2O9UX

Monellin (mnei) at 1.15 resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
95
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Monellin chain B and Monellin chain A
publication title Monellin (MNEI) at 1.15 A resolution
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 23
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2o9uX00
1GD4A 5EQLA 3PYJA 3PXMA 4CCVA 1M9GA 1TIJA 2BO9B 1MNLA 3IMAB 4TX4A 2KXGA 1PFPA 3UL6A 1R4CA 4N6V0 3LH4A 4N6MA 5ELUA 1KWIA 3MWZA 1CYVA 4N6LA 1N9JA 4N6TA 5LC7A 1A67A 2W9PA 4ZM8A 1ROAA 4N6UA 4N6OB 3PS8A 1RN7A 3KFQC 2W9QA 1CYUA 2CH9A 5ELJA 1YVBI 5LC6A 3L0RA 1NB5I 3S67A 1N5PA 4IT7A 3UL5A 3QRDA 4N6NB 4LZIA 5A0OB 3SVAA 1LXEA 3Q2PA 1G96A 3K9MC 1FA3A 2O9UX 1GD3A 3KSED 3NX0A 1STFI 1N5HA 1A90A 1DVCA 1IV9A 4EYCA 1FUWA 1CEWI 1EQKA 1DVDA 2OCTA 1MOLA 1NB3I 3GAXA 1IV7A 1WNHA
chains in the Genus database with same CATH superfamily
3OV4A 4HM5B 5HGRA 3PYJA 2CG0A 5CF1A 1PU4A 2P38A 3CNMA 2P0MA 3CNXA 1TU5A 1RKYA 2XFSA 1W2B2 1W6CA 1O7GB 2P0XA 3PXMA 1X1UA 1BSEA 1ZS7A 3U1WA 1B2MA 3BB9A 4OK0A 1LRAA 1TIJA 2BO9B 3EN8A 3UNLA 1MNLA 1HZ1A 3S28A 1BNIA 4TX4A 4X2OA 1Q40B 3AMOB 3DY5A 3NHXA 1N9EA 1R4YA 1BGSA 3F14A 1LQMB 3NQYA 1PFPA 3FF0A 3UL6A 1TRPA 1JBTA 1BSDA 1BU4A 3SOAA 3X42A 5BU4A 1M1K4 1UUGB 1BNGA 1VQ63 1UGIA 2GXFA 2V1LA 5AYSC 3CC23 4HM0B 1IYYA 4HM4B 3MWZA 3AMOA 3CCR3 2AAEA 1RGGA 3HOHA 4BTXA 5CF2A 1K8A4 1FYSA 5LC7A 1BNFA 3LTBA 5G1KA 5AEWB 4BTWA 1ROAA 3LOYA 3G8ZA 1DMQA 5CLKA 2E2TA 3GZXB 3GRDA 1RSNA 1W6GA 7RNTA 3WOFB 2GEYA 4CJNA 2XR8B 1STDA 4MMXB 2HMMB 1AVLA 1UCKA 1GOYA 2CH9A 1WMNA 2E2UA 2F5MA 3DXOA 3LXUX 4HKVB 3TDGA 2QEX3 1U5OA 5ELJA 4HYZA 1C54A 1VQL3 5LC6A 1W4NA 3D4AA 5JPPA 3L0RA 1V58A 1NB5I 4RNZA 2F98A 1JB2A 2P05A 4G1MB 1PY3A 1RGAA 3Q3FA 1GSPA 1BNRA 1S723 3UL5A 2R4IA 3QRDA 1NJI4 4NPBA 3CCJ3 4LZIA 5A0OB 3HX8A 3WMDA 2LYXA 1YJW3 1RTUA 3CCV3 1L5GB 4EV5A 3MPHA 1Q7HA 3LYGA 1LXEA 3Q2PA 1QJGA 3HK4A 5IEOA 3I553 3K9MC 1SQWA 2IYJA 4LGQA 1D6UA 4R1KA 1RCKA 1BRKA 2KF6A 2BT3A 1BANA 1EEJA 1YHQ3 1FZUA 7GSPA 1KC84 4XBXA 5G2GA 2K0MA 1Q864 4KFFA 3NX0A 2CKFB 4WWUC 1WMOA 3HZPA 1IU7A 1IQ8A 2ML6A 1C7HA 4I4KA 1JJ22 4U13A 3EF8A 2GSPA 5EEOA 1HKXA 4GL6A 2WO0A 2RFRA 1JZOA 1D6ZA 2CX1A 3KN4A 1GOVA 3OWUA 3BNBA 1IT7A 2BU4A 3SOYA 3S27A 1FUWA 1IVXA 1ZO2A 3DGOA 2SARA 3T0UA 4AKYA 2OCTA 1QAFA 4L8PA 4O3VA 1NB3I 3ALAA 2XEPA 4K90B 3A5EA 3STDA 3V99A 1TRQA 1RJOA 1FGOA 1JRQA 2GBXB 3NXJA 1RGCA 1IQYA 1I8VA 4K61A 3CME3 1VQ93 1BVIA 1EG9B 2ZDJA 3D5GA 2BMOB 4AKZA 3EBTA 2OOVA 1B2ZA 2UGIA 5IG5A 2QGUA 1GD4A 4QWTA 2BHMA 1KSIA 3MSOA 1GS3A 2PZVA 2C4BA 2XSOB 1RGEA 3AHWA 1K9M4 2GU3A 1GMRA 2XFTA 1WMPA 1SARA 1RNTA 5DRVA 3OWSA 4RBNA 3U97A 1W02A 3D9RA 3IMAB 1I70A 2Q07A 2OQEA 1NO3A 2I9WA 1HYFA 1Z1SA 4BIRA 5BIRA 3OW22 4XBYA 1SIHA 1UCJA 3J7Yd 3PCSA 4N6V0 1ISKA 1I0XA 3VGNA 3CC73 1FGRA 4X2HA 3PZWA 1W7CA 2W56B 4N6MA 2W0QA 5ELUA 1Q824 1KWIA 1TJDA 3X40A 3DGYA 4N6LA 5M19A 4FMCA 1W01A 1MWSA 1RGKA 5KP4A 1EKMA 2HMLB 2HMNB 2CX0A 1A67A 3N54B 2Z6BA 1YIJ3 3GSPA 2W56A 3B8LA 2Z76A 5D83A 4GSPA 1NU3A 1V74A 1DMNA 4GHOA 4R4KA 2W9QA 1VQ43 2QA43 3B7CA 2KRTA 3HIGA 1X1YA 3ECFA 6RNTA 2LQVA 4FMBA 2YFJB 2MF7A 2CFGA 5AI1A 4XDVA 5IG0A 1ASKA 1I3FA 1W6YA 2CFDA 2CW9A 2ZHXB 3EE1A 2UX0A 4XM4A 1YVSA 4I5QA 2Z77A 2E2VA 1BSBA 1JV2B 1I2GA 1LNHA 1RGHA 2R41A 1LNIA 3EHCA 3EX9A 4OVMA 2OTJ3 2YX9A 1OH0A 4NHFA 5AIGA 2J8XB 2ZA4A 1B2XA 1MGWA 8RNTA 1N8R4 2FNQA 3S5CA 2D42A 3NV0A 4O8SA 1I2EA 2CHCA 1T3BA 3WA2X 3V92A 5IG3A 1GY6A 1U8CB 1OHPA 5FW5A 3B4OA 1CYUA 2YFIB 4FMDA 5CXOA 3X3YA 3BNCA 3JUNA 3SYUA 3BNEA 4FMAA 4EV2A 1VZZA 1US1A 2CFWA 5JBSA 3CCU3 2GU1A 4JRFA 3RGAA 3T8UA 3M8CA 3CMA3 1BSAA 2RGQA 1NWWA 2IY2A 3X41A 3LTDA 1RDSA 1N8QA 7STDA 1ULJB 1QAKA 1DVCA 4WP5A 4RZMA 3CCQ3 3KSPA 4FCZA 2JQ5A 3OX9A 1GY5A 4J9AA 2F86B 3DGNA 3EQQB 3UJMA 2CIUA 5BXQA 1FGQA 3AHSA 2C11A 2XSHB 1T5YA 4FR9A 5D81A 1JKGA 2RSXA 1OUNA 1MOLA 3BIRA 5I97A 2CFLA 5AYRB 3DH2A 1LVNA 2KCDA 3IJEB 3ZG0A 1O7HB 1OF5A 3V98A 1CH0A 2K3DA 5TGNA 3WDGB 1VQ73 4HM3B 1QMAA 4LYLB 1SIIA 5IERA 4WHAA 1BAOA 3G713 2FXTA 4HZBB 1K28A 3JUOA 1W5ZA 1FGTA 4MJDA 1WNHA 3MYTA 3NBBA 4K1VA 5KP3A 4BU4A 3X3XA 1UDII 4NREA 3SLUA 3T8NA 4J8TA 1Q9EA 1B2SA 2W04A 3FGYA 3N8BA 4HOHA 4LEHA 2KF3A 1O7WB 2INXA 1RLSA 4EBGA 3WODG 1YJ93 2K54A 1W2ZA 1VQP3 1RMSA 2B24B 2W2CA 3KZTA 4FCJA 5IF6A 3EJVA 3G0KA 3DUKA 4XB5A 2D1WA 3AGOA 1EUIC 2Y73A 3JVCA 1BRHA 2BMQB 3VSYA 1RRLA 1E3VA 1R4CA 4J5KA 1YJN3 2OOVC 2KF4A 4H61A 2KAAA 3WR2A 1BNSA 1LQGC 2C10A 3BU4A 1E97A 3LH4A 3QK9A 4HM8B 1FW7A 4GB5A 3PCRA 4OUQA 3O8YA 1JBSA 2HMOB 4BL3A 4BTYA 2OTL3 1PYLA 2H0GA 1UCIA 1RNBA 1N9JA 2CG1A 3JUQA 2HMKB 3S29A 1M1XB 3CCE3 1KQS2 5G1LA 1VQO3 3GWRA 4ZM8A 3A76A 2F56A 3DGMA 3IPTA 1YNVX 1OGXA 2OQEC 2B1XB 4N6UA 3MG2A 4N6OB 3URPA 3EC9A 3HIIA 1UI8A 4RNTA 2F5WA 1BRIA 4HM2B 1TTOA 3ZFZA 3BLZA 2CWUA 1QVG2 1MGRA 3RDEA 4KVHA 4WYKA 4HM1B 3G6E3 1YVBI 1AR0A 1Q7Y4 5STDA 2XH9A 3I0YA 3LT8A 1IVVA 4L7KA 1GMQA 1VQ83 1TFOA 2GBWB 2WOFA 1DMMA 1HU9A 1JB4A 2H0IA 4KFEA 2UUGC 4R80A 5DREA 1N5PA 1Q42A 5AEUB 2BMRB 4IT7A 4N6NB 3RGRA 1JN5A 1SPUA 1JNQA 1RN4A 5D82A 4EW5A 1VQM3 1D6YA 2MC8A 1J2BA 1MWTA 4Q53A 1VQN3 2HMJB 1BRGA 3OWYA 1S5AA 3UB1A 1LOYA 3Q1CA 4KZ1A 1YGEA 4HM7B 2QIYA 2P09A 1G96A 9RNTA 1TUHA 4JF8A 3FSDA 1RGFA 5RNTA 1UUVB 1AQZA 1ROVA 3N9HA 2RBIA 1AVKA 4DKIA 1GOUA 3KSED 3K0ZA 3NV0B 4H3UA 1JZDA 3ZG5A 1YIT3 1WTHA 1B20A 4PEJA 3B4PA 3X3ZA 1N5HA 1LOVA 1ZX2A 2H0HA 1A90A 2ML5A 3WHOA 1TFKA 2WGQA 3AGNA 2WGOA 3HI7A 3LTAA 1B27A 4CPKA 2O3OA 2L1SA 4ILFA 1Q814 1MWUA 3K5TA 5HOHA 1EQKA 3CC43 1B3SA 4O02B 3LZAA 3KE7A 1OHSA 3SEDA 4R9KA 1OACA 1X1WA 3GAXA 4IPBA 1YI23 4J5GA 3D79A 1UW1A 1IV7A 2JDIH 3LT9A 1RGLA 3D5IA 3ROBA 3LMLA 6GSPA 1K734 2IUKA 2PNCA 3PGBA 3JUPA 1IVWA 5AIIA 4LSOA 2WOHA 4N3VA 1Q40A 5BVBA 3K63A 1JKGB 1BRNL 5EQLA 1VQK3 1AY7A 3F40A 2F4YA 3OXAA 3DGLA 4HJLB 1IK3A 1OF5B 2IA7A 3MG3A 5IENA 4CCVA 1W00A 1M9GA 1RRHA 1T2IA 1A2KA 3FG4A 1T2HA 5AIFA 3EB8A 3CCL3 1OCVA 2M7OA 1WQLB 3MHEA 2KXGA 2YFLB 1QVF2 2Z7AA 2SBLA 2STDA 1B2UA 2BIRA 3JUMA 2HOHA 2AADA 1X1XA 3RNTA 4MEIA 2RNTA 3F7SA 1CYVA 1BUJA 4EC6A 4XBTA 1UCLA 3GZRA 3NBRA 3EBYA 3FG1A 3NM7A 4N6TA 1GYBA 2W9PA 3KCHA 4AEQA 4CDLA 3WA3A 1DYUA 1F8NA 1IVUA 1ZGXA 1A2VA 1DETA 4HZ9B 5CK6A 2ZL8A 1TP6A 1E3RA 1RN7A 3DMCA 1IDPA 3KFQC 3MG1A 3PS8A 4WFOA 1BUQA 1K41A 3WOEB 2FGTA 1O7PB 3DZLA 3FH1A 3G16A 3KKGA 1JB5A 3NM2A 1BIRA 5AIHA 1OHOA 2XF3A 4R9LA 1NDOB 3ER7A 3MKIA 1KD14 3BNDA 1BNEA 5FGOA 3FG3A 1RHLA 3SX1A 1BRSA 4LMIA 2XGLA 5GSPA 2KF5A 4STDA 1EA2A 3S67A 2CWTA 4EXRA 3FLJA 1JBRA 5M18A 3F8HA 5M1AA 1I0VA 3D3LA 1CQSA 1O7NB 4O2HA 1OGZA 5EVHA 2F99A 5KP1A 3FCSB 2IUJA 3GZBA 3CXC2 3CPOA 5IEPA 3G4S3 3K7CA 1B21A 1BRJA 4MMZB 3FZWA 4WYKB 3SVAA 4ORLA 3CPW2 2A15A 3I563 1O7MB 3FF2A 4HVNA 2GEXA 1RN1A 3F8XA 6STDA 4KT3B 1FA3A 3NUVA 4HM6B 2O9UX 3GZYB 3VF1A 3H3HA 1UGHI 1GD3A 2CC3A 8CHOA 2XGNA 1JN5B 3DM8A 3EN1B 5JPUA 3E99A 1STFI 3LTCA 1VQQA 1IT8A 4KFDA 1BSCA 4L8OA 3CCS3 2RCDA 3FKAA 4RNYA 1I2FA 1IV9A 2IMJA 3Q90A 1M904 3CCM3 1MWRA 4HAAA 1Y4KA 1UI7A 1GY7A 4EYCA 3H51A 2CK3H 1UUWB 1A2PA 3SXXA 1CEWI 2BNGA 3NQZA 2OWPA 1QALA 1SJWA 1YGWA 1FGMA 1ULIB 4IIAA 2XRXB 1DVDA 4FCMA 1G0TA 2L4VA 4K1UA 3F9SA 1AV4A 1VQ53 1V57A 1IQXA 2CFKA 3KIIA 1I3IA 1FUTA 2W6JH 4XDWA 4BL2A 3NBJA 4HBRA 1DE3A 1BNJA 1LOWA 3CU3A 1G02A 2W03A 3CD63 3F7XA 1LOXA 2CWVA 1GMPA 4MMYB 1RCLA 5IG4A 1NNVA 1OPYA 1FUSA 1BOXA 5IW9A 2Y74A
chains in the Genus database with same CATH topology
3OV4A 4HM5B 5HGRA 3PYJA 2CG0A 5CF1A 1PU4A 2P38A 3CNMA 2P0MA 3CNXA 1TU5A 1RKYA 2XFSA 1W2B2 1W6CA 1O7GB 2P0XA 3PXMA 3U1WA 3BB9A 4OK0A 1TIJA 3EN8A 2BO9B 3UNLA 1MNLA 3S28A 4TX4A 4X2OA 1Q40B 3AMOB 3DY5A 3NHXA 1N9EA 3F14A 3NQYA 1PFPA 3FF0A 3UL6A 3X42A 3SOAA 1M1K4 1VQ63 2GXFA 2V1LA 5AYSC 3CC23 4HM0B 4HM4B 3MWZA 3AMOA 3CCR3 4BTXA 5CF2A 1K8A4 5LC7A 3LTBA 5AEWB 4BTWA 1ROAA 3LOYA 3G8ZA 1DMQA 5CLKA 2E2TA 3GZXB 3GRDA 1W6GA 3WOFB 2GEYA 2XR8B 1STDA 4MMXB 2HMMB 1AVLA 3LXUX 2CH9A 1WMNA 2E2UA 3DXOA 2QEX3 1CYUA 4HKVB 3TDGA 1U5OA 5ELJA 4HYZA 1VQL3 5LC6A 1W4NA 5JPPA 3L0RA 1NB5I 4RNZA 2F98A 1JB2A 2P05A 4G1MB 1S723 3UL5A 2R4IA 3QRDA 1NJI4 3CCJ3 4LZIA 5A0OB 3HX8A 3WMDA 2LYXA 1YJW3 3CCV3 1L5GB 4EV5A 3MPHA 3LYGA 1LXEA 3Q2PA 1QJGA 3HK4A 5IEOA 3I553 3K9MC 1SQWA 4LGQA 1D6UA 4R1KA 2BT3A 1YHQ3 1KC84 4XBXA 5G2GA 2K0MA 1Q864 4KFFA 3NX0A 2CKFB 4WWUC 1WMOA 3HZPA 1IU7A 1IQ8A 2ML6A 1C7HA 4I4KA 1JJ22 4U13A 3EF8A 5EEOA 1HKXA 4GL6A 2WO0A 2RFRA 3KN4A 1D6ZA 3OWUA 3BNBA 1IT7A 3SOYA 1FUWA 3S27A 1IVXA 1ZO2A 3DGOA 3T0UA 4AKYA 2OCTA 1QAFA 4L8PA 4O3VA 1NB3I 3ALAA 2XEPA 4K90B 3STDA 3V99A 1RJOA 1FGOA 1JRQA 2GBXB 3NXJA 1IQYA 4K61A 3CME3 1VQ93 1EG9B 2ZDJA 2BMOB 4AKZA 3EBTA 2OOVA 5IG5A 2QGUA 1GD4A 4QWTA 2BHMA 1KSIA 3MSOA 1GS3A 2PZVA 2XSOB 1K9M4 2GU3A 2XFTA 1WMPA 5DRVA 3OWSA 4RBNA 3U97A 1W02A 3D9RA 3IMAB 2Q07A 2OQEA 1NO3A 2I9WA 1Z1SA 3OW22 4XBYA 1SIHA 3J7Yd 3PCSA 4N6V0 1ISKA 3VGNA 3CC73 1FGRA 4X2HA 3PZWA 1W7CA 2W56B 4N6MA 2W0QA 5ELUA 1Q824 1KWIA 3X40A 4N6LA 4FMCA 1W01A 5KP4A 1EKMA 2HMLB 2HMNB 1A67A 3N54B 2Z6BA 1YIJ3 2W56A 3B8LA 2Z76A 5D83A 1NU3A 1V74A 1DMNA 4R4KA 2W9QA 1VQ43 2QA43 3B7CA 2KRTA 3HIGA 3ECFA 2LQVA 4FMBA 2YFJB 2MF7A 2CFGA 5AI1A 4XDVA 5IG0A 1ASKA 2CFDA 1W6YA 2CW9A 3EE1A 2UX0A 4XM4A 2Z77A 2E2VA 1JV2B 3EX9A 1LNHA 3EHCA 2OTJ3 4OVMA 2YX9A 1OH0A 4NHFA 5AIGA 1N8R4 2FNQA 3S5CA 2D42A 3NV0A 4O8SA 2CHCA 3WA2X 3V92A 5IG3A 1GY6A 1U8CB 1OHPA 5FW5A 3B4OA 2YFIB 4FMDA 5CXOA 3X3YA 3BNCA 3JUNA 4EV2A 3BNEA 4FMAA 5JBSA 1VZZA 1US1A 2CFWA 3CCU3 2GU1A 4JRFA 3RGAA 3T8UA 3M8CA 3CMA3 2RGQA 1NWWA 3X41A 3LTDA 1N8QA 7STDA 1ULJB 1QAKA 1DVCA 4WP5A 4RZMA 3CCQ3 3KSPA 4FCZA 2JQ5A 3OX9A 1GY5A 4J9AA 2F86B 3DGNA 3EQQB 3UJMA 2CIUA 5BXQA 1FGQA 2C11A 2XSHB 1T5YA 4FR9A 5D81A 1JKGA 2RSXA 1OUNA 1MOLA 5I97A 2CFLA 5AYRB 1LVNA 2KCDA 3IJEB 1O7HB 1OF5A 3V98A 5TGNA 3WDGB 1VQ73 4HM3B 1QMAA 1SIIA 5IERA 4WHAA 3G713 2FXTA 4HZBB 1K28A 3JUOA 1W5ZA 1FGTA 4MJDA 1WNHA 3MYTA 3NBBA 4K1VA 5KP3A 3X3XA 3T8NA 4NREA 3SLUA 4J8TA 3N8BA 2W04A 3FGYA 4LEHA 1O7WB 2INXA 4EBGA 3WODG 1YJ93 2K54A 1W2ZA 1VQP3 2W2CA 2B24B 3KZTA 4FCJA 5IF6A 3EJVA 3G0KA 3DUKA 4XB5A 2D1WA 2Y73A 3JVCA 2BMQB 3VSYA 1RRLA 1E3VA 1R4CA 1YJN3 2OOVC 4H61A 2C10A 3LH4A 1E97A 3QK9A 4HM8B 4GB5A 3PCRA 4OUQA 3O8YA 2OTL3 2HMOB 4BTYA 1N9JA 2CG1A 3JUQA 2HMKB 3S29A 1M1XB 3CCE3 1KQS2 1VQO3 3GWRA 4ZM8A 3A76A 3DGMA 3IPTA 1OGXA 2OQEC 2B1XB 4N6UA 3MG2A 4N6OB 3EC9A 3HIIA 1UI8A 4HM2B 3BLZA 2CWUA 1QVG2 3RDEA 4KVHA 4WYKA 4HM1B 3G6E3 1YVBI 1AR0A 1Q7Y4 5STDA 2XH9A 3I0YA 1IVVA 4L7KA 1VQ83 1TFOA 2GBWB 2WOFA 1DMMA 1HU9A 1JB4A 4KFEA 4R80A 5DREA 1N5PA 1Q42A 5AEUB 2BMRB 4IT7A 4N6NB 3RGRA 1JN5A 1SPUA 1JNQA 5D82A 1VQM3 1D6YA 2MC8A 1J2BA 4Q53A 1VQN3 2HMJB 3OWYA 1S5AA 3UB1A 3Q1CA 4KZ1A 1YGEA 4HM7B 2QIYA 2P09A 1G96A 1TUHA 4JF8A 3FSDA 1UUVB 3N9HA 1ROVA 1AVKA 3KSED 3K0ZA 3NV0B 4H3UA 1YIT3 1WTHA 4PEJA 3B4PA 3X3ZA 1N5HA 1ZX2A 1A90A 2ML5A 1TFKA 2WGQA 2WGOA 3HI7A 3LTAA 2O3OA 1Q814 3K5TA 1EQKA 3CC43 4O02B 3LZAA 3KE7A 1OHSA 3SEDA 4R9KA 1OACA 3GAXA 4IPBA 1YI23 1UW1A 1IV7A 2JDIH 3LT9A 1K734 3ROBA 3LMLA 2IUKA 2PNCA 3PGBA 3JUPA 1IVWA 5AIIA 4LSOA 2WOHA 4N3VA 1Q40A 5BVBA 3K63A 1JKGB 5EQLA 1VQK3 3F40A 3OXAA 3DGLA 4HJLB 1IK3A 1OF5B 2IA7A 3MG3A 5IENA 4CCVA 1W00A 1M9GA 1RRHA 1A2KA 3FG4A 5AIFA 3EB8A 3CCL3 1OCVA 2M7OA 1WQLB 3MHEA 2KXGA 2YFLB 1QVF2 2Z7AA 2SBLA 2STDA 3JUMA 4MEIA 3F7SA 1CYVA 4EC6A 4XBTA 3GZRA 3NBRA 3EBYA 3FG1A 3NM7A 4N6TA 1GYBA 2W9PA 4AEQA 4CDLA 3WA3A 1DYUA 1F8NA 1IVUA 1A2VA 4HZ9B 5CK6A 2ZL8A 1TP6A 1E3RA 1RN7A 3DMCA 1IDPA 3KFQC 3MG1A 3PS8A 4WFOA 1BUQA 1K41A 3WOEB 2FGTA 1O7PB 3DZLA 3FH1A 3G16A 3KKGA 1JB5A 3NM2A 5AIHA 1OHOA 2XF3A 4R9LA 1NDOB 3ER7A 3MKIA 1KD14 3BNDA 5FGOA 3FG3A 3SX1A 4LMIA 2XGLA 4EXRA 4STDA 1EA2A 3S67A 2CWTA 3FLJA 3F8HA 3D3LA 1CQSA 1O7NB 4O2HA 1OGZA 5EVHA 2F99A 5KP1A 3FCSB 2IUJA 3GZBA 3CXC2 3CPOA 5IEPA 3G4S3 3K7CA 4WYKB 4MMZB 3FZWA 3SVAA 4ORLA 3CPW2 2A15A 3I563 1O7MB 3FF2A 4HVNA 2GEXA 3F8XA 6STDA 1FA3A 3NUVA 4HM6B 2O9UX 3GZYB 3VF1A 3H3HA 1GD3A 2CC3A 8CHOA 2XGNA 1JN5B 3DM8A 3EN1B 5JPUA 3E99A 1STFI 3LTCA 1IT8A 4KFDA 4L8OA 3CCS3 2RCDA 3FKAA 4RNYA 2IMJA 1IV9A 3Q90A 1M904 3CCM3 1Y4KA 1UI7A 1GY7A 4EYCA 3H51A 2CK3H 1UUWB 3SXXA 1CEWI 2BNGA 3NQZA 2OWPA 1QALA 1SJWA 1FGMA 1ULIB 4IIAA 2XRXB 1DVDA 4FCMA 2L4VA 4K1UA 3F9SA 1AV4A 1VQ53 1IQXA 2CFKA 3KIIA 2W6JH 4XDWA 3NBJA 4HBRA 3CU3A 2W03A 3CD63 3F7XA 1LOXA 2CWVA 4MMYB 5IG4A 1OPYA 3LT8A 5IW9A 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD4 A;  5EQL A;  3PYJ A;  3PXM A;  4CCV A;  1M9G A;  1TIJ A;  2BO9 B;  1MNL A;  3IMA B;  4TX4 A;  2KXG A;  1PFP A;  3UL6 A;  1R4C A;  4N6V 0;  3LH4 A;  4N6M A;  5ELU A;  1KWI A;  3MWZ A;  1CYV A;  4N6L A;  1N9J A;  4N6T A;  5LC7 A;  1A67 A;  2W9P A;  4ZM8 A;  1ROA A;  4N6U A;  4N6O B;  3PS8 A;  1RN7 A;  3KFQ C;  2W9Q A;  1CYU A;  2CH9 A;  5ELJ A;  1YVB I;  5LC6 A;  3L0R A;  1NB5 I;  3S67 A;  1N5P A;  4IT7 A;  3UL5 A;  3QRD A;  4N6N B;  4LZI A;  5A0O B;  3SVA A;  1LXE A;  3Q2P A;  1G96 A;  3K9M C;  1FA3 A;  2O9U X;  1GD3 A;  3KSE D;  3NX0 A;  1STF I;  1N5H A;  1A90 A;  1DVC A;  1IV9 A;  4EYC A;  1FUW A;  1CEW I;  1EQK A;  1DVD A;  2OCT A;  1MOL A;  1NB3 I;  3GAX A;  1IV7 A;  1WNH A; 
#chains in the Genus database with same CATH topology
 3OV4 A;  4HM5 B;  5HGR A;  3PYJ A;  2CG0 A;  5CF1 A;  1PU4 A;  2P38 A;  3CNM A;  2P0M A;  3CNX A;  1TU5 A;  1RKY A;  2XFS A;  1W2B 2;  1W6C A;  1O7G B;  2P0X A;  3PXM A;  1X1U A;  1BSE A;  1ZS7 A;  3U1W A;  1B2M A;  3BB9 A;  4OK0 A;  1LRA A;  1TIJ A;  2BO9 B;  3EN8 A;  3UNL A;  1MNL A;  1HZ1 A;  3S28 A;  1BNI A;  4TX4 A;  4X2O A;  1Q40 B;  3AMO B;  3DY5 A;  3NHX A;  1N9E A;  1R4Y A;  1BGS A;  3F14 A;  1LQM B;  3NQY A;  1PFP A;  3FF0 A;  3UL6 A;  1TRP A;  1JBT A;  1BSD A;  1BU4 A;  3SOA A;  3X42 A;  5BU4 A;  1M1K 4;  1UUG B;  1BNG A;  1VQ6 3;  1UGI A;  2GXF A;  2V1L A;  5AYS C;  3CC2 3;  4HM0 B;  1IYY A;  4HM4 B;  3MWZ A;  3AMO A;  3CCR 3;  2AAE A;  1RGG A;  3HOH A;  4BTX A;  5CF2 A;  1K8A 4;  1FYS A;  5LC7 A;  1BNF A;  3LTB A;  5G1K A;  5AEW B;  4BTW A;  1ROA A;  3LOY A;  3G8Z A;  1DMQ A;  5CLK A;  2E2T A;  3GZX B;  3GRD A;  1RSN A;  1W6G A;  7RNT A;  3WOF B;  2GEY A;  4CJN A;  2XR8 B;  1STD A;  4MMX B;  2HMM B;  1AVL A;  1UCK A;  1GOY A;  2CH9 A;  1WMN A;  2E2U A;  2F5M A;  3DXO A;  3LXU X;  4HKV B;  3TDG A;  2QEX 3;  1U5O A;  5ELJ A;  4HYZ A;  1C54 A;  1VQL 3;  5LC6 A;  1W4N A;  3D4A A;  5JPP A;  3L0R A;  1V58 A;  1NB5 I;  4RNZ A;  2F98 A;  1JB2 A;  2P05 A;  4G1M B;  1PY3 A;  1RGA A;  3Q3F A;  1GSP A;  1BNR A;  1S72 3;  3UL5 A;  2R4I A;  3QRD A;  1NJI 4;  4NPB A;  3CCJ 3;  4LZI A;  5A0O B;  3HX8 A;  3WMD A;  2LYX A;  1YJW 3;  1RTU A;  3CCV 3;  1L5G B;  4EV5 A;  3MPH A;  1Q7H A;  3LYG A;  1LXE A;  3Q2P A;  1QJG A;  3HK4 A;  5IEO A;  3I55 3;  3K9M C;  1SQW A;  2IYJ A;  4LGQ A;  1D6U A;  4R1K A;  1RCK A;  1BRK A;  2KF6 A;  2BT3 A;  1BAN A;  1EEJ A;  1YHQ 3;  1FZU A;  7GSP A;  1KC8 4;  4XBX A;  5G2G A;  2K0M A;  1Q86 4;  4KFF A;  3NX0 A;  2CKF B;  4WWU C;  1WMO A;  3HZP A;  1IU7 A;  1IQ8 A;  2ML6 A;  1C7H A;  4I4K A;  1JJ2 2;  4U13 A;  3EF8 A;  2GSP A;  5EEO A;  1HKX A;  4GL6 A;  2WO0 A;  2RFR A;  1JZO A;  1D6Z A;  2CX1 A;  3KN4 A;  1GOV A;  3OWU A;  3BNB A;  1IT7 A;  2BU4 A;  3SOY A;  3S27 A;  1FUW A;  1IVX A;  1ZO2 A;  3DGO A;  2SAR A;  3T0U A;  4AKY A;  2OCT A;  1QAF A;  4L8P A;  4O3V A;  1NB3 I;  3ALA A;  2XEP A;  4K90 B;  3A5E A;  3STD A;  3V99 A;  1TRQ A;  1RJO A;  1FGO A;  1JRQ A;  2GBX B;  3NXJ A;  1RGC A;  1IQY A;  1I8V A;  4K61 A;  3CME 3;  1VQ9 3;  1BVI A;  1EG9 B;  2ZDJ A;  3D5G A;  2BMO B;  4AKZ A;  3EBT A;  2OOV A;  1B2Z A;  2UGI A;  5IG5 A;  2QGU A;  1GD4 A;  4QWT A;  2BHM A;  1KSI A;  3MSO A;  1GS3 A;  2PZV A;  2C4B A;  2XSO B;  1RGE A;  3AHW A;  1K9M 4;  2GU3 A;  1GMR A;  2XFT A;  1WMP A;  1SAR A;  1RNT A;  5DRV A;  3OWS A;  4RBN A;  3U97 A;  1W02 A;  3D9R A;  3IMA B;  1I70 A;  2Q07 A;  2OQE A;  1NO3 A;  2I9W A;  1HYF A;  1Z1S A;  4BIR A;  5BIR A;  3OW2 2;  4XBY A;  1SIH A;  1UCJ A;  3J7Y d;  3PCS A;  4N6V 0;  1ISK A;  1I0X A;  3VGN A;  3CC7 3;  1FGR A;  4X2H A;  3PZW A;  1W7C A;  2W56 B;  4N6M A;  2W0Q A;  5ELU A;  1Q82 4;  1KWI A;  1TJD A;  3X40 A;  3DGY A;  4N6L A;  5M19 A;  4FMC A;  1W01 A;  1MWS A;  1RGK A;  5KP4 A;  1EKM A;  2HML B;  2HMN B;  2CX0 A;  1A67 A;  3N54 B;  2Z6B A;  1YIJ 3;  3GSP A;  2W56 A;  3B8L A;  2Z76 A;  5D83 A;  4GSP A;  1NU3 A;  1V74 A;  1DMN A;  4GHO A;  4R4K A;  2W9Q A;  1VQ4 3;  2QA4 3;  3B7C A;  2KRT A;  3HIG A;  1X1Y A;  3ECF A;  6RNT A;  2LQV A;  4FMB A;  2YFJ B;  2MF7 A;  2CFG A;  5AI1 A;  4XDV A;  5IG0 A;  1ASK A;  1I3F A;  1W6Y A;  2CFD A;  2CW9 A;  2ZHX B;  3EE1 A;  2UX0 A;  4XM4 A;  1YVS A;  4I5Q A;  2Z77 A;  2E2V A;  1BSB A;  1JV2 B;  1I2G A;  1LNH A;  1RGH A;  2R41 A;  1LNI A;  3EHC A;  3EX9 A;  4OVM A;  2OTJ 3;  2YX9 A;  1OH0 A;  4NHF A;  5AIG A;  2J8X B;  2ZA4 A;  1B2X A;  1MGW A;  8RNT A;  1N8R 4;  2FNQ A;  3S5C A;  2D42 A;  3NV0 A;  4O8S A;  1I2E A;  2CHC A;  1T3B A;  3WA2 X;  3V92 A;  5IG3 A;  1GY6 A;  1U8C B;  1OHP A;  5FW5 A;  3B4O A;  1CYU A;  2YFI B;  4FMD A;  5CXO A;  3X3Y A;  3BNC A;  3JUN A;  3SYU A;  3BNE A;  4FMA A;  4EV2 A;  1VZZ A;  1US1 A;  2CFW A;  5JBS A;  3CCU 3;  2GU1 A;  4JRF A;  3RGA A;  3T8U A;  3M8C A;  3CMA 3;  1BSA A;  2RGQ A;  1NWW A;  2IY2 A;  3X41 A;  3LTD A;  1RDS A;  1N8Q A;  7STD A;  1ULJ B;  1QAK A;  1DVC A;  4WP5 A;  4RZM A;  3CCQ 3;  3KSP A;  4FCZ A;  2JQ5 A;  3OX9 A;  1GY5 A;  4J9A A;  2F86 B;  3DGN A;  3EQQ B;  3UJM A;  2CIU A;  5BXQ A;  1FGQ A;  3AHS A;  2C11 A;  2XSH B;  1T5Y A;  4FR9 A;  5D81 A;  1JKG A;  2RSX A;  1OUN A;  1MOL A;  3BIR A;  5I97 A;  2CFL A;  5AYR B;  3DH2 A;  1LVN A;  2KCD A;  3IJE B;  3ZG0 A;  1O7H B;  1OF5 A;  3V98 A;  1CH0 A;  2K3D A;  5TGN A;  3WDG B;  1VQ7 3;  4HM3 B;  1QMA A;  4LYL B;  1SII A;  5IER A;  4WHA A;  1BAO A;  3G71 3;  2FXT A;  4HZB B;  1K28 A;  3JUO A;  1W5Z A;  1FGT A;  4MJD A;  1WNH A;  3MYT A;  3NBB A;  4K1V A;  5KP3 A;  4BU4 A;  3X3X A;  1UDI I;  4NRE A;  3SLU A;  3T8N A;  4J8T A;  1Q9E A;  1B2S A;  2W04 A;  3FGY A;  3N8B A;  4HOH A;  4LEH A;  2KF3 A;  1O7W B;  2INX A;  1RLS A;  4EBG A;  3WOD G;  1YJ9 3;  2K54 A;  1W2Z A;  1VQP 3;  1RMS A;  2B24 B;  2W2C A;  3KZT A;  4FCJ A;  5IF6 A;  3EJV A;  3G0K A;  3DUK A;  4XB5 A;  2D1W A;  3AGO A;  1EUI C;  2Y73 A;  3JVC A;  1BRH A;  2BMQ B;  3VSY A;  1RRL A;  1E3V A;  1R4C A;  4J5K A;  1YJN 3;  2OOV C;  2KF4 A;  4H61 A;  2KAA A;  3WR2 A;  1BNS A;  1LQG C;  2C10 A;  3BU4 A;  1E97 A;  3LH4 A;  3QK9 A;  4HM8 B;  1FW7 A;  4GB5 A;  3PCR A;  4OUQ A;  3O8Y A;  1JBS A;  2HMO B;  4BL3 A;  4BTY A;  2OTL 3;  1PYL A;  2H0G A;  1UCI A;  1RNB A;  1N9J A;  2CG1 A;  3JUQ A;  2HMK B;  3S29 A;  1M1X B;  3CCE 3;  1KQS 2;  5G1L A;  1VQO 3;  3GWR A;  4ZM8 A;  3A76 A;  2F56 A;  3DGM A;  3IPT A;  1YNV X;  1OGX A;  2OQE C;  2B1X B;  4N6U A;  3MG2 A;  4N6O B;  3URP A;  3EC9 A;  3HII A;  1UI8 A;  4RNT A;  2F5W A;  1BRI A;  4HM2 B;  1TTO A;  3ZFZ A;  3BLZ A;  2CWU A;  1QVG 2;  1MGR A;  3RDE A;  4KVH A;  4WYK A;  4HM1 B;  3G6E 3;  1YVB I;  1AR0 A;  1Q7Y 4;  5STD A;  2XH9 A;  3I0Y A;  3LT8 A;  1IVV A;  4L7K A;  1GMQ A;  1VQ8 3;  1TFO A;  2GBW B;  2WOF A;  1DMM A;  1HU9 A;  1JB4 A;  2H0I A;  4KFE A;  2UUG C;  4R80 A;  5DRE A;  1N5P A;  1Q42 A;  5AEU B;  2BMR B;  4IT7 A;  4N6N B;  3RGR A;  1JN5 A;  1SPU A;  1JNQ A;  1RN4 A;  5D82 A;  4EW5 A;  1VQM 3;  1D6Y A;  2MC8 A;  1J2B A;  1MWT A;  4Q53 A;  1VQN 3;  2HMJ B;  1BRG A;  3OWY A;  1S5A A;  3UB1 A;  1LOY A;  3Q1C A;  4KZ1 A;  1YGE A;  4HM7 B;  2QIY A;  2P09 A;  1G96 A;  9RNT A;  1TUH A;  4JF8 A;  3FSD A;  1RGF A;  5RNT A;  1UUV B;  1AQZ A;  1ROV A;  3N9H A;  2RBI A;  1AVK A;  4DKI A;  1GOU A;  3KSE D;  3K0Z A;  3NV0 B;  4H3U A;  1JZD A;  3ZG5 A;  1YIT 3;  1WTH A;  1B20 A;  4PEJ A;  3B4P A;  3X3Z A;  1N5H A;  1LOV A;  1ZX2 A;  2H0H A;  1A90 A;  2ML5 A;  3WHO A;  1TFK A;  2WGQ A;  3AGN A;  2WGO A;  3HI7 A;  3LTA A;  1B27 A;  4CPK A;  2O3O A;  2L1S A;  4ILF A;  1Q81 4;  1MWU A;  3K5T A;  5HOH A;  1EQK A;  3CC4 3;  1B3S A;  4O02 B;  3LZA A;  3KE7 A;  1OHS A;  3SED A;  4R9K A;  1OAC A;  1X1W A;  3GAX A;  4IPB A;  1YI2 3;  4J5G A;  3D79 A;  1UW1 A;  1IV7 A;  2JDI H;  3LT9 A;  1RGL A;  3D5I A;  3ROB A;  3LML A;  6GSP A;  1K73 4;  2IUK A;  2PNC A;  3PGB A;  3JUP A;  1IVW A;  5AII A;  4LSO A;  2WOH A;  4N3V A;  1Q40 A;  5BVB A;  3K63 A;  1JKG B;  1BRN L;  5EQL A;  1VQK 3;  1AY7 A;  3F40 A;  2F4Y A;  3OXA A;  3DGL A;  4HJL B;  1IK3 A;  1OF5 B;  2IA7 A;  3MG3 A;  5IEN A;  4CCV A;  1W00 A;  1M9G A;  1RRH A;  1T2I A;  1A2K A;  3FG4 A;  1T2H A;  5AIF A;  3EB8 A;  3CCL 3;  1OCV A;  2M7O A;  1WQL B;  3MHE A;  2KXG A;  2YFL B;  1QVF 2;  2Z7A A;  2SBL A;  2STD A;  1B2U A;  2BIR A;  3JUM A;  2HOH A;  2AAD A;  1X1X A;  3RNT A;  4MEI A;  2RNT A;  3F7S A;  1CYV A;  1BUJ A;  4EC6 A;  4XBT A;  1UCL A;  3GZR A;  3NBR A;  3EBY A;  3FG1 A;  3NM7 A;  4N6T A;  1GYB A;  2W9P A;  3KCH A;  4AEQ A;  4CDL A;  3WA3 A;  1DYU A;  1F8N A;  1IVU A;  1ZGX A;  1A2V A;  1DET A;  4HZ9 B;  5CK6 A;  2ZL8 A;  1TP6 A;  1E3R A;  1RN7 A;  3DMC A;  1IDP A;  3KFQ C;  3MG1 A;  3PS8 A;  4WFO A;  1BUQ A;  1K41 A;  3WOE B;  2FGT A;  1O7P B;  3DZL A;  3FH1 A;  3G16 A;  3KKG A;  1JB5 A;  3NM2 A;  1BIR A;  5AIH A;  1OHO A;  2XF3 A;  4R9L A;  1NDO B;  3ER7 A;  3MKI A;  1KD1 4;  3BND A;  1BNE A;  5FGO A;  3FG3 A;  1RHL A;  3SX1 A;  1BRS A;  4LMI A;  2XGL A;  5GSP A;  2KF5 A;  4STD A;  1EA2 A;  3S67 A;  2CWT A;  4EXR A;  3FLJ A;  1JBR A;  5M18 A;  3F8H A;  5M1A A;  1I0V A;  3D3L A;  1CQS A;  1O7N B;  4O2H A;  1OGZ A;  5EVH A;  2F99 A;  5KP1 A;  3FCS B;  2IUJ A;  3GZB A;  3CXC 2;  3CPO A;  5IEP A;  3G4S 3;  3K7C A;  1B21 A;  1BRJ A;  4MMZ B;  3FZW A;  4WYK B;  3SVA A;  4ORL A;  3CPW 2;  2A15 A;  3I56 3;  1O7M B;  3FF2 A;  4HVN A;  2GEX A;  1RN1 A;  3F8X A;  6STD A;  4KT3 B;  1FA3 A;  3NUV A;  4HM6 B;  2O9U X;  3GZY B;  3VF1 A;  3H3H A;  1UGH I;  1GD3 A;  2CC3 A;  8CHO A;  2XGN A;  1JN5 B;  3DM8 A;  3EN1 B;  5JPU A;  3E99 A;  1STF I;  3LTC A;  1VQQ A;  1IT8 A;  4KFD A;  1BSC A;  4L8O A;  3CCS 3;  2RCD A;  3FKA A;  4RNY A;  1I2F A;  1IV9 A;  2IMJ A;  3Q90 A;  1M90 4;  3CCM 3;  1MWR A;  4HAA A;  1Y4K A;  1UI7 A;  1GY7 A;  4EYC A;  3H51 A;  2CK3 H;  1UUW B;  1A2P A;  3SXX A;  1CEW I;  2BNG A;  3NQZ A;  2OWP A;  1QAL A;  1SJW A;  1YGW A;  1FGM A;  1ULI B;  4IIA A;  2XRX B;  1DVD A;  4FCM A;  1G0T A;  2L4V A;  4K1U A;  3F9S A;  1AV4 A;  1VQ5 3;  1V57 A;  1IQX A;  2CFK A;  3KII A;  1I3I A;  1FUT A;  2W6J H;  4XDW A;  4BL2 A;  3NBJ A;  4HBR A;  1DE3 A;  1BNJ A;  1LOW A;  3CU3 A;  1G02 A;  2W03 A;  3CD6 3;  3F7X A;  1LOX A;  2CWV A;  1GMP A;  4MMY B;  1RCL A;  5IG4 A;  1NNV A;  1OPY A;  1FUS A;  1BOX A;  5IW9 A;  2Y74 A; 
#chains in the Genus database with same CATH homology
 3OV4 A;  4HM5 B;  5HGR A;  3PYJ A;  2CG0 A;  5CF1 A;  1PU4 A;  2P38 A;  3CNM A;  2P0M A;  3CNX A;  1TU5 A;  1RKY A;  2XFS A;  1W2B 2;  1W6C A;  1O7G B;  2P0X A;  3PXM A;  3U1W A;  3BB9 A;  4OK0 A;  1TIJ A;  3EN8 A;  2BO9 B;  3UNL A;  1MNL A;  3S28 A;  4TX4 A;  4X2O A;  1Q40 B;  3AMO B;  3DY5 A;  3NHX A;  1N9E A;  3F14 A;  3NQY A;  1PFP A;  3FF0 A;  3UL6 A;  3X42 A;  3SOA A;  1M1K 4;  1VQ6 3;  2GXF A;  2V1L A;  5AYS C;  3CC2 3;  4HM0 B;  4HM4 B;  3MWZ A;  3AMO A;  3CCR 3;  4BTX A;  5CF2 A;  1K8A 4;  5LC7 A;  3LTB A;  5AEW B;  4BTW A;  1ROA A;  3LOY A;  3G8Z A;  1DMQ A;  5CLK A;  2E2T A;  3GZX B;  3GRD A;  1W6G A;  3WOF B;  2GEY A;  2XR8 B;  1STD A;  4MMX B;  2HMM B;  1AVL A;  3LXU X;  2CH9 A;  1WMN A;  2E2U A;  3DXO A;  2QEX 3;  1CYU A;  4HKV B;  3TDG A;  1U5O A;  5ELJ A;  4HYZ A;  1VQL 3;  5LC6 A;  1W4N A;  5JPP A;  3L0R A;  1NB5 I;  4RNZ A;  2F98 A;  1JB2 A;  2P05 A;  4G1M B;  1S72 3;  3UL5 A;  2R4I A;  3QRD A;  1NJI 4;  3CCJ 3;  4LZI A;  5A0O B;  3HX8 A;  3WMD A;  2LYX A;  1YJW 3;  3CCV 3;  1L5G B;  4EV5 A;  3MPH A;  3LYG A;  1LXE A;  3Q2P A;  1QJG A;  3HK4 A;  5IEO A;  3I55 3;  3K9M C;  1SQW A;  4LGQ A;  1D6U A;  4R1K A;  2BT3 A;  1YHQ 3;  1KC8 4;  4XBX A;  5G2G A;  2K0M A;  1Q86 4;  4KFF A;  3NX0 A;  2CKF B;  4WWU C;  1WMO A;  3HZP A;  1IU7 A;  1IQ8 A;  2ML6 A;  1C7H A;  4I4K A;  1JJ2 2;  4U13 A;  3EF8 A;  5EEO A;  1HKX A;  4GL6 A;  2WO0 A;  2RFR A;  3KN4 A;  1D6Z A;  3OWU A;  3BNB A;  1IT7 A;  3SOY A;  1FUW A;  3S27 A;  1IVX A;  1ZO2 A;  3DGO A;  3T0U A;  4AKY A;  2OCT A;  1QAF A;  4L8P A;  4O3V A;  1NB3 I;  3ALA A;  2XEP A;  4K90 B;  3STD A;  3V99 A;  1RJO A;  1FGO A;  1JRQ A;  2GBX B;  3NXJ A;  1IQY A;  4K61 A;  3CME 3;  1VQ9 3;  1EG9 B;  2ZDJ A;  2BMO B;  4AKZ A;  3EBT A;  2OOV A;  5IG5 A;  2QGU A;  1GD4 A;  4QWT A;  2BHM A;  1KSI A;  3MSO A;  1GS3 A;  2PZV A;  2XSO B;  1K9M 4;  2GU3 A;  2XFT A;  1WMP A;  5DRV A;  3OWS A;  4RBN A;  3U97 A;  1W02 A;  3D9R A;  3IMA B;  2Q07 A;  2OQE A;  1NO3 A;  2I9W A;  1Z1S A;  3OW2 2;  4XBY A;  1SIH A;  3J7Y d;  3PCS A;  4N6V 0;  1ISK A;  3VGN A;  3CC7 3;  1FGR A;  4X2H A;  3PZW A;  1W7C A;  2W56 B;  4N6M A;  2W0Q A;  5ELU A;  1Q82 4;  1KWI A;  3X40 A;  4N6L A;  4FMC A;  1W01 A;  5KP4 A;  1EKM A;  2HML B;  2HMN B;  1A67 A;  3N54 B;  2Z6B A;  1YIJ 3;  2W56 A;  3B8L A;  2Z76 A;  5D83 A;  1NU3 A;  1V74 A;  1DMN A;  4R4K A;  2W9Q A;  1VQ4 3;  2QA4 3;  3B7C A;  2KRT A;  3HIG A;  3ECF A;  2LQV A;  4FMB A;  2YFJ B;  2MF7 A;  2CFG A;  5AI1 A;  4XDV A;  5IG0 A;  1ASK A;  2CFD A;  1W6Y A;  2CW9 A;  3EE1 A;  2UX0 A;  4XM4 A;  2Z77 A;  2E2V A;  1JV2 B;  3EX9 A;  1LNH A;  3EHC A;  2OTJ 3;  4OVM A;  2YX9 A;  1OH0 A;  4NHF A;  5AIG A;  1N8R 4;  2FNQ A;  3S5C A;  2D42 A;  3NV0 A;  4O8S A;  2CHC A;  3WA2 X;  3V92 A;  5IG3 A;  1GY6 A;  1U8C B;  1OHP A;  5FW5 A;  3B4O A;  2YFI B;  4FMD A;  5CXO A;  3X3Y A;  3BNC A;  3JUN A;  4EV2 A;  3BNE A;  4FMA A;  5JBS A;  1VZZ A;  1US1 A;  2CFW A;  3CCU 3;  2GU1 A;  4JRF A;  3RGA A;  3T8U A;  3M8C A;  3CMA 3;  2RGQ A;  1NWW A;  3X41 A;  3LTD A;  1N8Q A;  7STD A;  1ULJ B;  1QAK A;  1DVC A;  4WP5 A;  4RZM A;  3CCQ 3;  3KSP A;  4FCZ A;  2JQ5 A;  3OX9 A;  1GY5 A;  4J9A A;  2F86 B;  3DGN A;  3EQQ B;  3UJM A;  2CIU A;  5BXQ A;  1FGQ A;  2C11 A;  2XSH B;  1T5Y A;  4FR9 A;  5D81 A;  1JKG A;  2RSX A;  1OUN A;  1MOL A;  5I97 A;  2CFL A;  5AYR B;  1LVN A;  2KCD A;  3IJE B;  1O7H B;  1OF5 A;  3V98 A;  5TGN A;  3WDG B;  1VQ7 3;  4HM3 B;  1QMA A;  1SII A;  5IER A;  4WHA A;  3G71 3;  2FXT A;  4HZB B;  1K28 A;  3JUO A;  1W5Z A;  1FGT A;  4MJD A;  1WNH A;  3MYT A;  3NBB A;  4K1V A;  5KP3 A;  3X3X A;  3T8N A;  4NRE A;  3SLU A;  4J8T A;  3N8B A;  2W04 A;  3FGY A;  4LEH A;  1O7W B;  2INX A;  4EBG A;  3WOD G;  1YJ9 3;  2K54 A;  1W2Z A;  1VQP 3;  2W2C A;  2B24 B;  3KZT A;  4FCJ A;  5IF6 A;  3EJV A;  3G0K A;  3DUK A;  4XB5 A;  2D1W A;  2Y73 A;  3JVC A;  2BMQ B;  3VSY A;  1RRL A;  1E3V A;  1R4C A;  1YJN 3;  2OOV C;  4H61 A;  2C10 A;  3LH4 A;  1E97 A;  3QK9 A;  4HM8 B;  4GB5 A;  3PCR A;  4OUQ A;  3O8Y A;  2OTL 3;  2HMO B;  4BTY A;  1N9J A;  2CG1 A;  3JUQ A;  2HMK B;  3S29 A;  1M1X B;  3CCE 3;  1KQS 2;  1VQO 3;  3GWR A;  4ZM8 A;  3A76 A;  3DGM A;  3IPT A;  1OGX A;  2OQE C;  2B1X B;  4N6U A;  3MG2 A;  4N6O B;  3EC9 A;  3HII A;  1UI8 A;  4HM2 B;  3BLZ A;  2CWU A;  1QVG 2;  3RDE A;  4KVH A;  4WYK A;  4HM1 B;  3G6E 3;  1YVB I;  1AR0 A;  1Q7Y 4;  5STD A;  2XH9 A;  3I0Y A;  1IVV A;  4L7K A;  1VQ8 3;  1TFO A;  2GBW B;  2WOF A;  1DMM A;  1HU9 A;  1JB4 A;  4KFE A;  4R80 A;  5DRE A;  1N5P A;  1Q42 A;  5AEU B;  2BMR B;  4IT7 A;  4N6N B;  3RGR A;  1JN5 A;  1SPU A;  1JNQ A;  5D82 A;  1VQM 3;  1D6Y A;  2MC8 A;  1J2B A;  4Q53 A;  1VQN 3;  2HMJ B;  3OWY A;  1S5A A;  3UB1 A;  3Q1C A;  4KZ1 A;  1YGE A;  4HM7 B;  2QIY A;  2P09 A;  1G96 A;  1TUH A;  4JF8 A;  3FSD A;  1UUV B;  3N9H A;  1ROV A;  1AVK A;  3KSE D;  3K0Z A;  3NV0 B;  4H3U A;  1YIT 3;  1WTH A;  4PEJ A;  3B4P A;  3X3Z A;  1N5H A;  1ZX2 A;  1A90 A;  2ML5 A;  1TFK A;  2WGQ A;  2WGO A;  3HI7 A;  3LTA A;  2O3O A;  1Q81 4;  3K5T A;  1EQK A;  3CC4 3;  4O02 B;  3LZA A;  3KE7 A;  1OHS A;  3SED A;  4R9K A;  1OAC A;  3GAX A;  4IPB A;  1YI2 3;  1UW1 A;  1IV7 A;  2JDI H;  3LT9 A;  1K73 4;  3ROB A;  3LML A;  2IUK A;  2PNC A;  3PGB A;  3JUP A;  1IVW A;  5AII A;  4LSO A;  2WOH A;  4N3V A;  1Q40 A;  5BVB A;  3K63 A;  1JKG B;  5EQL A;  1VQK 3;  3F40 A;  3OXA A;  3DGL A;  4HJL B;  1IK3 A;  1OF5 B;  2IA7 A;  3MG3 A;  5IEN A;  4CCV A;  1W00 A;  1M9G A;  1RRH A;  1A2K A;  3FG4 A;  5AIF A;  3EB8 A;  3CCL 3;  1OCV A;  2M7O A;  1WQL B;  3MHE A;  2KXG A;  2YFL B;  1QVF 2;  2Z7A A;  2SBL A;  2STD A;  3JUM A;  4MEI A;  3F7S A;  1CYV A;  4EC6 A;  4XBT A;  3GZR A;  3NBR A;  3EBY A;  3FG1 A;  3NM7 A;  4N6T A;  1GYB A;  2W9P A;  4AEQ A;  4CDL A;  3WA3 A;  1DYU A;  1F8N A;  1IVU A;  1A2V A;  4HZ9 B;  5CK6 A;  2ZL8 A;  1TP6 A;  1E3R A;  1RN7 A;  3DMC A;  1IDP A;  3KFQ C;  3MG1 A;  3PS8 A;  4WFO A;  1BUQ A;  1K41 A;  3WOE B;  2FGT A;  1O7P B;  3DZL A;  3FH1 A;  3G16 A;  3KKG A;  1JB5 A;  3NM2 A;  5AIH A;  1OHO A;  2XF3 A;  4R9L A;  1NDO B;  3ER7 A;  3MKI A;  1KD1 4;  3BND A;  5FGO A;  3FG3 A;  3SX1 A;  4LMI A;  2XGL A;  4EXR A;  4STD A;  1EA2 A;  3S67 A;  2CWT A;  3FLJ A;  3F8H A;  3D3L A;  1CQS A;  1O7N B;  4O2H A;  1OGZ A;  5EVH A;  2F99 A;  5KP1 A;  3FCS B;  2IUJ A;  3GZB A;  3CXC 2;  3CPO A;  5IEP A;  3G4S 3;  3K7C A;  4WYK B;  4MMZ B;  3FZW A;  3SVA A;  4ORL A;  3CPW 2;  2A15 A;  3I56 3;  1O7M B;  3FF2 A;  4HVN A;  2GEX A;  3F8X A;  6STD A;  1FA3 A;  3NUV A;  4HM6 B;  2O9U X;  3GZY B;  3VF1 A;  3H3H A;  1GD3 A;  2CC3 A;  8CHO A;  2XGN A;  1JN5 B;  3DM8 A;  3EN1 B;  5JPU A;  3E99 A;  1STF I;  3LTC A;  1IT8 A;  4KFD A;  4L8O A;  3CCS 3;  2RCD A;  3FKA A;  4RNY A;  2IMJ A;  1IV9 A;  3Q90 A;  1M90 4;  3CCM 3;  1Y4K A;  1UI7 A;  1GY7 A;  4EYC A;  3H51 A;  2CK3 H;  1UUW B;  3SXX A;  1CEW I;  2BNG A;  3NQZ A;  2OWP A;  1QAL A;  1SJW A;  1FGM A;  1ULI B;  4IIA A;  2XRX B;  1DVD A;  4FCM A;  2L4V A;  4K1U A;  3F9S A;  1AV4 A;  1VQ5 3;  1IQX A;  2CFK A;  3KII A;  2W6J H;  4XDW A;  3NBJ A;  4HBR A;  3CU3 A;  2W03 A;  3CD6 3;  3F7X A;  1LOX A;  2CWV A;  4MMY B;  5IG4 A;  1OPY A;  3LT8 A;  5IW9 A;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...