2O9UX

Monellin (mnei) at 1.15 resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
95
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Monellin chain B and Monellin chain A
publication title Monellin (MNEI) at 1.15 A resolution
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
total genus 23
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2o9uX00
3PXMA 5LC7A 1DVCA 5EQLA 1GD4A 1IV7A 1M9GA 2OCTA 1GD3A 3PS8A 1PFPA 1DVDA 3L0RA 4IT7A 4LZIA 2KXGA 1IV9A 1CYUA 1WNHA 3NX0A 1N5HA 1TIJA 3LH4A 2O9UX 3Q2PA 1FA3A 5ELJA 1CYVA 2W9QA 3K9MC 3MWZA 1YVBI 1A67A 4N6NB 1CEWI 3GAXA 3KSED 1EQKA 4N6MA 2CH9A 1R4CA 3IMAB 3UL5A 3QRDA 3S67A 1MNLA 1NB5I 3SVAA 5LC6A 1N9JA 1FUWA 1G96A 4N6OB 4CCVA 4EYCA 3UL6A 1STFI 1ROAA 3PYJA 3KFQC 2W9PA 4ZM8A 4N6LA 5ELUA 2BO9B 1NB3I 1KWIA 1MOLA 1A90A 1RN7A 1N5PA 5A0OB 4TX4A 4N6V0 4N6UA 4N6TA 1LXEA
chains in the Genus database with same CATH superfamily
2JQ5A 3KCHA 2CC3A 1X1XA 1HYFA 1IVWA 4KFEA 3CC43 1VQO3 1B2XA 3I563 2W2CA 2KF6A 5JPPA 3FLJA 4WHAA 1VQN3 5FGOA 5G1LA 4XM4A 3WODG 1E3VA 1D6UA 1DVDA 2INXA 5KP1A 1OHSA 1SIIA 2FGTA 3NM7A 2W56A 1Z1SA 1UCLA 3EHCA 1X1YA 4FMDA 2D42A 4HM2B 2FXTA 4BL3A 1BNEA 1TTOA 4HM1B 3CC23 3J7Yd 3JUOA 3AMOB 5STDA 1WMNA 5AIIA 2WOFA 1WNHA 3OX9A 5AIHA 2HOHA 3DUKA 2Z6BA 1UDII 2YFJB 5AYSC 3LYGA 1C7HA 1JB4A 1HKXA 2CK3H 2F5MA 5AEWB 1RCKA 2B1XB 2YFIB 2W9QA 6RNTA 1VQ83 4K61A 5IEOA 5IW9A 1BRSA 1RKYA 1I70A 2XSOB 1WTHA 2HMNB 1I8VA 1UGHI 1J2BA 1ZS7A 3ZG0A 3URPA 1W6YA 3OXAA 1Q7HA 4XBYA 3T0UA 1CEWI 2IMJA 2W56B 1TFKA 5RNTA 1T3BA 1CH0A 3K7CA 3VGNA 1GSPA 2H0IA 2P0XA 4GSPA 3FF0A 1BRJA 1RRLA 1YNVX 1IU7A 2RSXA 4HM6B 1KSIA 4JRFA 2KF3A 1MWSA 1VQ63 4N6MA 2WOHA 1AQZA 3HOHA 1R4CA 3TDGA 1BRKA 3B4OA 3QRDA 3Q3FA 3CCU3 3S67A 1KQS2 2F98A 1EUIC 3SVAA 1FGTA 4HAAA 1NB5I 1N9JA 4MEIA 1TFOA 1LNHA 1QMAA 4R9KA 1RGAA 2IA7A 1AV4A 1FUWA 3ER7A 2A15A 4EXRA 3MSOA 1MGRA 3K0ZA 1VQK3 4ILFA 4R80A 3I0YA 1BUJA 3STDA 3BNDA 1W2ZA 1GY5A 4J9AA 5EVHA 3SLUA 5BU4A 1W4NA 1ISKA 1PU4A 4CCVA 3SOAA 1E97A 1RN1A 1NO3A 3NBRA 1KC84 2YX9A 1EG9B 3RGRA 1UCIA 1STFI 3CMA3 3DY5A 2R4IA 4BU4A 1MGWA 4HM0B 2K3DA 1JNQA 2XF3A 1BNJA 2RGQA 5G2GA 3O8YA 4G1MB 2CWUA 1TU5A 2BO9B 3QK9A 5IF6A 3HK4A 3JVCA 1KWIA 1IQ8A 1GMRA 1MOLA 1IVUA 2BT3A 2XGLA 4HM8B 1BSBA 4GHOA 3U97A 2GEYA 3FH1A 5IG0A 3GZRA 5CF2A 8RNTA 1YHQ3 1BOXA 1A90A 4XDVA 3CC73 1STDA 2KCDA 2WGQA 1NWWA 1UUWB 1RN4A 3D5IA 5A0OB 3HIGA 1W5ZA 2GEXA 5AI1A 4TX4A 4IIAA 4MMZB 1Q814 7STDA 2H0GA 2W03A 3X40A 1V57A 3DGNA 5M1AA 2F5WA 3U1WA 4BTXA 4HKVB 5JBSA 1W7CA 4N6TA 2HMOB 2ZHXB 3F9SA 2LQVA 1GYBA 2C11A 3G16A 1IQYA 5HOHA 2W0QA 1AY7A 4FCMA 3S28A 2E2UA 3FCSB 3EQQB 3WHOA 1BNGA 5M19A 9RNTA 1OUNA 3VF1A 2SBLA 1BIRA 3CCE3 3G0KA 1OF5A 3CCV3 1BRNL 1Q864 3IPTA 1FGMA 3HZPA 1WMOA 1UW1A 1Q40A 1BVIA 4LZIA 2CFWA 3EN8A 3BLZA 2KXGA 1OPYA 3UB1A 3KZTA 3D79A 1K8A4 1D6ZA 3DZLA 3EF8A 1CYUA 1YJW3 1US1A 3LMLA 4O3VA 2H0HA 4CPKA 1TIJA 2I9WA 1N8QA 4X2HA 4AKZA 2PZVA 2BNGA 1RCLA 1PY3A 2BIRA 3EX9A 3KIIA 2CFKA 3N9HA 3KKGA 1I0VA 1V58A 1RGGA 1U5OA 5D81A 3PCSA 3MWZA 4XBXA 2ML6A 3GZXB 1OF5B 2SARA 1I3IA 1RSNA 2QIYA 2HMJB 2QGUA 4HM3B 4HZBB 1OACA 4LYLB 3BU4A 4XDWA 1HZ1A 3X41A 4BTYA 1FGRA 4KFDA 1VQ53 3DH2A 1IVXA 1Q40B 3PGBA 1YI23 1DYUA 1G02A 3D9RA 5CLKA 2XSHB 3KSED 1FUTA 1W6GA 1CQSA 3RDEA 3EC9A 1LQGC 1V74A 1JN5A 4DKIA 4MJDA 3K63A 3DXOA 3FSDA 4K1VA 3DGLA 1SIHA 4EBGA 4KFFA 2F86B 5LC6A 2BMOB 3FZWA 4JF8A 1N8R4 1I3FA 4L7KA 1VQ43 1G96A 1O7HB 1LOXA 1IT8A 2BMQB 3G713 2R41A 1JBRA 1QALA 4I5QA 5IG4A 2D1WA 3DGYA 3D3LA 2JDIH 2OQEC 3CNMA 3HI7A 2CG0A 4AKYA 3G6E3 3B4PA 3WOFB 3MPHA 4EV5A 6GSPA 2P38A 1U8CB 1BNIA 3RGAA 1GMPA 2CFLA 2RBIA 1JN5B 1YGWA 1F8NA 1BANA 3X3XA 2Y74A 1UCJA 2ZA4A 1LQMB 2AAEA 3CME3 3X3ZA 1VQL3 1DE3A 4J5GA 1FYSA 1BRIA 1DMMA 3NXJA 1ZGXA 3DMCA 1S5AA 4RZMA 1NB3I 2GXFA 4NPBA 5AYRB 3JUNA 3SXXA 3LZAA 2OTL3 2CWVA 1RGEA 4FCJA 1RGLA 2BHMA 3VSYA 1TJDA 2FNQA 1RN7A 4WWUC 3S27A 4LEHA 1VQM3 3KN4A 4X2OA 4RBNA 3AGNA 2XGNA 2IUKA 2RFRA 5AIGA 4K1UA 2RNTA 4OUQA 5EEOA 1EA2A 3OWYA 1JB5A 2CHCA 1I2FA 3MG2A 1IQXA 2CKFB 4N6UA 1O7PB 3SX1A 2MC8A 1VQ93 1LXEA 3F8XA 2OQEA 3AHWA 1NU3A 1TRPA 3NHXA 4K90B 1QJGA 1W00A 4LMIA 5LC7A 2F99A 3CCJ3 3GWRA 1GOYA 1RDSA 1GD4A 2CWTA 1IV7A 1JJ22 1D6YA 1R4YA 3CCQ3 1JRQA 4XB5A 1MWUA 1M9GA 1LOWA 3SEDA 2CFGA 2B24B 4GL6A 3WOEB 3CCR3 1GD3A 1BRGA 1PFPA 1UI8A 3A5EA 3H3HA 3PS8A 2IUJA 3GSPA 4HM7B 2E2TA 3L0RA 1SPUA 3H51A 4IT7A 3F14A 1Q824 3HX8A 3OW22 1M904 4NREA 2KAAA 1B2SA 3X42A 2CX0A 2Y73A 4RNYA 3LXUX 1VQQA 1QVG2 1NDOB 1M1K4 2F56A 3ECFA 1YIT3 3WDGB 3V92A 2GBWB 3NBJA 4QWTA 3LH4A 3LTDA 4L8OA 5GSPA 4CDLA 1W02A 1VQ73 4EC6A 4RNTA 3IJEB 1FA3A 1ULJB 5ELJA 3ZFZA 3CXC2 5M18A 5CXOA 4STDA 1YVBI 2HMKB 4O02B 1BSEA 2KF5A 2F4YA 3V99A 1BSCA 1LRAA 3M8CA 3FG3A 4N6NB 1LVNA 1W2B2 2ML5A 5KP3A 1W6CA 5JPUA 1UGIA 4MMYB 3BNBA 3UNLA 3JUPA 3WMDA 1B27A 1X1UA 2QA43 5I97A 3GZBA 1DMNA 3GAXA 3K5TA 3NUVA 4LSOA 1DETA 3LT9A 1G0TA 5G1KA 1ULIB 3T8NA 4CJNA 1Q7Y4 1OGXA 4L8PA 2AADA 2GSPA 3FG1A 1K28A 2K54A 3NV0A 1I0XA 4I4KA 8CHOA 1MNLA 1K9M4 4HVNA 1A2PA 1GOUA 3E99A 1RRHA 1BNSA 1N9EA 5AEUB 1YGEA 4NHFA 2Z7AA 7GSPA 3JUMA 2XRXB 1SJWA 2C10A 1FGQA 2CFDA 3DGOA 4WFOA 1AVLA 4KZ1A 1I2GA 3AHSA 1T5YA 3NBBA 3WA2X 4AEQA 1S723 1ASKA 1B3SA 1IVVA 1A2VA 4EYCA 1OH0A 1B2ZA 4HM4B 3AMOA 1AR0A 3MG3A 4RNZA 1JB2A 1GY6A 2IYJA 1YJ93 5IENA 2WGOA 1ROAA 2GU3A 3BNEA 3LOYA 3B7CA 3FF2A 3NV0B 1OHPA 2W9PA 3BNCA 3N8BA 3CPOA 4N6LA 1BUQA 5FW5A 4HYZA 1TP6A 1NNVA 2HMMB 3EJVA 1JBTA 2GU1A 4WP5A 1MWTA 2E2VA 2GBXB 3PCRA 1BSAA 1OCVA 4FMAA 1JV2B 3UJMA 2OTJ3 4J8TA 3B8LA 3F7SA 5IERA 3FG4A 3MG1A 4FMCA 2L4VA 4OK0A 1RHLA 1RLSA 2Z76A 2CG1A 3NQYA 3V98A 1RTUA 3ROBA 5CF1A 1GY7A 2XFSA 4EW5A 1IDPA 4IPBA 3Q90A 4FCZA 1VQP3 1O7NB 1YJN3 1Q42A 1VZZA 3OV4A 4ORLA 2XFTA 1K734 1FW7A 1JKGA 2WO0A 2W6JH 1O7GB 1GOVA 3PXMA 1DVCA 3CU3A 1PYLA 3WA3A 2LYXA 2OWPA 4Q53A 1L5GB 5TGNA 1FZUA 1RGHA 5EQLA 2V1LA 4GB5A 1BGSA 3OWUA 1WQLB 2IY2A 2Q07A 3LTAA 4HBRA 1E3RA 1OHOA 1RGCA 1UI7A 1QAFA 2YFLB 2OCTA 4H61A 1GS3A 4KT3B 2BMRB 3EE1A 4OVMA 1C54A 1IYYA 1WMPA 1IK3A 1LOVA 3SOYA 4HZ9B 3G4S3 1BAOA 3CCM3 3EN1B 3LTCA 4HOHA 3OWSA 4WYKA 1MWRA 2PNCA 3GZYB 4HJLB 4BL2A 2ZDJA 1IV9A 3S29A 4BTWA 3G8ZA 4HM5B 1YVSA 3GRDA 3NX0A 2Z77A 5D83A 1N5HA 2UUGC 5IG3A 1LNIA 1NJI4 1BNRA 1B2UA 1JKGB 2O9UX 3F7XA 3Q2PA 5CK6A 7RNTA 1UCKA 1ZO2A 5HGRA 4BIRA 2C4BA 3NM2A 4FR9A 2W04A 1CYVA 1SARA 3K9MC 4J5KA 3EBTA 3EBYA 3F40A 3MKIA 5KP4A 3CNXA 1KD14 4R1KA 5D82A 1A67A 4MMXB 3JUQA 3DGMA 1ZX2A 1BNFA 3LT8A 1EEJA 5AIFA 2UX0A 3A76A 3ZG5A 1Q9EA 2CX1A 1B2MA 1RNTA 4WYKB 3KSPA 2KF4A 4PEJA 1EQKA 3CPW2 4R9LA 1T2HA 1RNBA 3S5CA 1YIJ3 2BU4A 4KVHA 3WR2A 3CCS3 2CH9A 1O7MB 4O8SA 4N3VA 3IMAB 3UL5A 2OOVC 2M7OA 3BB9A 2QEX3 1GMQA 3SYUA 3AGOA 2KRTA 1SQWA 2O3OA 3BIRA 1IT7A 1EKMA 1OGZA 1FUSA 1X1WA 3HIIA 1QVF2 1DMQA 1QAKA 3Q1CA 3MYTA 4XBTA 4FMBA 1UUGB 1B20A 3D4AA 2XH9A 1LOYA 1TUHA 3FKAA 4U13A 2ZL8A 1HU9A 4N6OB 1JZDA 2P0MA 2CIUA 4R4KA 3UL6A 1I2EA 2RCDA 1RMSA 3MHEA 3F8HA 1RGFA 3PYJA 1BRHA 3ALAA 1K41A 3KFQC 1A2KA 4ZM8A 2XR8B 3CD63 5ELUA 1TRQA 1BSDA 2STDA 2XEPA 3EB8A 3PZWA 5IEPA 4O2HA 1AVKA 3FGYA 1B21A 2MF7A 5DRVA 5BIRA 3I553 1FGOA 1T2IA 1UUVB 5IG5A 1N5PA 1Y4KA 1ROVA 3KE7A 1W01A 2P09A 4H3UA 2OOVA 3T8UA 2CW9A 1RJOA 4EV2A 3D5GA 3CCL3 2UGIA 3X3YA 1O7WB 2P05A 3DM8A 3N54B 4N6V0 1BU4A 4LGQA 1JBSA 2K0MA 5DREA 2J8XB 3RNTA 1JZOA 1RGKA 2HMLB 1M1XB 5BVBA 2L1SA 3NQZA 6STDA 5BXQA 3LTBA
chains in the Genus database with same CATH topology
2JQ5A 2CC3A 1IVWA 4KFEA 3CC43 1VQO3 1VQN3 3I563 2W2CA 5JPPA 3FLJA 4WHAA 5FGOA 4XM4A 3WODG 1E3VA 1D6UA 1DVDA 2INXA 5KP1A 1OHSA 1SIIA 2FGTA 3NM7A 2W56A 1Z1SA 3EHCA 4FMDA 2D42A 4HM2B 2FXTA 4HM1B 3CC23 3J7Yd 3JUOA 3AMOB 5STDA 1WMNA 5AIIA 2WOFA 1WNHA 3OX9A 5AIHA 3DUKA 2Z6BA 2YFJB 5AYSC 3LYGA 1C7HA 1JB4A 1HKXA 2CK3H 5AEWB 2B1XB 2YFIB 2W9QA 1VQ83 4K61A 5IEOA 5IW9A 1RKYA 2XSOB 1WTHA 2HMNB 1J2BA 1W6YA 3OXAA 4XBYA 3T0UA 1CEWI 2IMJA 2W56B 1TFKA 3K7CA 3VGNA 2P0XA 3FF0A 1RRLA 2RSXA 1IU7A 4HM6B 1KSIA 4JRFA 1VQ63 4N6MA 2WOHA 3TDGA 1R4CA 3B4OA 3QRDA 3CCU3 3S67A 1KQS2 2F98A 3SVAA 1NB5I 1FGTA 1N9JA 4MEIA 1TFOA 1LNHA 1QMAA 4R9KA 2IA7A 1FUWA 1AV4A 3ER7A 2A15A 4EXRA 3MSOA 3K0ZA 1VQK3 4R80A 3I0YA 3STDA 3BNDA 1W2ZA 1GY5A 4J9AA 5EVHA 3SLUA 1ISKA 1W4NA 1PU4A 4CCVA 3SOAA 1E97A 1NO3A 3NBRA 1KC84 2YX9A 1EG9B 3RGRA 1STFI 3CMA3 3DY5A 2R4IA 4HM0B 1JNQA 2XF3A 2RGQA 5G2GA 3O8YA 4G1MB 2CWUA 1TU5A 2BO9B 3QK9A 5IF6A 3HK4A 3JVCA 1KWIA 1IQ8A 1MOLA 1IVUA 2BT3A 2XGLA 4HM8B 3U97A 1YHQ3 2GEYA 3FH1A 5IG0A 3GZRA 5CF2A 1A90A 4XDVA 3CC73 1STDA 2KCDA 2WGQA 1NWWA 1UUWB 5A0OB 3HIGA 1W5ZA 2GEXA 5AI1A 4TX4A 4IIAA 4MMZB 1Q814 7STDA 2W03A 3X40A 4BTXA 3DGNA 3U1WA 4HKVB 5JBSA 1W7CA 4N6TA 2HMOB 3F9SA 2LQVA 1GYBA 2C11A 3G16A 1IQYA 2W0QA 4FCMA 3S28A 2E2UA 3FCSB 3EQQB 1OUNA 3VF1A 2SBLA 3CCV3 3CCE3 3G0KA 1OF5A 1Q864 3IPTA 1FGMA 3HZPA 1WMOA 1UW1A 1Q40A 4LZIA 2CFWA 3EN8A 3BLZA 2KXGA 1OPYA 3UB1A 3KZTA 1K8A4 1D6ZA 3DZLA 3EF8A 1CYUA 1YJW3 1US1A 3LMLA 4O3VA 1TIJA 2I9WA 1N8QA 4X2HA 4AKZA 2PZVA 2BNGA 3EX9A 3KIIA 2CFKA 3N9HA 3KKGA 5D81A 1U5OA 3PCSA 3MWZA 4XBXA 2ML6A 3GZXB 1OF5B 4HM3B 2QIYA 4HZBB 3CCM3 2HMJB 2QGUA 1OACA 3X41A 4XDWA 4BTYA 1FGRA 4KFDA 1VQ53 1IVXA 1Q40B 3PGBA 1YI23 1DYUA 3D9RA 5CLKA 2XSHB 3KSED 3RDEA 1W6GA 1CQSA 3EC9A 1V74A 1JN5A 4MJDA 3K63A 3DXOA 3FSDA 4K1VA 3DGLA 1SIHA 4EBGA 4KFFA 2F86B 5LC6A 2BMOB 3FZWA 4JF8A 1N8R4 4L7KA 1VQ43 1G96A 1O7HB 1LOXA 1IT8A 2BMQB 3G713 1QALA 5IG4A 2D1WA 3D3LA 2JDIH 2OQEC 3CNMA 3HI7A 2CG0A 4AKYA 3G6E3 3B4PA 3WOFB 3MPHA 4EV5A 2P38A 1U8CB 3RGAA 2CFLA 1JN5B 1F8NA 3X3XA 2Y74A 3CME3 3X3ZA 1VQL3 1DMMA 3NXJA 3DMCA 5AYRB 1S5AA 4RZMA 1NB3I 2GXFA 3SXXA 3CCR3 3JUNA 3LZAA 2OTL3 2CWVA 4FCJA 2BHMA 3VSYA 2FNQA 1RN7A 4WWUC 3S27A 4LEHA 1VQM3 3KN4A 4X2OA 4RBNA 2XGNA 2IUKA 2RFRA 5AIGA 4K1UA 4OUQA 5EEOA 1EA2A 3OWYA 1JB5A 2CHCA 3MG2A 1IQXA 2CKFB 4N6UA 1O7PB 3SX1A 2MC8A 1VQ93 1LXEA 3F8XA 2OQEA 1NU3A 3NHXA 4K90B 1QJGA 1W00A 4LMIA 5LC7A 2F99A 3CCJ3 3GWRA 1GD4A 2CWTA 1IV7A 1JJ22 1D6YA 3CCQ3 1JRQA 4XB5A 1M9GA 3SEDA 2CFGA 2B24B 4GL6A 3WOEB 1GD3A 3PS8A 1PFPA 1UI8A 3H3HA 2IUJA 4HM7B 1Q824 2E2TA 3L0RA 1SPUA 3H51A 4IT7A 3F14A 3HX8A 3OW22 1M904 4NREA 3X42A 2Y73A 4RNYA 3LXUX 1QVG2 1NDOB 1M1K4 3ECFA 1YIT3 3WDGB 3V92A 2GBWB 3NBJA 4QWTA 3LH4A 3LTDA 4L8OA 4CDLA 1W02A 1VQ73 4EC6A 3IJEB 1FA3A 1ULJB 5ELJA 3CXC2 5CXOA 4STDA 1YVBI 2HMKB 4O02B 3V99A 3M8CA 3FG3A 4N6NB 1LVNA 1W2B2 2ML5A 5KP3A 1W6CA 5JPUA 4MMYB 3BNBA 3UNLA 3JUPA 3WMDA 2QA43 5I97A 3GZBA 1DMNA 3GAXA 3K5TA 3NUVA 4LSOA 3LT9A 1ULIB 3T8NA 1Q7Y4 1OGXA 4L8PA 3FG1A 1K28A 2K54A 3NV0A 4I4KA 8CHOA 1MNLA 1K9M4 4HVNA 3E99A 1RRHA 1N9EA 5AEUB 1YGEA 4NHFA 2Z7AA 3JUMA 2XRXB 1SJWA 2C10A 1FGQA 2CFDA 3DGOA 4WFOA 1AVLA 4KZ1A 1T5YA 3NBBA 3WA2X 4AEQA 1S723 1ASKA 1IVVA 1A2VA 4EYCA 1OH0A 4HM4B 3AMOA 1AR0A 3MG3A 4RNZA 1JB2A 1GY6A 1YJ93 5IENA 2WGOA 1ROAA 2GU3A 3BNEA 3LOYA 3B7CA 3FF2A 3NV0B 1OHPA 2W9PA 3BNCA 3N8BA 3CPOA 4N6LA 1BUQA 5FW5A 4HYZA 1TP6A 2HMMB 3EJVA 2GU1A 4WP5A 2E2VA 2GBXB 3PCRA 1OCVA 4FMAA 1JV2B 3UJMA 2OTJ3 4J8TA 3B8LA 3F7SA 5IERA 3FG4A 3MG1A 4FMCA 2L4VA 4OK0A 2Z76A 2CG1A 3V98A 3NQYA 5CF1A 3ROBA 1GY7A 2XFSA 1IDPA 4IPBA 3Q90A 4FCZA 1VQP3 1O7NB 1YJN3 1Q42A 1VZZA 3OV4A 4ORLA 2XFTA 1K734 1JKGA 2WO0A 2W6JH 1O7GB 3PXMA 1DVCA 3CU3A 3WA3A 2LYXA 2OWPA 4Q53A 1L5GB 5TGNA 5EQLA 2V1LA 4GB5A 3OWUA 1WQLB 2Q07A 3LTAA 4HBRA 1E3RA 1OHOA 1UI7A 2YFLB 1QAFA 4H61A 2OCTA 4OVMA 1GS3A 2BMRB 3EE1A 1WMPA 1IK3A 3SOYA 4HZ9B 3G4S3 3EN1B 3LTCA 3OWSA 4WYKA 3GZYB 2PNCA 4HJLB 2ZDJA 1IV9A 3S29A 4BTWA 3G8ZA 4HM5B 5D83A 3GRDA 3NX0A 2Z77A 3I553 1N5HA 5IG3A 1NJI4 1JKGB 2O9UX 3F7XA 3Q2PA 5CK6A 1ZO2A 5HGRA 3NM2A 4FR9A 2W04A 1CYVA 3K9MC 3EBTA 3EBYA 3F40A 3MKIA 5KP4A 3CNXA 1KD14 4R1KA 5D82A 1A67A 4MMXB 3JUQA 3DGMA 1ZX2A 3LT8A 5AIFA 2UX0A 3A76A 4WYKB 3KSPA 4PEJA 1EQKA 3CPW2 4R9LA 3S5CA 1YIJ3 4KVHA 3CCS3 2CH9A 1O7MB 4O8SA 4N3VA 3IMAB 3UL5A 2OOVC 2M7OA 3BB9A 2QEX3 2KRTA 1SQWA 2O3OA 1IT7A 1EKMA 1OGZA 3HIIA 1QVF2 1DMQA 1QAKA 3Q1CA 3MYTA 4XBTA 4FMBA 2XH9A 1TUHA 3FKAA 4U13A 2ZL8A 1HU9A 4N6OB 2P0MA 2CIUA 4R4KA 3UL6A 2RCDA 3MHEA 3F8HA 3PYJA 3ALAA 1K41A 3KFQC 1A2KA 4ZM8A 2XR8B 3CD63 5ELUA 2STDA 2XEPA 3EB8A 3PZWA 5IEPA 4O2HA 1AVKA 3FGYA 2MF7A 5DRVA 1FGOA 1UUVB 5IG5A 1N5PA 1Y4KA 1ROVA 3KE7A 1W01A 2P09A 4H3UA 2OOVA 3T8UA 2CW9A 1RJOA 4EV2A 3CCL3 3X3YA 1O7WB 2P05A 3DM8A 3N54B 4N6V0 4LGQA 2K0MA 5DREA 2HMLB 5BVBA 1M1XB 3NQZA 6STDA 5BXQA 3LTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PXM A;  5LC7 A;  1DVC A;  5EQL A;  1GD4 A;  1IV7 A;  1M9G A;  2OCT A;  1GD3 A;  3PS8 A;  1PFP A;  1DVD A;  3L0R A;  4IT7 A;  4LZI A;  2KXG A;  1IV9 A;  1CYU A;  1WNH A;  3NX0 A;  1N5H A;  1TIJ A;  3LH4 A;  2O9U X;  3Q2P A;  1FA3 A;  5ELJ A;  1CYV A;  2W9Q A;  3K9M C;  3MWZ A;  1YVB I;  1A67 A;  4N6N B;  1CEW I;  3GAX A;  3KSE D;  1EQK A;  4N6M A;  2CH9 A;  1R4C A;  3IMA B;  3UL5 A;  3QRD A;  3S67 A;  1MNL A;  1NB5 I;  3SVA A;  5LC6 A;  1N9J A;  1FUW A;  1G96 A;  4N6O B;  4CCV A;  4EYC A;  3UL6 A;  1STF I;  1ROA A;  3PYJ A;  3KFQ C;  2W9P A;  4ZM8 A;  4N6L A;  5ELU A;  2BO9 B;  1NB3 I;  1KWI A;  1MOL A;  1A90 A;  1RN7 A;  1N5P A;  5A0O B;  4TX4 A;  4N6V 0;  4N6U A;  4N6T A;  1LXE A; 
#chains in the Genus database with same CATH topology
 2JQ5 A;  3KCH A;  2CC3 A;  1X1X A;  1HYF A;  1IVW A;  4KFE A;  3CC4 3;  1VQO 3;  1B2X A;  3I56 3;  2W2C A;  2KF6 A;  5JPP A;  3FLJ A;  4WHA A;  1VQN 3;  5FGO A;  5G1L A;  4XM4 A;  3WOD G;  1E3V A;  1D6U A;  1DVD A;  2INX A;  5KP1 A;  1OHS A;  1SII A;  2FGT A;  3NM7 A;  2W56 A;  1Z1S A;  1UCL A;  3EHC A;  1X1Y A;  4FMD A;  2D42 A;  4HM2 B;  2FXT A;  4BL3 A;  1BNE A;  1TTO A;  4HM1 B;  3CC2 3;  3J7Y d;  3JUO A;  3AMO B;  5STD A;  1WMN A;  5AII A;  2WOF A;  1WNH A;  3OX9 A;  5AIH A;  2HOH A;  3DUK A;  2Z6B A;  1UDI I;  2YFJ B;  5AYS C;  3LYG A;  1C7H A;  1JB4 A;  1HKX A;  2CK3 H;  2F5M A;  5AEW B;  1RCK A;  2B1X B;  2YFI B;  2W9Q A;  6RNT A;  1VQ8 3;  4K61 A;  5IEO A;  5IW9 A;  1BRS A;  1RKY A;  1I70 A;  2XSO B;  1WTH A;  2HMN B;  1I8V A;  1UGH I;  1J2B A;  1ZS7 A;  3ZG0 A;  3URP A;  1W6Y A;  3OXA A;  1Q7H A;  4XBY A;  3T0U A;  1CEW I;  2IMJ A;  2W56 B;  1TFK A;  5RNT A;  1T3B A;  1CH0 A;  3K7C A;  3VGN A;  1GSP A;  2H0I A;  2P0X A;  4GSP A;  3FF0 A;  1BRJ A;  1RRL A;  1YNV X;  1IU7 A;  2RSX A;  4HM6 B;  1KSI A;  4JRF A;  2KF3 A;  1MWS A;  1VQ6 3;  4N6M A;  2WOH A;  1AQZ A;  3HOH A;  1R4C A;  3TDG A;  1BRK A;  3B4O A;  3QRD A;  3Q3F A;  3CCU 3;  3S67 A;  1KQS 2;  2F98 A;  1EUI C;  3SVA A;  1FGT A;  4HAA A;  1NB5 I;  1N9J A;  4MEI A;  1TFO A;  1LNH A;  1QMA A;  4R9K A;  1RGA A;  2IA7 A;  1AV4 A;  1FUW A;  3ER7 A;  2A15 A;  4EXR A;  3MSO A;  1MGR A;  3K0Z A;  1VQK 3;  4ILF A;  4R80 A;  3I0Y A;  1BUJ A;  3STD A;  3BND A;  1W2Z A;  1GY5 A;  4J9A A;  5EVH A;  3SLU A;  5BU4 A;  1W4N A;  1ISK A;  1PU4 A;  4CCV A;  3SOA A;  1E97 A;  1RN1 A;  1NO3 A;  3NBR A;  1KC8 4;  2YX9 A;  1EG9 B;  3RGR A;  1UCI A;  1STF I;  3CMA 3;  3DY5 A;  2R4I A;  4BU4 A;  1MGW A;  4HM0 B;  2K3D A;  1JNQ A;  2XF3 A;  1BNJ A;  2RGQ A;  5G2G A;  3O8Y A;  4G1M B;  2CWU A;  1TU5 A;  2BO9 B;  3QK9 A;  5IF6 A;  3HK4 A;  3JVC A;  1KWI A;  1IQ8 A;  1GMR A;  1MOL A;  1IVU A;  2BT3 A;  2XGL A;  4HM8 B;  1BSB A;  4GHO A;  3U97 A;  2GEY A;  3FH1 A;  5IG0 A;  3GZR A;  5CF2 A;  8RNT A;  1YHQ 3;  1BOX A;  1A90 A;  4XDV A;  3CC7 3;  1STD A;  2KCD A;  2WGQ A;  1NWW A;  1UUW B;  1RN4 A;  3D5I A;  5A0O B;  3HIG A;  1W5Z A;  2GEX A;  5AI1 A;  4TX4 A;  4IIA A;  4MMZ B;  1Q81 4;  7STD A;  2H0G A;  2W03 A;  3X40 A;  1V57 A;  3DGN A;  5M1A A;  2F5W A;  3U1W A;  4BTX A;  4HKV B;  5JBS A;  1W7C A;  4N6T A;  2HMO B;  2ZHX B;  3F9S A;  2LQV A;  1GYB A;  2C11 A;  3G16 A;  1IQY A;  5HOH A;  2W0Q A;  1AY7 A;  4FCM A;  3S28 A;  2E2U A;  3FCS B;  3EQQ B;  3WHO A;  1BNG A;  5M19 A;  9RNT A;  1OUN A;  3VF1 A;  2SBL A;  1BIR A;  3CCE 3;  3G0K A;  1OF5 A;  3CCV 3;  1BRN L;  1Q86 4;  3IPT A;  1FGM A;  3HZP A;  1WMO A;  1UW1 A;  1Q40 A;  1BVI A;  4LZI A;  2CFW A;  3EN8 A;  3BLZ A;  2KXG A;  1OPY A;  3UB1 A;  3KZT A;  3D79 A;  1K8A 4;  1D6Z A;  3DZL A;  3EF8 A;  1CYU A;  1YJW 3;  1US1 A;  3LML A;  4O3V A;  2H0H A;  4CPK A;  1TIJ A;  2I9W A;  1N8Q A;  4X2H A;  4AKZ A;  2PZV A;  2BNG A;  1RCL A;  1PY3 A;  2BIR A;  3EX9 A;  3KII A;  2CFK A;  3N9H A;  3KKG A;  1I0V A;  1V58 A;  1RGG A;  1U5O A;  5D81 A;  3PCS A;  3MWZ A;  4XBX A;  2ML6 A;  3GZX B;  1OF5 B;  2SAR A;  1I3I A;  1RSN A;  2QIY A;  2HMJ B;  2QGU A;  4HM3 B;  4HZB B;  1OAC A;  4LYL B;  3BU4 A;  4XDW A;  1HZ1 A;  3X41 A;  4BTY A;  1FGR A;  4KFD A;  1VQ5 3;  3DH2 A;  1IVX A;  1Q40 B;  3PGB A;  1YI2 3;  1DYU A;  1G02 A;  3D9R A;  5CLK A;  2XSH B;  3KSE D;  1FUT A;  1W6G A;  1CQS A;  3RDE A;  3EC9 A;  1LQG C;  1V74 A;  1JN5 A;  4DKI A;  4MJD A;  3K63 A;  3DXO A;  3FSD A;  4K1V A;  3DGL A;  1SIH A;  4EBG A;  4KFF A;  2F86 B;  5LC6 A;  2BMO B;  3FZW A;  4JF8 A;  1N8R 4;  1I3F A;  4L7K A;  1VQ4 3;  1G96 A;  1O7H B;  1LOX A;  1IT8 A;  2BMQ B;  3G71 3;  2R41 A;  1JBR A;  1QAL A;  4I5Q A;  5IG4 A;  2D1W A;  3DGY A;  3D3L A;  2JDI H;  2OQE C;  3CNM A;  3HI7 A;  2CG0 A;  4AKY A;  3G6E 3;  3B4P A;  3WOF B;  3MPH A;  4EV5 A;  6GSP A;  2P38 A;  1U8C B;  1BNI A;  3RGA A;  1GMP A;  2CFL A;  2RBI A;  1JN5 B;  1YGW A;  1F8N A;  1BAN A;  3X3X A;  2Y74 A;  1UCJ A;  2ZA4 A;  1LQM B;  2AAE A;  3CME 3;  3X3Z A;  1VQL 3;  1DE3 A;  4J5G A;  1FYS A;  1BRI A;  1DMM A;  3NXJ A;  1ZGX A;  3DMC A;  1S5A A;  4RZM A;  1NB3 I;  2GXF A;  4NPB A;  5AYR B;  3JUN A;  3SXX A;  3LZA A;  2OTL 3;  2CWV A;  1RGE A;  4FCJ A;  1RGL A;  2BHM A;  3VSY A;  1TJD A;  2FNQ A;  1RN7 A;  4WWU C;  3S27 A;  4LEH A;  1VQM 3;  3KN4 A;  4X2O A;  4RBN A;  3AGN A;  2XGN A;  2IUK A;  2RFR A;  5AIG A;  4K1U A;  2RNT A;  4OUQ A;  5EEO A;  1EA2 A;  3OWY A;  1JB5 A;  2CHC A;  1I2F A;  3MG2 A;  1IQX A;  2CKF B;  4N6U A;  1O7P B;  3SX1 A;  2MC8 A;  1VQ9 3;  1LXE A;  3F8X A;  2OQE A;  3AHW A;  1NU3 A;  1TRP A;  3NHX A;  4K90 B;  1QJG A;  1W00 A;  4LMI A;  5LC7 A;  2F99 A;  3CCJ 3;  3GWR A;  1GOY A;  1RDS A;  1GD4 A;  2CWT A;  1IV7 A;  1JJ2 2;  1D6Y A;  1R4Y A;  3CCQ 3;  1JRQ A;  4XB5 A;  1MWU A;  1M9G A;  1LOW A;  3SED A;  2CFG A;  2B24 B;  4GL6 A;  3WOE B;  3CCR 3;  1GD3 A;  1BRG A;  1PFP A;  1UI8 A;  3A5E A;  3H3H A;  3PS8 A;  2IUJ A;  3GSP A;  4HM7 B;  2E2T A;  3L0R A;  1SPU A;  3H51 A;  4IT7 A;  3F14 A;  1Q82 4;  3HX8 A;  3OW2 2;  1M90 4;  4NRE A;  2KAA A;  1B2S A;  3X42 A;  2CX0 A;  2Y73 A;  4RNY A;  3LXU X;  1VQQ A;  1QVG 2;  1NDO B;  1M1K 4;  2F56 A;  3ECF A;  1YIT 3;  3WDG B;  3V92 A;  2GBW B;  3NBJ A;  4QWT A;  3LH4 A;  3LTD A;  4L8O A;  5GSP A;  4CDL A;  1W02 A;  1VQ7 3;  4EC6 A;  4RNT A;  3IJE B;  1FA3 A;  1ULJ B;  5ELJ A;  3ZFZ A;  3CXC 2;  5M18 A;  5CXO A;  4STD A;  1YVB I;  2HMK B;  4O02 B;  1BSE A;  2KF5 A;  2F4Y A;  3V99 A;  1BSC A;  1LRA A;  3M8C A;  3FG3 A;  4N6N B;  1LVN A;  1W2B 2;  2ML5 A;  5KP3 A;  1W6C A;  5JPU A;  1UGI A;  4MMY B;  3BNB A;  3UNL A;  3JUP A;  3WMD A;  1B27 A;  1X1U A;  2QA4 3;  5I97 A;  3GZB A;  1DMN A;  3GAX A;  3K5T A;  3NUV A;  4LSO A;  1DET A;  3LT9 A;  1G0T A;  5G1K A;  1ULI B;  3T8N A;  4CJN A;  1Q7Y 4;  1OGX A;  4L8P A;  2AAD A;  2GSP A;  3FG1 A;  1K28 A;  2K54 A;  3NV0 A;  1I0X A;  4I4K A;  8CHO A;  1MNL A;  1K9M 4;  4HVN A;  1A2P A;  1GOU A;  3E99 A;  1RRH A;  1BNS A;  1N9E A;  5AEU B;  1YGE A;  4NHF A;  2Z7A A;  7GSP A;  3JUM A;  2XRX B;  1SJW A;  2C10 A;  1FGQ A;  2CFD A;  3DGO A;  4WFO A;  1AVL A;  4KZ1 A;  1I2G A;  3AHS A;  1T5Y A;  3NBB A;  3WA2 X;  4AEQ A;  1S72 3;  1ASK A;  1B3S A;  1IVV A;  1A2V A;  4EYC A;  1OH0 A;  1B2Z A;  4HM4 B;  3AMO A;  1AR0 A;  3MG3 A;  4RNZ A;  1JB2 A;  1GY6 A;  2IYJ A;  1YJ9 3;  5IEN A;  2WGO A;  1ROA A;  2GU3 A;  3BNE A;  3LOY A;  3B7C A;  3FF2 A;  3NV0 B;  1OHP A;  2W9P A;  3BNC A;  3N8B A;  3CPO A;  4N6L A;  1BUQ A;  5FW5 A;  4HYZ A;  1TP6 A;  1NNV A;  2HMM B;  3EJV A;  1JBT A;  2GU1 A;  4WP5 A;  1MWT A;  2E2V A;  2GBX B;  3PCR A;  1BSA A;  1OCV A;  4FMA A;  1JV2 B;  3UJM A;  2OTJ 3;  4J8T A;  3B8L A;  3F7S A;  5IER A;  3FG4 A;  3MG1 A;  4FMC A;  2L4V A;  4OK0 A;  1RHL A;  1RLS A;  2Z76 A;  2CG1 A;  3NQY A;  3V98 A;  1RTU A;  3ROB A;  5CF1 A;  1GY7 A;  2XFS A;  4EW5 A;  1IDP A;  4IPB A;  3Q90 A;  4FCZ A;  1VQP 3;  1O7N B;  1YJN 3;  1Q42 A;  1VZZ A;  3OV4 A;  4ORL A;  2XFT A;  1K73 4;  1FW7 A;  1JKG A;  2WO0 A;  2W6J H;  1O7G B;  1GOV A;  3PXM A;  1DVC A;  3CU3 A;  1PYL A;  3WA3 A;  2LYX A;  2OWP A;  4Q53 A;  1L5G B;  5TGN A;  1FZU A;  1RGH A;  5EQL A;  2V1L A;  4GB5 A;  1BGS A;  3OWU A;  1WQL B;  2IY2 A;  2Q07 A;  3LTA A;  4HBR A;  1E3R A;  1OHO A;  1RGC A;  1UI7 A;  1QAF A;  2YFL B;  2OCT A;  4H61 A;  1GS3 A;  4KT3 B;  2BMR B;  3EE1 A;  4OVM A;  1C54 A;  1IYY A;  1WMP A;  1IK3 A;  1LOV A;  3SOY A;  4HZ9 B;  3G4S 3;  1BAO A;  3CCM 3;  3EN1 B;  3LTC A;  4HOH A;  3OWS A;  4WYK A;  1MWR A;  2PNC A;  3GZY B;  4HJL B;  4BL2 A;  2ZDJ A;  1IV9 A;  3S29 A;  4BTW A;  3G8Z A;  4HM5 B;  1YVS A;  3GRD A;  3NX0 A;  2Z77 A;  5D83 A;  1N5H A;  2UUG C;  5IG3 A;  1LNI A;  1NJI 4;  1BNR A;  1B2U A;  1JKG B;  2O9U X;  3F7X A;  3Q2P A;  5CK6 A;  7RNT A;  1UCK A;  1ZO2 A;  5HGR A;  4BIR A;  2C4B A;  3NM2 A;  4FR9 A;  2W04 A;  1CYV A;  1SAR A;  3K9M C;  4J5K A;  3EBT A;  3EBY A;  3F40 A;  3MKI A;  5KP4 A;  3CNX A;  1KD1 4;  4R1K A;  5D82 A;  1A67 A;  4MMX B;  3JUQ A;  3DGM A;  1ZX2 A;  1BNF A;  3LT8 A;  1EEJ A;  5AIF A;  2UX0 A;  3A76 A;  3ZG5 A;  1Q9E A;  2CX1 A;  1B2M A;  1RNT A;  4WYK B;  3KSP A;  2KF4 A;  4PEJ A;  1EQK A;  3CPW 2;  4R9L A;  1T2H A;  1RNB A;  3S5C A;  1YIJ 3;  2BU4 A;  4KVH A;  3WR2 A;  3CCS 3;  2CH9 A;  1O7M B;  4O8S A;  4N3V A;  3IMA B;  3UL5 A;  2OOV C;  2M7O A;  3BB9 A;  2QEX 3;  1GMQ A;  3SYU A;  3AGO A;  2KRT A;  1SQW A;  2O3O A;  3BIR A;  1IT7 A;  1EKM A;  1OGZ A;  1FUS A;  1X1W A;  3HII A;  1QVF 2;  1DMQ A;  1QAK A;  3Q1C A;  3MYT A;  4XBT A;  4FMB A;  1UUG B;  1B20 A;  3D4A A;  2XH9 A;  1LOY A;  1TUH A;  3FKA A;  4U13 A;  2ZL8 A;  1HU9 A;  4N6O B;  1JZD A;  2P0M A;  2CIU A;  4R4K A;  3UL6 A;  1I2E A;  2RCD A;  1RMS A;  3MHE A;  3F8H A;  1RGF A;  3PYJ A;  1BRH A;  3ALA A;  1K41 A;  3KFQ C;  1A2K A;  4ZM8 A;  2XR8 B;  3CD6 3;  5ELU A;  1TRQ A;  1BSD A;  2STD A;  2XEP A;  3EB8 A;  3PZW A;  5IEP A;  4O2H A;  1AVK A;  3FGY A;  1B21 A;  2MF7 A;  5DRV A;  5BIR A;  3I55 3;  1FGO A;  1T2I A;  1UUV B;  5IG5 A;  1N5P A;  1Y4K A;  1ROV A;  3KE7 A;  1W01 A;  2P09 A;  4H3U A;  2OOV A;  3T8U A;  2CW9 A;  1RJO A;  4EV2 A;  3D5G A;  3CCL 3;  2UGI A;  3X3Y A;  1O7W B;  2P05 A;  3DM8 A;  3N54 B;  4N6V 0;  1BU4 A;  4LGQ A;  1JBS A;  2K0M A;  5DRE A;  2J8X B;  3RNT A;  1JZO A;  1RGK A;  2HML B;  1M1X B;  5BVB A;  2L1S A;  3NQZ A;  6STD A;  5BXQ A;  3LTB A; 
#chains in the Genus database with same CATH homology
 2JQ5 A;  2CC3 A;  1IVW A;  4KFE A;  3CC4 3;  1VQO 3;  1VQN 3;  3I56 3;  2W2C A;  5JPP A;  3FLJ A;  4WHA A;  5FGO A;  4XM4 A;  3WOD G;  1E3V A;  1D6U A;  1DVD A;  2INX A;  5KP1 A;  1OHS A;  1SII A;  2FGT A;  3NM7 A;  2W56 A;  1Z1S A;  3EHC A;  4FMD A;  2D42 A;  4HM2 B;  2FXT A;  4HM1 B;  3CC2 3;  3J7Y d;  3JUO A;  3AMO B;  5STD A;  1WMN A;  5AII A;  2WOF A;  1WNH A;  3OX9 A;  5AIH A;  3DUK A;  2Z6B A;  2YFJ B;  5AYS C;  3LYG A;  1C7H A;  1JB4 A;  1HKX A;  2CK3 H;  5AEW B;  2B1X B;  2YFI B;  2W9Q A;  1VQ8 3;  4K61 A;  5IEO A;  5IW9 A;  1RKY A;  2XSO B;  1WTH A;  2HMN B;  1J2B A;  1W6Y A;  3OXA A;  4XBY A;  3T0U A;  1CEW I;  2IMJ A;  2W56 B;  1TFK A;  3K7C A;  3VGN A;  2P0X A;  3FF0 A;  1RRL A;  2RSX A;  1IU7 A;  4HM6 B;  1KSI A;  4JRF A;  1VQ6 3;  4N6M A;  2WOH A;  3TDG A;  1R4C A;  3B4O A;  3QRD A;  3CCU 3;  3S67 A;  1KQS 2;  2F98 A;  3SVA A;  1NB5 I;  1FGT A;  1N9J A;  4MEI A;  1TFO A;  1LNH A;  1QMA A;  4R9K A;  2IA7 A;  1FUW A;  1AV4 A;  3ER7 A;  2A15 A;  4EXR A;  3MSO A;  3K0Z A;  1VQK 3;  4R80 A;  3I0Y A;  3STD A;  3BND A;  1W2Z A;  1GY5 A;  4J9A A;  5EVH A;  3SLU A;  1ISK A;  1W4N A;  1PU4 A;  4CCV A;  3SOA A;  1E97 A;  1NO3 A;  3NBR A;  1KC8 4;  2YX9 A;  1EG9 B;  3RGR A;  1STF I;  3CMA 3;  3DY5 A;  2R4I A;  4HM0 B;  1JNQ A;  2XF3 A;  2RGQ A;  5G2G A;  3O8Y A;  4G1M B;  2CWU A;  1TU5 A;  2BO9 B;  3QK9 A;  5IF6 A;  3HK4 A;  3JVC A;  1KWI A;  1IQ8 A;  1MOL A;  1IVU A;  2BT3 A;  2XGL A;  4HM8 B;  3U97 A;  1YHQ 3;  2GEY A;  3FH1 A;  5IG0 A;  3GZR A;  5CF2 A;  1A90 A;  4XDV A;  3CC7 3;  1STD A;  2KCD A;  2WGQ A;  1NWW A;  1UUW B;  5A0O B;  3HIG A;  1W5Z A;  2GEX A;  5AI1 A;  4TX4 A;  4IIA A;  4MMZ B;  1Q81 4;  7STD A;  2W03 A;  3X40 A;  4BTX A;  3DGN A;  3U1W A;  4HKV B;  5JBS A;  1W7C A;  4N6T A;  2HMO B;  3F9S A;  2LQV A;  1GYB A;  2C11 A;  3G16 A;  1IQY A;  2W0Q A;  4FCM A;  3S28 A;  2E2U A;  3FCS B;  3EQQ B;  1OUN A;  3VF1 A;  2SBL A;  3CCV 3;  3CCE 3;  3G0K A;  1OF5 A;  1Q86 4;  3IPT A;  1FGM A;  3HZP A;  1WMO A;  1UW1 A;  1Q40 A;  4LZI A;  2CFW A;  3EN8 A;  3BLZ A;  2KXG A;  1OPY A;  3UB1 A;  3KZT A;  1K8A 4;  1D6Z A;  3DZL A;  3EF8 A;  1CYU A;  1YJW 3;  1US1 A;  3LML A;  4O3V A;  1TIJ A;  2I9W A;  1N8Q A;  4X2H A;  4AKZ A;  2PZV A;  2BNG A;  3EX9 A;  3KII A;  2CFK A;  3N9H A;  3KKG A;  5D81 A;  1U5O A;  3PCS A;  3MWZ A;  4XBX A;  2ML6 A;  3GZX B;  1OF5 B;  4HM3 B;  2QIY A;  4HZB B;  3CCM 3;  2HMJ B;  2QGU A;  1OAC A;  3X41 A;  4XDW A;  4BTY A;  1FGR A;  4KFD A;  1VQ5 3;  1IVX A;  1Q40 B;  3PGB A;  1YI2 3;  1DYU A;  3D9R A;  5CLK A;  2XSH B;  3KSE D;  3RDE A;  1W6G A;  1CQS A;  3EC9 A;  1V74 A;  1JN5 A;  4MJD A;  3K63 A;  3DXO A;  3FSD A;  4K1V A;  3DGL A;  1SIH A;  4EBG A;  4KFF A;  2F86 B;  5LC6 A;  2BMO B;  3FZW A;  4JF8 A;  1N8R 4;  4L7K A;  1VQ4 3;  1G96 A;  1O7H B;  1LOX A;  1IT8 A;  2BMQ B;  3G71 3;  1QAL A;  5IG4 A;  2D1W A;  3D3L A;  2JDI H;  2OQE C;  3CNM A;  3HI7 A;  2CG0 A;  4AKY A;  3G6E 3;  3B4P A;  3WOF B;  3MPH A;  4EV5 A;  2P38 A;  1U8C B;  3RGA A;  2CFL A;  1JN5 B;  1F8N A;  3X3X A;  2Y74 A;  3CME 3;  3X3Z A;  1VQL 3;  1DMM A;  3NXJ A;  3DMC A;  5AYR B;  1S5A A;  4RZM A;  1NB3 I;  2GXF A;  3SXX A;  3CCR 3;  3JUN A;  3LZA A;  2OTL 3;  2CWV A;  4FCJ A;  2BHM A;  3VSY A;  2FNQ A;  1RN7 A;  4WWU C;  3S27 A;  4LEH A;  1VQM 3;  3KN4 A;  4X2O A;  4RBN A;  2XGN A;  2IUK A;  2RFR A;  5AIG A;  4K1U A;  4OUQ A;  5EEO A;  1EA2 A;  3OWY A;  1JB5 A;  2CHC A;  3MG2 A;  1IQX A;  2CKF B;  4N6U A;  1O7P B;  3SX1 A;  2MC8 A;  1VQ9 3;  1LXE A;  3F8X A;  2OQE A;  1NU3 A;  3NHX A;  4K90 B;  1QJG A;  1W00 A;  4LMI A;  5LC7 A;  2F99 A;  3CCJ 3;  3GWR A;  1GD4 A;  2CWT A;  1IV7 A;  1JJ2 2;  1D6Y A;  3CCQ 3;  1JRQ A;  4XB5 A;  1M9G A;  3SED A;  2CFG A;  2B24 B;  4GL6 A;  3WOE B;  1GD3 A;  3PS8 A;  1PFP A;  1UI8 A;  3H3H A;  2IUJ A;  4HM7 B;  1Q82 4;  2E2T A;  3L0R A;  1SPU A;  3H51 A;  4IT7 A;  3F14 A;  3HX8 A;  3OW2 2;  1M90 4;  4NRE A;  3X42 A;  2Y73 A;  4RNY A;  3LXU X;  1QVG 2;  1NDO B;  1M1K 4;  3ECF A;  1YIT 3;  3WDG B;  3V92 A;  2GBW B;  3NBJ A;  4QWT A;  3LH4 A;  3LTD A;  4L8O A;  4CDL A;  1W02 A;  1VQ7 3;  4EC6 A;  3IJE B;  1FA3 A;  1ULJ B;  5ELJ A;  3CXC 2;  5CXO A;  4STD A;  1YVB I;  2HMK B;  4O02 B;  3V99 A;  3M8C A;  3FG3 A;  4N6N B;  1LVN A;  1W2B 2;  2ML5 A;  5KP3 A;  1W6C A;  5JPU A;  4MMY B;  3BNB A;  3UNL A;  3JUP A;  3WMD A;  2QA4 3;  5I97 A;  3GZB A;  1DMN A;  3GAX A;  3K5T A;  3NUV A;  4LSO A;  3LT9 A;  1ULI B;  3T8N A;  1Q7Y 4;  1OGX A;  4L8P A;  3FG1 A;  1K28 A;  2K54 A;  3NV0 A;  4I4K A;  8CHO A;  1MNL A;  1K9M 4;  4HVN A;  3E99 A;  1RRH A;  1N9E A;  5AEU B;  1YGE A;  4NHF A;  2Z7A A;  3JUM A;  2XRX B;  1SJW A;  2C10 A;  1FGQ A;  2CFD A;  3DGO A;  4WFO A;  1AVL A;  4KZ1 A;  1T5Y A;  3NBB A;  3WA2 X;  4AEQ A;  1S72 3;  1ASK A;  1IVV A;  1A2V A;  4EYC A;  1OH0 A;  4HM4 B;  3AMO A;  1AR0 A;  3MG3 A;  4RNZ A;  1JB2 A;  1GY6 A;  1YJ9 3;  5IEN A;  2WGO A;  1ROA A;  2GU3 A;  3BNE A;  3LOY A;  3B7C A;  3FF2 A;  3NV0 B;  1OHP A;  2W9P A;  3BNC A;  3N8B A;  3CPO A;  4N6L A;  1BUQ A;  5FW5 A;  4HYZ A;  1TP6 A;  2HMM B;  3EJV A;  2GU1 A;  4WP5 A;  2E2V A;  2GBX B;  3PCR A;  1OCV A;  4FMA A;  1JV2 B;  3UJM A;  2OTJ 3;  4J8T A;  3B8L A;  3F7S A;  5IER A;  3FG4 A;  3MG1 A;  4FMC A;  2L4V A;  4OK0 A;  2Z76 A;  2CG1 A;  3V98 A;  3NQY A;  5CF1 A;  3ROB A;  1GY7 A;  2XFS A;  1IDP A;  4IPB A;  3Q90 A;  4FCZ A;  1VQP 3;  1O7N B;  1YJN 3;  1Q42 A;  1VZZ A;  3OV4 A;  4ORL A;  2XFT A;  1K73 4;  1JKG A;  2WO0 A;  2W6J H;  1O7G B;  3PXM A;  1DVC A;  3CU3 A;  3WA3 A;  2LYX A;  2OWP A;  4Q53 A;  1L5G B;  5TGN A;  5EQL A;  2V1L A;  4GB5 A;  3OWU A;  1WQL B;  2Q07 A;  3LTA A;  4HBR A;  1E3R A;  1OHO A;  1UI7 A;  2YFL B;  1QAF A;  4H61 A;  2OCT A;  4OVM A;  1GS3 A;  2BMR B;  3EE1 A;  1WMP A;  1IK3 A;  3SOY A;  4HZ9 B;  3G4S 3;  3EN1 B;  3LTC A;  3OWS A;  4WYK A;  3GZY B;  2PNC A;  4HJL B;  2ZDJ A;  1IV9 A;  3S29 A;  4BTW A;  3G8Z A;  4HM5 B;  5D83 A;  3GRD A;  3NX0 A;  2Z77 A;  3I55 3;  1N5H A;  5IG3 A;  1NJI 4;  1JKG B;  2O9U X;  3F7X A;  3Q2P A;  5CK6 A;  1ZO2 A;  5HGR A;  3NM2 A;  4FR9 A;  2W04 A;  1CYV A;  3K9M C;  3EBT A;  3EBY A;  3F40 A;  3MKI A;  5KP4 A;  3CNX A;  1KD1 4;  4R1K A;  5D82 A;  1A67 A;  4MMX B;  3JUQ A;  3DGM A;  1ZX2 A;  3LT8 A;  5AIF A;  2UX0 A;  3A76 A;  4WYK B;  3KSP A;  4PEJ A;  1EQK A;  3CPW 2;  4R9L A;  3S5C A;  1YIJ 3;  4KVH A;  3CCS 3;  2CH9 A;  1O7M B;  4O8S A;  4N3V A;  3IMA B;  3UL5 A;  2OOV C;  2M7O A;  3BB9 A;  2QEX 3;  2KRT A;  1SQW A;  2O3O A;  1IT7 A;  1EKM A;  1OGZ A;  3HII A;  1QVF 2;  1DMQ A;  1QAK A;  3Q1C A;  3MYT A;  4XBT A;  4FMB A;  2XH9 A;  1TUH A;  3FKA A;  4U13 A;  2ZL8 A;  1HU9 A;  4N6O B;  2P0M A;  2CIU A;  4R4K A;  3UL6 A;  2RCD A;  3MHE A;  3F8H A;  3PYJ A;  3ALA A;  1K41 A;  3KFQ C;  1A2K A;  4ZM8 A;  2XR8 B;  3CD6 3;  5ELU A;  2STD A;  2XEP A;  3EB8 A;  3PZW A;  5IEP A;  4O2H A;  1AVK A;  3FGY A;  2MF7 A;  5DRV A;  1FGO A;  1UUV B;  5IG5 A;  1N5P A;  1Y4K A;  1ROV A;  3KE7 A;  1W01 A;  2P09 A;  4H3U A;  2OOV A;  3T8U A;  2CW9 A;  1RJO A;  4EV2 A;  3CCL 3;  3X3Y A;  1O7W B;  2P05 A;  3DM8 A;  3N54 B;  4N6V 0;  4LGQ A;  2K0M A;  5DRE A;  2HML B;  5BVB A;  1M1X B;  3NQZ A;  6STD A;  5BXQ A;  3LTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...