2O9UX

Monellin (mnei) at 1.15 resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
95
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords Monellin chain B and Monellin chain A
publication title Monellin (MNEI) at 1.15 A resolution
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
total genus 23
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2o9uX00
3UL5A 1MOLA 1NB3I 1A67A 1DVDA 4TX4A 1CYVA 4N6MA 1PFPA 5LC6A 4N6NB 3KFQC 1N5HA 3L0RA 2W9QA 4N6V0 5EQLA 1RN7A 1DVCA 1MNLA 4N6UA 4CCVA 2OCTA 3Q2PA 3K9MC 4ZM8A 1N5PA 1G96A 1EQKA 3PXMA 2BO9B 3LH4A 2O9UX 1CYUA 1STFI 4N6OB 1IV9A 1TIJA 1CEWI 3IMAB 1KWIA 1GD3A 2KXGA 1GD4A 5A0OB 5LC7A 2CH9A 4LZIA 1N9JA 1A90A 2W9PA 1WNHA 1R4CA 3NX0A 3KSED 1IV7A 4EYCA 3PS8A 1LXEA 1NB5I 3MWZA 1ROAA 3UL6A 4N6LA 5ELJA 3SVAA 3GAXA 4IT7A 1YVBI 1M9GA 1FUWA 4N6TA 3S67A 3QRDA 3PYJA 1FA3A 5ELUA
chains in the Genus database with same CATH superfamily
1V74A 2CW9A 2UUGC 5IG0A 4R4KA 1I2EA 4AKZA 1KQS2 1VQL3 1MWTA 2HMKB 3CC43 1ULIB 1B2MA 2V1LA 1RGHA 2RGQA 4WP5A 2P0MA 4N6MA 2IYJA 4XB5A 2HMLB 3CCU3 3V98A 3K0ZA 3MHEA 2I9WA 1VQ53 1HYFA 1FUSA 2CFDA 2HMNB 1C7HA 2P38A 2A15A 1JBSA 3DZLA 3KFQC 4OUQA 2UX0A 3BLZA 1ASKA 4U13A 1SARA 2C10A 2OOVA 3O8YA 5G2GA 4BIRA 1Q814 4LGQA 3X41A 2BNGA 2FXTA 1EKMA 4HM3B 1DMMA 2XGLA 1Q42A 1Y4KA 1BRSA 3U97A 1RN7A 1GMQA 5IG5A 1BNRA 4O2HA 5CF1A 3CCM3 1MNLA 3ER7A 1JBTA 4HM6B 1V58A 1BNJA 2BMQB 4STDA 4R80A 1QALA 3Q2PA 1T2HA 2UGIA 2RFRA 3D5GA 3STDA 3F40A 3RGAA 2KF4A 1BRKA 1YJN3 1GOVA 1JJ22 3NV0B 5HOHA 3FH1A 1X1WA 2B24B 1NJI4 2PZVA 5D83A 2IY2A 3PXMA 1GY5A 3D4AA 2BO9B 3UB1A 3SYUA 1I2GA 3S27A 3NQZA 3EJVA 3VF1A 4NHFA 1E3RA 1B21A 3MYTA 1IT7A 1FGQA 1V57A 1IV9A 3D79A 2WOFA 3MG3A 4H3UA 3NHXA 3NV0A 1B2UA 1RMSA 1D6ZA 3PCSA 2ZHXB 1ZS7A 3VSYA 4BL3A 3FZWA 1GY6A 3KIIA 1W6CA 5BXQA 1FGOA 5AIHA 2HMJB 3PZWA 1K9M4 1ZO2A 3HX8A 2Z76A 4HM0B 1VQP3 3F9SA 3KZTA 2W0QA 5AI1A 2LYXA 1RTUA 4K1UA 4HVNA 2CFWA 5G1LA 2CH9A 1GS3A 1DYUA 5LC7A 3KE7A 1BNGA 2Z6BA 4GHOA 1NNVA 4HBRA 1FZUA 1IVXA 1I8VA 5DREA 4K61A 1A90A 3X42A 4KZ1A 3OV4A 3FCSB 3SOAA 5CK6A 2R4IA 2YFIB 3MPHA 3LTBA 1E97A 3EE1A 2BU4A 1ZX2A 3EBTA 1VQK3 1GYBA 3G0KA 1IV7A 4GSPA 1KSIA 4MMYB 3SOYA 4HAAA 2ZA4A 2AADA 3DY5A 4EC6A 2F4YA 1RGKA 4OK0A 3FG4A 3T0UA 3WODG 1LNHA 1JB5A 1O7HB 3AHWA 4WYKA 1FGTA 3JVCA 5JPUA 3LTDA 1RN1A 5AIIA 1JNQA 3GZBA 3CNMA 1RHLA 5KP1A 1BNEA 1GSPA 1FYSA 5D81A 4O8SA 2R41A 1SIIA 2IMJA 1TU5A 2F98A 1UGIA 1O7NB 1LVNA 3U1WA 1RN4A 3CCJ3 1Z1SA 4HM5B 1YVBI 1QVG2 3EN8A 1I0VA 2OWPA 3S28A 1T3BA 1RLSA 3PYJA 1K8A4 1VQ83 1UDII 5IERA 1RCKA 1QAKA 2GBXB 2W6JH 4MJDA 4HM1B 4H61A 4XDWA 3T8UA 1FA3A 3MKIA 4GL6A 1J2BA 3OWYA 1VQQA 1RNTA 4XBYA 3NQYA 5CF2A 1JV2B 1FUTA 1NU3A 3F14A 2IA7A 1O7PB 3MG2A 5KP3A 4EW5A 1CYVA 4KFFA 4XBTA 7GSPA 3CMA3 1BSAA 3WA2X 2H0IA 4WHAA 1QVF2 5LC6A 2KF6A 3DGNA 1Q40A 2W03A 1HZ1A 1OGXA 2W56A 3H3HA 2Z7AA 3L0RA 4AKYA 1MGRA 1AVLA 3HZPA 3FF2A 3BNDA 2CG1A 4R9KA 1JB2A 1DMNA 2XFSA 3WHOA 1B2XA 1X1UA 5TGNA 3G4S3 3VGNA 2Z77A 3X3YA 1YJ93 1BNIA 1C54A 1RKYA 4HKVB 2KAAA 3WA3A 2GU1A 4HZ9B 4EV2A 2CIUA 6GSPA 1IQYA 1RJOA 1DE3A 1RDSA 4RNZA 1R4YA 1LOYA 1IT8A 1G02A 1NO3A 3WDGB 1BANA 1TJDA 2CX1A 3CPW2 1A2VA 1N5PA 1UCLA 1W6GA 1YGEA 1WQLB 3H51A 1PY3A 3CCV3 3BNBA 3EF8A 1B20A 3ALAA 4Q53A 4BU4A 5JBSA 2J8XB 2QA43 1GY7A 1BSEA 1E3VA 2B1XB 3BIRA 3K7CA 3N9HA 1T2IA 1FGMA 4KT3B 3ZG0A 1VQO3 4LSOA 2K0MA 4MEIA 3G713 1G0TA 2F5MA 4L8OA 1CEWI 3IMAB 3KCHA 1X1XA 2WOHA 1BUQA 3DGMA 1OF5B 4EXRA 1OHOA 2XSHB 4O02B 1OPYA 1AR0A 1UUVB 2BMRB 1IVUA 1DETA 3ECFA 1IQ8A 1RGGA 1TRQA 1US1A 1S723 3JUQA 1GMRA 1BRGA 3Q3FA 3DH2A 1BRNL 1BSCA 1YGWA 3AHSA 3CC23 3LZAA 2XGNA 2IUKA 4BL2A 1VQ73 3RGRA 1OF5A 2F99A 3N54B 1LOWA 5AIFA 1NDOB 1Q7Y4 3SEDA 1SJWA 4K1VA 6RNTA 1IDPA 5AYRB 1UGHI 5M1AA 5RNTA 3Q90A 4XM4A 1LXEA 1RGEA 5IENA 4FCZA 2CC3A 3CCS3 1ZGXA 2KF5A 3CU3A 7STDA 2YFLB 2WGQA 1N8QA 1BRJA 1MWSA 1X1YA 1L5GB 3SX1A 1YIT3 3LT9A 1YIJ3 1PU4A 3IPTA 1UW1A 1IYYA 4N6LA 1LQMB 2GXFA 3E99A 1SPUA 1W2ZA 3SVAA 1I0XA 3EBYA 1W7CA 4HM7B 3X40A 3IJEB 1UI7A 4LMIA 4EBGA 4N6TA 4JRFA 4WYKB 5EEOA 3K63A 1W4NA 2RCDA 1YHQ3 1BNFA 1IK3A 5ELUA 2BT3A 2F86B 4LEHA 1WMOA 3UL5A 2E2UA 1EG9B 1MOLA 4FMDA 1NB3I 9RNTA 4NREA 2QEX3 1BSDA 4RNYA 3HIGA 4XDVA 3CCR3 1D6UA 1DVDA 1RGFA 1TP6A 2CKFB 2D1WA 2LQVA 2STDA 3HK4A 2H0GA 2E2TA 4KFEA 2KRTA 4JF8A 1HKXA 4PEJA 4XBXA 3EHCA 1LOVA 3PCRA 2HMMB 1OUNA 2GEXA 5HGRA 3GZXB 1W00A 4R1KA 5STDA 2WO0A 1RNBA 3KSPA 3OWUA 1N8R4 1SIHA 3EB8A 1M1K4 3DXOA 1Q824 3EQQB 1YJW3 2BHMA 3GWRA 1BSBA 1JN5B 4N6V0 2CK3H 1DMQA 3JUMA 4J5GA 3TDGA 3X3XA 2W2CA 1U8CB 4K90B 5EQLA 1B27A 3S29A 3I563 3LYGA 1OH0A 4FMCA 2CWUA 3CCQ3 1Q40B 2CG0A 4ILFA 5IW9A 2YFJB 3AMOB 1JN5A 2W56B 4CCVA 3LXUX 2D42A 3K9MC 3S5CA 1HU9A 3RDEA 2JDIH 5CLKA 2ML6A 1K28A 1F8NA 1EQKA 1AY7A 2OQEC 4MMXB 1RGAA 4I4KA 1OHPA 2GEYA 3AMOA 3LH4A 2O9UX 1A2KA 2YX9A 1M904 3F8XA 1UUGB 2WGOA 1KC84 4I5QA 1AQZA 4ORLA 2CWVA 5GSPA 2K54A 4FCJA 3DM8A 2RBIA 3SXXA 1QJGA 3EC9A 3F7XA 1W02A 3B4PA 3NBBA 1TIJA 1BAOA 3FSDA 3G16A 4O3VA 1QMAA 4FR9A 4HOHA 4HM4B 5IEPA 1T5YA 1WMPA 1KWIA 3CNXA 1BOXA 4FMBA 4X2OA 4RBNA 1JZDA 4DKIA 5I97A 3LTCA 3ROBA 1GD4A 2Y74A 3FLJA 5CXOA 1BRIA 1N9JA 2FGTA 4FCMA 2W9PA 1WNHA 1Q7HA 2Q07A 2C4BA 1R4CA 3LT8A 2L1SA 3NX0A 1IVVA 3D5IA 1SQWA 3OWSA 1IU7A 3A5EA 1UUWB 1BUJA 4RNTA 1RRLA 1BNSA 3AGOA 3KSED 1I3FA 2K3DA 2W04A 3JUPA 4EYCA 3PS8A 2INXA 3Q1CA 3D9RA 4NPBA 1EUIC 3MWZA 3DUKA 5D82A 5IG3A 4GB5A 1QAFA 1IVWA 7RNTA 3EN1B 2L4VA 1GOUA 2H0HA 1CQSA 3LTAA 1AVKA 1LRAA 5FGOA 3FG3A 1RGLA 2ZDJA 3GZYB 1BIRA 3MSOA 5BVBA 5ELJA 1OGZA 6STDA 3JUOA 4IT7A 3HI7A 4BTXA 2P05A 2XRXB 1LNIA 5AEWB 1M9GA 1FUWA 5JPPA 1AV4A 1YVSA 3S67A 2JQ5A 3NXJA 3QRDA 3CCE3 3CCL3 2Y73A 3GRDA 2OOVC 3GZRA 5EVHA 2OTL3 5AIGA 8RNTA 4IPBA 3OXAA 3EX9A 5IG4A 5M19A 1OHSA 1W01A 3DGOA 2GU3A 2ZL8A 1RSNA 2PNCA 1N9EA 1A67A 4WWUC 3F7SA 1TRPA 3DGYA 4TX4A 1VQ43 8CHOA 5AYSC 4HM8B 5IEOA 1YNVX 2C11A 1EA2A 1PFPA 2GBWB 3B8LA 3G8ZA 3URPA 1K734 3BNEA 2MC8A 3NM2A 4HYZA 1LQGC 2CX0A 2KCDA 3T8NA 1UCJA 1O7MB 3JUNA 3BB9A 4N6NB 4EV5A 1Q864 3UNLA 3A76A 1N5HA 2ML5A 4RZMA 2W9QA 1ISKA 1JZOA 1UI8A 2GSPA 3HOHA 3K5TA 1BU4A 1PYLA 3KN4A 1RGCA 3MG1A 4X2HA 3V92A 2P09A 4CJNA 3UJMA 3CD63 1I3IA 3D3LA 1YI23 1DVCA 5BU4A 2RSXA 5FW5A 1O7WB 2F56A 1UCIA 1NWWA 3ZFZA 1GOYA 3NUVA 3FKAA 4HM2B 2OTJ3 4N6UA 3BNCA 4LYLB 2OCTA 3CC73 1MGWA 4ZM8A 1CH0A 3KKGA 4HZBB 3I553 3FG1A 4J5KA 1G96A 1M1XB 1O7GB 3N8BA 1ULJB 3G6E3 1BRHA 1BVIA 1I2FA 1TUHA 2XFTA 3DGLA 4MMZB 3WOEB 1FW7A 2MF7A 1JRQA 1B2SA 1VZZA 4J8TA 4J9AA 1STFI 4N6OB 1CYUA 3I0YA 1MWUA 4L7KA 2KF3A 2M7OA 4BTWA 1TTOA 5IF6A 3OX9A 2HOHA 3ZG5A 3X3ZA 1U5OA 2HMOB 1JKGB 2XR8B 4KFDA 4R9LA 1LOXA 2IUJA 1ROVA 4CPKA 2SARA 1W5ZA 3LOYA 1GD3A 2P0XA 3CME3 2KXGA 5A0OB 3NM7A 3B7CA 2BIRA 2CFLA 3RNTA 2FNQA 2OQEA 2AAEA 1D6YA 1GMPA 1K41A 3CPOA 4LZIA 4N3VA 4HJLB 4WFOA 4AEQA 1RCLA 3AGNA 1JKGA 4L8PA 1JB4A 1W6YA 1KD14 1S5AA 2CFGA 4CDLA 1W2B2 5M18A 2O3OA 5KP4A 2QGUA 1BGSA 1A2PA 1OACA 3FGYA 4QWTA 3LMLA 3WR2A 3QK9A 1VQM3 1TFKA 5DRVA 3SLUA 2SBLA 2BMOB 2XEPA 3PGBA 4BTYA 1NB5I 1TFOA 1STDA 1B3SA 2E2VA 4OVMA 1ROAA 4G1MB 3GSPA 5G1KA 2CFKA 3UL6A 1I70A 1JBRA 1MWRA 2QIYA 2XF3A 3CXC2 1WTHA 1VQ63 2CWTA 3J7Yd 3OW22 2XH9A 3BU4A 3B4OA 3FF0A 1B2ZA 1VQN3 4FMAA 4KVHA 3GAXA 3WMDA 2XSOB 3NBRA 1FGRA 2F5WA 5AEUB 3NBJA 1EEJA 1Q9EA 2RNTA 1RRHA 4IIAA 3HIIA 3V99A 3F8HA 2CHCA 3DMCA 1WMNA 5BIRA 3WOFB 3M8CA 1UCKA 1IQXA 1VQ93 1OCVA
chains in the Genus database with same CATH topology
1V74A 2CW9A 5IG0A 4R4KA 4AKZA 1KQS2 1VQL3 2HMKB 3CC43 1ULIB 2V1LA 2RGQA 4WP5A 2P0MA 4N6MA 4XB5A 3CCU3 2HMLB 3V98A 3K0ZA 3MHEA 2I9WA 1VQ53 2CFDA 2HMNB 1C7HA 2P38A 2A15A 3DZLA 3KFQC 4OUQA 2UX0A 3BLZA 1ASKA 4U13A 2C10A 2OOVA 3O8YA 5G2GA 1Q814 4LGQA 3X41A 2BNGA 2FXTA 1EKMA 4HM3B 1DMMA 2XGLA 1Q42A 1Y4KA 3U97A 1RN7A 5IG5A 4O2HA 5CF1A 3CCM3 1MNLA 3ER7A 4HM6B 2BMQB 4STDA 4R80A 1QALA 3Q2PA 2RFRA 3STDA 3F40A 3RGAA 1YJN3 1JJ22 3NV0B 3FH1A 2B24B 1NJI4 2PZVA 5D83A 3PXMA 1GY5A 2BO9B 3UB1A 3VF1A 3S27A 3NQZA 3EJVA 4NHFA 1E3RA 3MYTA 1IT7A 1FGQA 1IV9A 2WOFA 3MG3A 4H3UA 3NHXA 3NV0A 1D6ZA 3PCSA 3VSYA 3FZWA 1GY6A 3KIIA 1W6CA 5BXQA 1FGOA 5AIHA 2HMJB 3PZWA 1K9M4 1ZO2A 3HX8A 2Z76A 4HM0B 1VQP3 3F9SA 3KZTA 2W0QA 5AI1A 2LYXA 4K1UA 4HVNA 2CFWA 5LC7A 2CH9A 1GS3A 1DYUA 3KE7A 4HBRA 2Z6BA 1IVXA 5DREA 4K61A 1A90A 3X42A 4KZ1A 3OV4A 3FCSB 3SOAA 5CK6A 2R4IA 2YFIB 3MPHA 3LTBA 1E97A 3EE1A 1ZX2A 3EBTA 1VQK3 1GYBA 3G0KA 1IV7A 1KSIA 4MMYB 3SOYA 4EC6A 3DY5A 4OK0A 3FG4A 3T0UA 3WODG 1LNHA 1JB5A 1O7HB 4WYKA 1FGTA 3JVCA 5JPUA 3LTDA 5AIIA 1JNQA 3GZBA 3CNMA 5KP1A 5D81A 4O8SA 1SIIA 2IMJA 1TU5A 2F98A 1O7NB 1LVNA 3U1WA 3CCJ3 1Z1SA 4HM5B 1YVBI 1QVG2 3EN8A 2OWPA 3S28A 1K8A4 3PYJA 1VQ83 5IERA 2GBXB 1QAKA 3T8UA 2W6JH 4MJDA 4HM1B 4H61A 4XDWA 1FA3A 3MKIA 4GL6A 1J2BA 3OWYA 4XBYA 3NQYA 5CF2A 1JV2B 1NU3A 3F14A 2IA7A 1O7PB 3MG2A 5KP3A 1CYVA 4KFFA 4XBTA 3CMA3 3WA2X 1QVF2 4WHAA 5LC6A 3DGNA 1Q40A 2W03A 1OGXA 2W56A 3H3HA 2Z7AA 3L0RA 4AKYA 1AVLA 3HZPA 3FF2A 3BNDA 2CG1A 4R9KA 1JB2A 1DMNA 2XFSA 5TGNA 3G4S3 3VGNA 2Z77A 3X3YA 1YJ93 1RKYA 4HKVB 3WA3A 2GU1A 4HZ9B 4EV2A 2CIUA 1IQYA 1RJOA 4RNZA 1IT8A 1NO3A 3WDGB 3CPW2 1A2VA 1N5PA 1W6GA 1YGEA 1WQLB 3H51A 3CCV3 3BNBA 3EF8A 3ALAA 4Q53A 5JBSA 2QA43 1GY7A 1E3VA 2B1XB 3K7CA 3N9HA 1FGMA 1VQO3 4LSOA 2K0MA 4MEIA 3G713 4L8OA 1CEWI 3IMAB 2WOHA 1BUQA 3DGMA 1OF5B 4EXRA 1OHOA 2XSHB 4O02B 1OPYA 1AR0A 1UUVB 2BMRB 1IVUA 1S723 3ECFA 1IQ8A 1US1A 3JUQA 3CC23 3LZAA 2XGNA 2IUKA 1VQ73 3RGRA 1OF5A 2F99A 3N54B 5AIFA 1NDOB 1Q7Y4 3SEDA 1SJWA 4K1VA 1IDPA 5AYRB 3Q90A 4XM4A 1LXEA 5IENA 4FCZA 2CC3A 3CCS3 3CU3A 7STDA 2YFLB 2WGQA 1N8QA 3SX1A 1L5GB 1YIT3 3LT9A 1YIJ3 1PU4A 3IPTA 1UW1A 4N6LA 2GXFA 3E99A 1SPUA 1W2ZA 3SVAA 3EBYA 4HM7B 1W7CA 3X40A 3IJEB 1UI7A 4LMIA 4EBGA 4N6TA 4JRFA 4WYKB 5EEOA 3K63A 1W4NA 2RCDA 1YHQ3 1IK3A 5ELUA 2BT3A 2F86B 4LEHA 1WMOA 3UL5A 2E2UA 1EG9B 1MOLA 4FMDA 1NB3I 2QEX3 4NREA 4RNYA 3HIGA 4XDVA 3CCR3 1D6UA 1DVDA 1TP6A 2CKFB 2LQVA 2D1WA 2STDA 3HK4A 4KFEA 2E2TA 2KRTA 4JF8A 1HKXA 4PEJA 4XBXA 3EHCA 3PCRA 2HMMB 1OUNA 2GEXA 5HGRA 3GZXB 1W00A 4R1KA 5STDA 2WO0A 3KSPA 3OWUA 1N8R4 1SIHA 3EB8A 1M1K4 3DXOA 1Q824 3EQQB 1YJW3 2BHMA 3GWRA 4N6V0 1JN5B 2CK3H 1DMQA 3JUMA 3TDGA 3X3XA 2W2CA 1U8CB 4K90B 5EQLA 3S29A 3I563 3LYGA 1OH0A 4FMCA 2CWUA 3CCQ3 1Q40B 2CG0A 5IW9A 2YFJB 3AMOB 1JN5A 2W56B 4CCVA 3LXUX 2D42A 3K9MC 3S5CA 1HU9A 3RDEA 2JDIH 5CLKA 2ML6A 1K28A 1F8NA 1EQKA 2OQEC 4MMXB 4I4KA 1OHPA 2GEYA 3AMOA 3LH4A 2O9UX 1A2KA 2YX9A 1M904 3F8XA 2WGOA 1KC84 4ORLA 2CWVA 2K54A 4FCJA 3DM8A 3SXXA 1QJGA 3EC9A 3F7XA 1W02A 3B4PA 3NBBA 1TIJA 3FSDA 3G16A 4O3VA 1QMAA 4FR9A 5IEPA 4HM4B 1T5YA 1WMPA 1KWIA 3CNXA 4FMBA 4X2OA 5I97A 4RBNA 3LTCA 3ROBA 1GD4A 2Y74A 3FLJA 5CXOA 1N9JA 2FGTA 4FCMA 2W9PA 1WNHA 2Q07A 1R4CA 3LT8A 3NX0A 1IVVA 3OWSA 1SQWA 1IU7A 1UUWB 1RRLA 3KSED 2W04A 3JUPA 4EYCA 3PS8A 2INXA 3Q1CA 3D9RA 3MWZA 3DUKA 5D82A 5IG3A 4GB5A 1QAFA 1IVWA 3EN1B 2L4VA 1CQSA 3LTAA 1AVKA 5FGOA 3FG3A 2ZDJA 3GZYB 5BVBA 3MSOA 5ELJA 1OGZA 6STDA 3JUOA 4IT7A 3HI7A 4BTXA 2P05A 2XRXB 5AEWB 1M9GA 1FUWA 5JPPA 1AV4A 3S67A 2JQ5A 3NXJA 3QRDA 3CCE3 3CCL3 2Y73A 3GRDA 2OOVC 3GZRA 5EVHA 2OTL3 5AIGA 4IPBA 3OXAA 3EX9A 5IG4A 1OHSA 1W01A 3DGOA 2GU3A 2ZL8A 2PNCA 1N9EA 1A67A 4WWUC 3F7SA 4TX4A 1VQ43 8CHOA 5AYSC 4HM8B 5IEOA 3B8LA 2C11A 1EA2A 1PFPA 2GBWB 3G8ZA 1K734 3BNEA 2MC8A 3NM2A 4HYZA 3T8NA 4EV5A 2KCDA 3JUNA 1O7MB 4N6NB 3BB9A 1Q864 3UNLA 3A76A 1N5HA 2ML5A 4RZMA 2W9QA 1ISKA 1UI8A 3K5TA 3KN4A 4X2HA 3MG1A 3V92A 2P09A 3UJMA 3CD63 3D3LA 1YI23 1DVCA 2RSXA 5FW5A 1O7WB 1NWWA 3NUVA 3FKAA 4HM2B 2OTJ3 4N6UA 3BNCA 3CC73 2OCTA 4ZM8A 3KKGA 4HZBB 3I553 3FG1A 1G96A 1M1XB 1O7GB 3N8BA 1ULJB 3G6E3 3WOEB 1TUHA 2XFTA 3DGLA 4MMZB 2MF7A 1JRQA 1VZZA 4J8TA 4J9AA 1STFI 4N6OB 1CYUA 3I0YA 4L7KA 2M7OA 4BTWA 5IF6A 3OX9A 3X3ZA 1U5OA 2HMOB 2XR8B 1JKGB 4KFDA 4R9LA 1LOXA 2IUJA 1ROVA 1W5ZA 3LOYA 1GD3A 2P0XA 3CME3 2KXGA 5A0OB 3NM7A 3B7CA 2CFLA 2FNQA 2OQEA 1D6YA 3CPOA 1K41A 4LZIA 4N3VA 4HJLB 4WFOA 4AEQA 1JKGA 4L8PA 1JB4A 1W6YA 1KD14 1S5AA 2CFGA 4CDLA 1W2B2 2O3OA 5KP4A 2QGUA 1OACA 3FGYA 4QWTA 3LMLA 3QK9A 1VQM3 1TFKA 5DRVA 3SLUA 2SBLA 2BMOB 2XEPA 3PGBA 4BTYA 1NB5I 1TFOA 1STDA 2E2VA 4OVMA 1ROAA 4G1MB 2CFKA 3UL6A 2QIYA 2XF3A 3CXC2 1WTHA 1VQ63 2CWTA 3J7Yd 3OW22 2XH9A 3FF0A 3B4OA 1VQN3 4FMAA 4KVHA 3GAXA 3WMDA 2XSOB 3NBRA 1FGRA 5AEUB 3NBJA 1RRHA 4IIAA 3HIIA 3V99A 3F8HA 2CHCA 3DMCA 1WMNA 3WOFB 3M8CA 1IQXA 1VQ93 1OCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL5 A;  1MOL A;  1NB3 I;  1A67 A;  1DVD A;  4TX4 A;  1CYV A;  4N6M A;  1PFP A;  5LC6 A;  4N6N B;  3KFQ C;  1N5H A;  3L0R A;  2W9Q A;  4N6V 0;  5EQL A;  1RN7 A;  1DVC A;  1MNL A;  4N6U A;  4CCV A;  2OCT A;  3Q2P A;  3K9M C;  4ZM8 A;  1N5P A;  1G96 A;  1EQK A;  3PXM A;  2BO9 B;  3LH4 A;  2O9U X;  1CYU A;  1STF I;  4N6O B;  1IV9 A;  1TIJ A;  1CEW I;  3IMA B;  1KWI A;  1GD3 A;  2KXG A;  1GD4 A;  5A0O B;  5LC7 A;  2CH9 A;  4LZI A;  1N9J A;  1A90 A;  2W9P A;  1WNH A;  1R4C A;  3NX0 A;  3KSE D;  1IV7 A;  4EYC A;  3PS8 A;  1LXE A;  1NB5 I;  3MWZ A;  1ROA A;  3UL6 A;  4N6L A;  5ELJ A;  3SVA A;  3GAX A;  4IT7 A;  1YVB I;  1M9G A;  1FUW A;  4N6T A;  3S67 A;  3QRD A;  3PYJ A;  1FA3 A;  5ELU A; 
#chains in the Genus database with same CATH topology
 1V74 A;  2CW9 A;  2UUG C;  5IG0 A;  4R4K A;  1I2E A;  4AKZ A;  1KQS 2;  1VQL 3;  1MWT A;  2HMK B;  3CC4 3;  1ULI B;  1B2M A;  2V1L A;  1RGH A;  2RGQ A;  4WP5 A;  2P0M A;  4N6M A;  2IYJ A;  4XB5 A;  2HML B;  3CCU 3;  3V98 A;  3K0Z A;  3MHE A;  2I9W A;  1VQ5 3;  1HYF A;  1FUS A;  2CFD A;  2HMN B;  1C7H A;  2P38 A;  2A15 A;  1JBS A;  3DZL A;  3KFQ C;  4OUQ A;  2UX0 A;  3BLZ A;  1ASK A;  4U13 A;  1SAR A;  2C10 A;  2OOV A;  3O8Y A;  5G2G A;  4BIR A;  1Q81 4;  4LGQ A;  3X41 A;  2BNG A;  2FXT A;  1EKM A;  4HM3 B;  1DMM A;  2XGL A;  1Q42 A;  1Y4K A;  1BRS A;  3U97 A;  1RN7 A;  1GMQ A;  5IG5 A;  1BNR A;  4O2H A;  5CF1 A;  3CCM 3;  1MNL A;  3ER7 A;  1JBT A;  4HM6 B;  1V58 A;  1BNJ A;  2BMQ B;  4STD A;  4R80 A;  1QAL A;  3Q2P A;  1T2H A;  2UGI A;  2RFR A;  3D5G A;  3STD A;  3F40 A;  3RGA A;  2KF4 A;  1BRK A;  1YJN 3;  1GOV A;  1JJ2 2;  3NV0 B;  5HOH A;  3FH1 A;  1X1W A;  2B24 B;  1NJI 4;  2PZV A;  5D83 A;  2IY2 A;  3PXM A;  1GY5 A;  3D4A A;  2BO9 B;  3UB1 A;  3SYU A;  1I2G A;  3S27 A;  3NQZ A;  3EJV A;  3VF1 A;  4NHF A;  1E3R A;  1B21 A;  3MYT A;  1IT7 A;  1FGQ A;  1V57 A;  1IV9 A;  3D79 A;  2WOF A;  3MG3 A;  4H3U A;  3NHX A;  3NV0 A;  1B2U A;  1RMS A;  1D6Z A;  3PCS A;  2ZHX B;  1ZS7 A;  3VSY A;  4BL3 A;  3FZW A;  1GY6 A;  3KII A;  1W6C A;  5BXQ A;  1FGO A;  5AIH A;  2HMJ B;  3PZW A;  1K9M 4;  1ZO2 A;  3HX8 A;  2Z76 A;  4HM0 B;  1VQP 3;  3F9S A;  3KZT A;  2W0Q A;  5AI1 A;  2LYX A;  1RTU A;  4K1U A;  4HVN A;  2CFW A;  5G1L A;  2CH9 A;  1GS3 A;  1DYU A;  5LC7 A;  3KE7 A;  1BNG A;  2Z6B A;  4GHO A;  1NNV A;  4HBR A;  1FZU A;  1IVX A;  1I8V A;  5DRE A;  4K61 A;  1A90 A;  3X42 A;  4KZ1 A;  3OV4 A;  3FCS B;  3SOA A;  5CK6 A;  2R4I A;  2YFI B;  3MPH A;  3LTB A;  1E97 A;  3EE1 A;  2BU4 A;  1ZX2 A;  3EBT A;  1VQK 3;  1GYB A;  3G0K A;  1IV7 A;  4GSP A;  1KSI A;  4MMY B;  3SOY A;  4HAA A;  2ZA4 A;  2AAD A;  3DY5 A;  4EC6 A;  2F4Y A;  1RGK A;  4OK0 A;  3FG4 A;  3T0U A;  3WOD G;  1LNH A;  1JB5 A;  1O7H B;  3AHW A;  4WYK A;  1FGT A;  3JVC A;  5JPU A;  3LTD A;  1RN1 A;  5AII A;  1JNQ A;  3GZB A;  3CNM A;  1RHL A;  5KP1 A;  1BNE A;  1GSP A;  1FYS A;  5D81 A;  4O8S A;  2R41 A;  1SII A;  2IMJ A;  1TU5 A;  2F98 A;  1UGI A;  1O7N B;  1LVN A;  3U1W A;  1RN4 A;  3CCJ 3;  1Z1S A;  4HM5 B;  1YVB I;  1QVG 2;  3EN8 A;  1I0V A;  2OWP A;  3S28 A;  1T3B A;  1RLS A;  3PYJ A;  1K8A 4;  1VQ8 3;  1UDI I;  5IER A;  1RCK A;  1QAK A;  2GBX B;  2W6J H;  4MJD A;  4HM1 B;  4H61 A;  4XDW A;  3T8U A;  1FA3 A;  3MKI A;  4GL6 A;  1J2B A;  3OWY A;  1VQQ A;  1RNT A;  4XBY A;  3NQY A;  5CF2 A;  1JV2 B;  1FUT A;  1NU3 A;  3F14 A;  2IA7 A;  1O7P B;  3MG2 A;  5KP3 A;  4EW5 A;  1CYV A;  4KFF A;  4XBT A;  7GSP A;  3CMA 3;  1BSA A;  3WA2 X;  2H0I A;  4WHA A;  1QVF 2;  5LC6 A;  2KF6 A;  3DGN A;  1Q40 A;  2W03 A;  1HZ1 A;  1OGX A;  2W56 A;  3H3H A;  2Z7A A;  3L0R A;  4AKY A;  1MGR A;  1AVL A;  3HZP A;  3FF2 A;  3BND A;  2CG1 A;  4R9K A;  1JB2 A;  1DMN A;  2XFS A;  3WHO A;  1B2X A;  1X1U A;  5TGN A;  3G4S 3;  3VGN A;  2Z77 A;  3X3Y A;  1YJ9 3;  1BNI A;  1C54 A;  1RKY A;  4HKV B;  2KAA A;  3WA3 A;  2GU1 A;  4HZ9 B;  4EV2 A;  2CIU A;  6GSP A;  1IQY A;  1RJO A;  1DE3 A;  1RDS A;  4RNZ A;  1R4Y A;  1LOY A;  1IT8 A;  1G02 A;  1NO3 A;  3WDG B;  1BAN A;  1TJD A;  2CX1 A;  3CPW 2;  1A2V A;  1N5P A;  1UCL A;  1W6G A;  1YGE A;  1WQL B;  3H51 A;  1PY3 A;  3CCV 3;  3BNB A;  3EF8 A;  1B20 A;  3ALA A;  4Q53 A;  4BU4 A;  5JBS A;  2J8X B;  2QA4 3;  1GY7 A;  1BSE A;  1E3V A;  2B1X B;  3BIR A;  3K7C A;  3N9H A;  1T2I A;  1FGM A;  4KT3 B;  3ZG0 A;  1VQO 3;  4LSO A;  2K0M A;  4MEI A;  3G71 3;  1G0T A;  2F5M A;  4L8O A;  1CEW I;  3IMA B;  3KCH A;  1X1X A;  2WOH A;  1BUQ A;  3DGM A;  1OF5 B;  4EXR A;  1OHO A;  2XSH B;  4O02 B;  1OPY A;  1AR0 A;  1UUV B;  2BMR B;  1IVU A;  1DET A;  3ECF A;  1IQ8 A;  1RGG A;  1TRQ A;  1US1 A;  1S72 3;  3JUQ A;  1GMR A;  1BRG A;  3Q3F A;  3DH2 A;  1BRN L;  1BSC A;  1YGW A;  3AHS A;  3CC2 3;  3LZA A;  2XGN A;  2IUK A;  4BL2 A;  1VQ7 3;  3RGR A;  1OF5 A;  2F99 A;  3N54 B;  1LOW A;  5AIF A;  1NDO B;  1Q7Y 4;  3SED A;  1SJW A;  4K1V A;  6RNT A;  1IDP A;  5AYR B;  1UGH I;  5M1A A;  5RNT A;  3Q90 A;  4XM4 A;  1LXE A;  1RGE A;  5IEN A;  4FCZ A;  2CC3 A;  3CCS 3;  1ZGX A;  2KF5 A;  3CU3 A;  7STD A;  2YFL B;  2WGQ A;  1N8Q A;  1BRJ A;  1MWS A;  1X1Y A;  1L5G B;  3SX1 A;  1YIT 3;  3LT9 A;  1YIJ 3;  1PU4 A;  3IPT A;  1UW1 A;  1IYY A;  4N6L A;  1LQM B;  2GXF A;  3E99 A;  1SPU A;  1W2Z A;  3SVA A;  1I0X A;  3EBY A;  1W7C A;  4HM7 B;  3X40 A;  3IJE B;  1UI7 A;  4LMI A;  4EBG A;  4N6T A;  4JRF A;  4WYK B;  5EEO A;  3K63 A;  1W4N A;  2RCD A;  1YHQ 3;  1BNF A;  1IK3 A;  5ELU A;  2BT3 A;  2F86 B;  4LEH A;  1WMO A;  3UL5 A;  2E2U A;  1EG9 B;  1MOL A;  4FMD A;  1NB3 I;  9RNT A;  4NRE A;  2QEX 3;  1BSD A;  4RNY A;  3HIG A;  4XDV A;  3CCR 3;  1D6U A;  1DVD A;  1RGF A;  1TP6 A;  2CKF B;  2D1W A;  2LQV A;  2STD A;  3HK4 A;  2H0G A;  2E2T A;  4KFE A;  2KRT A;  4JF8 A;  1HKX A;  4PEJ A;  4XBX A;  3EHC A;  1LOV A;  3PCR A;  2HMM B;  1OUN A;  2GEX A;  5HGR A;  3GZX B;  1W00 A;  4R1K A;  5STD A;  2WO0 A;  1RNB A;  3KSP A;  3OWU A;  1N8R 4;  1SIH A;  3EB8 A;  1M1K 4;  3DXO A;  1Q82 4;  3EQQ B;  1YJW 3;  2BHM A;  3GWR A;  1BSB A;  1JN5 B;  4N6V 0;  2CK3 H;  1DMQ A;  3JUM A;  4J5G A;  3TDG A;  3X3X A;  2W2C A;  1U8C B;  4K90 B;  5EQL A;  1B27 A;  3S29 A;  3I56 3;  3LYG A;  1OH0 A;  4FMC A;  2CWU A;  3CCQ 3;  1Q40 B;  2CG0 A;  4ILF A;  5IW9 A;  2YFJ B;  3AMO B;  1JN5 A;  2W56 B;  4CCV A;  3LXU X;  2D42 A;  3K9M C;  3S5C A;  1HU9 A;  3RDE A;  2JDI H;  5CLK A;  2ML6 A;  1K28 A;  1F8N A;  1EQK A;  1AY7 A;  2OQE C;  4MMX B;  1RGA A;  4I4K A;  1OHP A;  2GEY A;  3AMO A;  3LH4 A;  2O9U X;  1A2K A;  2YX9 A;  1M90 4;  3F8X A;  1UUG B;  2WGO A;  1KC8 4;  4I5Q A;  1AQZ A;  4ORL A;  2CWV A;  5GSP A;  2K54 A;  4FCJ A;  3DM8 A;  2RBI A;  3SXX A;  1QJG A;  3EC9 A;  3F7X A;  1W02 A;  3B4P A;  3NBB A;  1TIJ A;  1BAO A;  3FSD A;  3G16 A;  4O3V A;  1QMA A;  4FR9 A;  4HOH A;  4HM4 B;  5IEP A;  1T5Y A;  1WMP A;  1KWI A;  3CNX A;  1BOX A;  4FMB A;  4X2O A;  4RBN A;  1JZD A;  4DKI A;  5I97 A;  3LTC A;  3ROB A;  1GD4 A;  2Y74 A;  3FLJ A;  5CXO A;  1BRI A;  1N9J A;  2FGT A;  4FCM A;  2W9P A;  1WNH A;  1Q7H A;  2Q07 A;  2C4B A;  1R4C A;  3LT8 A;  2L1S A;  3NX0 A;  1IVV A;  3D5I A;  1SQW A;  3OWS A;  1IU7 A;  3A5E A;  1UUW B;  1BUJ A;  4RNT A;  1RRL A;  1BNS A;  3AGO A;  3KSE D;  1I3F A;  2K3D A;  2W04 A;  3JUP A;  4EYC A;  3PS8 A;  2INX A;  3Q1C A;  3D9R A;  4NPB A;  1EUI C;  3MWZ A;  3DUK A;  5D82 A;  5IG3 A;  4GB5 A;  1QAF A;  1IVW A;  7RNT A;  3EN1 B;  2L4V A;  1GOU A;  2H0H A;  1CQS A;  3LTA A;  1AVK A;  1LRA A;  5FGO A;  3FG3 A;  1RGL A;  2ZDJ A;  3GZY B;  1BIR A;  3MSO A;  5BVB A;  5ELJ A;  1OGZ A;  6STD A;  3JUO A;  4IT7 A;  3HI7 A;  4BTX A;  2P05 A;  2XRX B;  1LNI A;  5AEW B;  1M9G A;  1FUW A;  5JPP A;  1AV4 A;  1YVS A;  3S67 A;  2JQ5 A;  3NXJ A;  3QRD A;  3CCE 3;  3CCL 3;  2Y73 A;  3GRD A;  2OOV C;  3GZR A;  5EVH A;  2OTL 3;  5AIG A;  8RNT A;  4IPB A;  3OXA A;  3EX9 A;  5IG4 A;  5M19 A;  1OHS A;  1W01 A;  3DGO A;  2GU3 A;  2ZL8 A;  1RSN A;  2PNC A;  1N9E A;  1A67 A;  4WWU C;  3F7S A;  1TRP A;  3DGY A;  4TX4 A;  1VQ4 3;  8CHO A;  5AYS C;  4HM8 B;  5IEO A;  1YNV X;  2C11 A;  1EA2 A;  1PFP A;  2GBW B;  3B8L A;  3G8Z A;  3URP A;  1K73 4;  3BNE A;  2MC8 A;  3NM2 A;  4HYZ A;  1LQG C;  2CX0 A;  2KCD A;  3T8N A;  1UCJ A;  1O7M B;  3JUN A;  3BB9 A;  4N6N B;  4EV5 A;  1Q86 4;  3UNL A;  3A76 A;  1N5H A;  2ML5 A;  4RZM A;  2W9Q A;  1ISK A;  1JZO A;  1UI8 A;  2GSP A;  3HOH A;  3K5T A;  1BU4 A;  1PYL A;  3KN4 A;  1RGC A;  3MG1 A;  4X2H A;  3V92 A;  2P09 A;  4CJN A;  3UJM A;  3CD6 3;  1I3I A;  3D3L A;  1YI2 3;  1DVC A;  5BU4 A;  2RSX A;  5FW5 A;  1O7W B;  2F56 A;  1UCI A;  1NWW A;  3ZFZ A;  1GOY A;  3NUV A;  3FKA A;  4HM2 B;  2OTJ 3;  4N6U A;  3BNC A;  4LYL B;  2OCT A;  3CC7 3;  1MGW A;  4ZM8 A;  1CH0 A;  3KKG A;  4HZB B;  3I55 3;  3FG1 A;  4J5K A;  1G96 A;  1M1X B;  1O7G B;  3N8B A;  1ULJ B;  3G6E 3;  1BRH A;  1BVI A;  1I2F A;  1TUH A;  2XFT A;  3DGL A;  4MMZ B;  3WOE B;  1FW7 A;  2MF7 A;  1JRQ A;  1B2S A;  1VZZ A;  4J8T A;  4J9A A;  1STF I;  4N6O B;  1CYU A;  3I0Y A;  1MWU A;  4L7K A;  2KF3 A;  2M7O A;  4BTW A;  1TTO A;  5IF6 A;  3OX9 A;  2HOH A;  3ZG5 A;  3X3Z A;  1U5O A;  2HMO B;  1JKG B;  2XR8 B;  4KFD A;  4R9L A;  1LOX A;  2IUJ A;  1ROV A;  4CPK A;  2SAR A;  1W5Z A;  3LOY A;  1GD3 A;  2P0X A;  3CME 3;  2KXG A;  5A0O B;  3NM7 A;  3B7C A;  2BIR A;  2CFL A;  3RNT A;  2FNQ A;  2OQE A;  2AAE A;  1D6Y A;  1GMP A;  1K41 A;  3CPO A;  4LZI A;  4N3V A;  4HJL B;  4WFO A;  4AEQ A;  1RCL A;  3AGN A;  1JKG A;  4L8P A;  1JB4 A;  1W6Y A;  1KD1 4;  1S5A A;  2CFG A;  4CDL A;  1W2B 2;  5M18 A;  2O3O A;  5KP4 A;  2QGU A;  1BGS A;  1A2P A;  1OAC A;  3FGY A;  4QWT A;  3LML A;  3WR2 A;  3QK9 A;  1VQM 3;  1TFK A;  5DRV A;  3SLU A;  2SBL A;  2BMO B;  2XEP A;  3PGB A;  4BTY A;  1NB5 I;  1TFO A;  1STD A;  1B3S A;  2E2V A;  4OVM A;  1ROA A;  4G1M B;  3GSP A;  5G1K A;  2CFK A;  3UL6 A;  1I70 A;  1JBR A;  1MWR A;  2QIY A;  2XF3 A;  3CXC 2;  1WTH A;  1VQ6 3;  2CWT A;  3J7Y d;  3OW2 2;  2XH9 A;  3BU4 A;  3B4O A;  3FF0 A;  1B2Z A;  1VQN 3;  4FMA A;  4KVH A;  3GAX A;  3WMD A;  2XSO B;  3NBR A;  1FGR A;  2F5W A;  5AEU B;  3NBJ A;  1EEJ A;  1Q9E A;  2RNT A;  1RRH A;  4IIA A;  3HII A;  3V99 A;  3F8H A;  2CHC A;  3DMC A;  1WMN A;  5BIR A;  3WOF B;  3M8C A;  1UCK A;  1IQX A;  1VQ9 3;  1OCV A; 
#chains in the Genus database with same CATH homology
 1V74 A;  2CW9 A;  5IG0 A;  4R4K A;  4AKZ A;  1KQS 2;  1VQL 3;  2HMK B;  3CC4 3;  1ULI B;  2V1L A;  2RGQ A;  4WP5 A;  2P0M A;  4N6M A;  4XB5 A;  3CCU 3;  2HML B;  3V98 A;  3K0Z A;  3MHE A;  2I9W A;  1VQ5 3;  2CFD A;  2HMN B;  1C7H A;  2P38 A;  2A15 A;  3DZL A;  3KFQ C;  4OUQ A;  2UX0 A;  3BLZ A;  1ASK A;  4U13 A;  2C10 A;  2OOV A;  3O8Y A;  5G2G A;  1Q81 4;  4LGQ A;  3X41 A;  2BNG A;  2FXT A;  1EKM A;  4HM3 B;  1DMM A;  2XGL A;  1Q42 A;  1Y4K A;  3U97 A;  1RN7 A;  5IG5 A;  4O2H A;  5CF1 A;  3CCM 3;  1MNL A;  3ER7 A;  4HM6 B;  2BMQ B;  4STD A;  4R80 A;  1QAL A;  3Q2P A;  2RFR A;  3STD A;  3F40 A;  3RGA A;  1YJN 3;  1JJ2 2;  3NV0 B;  3FH1 A;  2B24 B;  1NJI 4;  2PZV A;  5D83 A;  3PXM A;  1GY5 A;  2BO9 B;  3UB1 A;  3VF1 A;  3S27 A;  3NQZ A;  3EJV A;  4NHF A;  1E3R A;  3MYT A;  1IT7 A;  1FGQ A;  1IV9 A;  2WOF A;  3MG3 A;  4H3U A;  3NHX A;  3NV0 A;  1D6Z A;  3PCS A;  3VSY A;  3FZW A;  1GY6 A;  3KII A;  1W6C A;  5BXQ A;  1FGO A;  5AIH A;  2HMJ B;  3PZW A;  1K9M 4;  1ZO2 A;  3HX8 A;  2Z76 A;  4HM0 B;  1VQP 3;  3F9S A;  3KZT A;  2W0Q A;  5AI1 A;  2LYX A;  4K1U A;  4HVN A;  2CFW A;  5LC7 A;  2CH9 A;  1GS3 A;  1DYU A;  3KE7 A;  4HBR A;  2Z6B A;  1IVX A;  5DRE A;  4K61 A;  1A90 A;  3X42 A;  4KZ1 A;  3OV4 A;  3FCS B;  3SOA A;  5CK6 A;  2R4I A;  2YFI B;  3MPH A;  3LTB A;  1E97 A;  3EE1 A;  1ZX2 A;  3EBT A;  1VQK 3;  1GYB A;  3G0K A;  1IV7 A;  1KSI A;  4MMY B;  3SOY A;  4EC6 A;  3DY5 A;  4OK0 A;  3FG4 A;  3T0U A;  3WOD G;  1LNH A;  1JB5 A;  1O7H B;  4WYK A;  1FGT A;  3JVC A;  5JPU A;  3LTD A;  5AII A;  1JNQ A;  3GZB A;  3CNM A;  5KP1 A;  5D81 A;  4O8S A;  1SII A;  2IMJ A;  1TU5 A;  2F98 A;  1O7N B;  1LVN A;  3U1W A;  3CCJ 3;  1Z1S A;  4HM5 B;  1YVB I;  1QVG 2;  3EN8 A;  2OWP A;  3S28 A;  1K8A 4;  3PYJ A;  1VQ8 3;  5IER A;  2GBX B;  1QAK A;  3T8U A;  2W6J H;  4MJD A;  4HM1 B;  4H61 A;  4XDW A;  1FA3 A;  3MKI A;  4GL6 A;  1J2B A;  3OWY A;  4XBY A;  3NQY A;  5CF2 A;  1JV2 B;  1NU3 A;  3F14 A;  2IA7 A;  1O7P B;  3MG2 A;  5KP3 A;  1CYV A;  4KFF A;  4XBT A;  3CMA 3;  3WA2 X;  1QVF 2;  4WHA A;  5LC6 A;  3DGN A;  1Q40 A;  2W03 A;  1OGX A;  2W56 A;  3H3H A;  2Z7A A;  3L0R A;  4AKY A;  1AVL A;  3HZP A;  3FF2 A;  3BND A;  2CG1 A;  4R9K A;  1JB2 A;  1DMN A;  2XFS A;  5TGN A;  3G4S 3;  3VGN A;  2Z77 A;  3X3Y A;  1YJ9 3;  1RKY A;  4HKV B;  3WA3 A;  2GU1 A;  4HZ9 B;  4EV2 A;  2CIU A;  1IQY A;  1RJO A;  4RNZ A;  1IT8 A;  1NO3 A;  3WDG B;  3CPW 2;  1A2V A;  1N5P A;  1W6G A;  1YGE A;  1WQL B;  3H51 A;  3CCV 3;  3BNB A;  3EF8 A;  3ALA A;  4Q53 A;  5JBS A;  2QA4 3;  1GY7 A;  1E3V A;  2B1X B;  3K7C A;  3N9H A;  1FGM A;  1VQO 3;  4LSO A;  2K0M A;  4MEI A;  3G71 3;  4L8O A;  1CEW I;  3IMA B;  2WOH A;  1BUQ A;  3DGM A;  1OF5 B;  4EXR A;  1OHO A;  2XSH B;  4O02 B;  1OPY A;  1AR0 A;  1UUV B;  2BMR B;  1IVU A;  1S72 3;  3ECF A;  1IQ8 A;  1US1 A;  3JUQ A;  3CC2 3;  3LZA A;  2XGN A;  2IUK A;  1VQ7 3;  3RGR A;  1OF5 A;  2F99 A;  3N54 B;  5AIF A;  1NDO B;  1Q7Y 4;  3SED A;  1SJW A;  4K1V A;  1IDP A;  5AYR B;  3Q90 A;  4XM4 A;  1LXE A;  5IEN A;  4FCZ A;  2CC3 A;  3CCS 3;  3CU3 A;  7STD A;  2YFL B;  2WGQ A;  1N8Q A;  3SX1 A;  1L5G B;  1YIT 3;  3LT9 A;  1YIJ 3;  1PU4 A;  3IPT A;  1UW1 A;  4N6L A;  2GXF A;  3E99 A;  1SPU A;  1W2Z A;  3SVA A;  3EBY A;  4HM7 B;  1W7C A;  3X40 A;  3IJE B;  1UI7 A;  4LMI A;  4EBG A;  4N6T A;  4JRF A;  4WYK B;  5EEO A;  3K63 A;  1W4N A;  2RCD A;  1YHQ 3;  1IK3 A;  5ELU A;  2BT3 A;  2F86 B;  4LEH A;  1WMO A;  3UL5 A;  2E2U A;  1EG9 B;  1MOL A;  4FMD A;  1NB3 I;  2QEX 3;  4NRE A;  4RNY A;  3HIG A;  4XDV A;  3CCR 3;  1D6U A;  1DVD A;  1TP6 A;  2CKF B;  2LQV A;  2D1W A;  2STD A;  3HK4 A;  4KFE A;  2E2T A;  2KRT A;  4JF8 A;  1HKX A;  4PEJ A;  4XBX A;  3EHC A;  3PCR A;  2HMM B;  1OUN A;  2GEX A;  5HGR A;  3GZX B;  1W00 A;  4R1K A;  5STD A;  2WO0 A;  3KSP A;  3OWU A;  1N8R 4;  1SIH A;  3EB8 A;  1M1K 4;  3DXO A;  1Q82 4;  3EQQ B;  1YJW 3;  2BHM A;  3GWR A;  4N6V 0;  1JN5 B;  2CK3 H;  1DMQ A;  3JUM A;  3TDG A;  3X3X A;  2W2C A;  1U8C B;  4K90 B;  5EQL A;  3S29 A;  3I56 3;  3LYG A;  1OH0 A;  4FMC A;  2CWU A;  3CCQ 3;  1Q40 B;  2CG0 A;  5IW9 A;  2YFJ B;  3AMO B;  1JN5 A;  2W56 B;  4CCV A;  3LXU X;  2D42 A;  3K9M C;  3S5C A;  1HU9 A;  3RDE A;  2JDI H;  5CLK A;  2ML6 A;  1K28 A;  1F8N A;  1EQK A;  2OQE C;  4MMX B;  4I4K A;  1OHP A;  2GEY A;  3AMO A;  3LH4 A;  2O9U X;  1A2K A;  2YX9 A;  1M90 4;  3F8X A;  2WGO A;  1KC8 4;  4ORL A;  2CWV A;  2K54 A;  4FCJ A;  3DM8 A;  3SXX A;  1QJG A;  3EC9 A;  3F7X A;  1W02 A;  3B4P A;  3NBB A;  1TIJ A;  3FSD A;  3G16 A;  4O3V A;  1QMA A;  4FR9 A;  5IEP A;  4HM4 B;  1T5Y A;  1WMP A;  1KWI A;  3CNX A;  4FMB A;  4X2O A;  5I97 A;  4RBN A;  3LTC A;  3ROB A;  1GD4 A;  2Y74 A;  3FLJ A;  5CXO A;  1N9J A;  2FGT A;  4FCM A;  2W9P A;  1WNH A;  2Q07 A;  1R4C A;  3LT8 A;  3NX0 A;  1IVV A;  3OWS A;  1SQW A;  1IU7 A;  1UUW B;  1RRL A;  3KSE D;  2W04 A;  3JUP A;  4EYC A;  3PS8 A;  2INX A;  3Q1C A;  3D9R A;  3MWZ A;  3DUK A;  5D82 A;  5IG3 A;  4GB5 A;  1QAF A;  1IVW A;  3EN1 B;  2L4V A;  1CQS A;  3LTA A;  1AVK A;  5FGO A;  3FG3 A;  2ZDJ A;  3GZY B;  5BVB A;  3MSO A;  5ELJ A;  1OGZ A;  6STD A;  3JUO A;  4IT7 A;  3HI7 A;  4BTX A;  2P05 A;  2XRX B;  5AEW B;  1M9G A;  1FUW A;  5JPP A;  1AV4 A;  3S67 A;  2JQ5 A;  3NXJ A;  3QRD A;  3CCE 3;  3CCL 3;  2Y73 A;  3GRD A;  2OOV C;  3GZR A;  5EVH A;  2OTL 3;  5AIG A;  4IPB A;  3OXA A;  3EX9 A;  5IG4 A;  1OHS A;  1W01 A;  3DGO A;  2GU3 A;  2ZL8 A;  2PNC A;  1N9E A;  1A67 A;  4WWU C;  3F7S A;  4TX4 A;  1VQ4 3;  8CHO A;  5AYS C;  4HM8 B;  5IEO A;  3B8L A;  2C11 A;  1EA2 A;  1PFP A;  2GBW B;  3G8Z A;  1K73 4;  3BNE A;  2MC8 A;  3NM2 A;  4HYZ A;  3T8N A;  4EV5 A;  2KCD A;  3JUN A;  1O7M B;  4N6N B;  3BB9 A;  1Q86 4;  3UNL A;  3A76 A;  1N5H A;  2ML5 A;  4RZM A;  2W9Q A;  1ISK A;  1UI8 A;  3K5T A;  3KN4 A;  4X2H A;  3MG1 A;  3V92 A;  2P09 A;  3UJM A;  3CD6 3;  3D3L A;  1YI2 3;  1DVC A;  2RSX A;  5FW5 A;  1O7W B;  1NWW A;  3NUV A;  3FKA A;  4HM2 B;  2OTJ 3;  4N6U A;  3BNC A;  3CC7 3;  2OCT A;  4ZM8 A;  3KKG A;  4HZB B;  3I55 3;  3FG1 A;  1G96 A;  1M1X B;  1O7G B;  3N8B A;  1ULJ B;  3G6E 3;  3WOE B;  1TUH A;  2XFT A;  3DGL A;  4MMZ B;  2MF7 A;  1JRQ A;  1VZZ A;  4J8T A;  4J9A A;  1STF I;  4N6O B;  1CYU A;  3I0Y A;  4L7K A;  2M7O A;  4BTW A;  5IF6 A;  3OX9 A;  3X3Z A;  1U5O A;  2HMO B;  2XR8 B;  1JKG B;  4KFD A;  4R9L A;  1LOX A;  2IUJ A;  1ROV A;  1W5Z A;  3LOY A;  1GD3 A;  2P0X A;  3CME 3;  2KXG A;  5A0O B;  3NM7 A;  3B7C A;  2CFL A;  2FNQ A;  2OQE A;  1D6Y A;  3CPO A;  1K41 A;  4LZI A;  4N3V A;  4HJL B;  4WFO A;  4AEQ A;  1JKG A;  4L8P A;  1JB4 A;  1W6Y A;  1KD1 4;  1S5A A;  2CFG A;  4CDL A;  1W2B 2;  2O3O A;  5KP4 A;  2QGU A;  1OAC A;  3FGY A;  4QWT A;  3LML A;  3QK9 A;  1VQM 3;  1TFK A;  5DRV A;  3SLU A;  2SBL A;  2BMO B;  2XEP A;  3PGB A;  4BTY A;  1NB5 I;  1TFO A;  1STD A;  2E2V A;  4OVM A;  1ROA A;  4G1M B;  2CFK A;  3UL6 A;  2QIY A;  2XF3 A;  3CXC 2;  1WTH A;  1VQ6 3;  2CWT A;  3J7Y d;  3OW2 2;  2XH9 A;  3FF0 A;  3B4O A;  1VQN 3;  4FMA A;  4KVH A;  3GAX A;  3WMD A;  2XSO B;  3NBR A;  1FGR A;  5AEU B;  3NBJ A;  1RRH A;  4IIA A;  3HII A;  3V99 A;  3F8H A;  2CHC A;  3DMC A;  1WMN A;  3WOF B;  3M8C A;  1IQX A;  1VQ9 3;  1OCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...