;  1UCI A;  2KF3 A;  2HOH A;  5RNT A;  1BRN L;  1JBT A;  1RGC A;  4BIR A;  3AHW A;  3DH2 A;  1RGE A;  3BIR A;  1BSA A;  1B2U A;  1BRH A;  1BNE A;  1RGL A;  3HOH A;  3KCH A;  1MGW A;  5GSP A;  4RNT A;  1IYY A;  2AAD A;  2F4Y A;  1BAO A;  3AHS A;  1I0X A;  1BSD A;  3WHO A;  1RSN A;  1BRS A;  1X1X A;  1I8V A;  1A2P A;  1GMR A;  1RN1 A;  1UCJ A;  2F5W A;  3RNT A;  1R4Y A;  1PY3 A;  1B2X A;  1FUS A;  1AY7 A;  1B2Z A;  1T2H A;  1T2I A;  4GSP A;  1JBS A;  1I2E A;  1DE3 A;  1TRP A;  1RMS A;  1GOV A;  3AGO A;  1RN4 A;  1YGW A;  8RNT A;  1BRJ A;  1LNI A;  3A5E A;  1I2G A;  2F5M A;  1B27 A;  1YVS A;  1MGR A;  2KF5 A;  3URP A;  1RDS A;  1G02 A;  1C54 A;  1BSB A;  1BNS A;  1PYL A;  1I3I A;  1RHL A;  1HYF A;  5BIR A;  3Q3F A;  4J5G A;  1RGK A;  2C4B A;  4HAA A;  1RLS A;  1I2F A;  1LRA A;  2ZA4 A;  1GOU A;  2F56 A;  3GSP A;  3DGY A;  7GSP A;  2BIR A;  1BUJ A;  1X1W A;  1BIR A;  2RNT A;  2KF6 A;  1FZU A;  1RCL A; 
#chains in the Genus database with same CATH topology
 2QEX 3;  3FF2 A;  1IQ8 A;  1YI2 3;  1RGF A;  1W00 A;  1JB5 A;  1LOV A;  1VZZ A;  2XSH B;  2L1S A;  3NUV A;  1CYU A;  1MWS A;  2CX0 A;  1DMQ A;  1BAN A;  4GHO A;  1GMQ A;  3Q2P A;  4LGQ A;  4NRE A;  1BSC A;  2Y73 A;  1TP6 A;  1F8N A;  3QK9 A;  1JKG A;  2IUK A;  4BL2 A;  3X41 A;  3I55 3;  1WQL B;  3FF0 A;  1YGE A;  2PZV A;  1Q86 4;  5AII A;  1HZ1 A;  4RZM A;  3U97 A;  1I3F A;  5HOH A;  3DGO A;  1QJG A;  1WMN A;  2YFI B;  1VQ5 3;  2P38 A;  4KFF A;  3OXA A;  3MPH A;  1MWU A;  2JDI H;  2STD A;  2W2C A;  4HKV B;  4N6V 0;  1WMP A;  1UUG B;  2JQ5 A;  3NM2 A;  1FUW A;  3D3L A;  3MKI A;  4KFD A;  1O7N B;  1ZGX A;  2W6J H;  3KN4 A;  1IV7 A;  3MSO A;  4KZ1 A;  1X1Y A;  5JPU A;  1AV4 A;  3WDG B;  2O9U X;  2E2U A;  1UCL A;  1K41 A;  1LXE A;  1I70 A;  4HOH A;  1UCK A;  4TX4 A;  1UI7 A;  4PEJ A;  2R41 A;  1M1X B;  3UL5 A;  1IDP A;  1JZD A;  1WMO A;  3ER7 A;  3BNC A;  2P09 A;  2XSO B;  4OUQ A;  2WOH A;  1W6C A;  1GD4 A;  2KF3 A;  5JPP A;  3CD6 3;  1L5G B;  3T8U A;  3WA3 A;  2IY2 A;  3FZW A;  2OCT A;  5BVB A;  1JN5 A;  3WOE B;  1Q82 4;  3BIR A;  1OUN A;  1BNE A;  1BRH A;  1B2U A;  3HOH A;  3LTC A;  3KCH A;  1OPY A;  4R4K A;  3BND A;  3CU3 A;  4HM3 B;  2OTJ 3;  1BAO A;  1I0X A;  3LYG A;  3NM7 A;  3NBR A;  5AIH A;  1KWI A;  1BRS A;  3ROB A;  2CG1 A;  3NV0 A;  3HZP A;  2RCD A;  4FMB A;  1UCJ A;  5G1L A;  1Q7Y 4;  2CWU A;  2ZHX B;  3SLU A;  3NQY A;  3PCR A;  3V99 A;  1MWT A;  1ZO2 A;  3S5C A;  1B2X A;  3NHX A;  1FUS A;  1AY7 A;  1GY7 A;  1T2H A;  4GSP A;  5M18 A;  4R9K A;  3J7Y d;  3T0U A;  3CNX A;  1PU4 A;  3V98 A;  1A90 A;  4XM4 A;  5LC6 A;  1RN4 A;  3VF1 A;  8CHO A;  3UNL A;  2SBL A;  5D83 A;  1YGW A;  1VQP 3;  8RNT A;  3LTD A;  2BMO B;  5FW5 A;  6STD A;  1MOL A;  1SQW A;  3BNE A;  2D42 A;  1I2G A;  3MG3 A;  3KSE D;  3SED A;  1ULJ B;  5DRE A;  3FG4 A;  3KE7 A;  2KCD A;  3K5T A;  1TU5 A;  1OAC A;  2KF5 A;  1RDS A;  4Q53 A;  3CCQ 3;  2GEY A;  3LOY A;  1R4C A;  3BNB A;  3LZA A;  3GWR A;  1IVU A;  1BNS A;  3ZG5 A;  5BXQ A;  1STF I;  1HYF A;  1IQX A;  2HMJ B;  4NHF A;  5BIR A;  2BT3 A;  4AEQ A;  3EBY A;  3F14 A;  1S5A A;  1FGR A;  5STD A;  2C4B A;  4HAA A;  1RLS A;  1TFK A;  1I2F A;  2K0M A;  4HYZ A;  1QAF A;  4IIA A;  4AKY A;  3CC2 3;  1GOU A;  4GB5 A;  1T3B A;  1LOX A;  3EBT A;  2W9Q A;  3UL6 A;  3WOF B;  5DRV A;  4DKI A;  2BIR A;  4STD A;  1A67 A;  1BUJ A;  1X1W A;  2BNG A;  2RNT A;  3NXJ A;  2KF6 A;  2W03 A;  4FMA A;  1VQ8 3;  1W4N A;  3GZX B;  4G1M B;  3S28 A;  3X3X A;  1RCL A;  4O3V A;  1LQM B;  7RNT A;  1LOY A;  1TFO A;  1Q7H A;  4EW5 A;  5IG5 A;  1RCK A;  1YJ9 3;  2OQE C;  2RFR A;  3B8L A;  1CH0 A;  1TTO A;  4FCJ A;  5M1A A;  3FG1 A;  3CME 3;  3Q1C A;  4HZ9 B;  1AVL A;  5CK6 A;  3Q90 A;  1FUT A;  1DET A;  4H3U A;  4MMZ B;  1RJO A;  3H3H A;  4HZB B;  3HK4 A;  1IK3 A;  4O02 B;  4L7K A;  1RRH A;  3D9R A;  1CQS A;  2F99 A;  3RGA A;  1IQY A;  4GL6 A;  4O8S A;  1N9J A;  2CX1 A;  5ELU A;  2CWV A;  4O2H A;  4EBG A;  1YJW 3;  2CFW A;  5AI1 A;  1JZO A;  4WHA A;  1RGA A;  1LOW A;  2KF4 A;  2RBI A;  3SYU A;  3GAX A;  5AYS C;  3NV0 B;  1VQ9 3;  1JBR A;  3M8C A;  3JUP A;  5I97 A;  4BL3 A;  3G16 A;  4ZM8 A;  1N8R 4;  2XFT A;  3D5I A;  5BU4 A;  5CF2 A;  1Y4K A;  1RNB A;  1JB2 A;  1RN7 A;  3SX1 A;  3FCS B;  4EYC A;  3BLZ A;  4FR9 A;  1BRG A;  3E99 A;  2OOV A;  3X42 A;  5JBS A;  1OCV A;  1RTU A;  2RSX A;  3CMA 3;  3FG3 A;  1GOY A;  2XRX B;  2HOH A;  4CDL A;  3PCS A;  1BRN L;  2F86 B;  3JUM A;  2GBW B;  3DH2 A;  2BHM A;  1EEJ A;  1ASK A;  1MGW A;  3DMC A;  4LSO A;  1YIT 3;  5A0O B;  2F4Y A;  4EXR A;  1HKX A;  1BSD A;  3FKA A;  4R9L A;  1ULI B;  1S72 3;  1VQ4 3;  1DVD A;  1X1X A;  2FXT A;  4HBR A;  2HMN B;  5AIF A;  2F5W A;  3RNT A;  4KVH A;  1N8Q A;  1NWW A;  3UB1 A;  2K54 A;  1R4Y A;  4LMI A;  1OHP A;  1WTH A;  4R80 A;  4K1V A;  3SVA A;  1PY3 A;  3CC4 3;  1YVB I;  3DUK A;  1DMM A;  1AVK A;  1NDO B;  4OVM A;  1GOV A;  4N6M A;  1M1K 4;  2XGL A;  4HVN A;  4N3V A;  2Z7A A;  3QRD A;  1BRJ A;  3I56 3;  2BO9 B;  4K90 B;  3B7C A;  2CFG A;  3HIG A;  1SJW A;  2XFS A;  4KFE A;  2HMK B;  2F5M A;  4WP5 A;  5EVH A;  7STD A;  3EX9 A;  1J2B A;  1B27 A;  2E2V A;  4KT3 B;  2W04 A;  3OX9 A;  3MHE A;  2XR8 B;  1VQO 3;  2ZL8 A;  4N6O B;  1G02 A;  1SII A;  3L0R A;  2CIU A;  1N5P A;  3CCR 3;  1A2K A;  4FCZ A;  1W7C A;  1C54 A;  3LML A;  4N6T A;  4EC6 A;  2C11 A;  4AKZ A;  2CFK A;  1UW1 A;  2P05 A;  2YFJ B;  3FGY A;  1O7P B;  2OWP A;  3NBB A;  3NBJ A;  3Q3F A;  3MYT A;  1RGK A;  2MC8 A;  2B24 B;  2CK3 H;  5ELJ A;  2QA4 3;  1LRA A;  2ZA4 A;  2F56 A;  3KFQ C;  3EC9 A;  2I9W A;  3DGY A;  4HM2 B;  3S67 A;  2HMM B;  5CF1 A;  1FZU A;  1ROV A;  2P0M A;  3JUN A;  3K7C A;  3RGR A;  2GU3 A;  4WFO A;  2H0I A;  5IEO A;  2SAR A;  3IMA B;  4R1K A;  1FW7 A;  2CFD A;  1EA2 A;  1BRI A;  2CC3 A;  3EN1 B;  3MG2 A;  3VGN A;  1NJI 4;  2Z76 A;  1V74 A;  4N6U A;  2WGQ A;  3I0Y A;  1MWR A;  3V92 A;  4N6L A;  4I4K A;  1IT8 A;  3F40 A;  5IG4 A;  1B2M A;  3T8N A;  3D5G A;  3F9S A;  1K9M 4;  1TUH A;  3HX8 A;  3JUO A;  2GSP A;  1QMA A;  1A2V A;  1OHS A;  2A15 A;  1UUV B;  1B20 A;  3AGN A;  3AMO A;  3NQZ A;  1TRQ A;  4WWU C;  5IER A;  2W56 B;  1LVN A;  1Z1S A;  1B2S A;  1JV2 B;  3DY5 A;  3K9M C;  1VQN 3;  2FNQ A;  1BNG A;  4RNY A;  1TJD A;  3DXO A;  1RGG A;  2IMJ A;  4HM0 B;  1AQZ A;  1O7G B;  1RGH A;  2W0Q A;  1B21 A;  2WO0 A;  2D1W A;  1BOX A;  3OWU A;  4EV2 A;  1GSP A;  3MWZ A;  2R4I A;  1Q81 4;  1W01 A;  2ZDJ A;  5IG3 A;  2OTL 3;  5CLK A;  5G2G A;  3STD A;  2KXG A;  3CCJ 3;  1NB5 I;  5IEN A;  2ML5 A;  4HJL B;  1GY5 A;  4I5Q A;  2QGU A;  1Q9E A;  1TIJ A;  3KSP A;  1E97 A;  3CCV 3;  1G0T A;  2W9P A;  1I0V A;  3PS8 A;  2KRT A;  4HM1 B;  1IT7 A;  1UCI A;  3EQQ B;  1UGH I;  3LXU X;  3U1W A;  5RNT A;  1JBT A;  4BIR A;  1NO3 A;  3AHW A;  2H0H A;  4XDV A;  2IUJ A;  2UGI A;  1WNH A;  1BSA A;  3LH4 A;  2CKF B;  5GSP A;  2UUG C;  5AEU B;  4XB5 A;  1IYY A;  2AAD A;  2OOV C;  3MG1 A;  4HM8 B;  3WHO A;  5FGO A;  1RSN A;  4LYL B;  1GMR A;  1IV9 A;  2GEX A;  3LT9 A;  4XBX A;  1Q42 A;  1BUQ A;  3EN8 A;  1UI8 A;  3JUQ A;  3TDG A;  5IEP A;  4RBN A;  3LTB A;  1T2I A;  1B2Z A;  3F7S A;  3F7X A;  3H51 A;  1QVF 2;  3CCS 3;  3PGB A;  1MNL A;  1FA3 A;  1IU7 A;  4HM4 B;  1NNV A;  1SPU A;  3UJM A;  1ZS7 A;  1DVC A;  1U8C B;  4LEH A;  2CW9 A;  1FGT A;  2Z77 A;  3CCE 3;  1CYV A;  2W56 A;  3F8X A;  1D6Y A;  3ALA A;  1GYB A;  3ECF A;  3EF8 A;  4NPB A;  4WYK A;  5M19 A;  5KP4 A;  3CPO A;  5KP3 A;  3CCM 3;  1W5Z A;  1BSB A;  1K73 4;  3DGM A;  2GU1 A;  4CJN A;  3DGN A;  1KC8 4;  3IPT A;  1VQQ A;  3A76 A;  1CEW I;  1W6G A;  1UGI A;  1D6U A;  2XGN A;  5AYR B;  1KQS 2;  1HU9 A;  4MJD A;  2O3O A;  3AMO B;  3GSP A;  3K63 A;  4BTW A;  1KD1 4;  1W2Z A;  1EUI C;  3OW2 2;  1U5O A;  4EV5 A;  2L4V A;  2CG0 A;  1OGX A;  3GZY B;  1NU3 A;  1BIR A;  3GRD A;  3CCL 3;  1US1 A;  1QAK A;  4MMX B;  2XH9 A;  3BB9 A;  2INX A;  1OF5 A;  1QVG 2;  1FGQ A;  1STD A;  1GMP A;  2IA7 A;  4K1U A;  4BU4 A;  2BU4 A;  2CHC A;  3O8Y A;  1O7H B;  1BNF A;  3K0Z A;  4ORL A;  5IF6 A;  3IJE B;  1W2B 2;  1B3S A;  1M9G A;  3N9H A;  1UDI I;  3F8H A;  3WR2 A;  5KP1 A;  6RNT A;  4J5K A;  1ISK A;  1VQ7 3;  1N5H A;  1SAR A;  3D4A A;  1C7H A;  2Z6B A;  4BTY A;  1X1U A;  3X3Y A;  2B1X B;  1EQK A;  5CXO A;  4BTX A;  2GBX B;  2P0X A;  3ZG0 A;  3DM8 A;  1RKY A;  1O7W B;  1BVI A;  3G0K A;  4HM6 B;  1YNV X;  3CPW 2;  1IVX A;  1V58 A;  1BU4 A;  3KKG A;  3OWS A;  1JJ2 2;  2F98 A;  2GXF A;  2MF7 A;  4J9A A;  1DYU A;  1SIH A;  1ZX2 A;  1FGM A;  3HI7 A;  3BU4 A;  4L8P A;  2LYX A;  2KAA A;  1BSE A;  1UUW B;  4H61 A;  1IVW A;  2CH9 A;  5EEO A;  1FYS A;  3SOY A;  3D79 A;  1NB3 I;  2PNC A;  1JNQ A;  3JVC A;  5LC7 A;  9RNT A;  1OHO A;  1Q40 B;  2C10 A;  1BGS A;  5IW9 A;  3EJV A;  2XEP A;  4JF8 A;  2HMO B;  2BMR B;  2LQV A;  1W6Y A;  2WGO A;  1FGO A;  2V1L A;  3EHC A;  1BRK A;  3S29 A;  3OV4 A;  1ROA A;  1E3V A;  4IPB A;  2AAE A;  1BNJ A;  1YIJ 3;  4CPK A;  4FMD A;  3X3Z A;  1IVV A;  1BNI A;  3DGL A;  1YHQ 3;  1RNT A;  2M7O A;  2WOF A;  1BNR A;  1VQ6 3;  4HM5 B;  1E3R A;  4FCM A;  5D82 A;  1K8A 4;  4U13 A;  6GSP A;  3FH1 A;  3WMD A;  1OH0 A;  1JRQ A;  1QAL A;  3EB8 A;  4LZI A;  3GZR A;  3PXM A;  5G1K A;  1RGC A;  5AEW B;  1OGZ A;  1K28 A;  1RGE A;  1RGL A;  3RDE A;  1YJN 3;  4WYK B;  3FLJ A;  1D6Z A;  1GY6 A;  4RNT A;  4HM7 B;  5IG0 A;  3AHS A;  5AIG A;  3VSY A;  2QIY A;  3DZL A;  4XDW A;  2RGQ A;  1LQG C;  3CNM A;  1I8V A;  3HII A;  4QWT A;  1A2P A;  1VQK 3;  1JKG B;  3SXX A;  1RN1 A;  4OK0 A;  1W02 A;  3CC7 3;  2H0G A;  3B4P A;  3WOD G;  2CFL A;  3LT8 A;  4XBY A;  3G4S 3;  3FSD A;  4J8T A;  4MEI A;  1JBS A;  1I2E A;  1GS3 A;  2CWT A;  2J8X B;  3KZT A;  1DE3 A;  1TRP A;  1JB4 A;  1RMS A;  3CCU 3;  1KSI A;  3AGO A;  2XF3 A;  1VQM 3;  1DMN A;  1N9E A;  3G8Z A;  3LTA A;  1OF5 B;  2ML6 A;  4L8O A;  1LNI A;  3KII A;  4IT7 A;  5D81 A;  1O7M B;  3A5E A;  4FMC A;  3S27 A;  3CXC 2;  1YVS A;  5TGN A;  1MGR A;  2K3D A;  2YFL B;  2YX9 A;  3OWY A;  3PZW A;  3SOA A;  3URP A;  1T5Y A;  2BMQ B;  3N54 B;  4K61 A;  3EE1 A;  3X40 A;  2HML B;  4CCV A;  1Q40 A;  4MMY B;  1PYL A;  1I3I A;  4XBT A;  3N8B A;  5HGR A;  1RHL A;  3G6E 3;  1G96 A;  4X2H A;  1M90 4;  3G71 3;  2Q07 A;  2IYJ A;  4J5G A;  5EQL A;  1RRL A;  1V57 A;  2Y74 A;  4X2O A;  3B4O A;  2UX0 A;  4RNZ A;  1JN5 B;  4ILF A;  4JRF A;  2E2T A;  4N6N B;  7GSP A;  1LNH A;  1AR0 A;  3NX0 A;  1VQL 3;  3GZB A;  2OQE A;  1PFP A;  2FGT A;  1EG9 B;  3PYJ A;  1GD3 A;  3ZFZ A;  3WA2 X;  1EKM A; 
#chains in the Genus database with same CATH homology
 1GMP A;  7RNT A;  1RGF A;  1LOV A;  1LOY A;  4BU4 A;  2SAR A;  1FW7 A;  2BU4 A;  1BRI A;  1BNF A;  1BAN A;  1RCK A;  1B3S A;  4GHO A;  1GMQ A;  1BSC A;  3WR2 A;  1CH0 A;  1TTO A;  4J5K A;  6RNT A;  1SAR A;  3D4A A;  1B2M A;  1X1U A;  1FUT A;  1DET A;  3D5G A;  2GSP A;  1HZ1 A;  1I3F A;  5HOH A;  1BVI A;  1YNV X;  1BU4 A;  1B20 A;  3AGN A;  1TRQ A;  3BU4 A;  1B2S A;  1BSE A;  2KAA A;  1RGA A;  1LOW A;  2KF4 A;  2RBI A;  1FYS A;  1BNG A;  3SYU A;  1RGG A;  9RNT A;  1AQZ A;  1RGH A;  1ZGX A;  1BGS A;  1B21 A;  1JBR A;  1BOX A;  1X1Y A;  1GSP A;  1UCL A;  1BRK A;  1I70 A;  4HOH A;  1UCK A;  2AAE A;  3D5I A;  1BNJ A;  5BU4 A;  1RNB A;  1BNI A;  1Q9E A;  1RNT A;  1BNR A;  1BRG A;  1RTU A;  1I0V A;  6GSP A;  1GOY A;  1UCI A;  2KF3 A;  2HOH A;  5RNT A;  1BRN L;  1JBT A;  1RGC A;  4BIR A;  3AHW A;  3DH2 A;  1RGE A;  3BIR A;  1BSA A;  1B2U A;  1BRH A;  1BNE A;  1RGL A;  3HOH A;  3KCH A;  1MGW A;  5GSP A;  4RNT A;  1IYY A;  2AAD A;  2F4Y A;  1BAO A;  3AHS A;  1I0X A;  1BSD A;  3WHO A;  1RSN A;  1BRS A;  1X1X A;  1I8V A;  1A2P A;  1GMR A;  1RN1 A;  1UCJ A;  2F5W A;  3RNT A;  1R4Y A;  1PY3 A;  1B2X A;  1FUS A;  1AY7 A;  1B2Z A;  1T2H A;  1T2I A;  4GSP A;  1JBS A;  1I2E A;  1DE3 A;  1TRP A;  1RMS A;  1GOV A;  3AGO A;  1RN4 A;  1YGW A;  8RNT A;  1BRJ A;  1LNI A;  3A5E A;  1I2G A;  2F5M A;  1B27 A;  1YVS A;  1MGR A;  2KF5 A;  3URP A;  1RDS A;  1G02 A;  1C54 A;  1BSB A;  1BNS A;  1PYL A;  1I3I A;  1RHL A;  1HYF A;  5BIR A;  3Q3F A;  4J5G A;  1RGK A;  2C4B A;  4HAA A;  1RLS A;  1I2F A;  1LRA A;  2ZA4 A;  1GOU A;  2F56 A;  3GSP A;  3DGY A;  7GSP A;  2BIR A;  1BUJ A;  1X1W A;  1BIR A;  2RNT A;  2KF6 A;  1FZU A;  1RCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...