2O9UX

Monellin (mnei) at 1.15 resolution
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
96
structure length
95
Chain Sequence
GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFADISEDYKTRGRKLLRFNGPVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Monellin (MNEI) at 1.15 A resolution
pubmed doi rcsb
source organism Dioscoreophyllum cumminsii
molecule tags Plant protein
molecule keywords Monellin chain B and Monellin chain A
total genus 23
structure length 95
sequence length 96
ec nomenclature
pdb deposition date 2006-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF09200 Monellin Monellin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2o9uX00
1DVDA 1N5HA 1CYVA 1M9GA 2CH9A 3Q2PA 1A67A 3MWZA 5EQLA 2BO9B 3L0RA 1G96A 3LH4A 1R4CA 3PYJA 4EYCA 1ROAA 2W9PA 3QRDA 3NX0A 1CYUA 1N9JA 3KFQC 1KWIA 2O9UX 4TX4A 1DVCA 5LC7A 1IV9A 1LXEA 3SVAA 4N6OB 3K9MC 1NB5I 3S67A 1MNLA 5LC6A 4IT7A 3KSED 1EQKA 5A0OB 1FUWA 1TIJA 4N6TA 3UL6A 1STFI 1A90A 5ELJA 4LZIA 1GD3A 4N6UA 1GD4A 1N5PA 1CEWI 1NB3I 1WNHA 3PXMA 1IV7A 4N6V0 4N6MA 2KXGA 3PS8A 3UL5A 1FA3A 1MOLA 2W9QA 4N6NB 5ELUA 4ZM8A 4N6LA 3GAXA 1RN7A 2OCTA 1PFPA 1YVBI 4CCVA 3IMAB
chains in the Genus database with same CATH superfamily
1SQWA 3I563 1YIT3 1HYFA 1G02A 1M9GA 3RDEA 1OGXA 2YFLB 5IW9A 2Q07A 3NHXA 2CFLA 3F9SA 5D82A 1K734 1RGCA 3A76A 4HAAA 3CCS3 1B3SA 2H0HA 3EBTA 1ROAA 2R41A 3LZAA 2D1WA 2CFGA 3NX0A 3S29A 3X3ZA 4TX4A 1BANA 3JUNA 2W2CA 3EB8A 3V98A 1HZ1A 3LYGA 1KC84 3GZXB 2E2UA 4FCJA 3WA3A 2QA43 2A15A 1BSDA 2STDA 2IMJA 3DGLA 1GD4A 1IQYA 1N5PA 3KZTA 3DGYA 3SXXA 3GZYB 4EW5A 1LVNA 3NUVA 3EE1A 2OWPA 1PY3A 2XEPA 1Z1SA 1RTUA 5D83A 1OF5B 3F8XA 1GS3A 1MWTA 1I8VA 1RGHA 3F7XA 4CCVA 2W56A 3DH2A 3G0KA 4MMZB 1K41A 3D5IA 3S5CA 1PU4A 3EX9A 3CCE3 1YVSA 3G713 1RMSA 1WMNA 3CD63 5IEPA 4EYCA 4KT3B 5JPPA 5KP1A 2GEYA 1GOUA 1I3FA 2XGLA 3KFQC 4H61A 1S723 3S28A 1DVCA 1E3VA 1I0XA 1J2BA 1YNVX 3CC73 2GEXA 1LOVA 1LNIA 1RGLA 2QIYA 2W56B 3F14A 3JUOA 1RNTA 1AQZA 1FZUA 3GRDA 1B20A 3LTCA 2P09A 2XSOB 3FF0A 2KF6A 2CG1A 4WFOA 1YVBI 4BTXA 1US1A 4L7KA 4X2OA 1FGTA 1GY7A 1X1WA 3B4PA 2FNQA 3FCSB 2UUGC 4NREA 5DRVA 2IUJA 1Q864 1RNBA 2MF7A 4FMDA 5I97A 3K5TA 2PNCA 1TUHA 1UDII 1WTHA 1R4CA 2IY2A 2H0IA 4X2HA 3VGNA 4K1VA 3DUKA 4LEHA 4CDLA 4HM0B 1GSPA 1JN5A 5CF1A 4DKIA 3CCJ3 1VQK3 1MWRA 4BTYA 1M904 3EQQB 3EC9A 1BGSA 1OH0A 1ULJB 5CF2A 2GBXB 2F5WA 4HOHA 6STDA 5AEUB 3T8UA 2CFKA 1QVG2 1MOLA 4LYLB 3ALAA 4BL2A 6RNTA 1D6YA 4R9KA 5IENA 3AGNA 1BSAA 1UCIA 1N5HA 3LTAA 3Q2PA 1W4NA 2Y73A 4K90B 1RGFA 1VQL3 3MYTA 4NHFA 1BRHA 1EKMA 3PYJA 1KD14 5FW5A 1FYSA 3N8BA 1O7GB 2Z76A 4KZ1A 4FMCA 3ZG0A 4HM7B 3V92A 1OHSA 4MEIA 1G0TA 3K9MC 4J8TA 4JRFA 4R1KA 1LOWA 1OHOA 5IERA 3ECFA 3KSED 2OTJ3 3U1WA 1RGAA 2W03A 1IVVA 2XGNA 4WWUC 4N6V0 1JBSA 4XBYA 3FLJA 8CHOA 2K3DA 3IPTA 4OVMA 5IF6A 4WYKB 2OQEA 4XDVA 2WGQA 4CJNA 4FCMA 3NV0A 3DGOA 1UGIA 3GZRA 2F86B 4OUQA 1A67A 1NDOB 3AHWA 4ORLA 3WODG 1GY5A 5AI1A 2Z77A 1VQO3 1Q7Y4 2H0GA 1BAOA 1DMNA 2BU4A 3FF2A 3MPHA 1TTOA 1HKXA 4HJLB 3H51A 2OOVC 4XB5A 2O3OA 3DY5A 1O7WB 2F56A 2K54A 2AAEA 1W2B2 2GXFA 3BIRA 1AVKA 3LXUX 4HKVB 3URPA 1B27A 3OX9A 1RDSA 1UCKA 3PXMA 1GMQA 3X3XA 1STDA 3U97A 4L8OA 4ZM8A 2XFTA 1LOYA 1WQLB 1BU4A 2ZDJA 3D3LA 1OUNA 1DETA 1RGGA 4GL6A 1M1XB 1D6UA 3OWYA 2QEX3 3HI7A 1DE3A 4BIRA 1BRNL 2CK3H 1WMPA 3CME3 2BT3A 2B1XB 3CCL3 3LMLA 3K63A 3OWSA 1EEJA 3GSPA 3PZWA 3WDGB 3T8NA 3NBRA 3FKAA 1AV4A 1N9EA 4AKZA 1VQ93 1I2GA 3CC43 1YJW3 4MMYB 2RGQA 2I9WA 1OACA 1I0VA 2JQ5A 3G4S3 5ELJA 1GD3A 3B8LA 2CFWA 1NB3I 3EN1B 1S5AA 3KSPA 1GOYA 2IA7A 1Q40A 1BNRA 4N6NB 4N6LA 3CPOA 3NM2A 5KP3A 1AVLA 1DMQA 4LSOA 1B2SA 1LOXA 4HBRA 5DREA 3OW22 2KF4A 1OCVA 3CCQ3 2M7OA 1CYVA 3NXJA 3OWUA 3NBJA 3AMOB 2C10A 2INXA 5AIGA 3AMOA 1VQ73 3JUQA 3CC23 1CYUA 2ZA4A 2MC8A 3UNLA 2O9UX 1BVIA 2FXTA 5CLKA 1IV9A 1BNFA 1JNQA 1LXEA 2ML6A 3A5EA 3D4AA 1T2IA 3G16A 4STDA 3S67A 3FG3A 3LOYA 5AIIA 4K61A 1DYUA 2CWUA 1FGQA 1AY7A 3DZLA 4H3UA 2HMNB 2E2VA 1TRPA 1ZS7A 1JBTA 1BUJA 4LMIA 1WNHA 1T5YA 4HM5B 1K9M4 4OK0A 2XH9A 3FGYA 3EHCA 3DM8A 1Q40B 5M19A 1MWUA 4AKYA 7GSPA 3HK4A 3D5GA 4KVHA 3SOAA 3ZFZA 2F4YA 2LQVA 3OV4A 1I3IA 3D9RA 4NPBA 1QAKA 2KF3A 1JB2A 2WO0A 2BO9B 3X41A 1IT8A 1O7PB 3AHSA 3SOYA 3O8YA 4GB5A 1TFKA 4HZBB 1TJDA 1UCJA 1UW1A 1RJOA 4N6OB 1NJI4 3H3HA 2HMKB 4O8SA 4I5QA 2BMOB 3BLZA 3HOHA 5G1KA 3FG1A 3SX1A 1W5ZA 1LQMB 3F7SA 1TP6A 1W2ZA 4MJDA 5A0OB 3MKIA 1UUVB 1V57A 2Y74A 4N6MA 5AIHA 1O7NB 2C4BA 4FR9A 4QWTA 3JUMA 1BNGA 4RNTA 1VQP3 1X1XA 3SEDA 2BMRB 2E2TA 2RCDA 1M1K4 4FMAA 2PZVA 4PEJA 1W6CA 1I70A 5IEOA 1EUIC 1K8A4 4J5KA 2CH9A 1IVXA 1T2HA 2R4IA 4KFFA 1R4YA 4R80A 3MWZA 3NQYA 1B2UA 1C7HA 3E99A 5G2GA 4KFEA 3WHOA 2CW9A 1RSNA 3HIGA 4O3VA 1VZZA 1IDPA 1RGKA 3LTDA 3LT9A 1O7HB 5LC7A 5AEWB 1TFOA 2W04A 1RCLA 1NB5I 3QK9A 1BIRA 1MGRA 3BB9A 3LT8A 5LC6A 3N54B 5CXOA 9RNTA 2J8XB 4LZIA 3KN4A 3PCRA 4HM2B 1JZOA 1CH0A 2B24B 3CNXA 3GWRA 4WYKA 4HYZA 2HMJB 3CCV3 1RN7A 4EBGA 3HX8A 3FSDA 5EVHA 3AGOA 4RNYA 3UB1A 2P05A 3DGNA 2WGOA 5EQLA 1DMMA 3L0RA 1ASKA 4FCZA 3S27A 3LH4A 2CIUA 4AEQA 3G6E3 1U5OA 3BNCA 3QRDA 4R9LA 1NO3A 2QGUA 2YFIB 3DGMA 3CPW2 2Z7AA 1V74A 4GHOA 4GSPA 1QAFA 1T3BA 4U13A 1X1UA 3D79A 1TIJA 1A90A 5M18A 1U8CB 4N6UA 1CEWI 1E3RA 1KSIA 3HIIA 3I553 2XFSA 1L5GB 1RHLA 3FH1A 3MSOA 4K1UA 2YFJB 4XBTA 2SBLA 2P0MA 5BXQA 4EV2A 1SIHA 2YX9A 2BIRA 1QALA 2GBWB 1B2ZA 3BNEA 3WR2A 1W6YA 4J5GA 1QVF2 1BRKA 1W02A 2GU3A 2OQEC 1VQ43 3X3YA 1RRHA 3B7CA 3F8HA 3RGAA 1BNJA 2RFRA 2D42A 1BRGA 4HM3B 1JB4A 1JKGA 1EG9B 5TGNA 1SIIA 1BOXA 3SVAA 2KAAA 5JPUA 4BL3A 1UGHI 4N6TA 3UL6A 1RCKA 4BTWA 1YGEA 3NM7A 2UX0A 4WP5A 3M8CA 1IT7A 1UI7A 2ZL8A 1C54A 4ILFA 1WMOA 2XF3A 4RNZA 5AIFA 1YJ93 4WHAA 3I0YA 3EBYA 3JUPA 1E97A 3ROBA 1YJN3 4HM4B 1YHQ3 6GSPA 4RZMA 3RNTA 3CCM3 1JBRA 2KCDA 1AR0A 5BIRA 1GOVA 1TRQA 4MMXB 1ISKA 1Q824 5KP4A 1IVWA 4N3VA 3VSYA 1B2MA 5IG0A 1BSCA 1B2XA 4L8PA 4IT7A 3NBBA 5STDA 1Y4KA 1TU5A 1W00A 1A2PA 4EC6A 1F8NA 1SJWA 5IG4A 3KKGA 4LGQA 1PYLA 3V99A 1NU3A 2KXGA 4HM8B 2W6JH 1JKGB 3PS8A 1GMRA 1JZDA 1UCLA 4O02B 3HZPA 4FMBA 2CX0A 2OCTA 4RBNA 4O2HA 1BRIA 2CG0A 1MWSA 3N9HA 2ML5A 2ZHXB 5G1LA 1BNEA 3X42A 3WOEB 3SYUA 3EJVA 3VF1A 1BRSA 1ULIB 1JV2B 1ZGXA 3UJMA 1IVUA 2F5MA 1VQN3 3TDGA 1BRJA 1Q7HA 1ZO2A 4XBXA 3K7CA 5HGRA 5RNTA 5FGOA 1BNSA 4HM6B 1IYYA 1SARA 3Q90A 3UL5A 1X1YA 1BNIA 1RGEA 1VQ83 2KRTA 2RNTA 3B4OA 5HOHA 5JBSA 1IQXA 5GSPA 3BU4A 3WMDA 3KIIA 2OTL3 4JF8A 5AYSC 1QJGA 2IYJA 2KF5A 1BSEA 5CK6A 4EV5A 2HOHA 2XSHB 3CMA3 5BVBA 3DXOA 4R4KA 1RLSA 1RN1A 3FG4A 2F99A 3PCSA 3BNDA 1B21A 2W9PA 3MHEA 1BSBA 2C11A 4J9AA 4XM4A 7RNTA 1NNVA 1RKYA 3PGBA 1W6GA 1FGOA 3EN8A 1MNLA 1IQ8A 2RSXA 1A2KA 3CXC2 1FGRA 4XDWA 1STFI 2IUKA 3STDA 1JB5A 1JRQA 2UGIA 3KE7A 1YIJ3 1LNHA 1UI8A 4I4KA 1GY6A 3OXAA 4IIAA 2WOHA 2W9QA 3GZBA 3LTBA 5IG3A 1RRLA 4KFDA 1UUWB 1CQSA 3F40A 4CPKA 2W0QA 2SARA 3ZG5A 1O7MB 1Q9EA 1W01A 2GU1A 1OGZA 2L1SA 2Z6BA 3MG3A 1DVDA 1OPYA 3EF8A 2HMMB 4IPBA 3CNMA 3G8ZA 3MG1A 1EA2A 5D81A 1FW7A 1G96A 1GMPA 3SLUA 5IG5A 5AYRB 2OOVA 1N9JA 1GYBA 1OF5A 1KWIA 2P38A 2XR8B 4HVNA 1HU9A 2V1LA 1ROVA 2FGTA 3DMCA 1W7CA 4G1MB 1OHPA 1JJ22 2WOFA 1IK3A 1MGWA 2P0XA 1FUWA 1FUTA 5M1AA 2BMQB 2CWVA 1JN5B 3CU3A 1RN4A 3ER7A 1SPUA 1I2EA 2F98A 3X40A 1QMAA 1LRAA 2LYXA 1KQS2 3J7Yd 3NV0B 1EQKA 1UUGB 1V58A 4EXRA 2BNGA 3GAXA 2XRXB 2HMOB 2JDIH 4Q53A 3WOFB 3NQZA 1BUQA 1FA3A 3IMAB 2AADA 4BU4A 3CCR3 2CHCA 3Q1CA 1IU7A 2BHMA 2HMLB 2K0MA 3JVCA 3BNBA 1Q814 3T0UA 1ZX2A 2CWTA 3K0ZA 1YI23 3CCU3 4HM1B 8RNTA 1VQM3 1YGWA 2CKFB 1D6ZA 3WA2X 1N8R4 1I2FA 2GSPA 4HZ9B 5BU4A 1FGMA 1NWWA 5EEOA 7STDA 3MG2A 3FZWA 1A2VA 1Q42A 3RGRA 1IV7A 3IJEB 2RBIA 1N8QA 1LQGC 1VQ63 1VQQA 1FUSA 1K28A 3Q3FA 5ELUA 2CFDA 2L4VA 1VQ53 2CC3A 2CX1A 1PFPA 3KCHA
chains in the Genus database with same CATH topology
1SQWA 3I563 1YIT3 3RDEA 1M9GA 1OGXA 2YFLB 5IW9A 2Q07A 3NHXA 2CFLA 3F9SA 5D82A 1K734 3A76A 3CCS3 3EBTA 1ROAA 3LZAA 2D1WA 2CFGA 3NX0A 3S29A 3X3ZA 4TX4A 3JUNA 2W2CA 3EB8A 3V98A 1KC84 3LYGA 3GZXB 2E2UA 4FCJA 3WA3A 2QA43 2A15A 2STDA 2IMJA 3DGLA 1N5PA 1GD4A 1IQYA 3KZTA 3SXXA 3GZYB 1LVNA 3NUVA 3EE1A 2OWPA 2XEPA 1Z1SA 5D83A 1OF5B 3F8XA 1GS3A 3F7XA 4CCVA 2W56A 3G0KA 4MMZB 1K41A 3S5CA 1PU4A 3EX9A 3CCE3 3G713 1WMNA 3CD63 5IEPA 4EYCA 5JPPA 5KP1A 2GEYA 2XGLA 4H61A 3KFQC 3S28A 1DVCA 1E3VA 1J2BA 3CC73 2GEXA 2W56B 2QIYA 3JUOA 3F14A 3GRDA 3LTCA 2P09A 2XSOB 3FF0A 2CG1A 4WFOA 1YVBI 4BTXA 1US1A 4L7KA 4X2OA 1FGTA 1GY7A 3B4PA 2FNQA 3FCSB 4NREA 5DRVA 2IUJA 1Q864 2MF7A 4FMDA 5I97A 3K5TA 2PNCA 1TUHA 1WTHA 1R4CA 4X2HA 3VGNA 4K1VA 3DUKA 4LEHA 4CDLA 4HM0B 1JN5A 5CF1A 3CCJ3 1VQK3 4BTYA 1M904 3EQQB 3EC9A 1OH0A 1ULJB 5CF2A 2GBXB 6STDA 5AEUB 3T8UA 2CFKA 1QVG2 1MOLA 3ALAA 1D6YA 4R9KA 5IENA 1N5HA 3LTAA 3Q2PA 1W4NA 2Y73A 4K90B 1VQL3 3MYTA 4NHFA 1EKMA 3PYJA 1KD14 5FW5A 3N8BA 1O7GB 2Z76A 4KZ1A 4FMCA 4HM7B 3V92A 1OHSA 4MEIA 3K9MC 4J8TA 4R1KA 4JRFA 1OHOA 5IERA 3ECFA 3KSED 2OTJ3 2W03A 1IVVA 2XGNA 4WWUC 4N6V0 4XBYA 3FLJA 8CHOA 3IPTA 4OVMA 5IF6A 4WYKB 2OQEA 4XDVA 2WGQA 4FCMA 3NV0A 3DGOA 3GZRA 2F86B 4OUQA 1A67A 1NDOB 4ORLA 3WODG 1GY5A 5AI1A 2Z77A 1VQO3 1Q7Y4 1DMNA 3FF2A 3MPHA 1HKXA 4HJLB 3H51A 2OOVC 4XB5A 2O3OA 3DY5A 1O7WB 2K54A 1W2B2 2GXFA 1AVKA 3LXUX 4HKVB 3OX9A 3PXMA 3X3XA 1STDA 3U97A 4L8OA 4ZM8A 2XFTA 3D3LA 1WQLB 2ZDJA 1OUNA 4GL6A 1M1XB 1D6UA 3OWYA 2QEX3 3HI7A 2CK3H 1WMPA 3CME3 2BT3A 2B1XB 3CCL3 3LMLA 3K63A 3OWSA 3WDGB 3PZWA 3T8NA 3NBRA 3FKAA 1AV4A 1N9EA 4AKZA 1VQ93 3CC43 1YJW3 4MMYB 2RGQA 2I9WA 1OACA 3G4S3 2JQ5A 5ELJA 1GD3A 3B8LA 2CFWA 1NB3I 3EN1B 1S5AA 3KSPA 2IA7A 1Q40A 4N6NB 4N6LA 3CPOA 3NM2A 5KP3A 1AVLA 1DMQA 4LSOA 1LOXA 4HBRA 5DREA 3OW22 1OCVA 3CCQ3 2M7OA 1CYVA 3NXJA 3OWUA 3NBJA 3AMOB 2C10A 2INXA 5AIGA 3AMOA 1VQ73 3JUQA 3CC23 1CYUA 2MC8A 3UNLA 2O9UX 3U1WA 2FXTA 5CLKA 1IV9A 1LXEA 1JNQA 2ML6A 3G16A 4STDA 3S67A 3FG3A 3LOYA 5AIIA 4K61A 1DYUA 1FGQA 2CWUA 3DZLA 4H3UA 2HMNB 2E2VA 4LMIA 1WNHA 1T5YA 4HM5B 1K9M4 4OK0A 2XH9A 3FGYA 3EHCA 3DM8A 1Q40B 4AKYA 3HK4A 4KVHA 3SOAA 3OV4A 2LQVA 3D9RA 1QAKA 1JB2A 2WO0A 2BO9B 3X41A 1IT8A 1O7PB 3SOYA 3O8YA 4GB5A 1TFKA 4HZBB 1UW1A 1RJOA 4N6OB 1NJI4 3H3HA 2HMKB 4O8SA 2BMOB 3BLZA 3SX1A 1EQKA 3FG1A 5A0OB 1W5ZA 3F7SA 1S723 1TP6A 1W2ZA 4MJDA 3MKIA 1UUVB 5AIHA 4N6MA 1O7NB 4FR9A 4QWTA 3JUMA 1VQP3 3SEDA 2BMRB 2E2TA 2RCDA 1M1K4 4FMAA 2PZVA 4PEJA 1W6CA 5IEOA 1K8A4 4R80A 2CH9A 1IVXA 2R4IA 4KFFA 3MWZA 3NQYA 1C7HA 3E99A 5G2GA 4KFEA 2CW9A 3HIGA 4O3VA 1VZZA 1IDPA 3LTDA 5LC7A 3LT9A 1O7HB 5AEWB 1TFOA 2W04A 1NB5I 3QK9A 3BB9A 5LC6A 3LT8A 3N54B 5CXOA 4LZIA 3KN4A 3PCRA 4HM2B 3GWRA 2B24B 3CNXA 4WYKA 4HYZA 2HMJB 3CCV3 1RN7A 4EBGA 3HX8A 3FSDA 5EVHA 4RNYA 3UB1A 2P05A 3DGNA 2WGOA 5EQLA 1DMMA 3L0RA 1ASKA 4FCZA 3S27A 3LH4A 2CIUA 4AEQA 3G6E3 1U5OA 3BNCA 3QRDA 4R9LA 1NO3A 2QGUA 2YFIB 3DGMA 3CPW2 2Z7AA 1V74A 1QAFA 4U13A 1TIJA 1A90A 1U8CB 4N6UA 1CEWI 1E3RA 1KSIA 3HIIA 3I553 2XFSA 1L5GB 3FH1A 3MSOA 4K1UA 2YFJB 4XBTA 2SBLA 2P0MA 5BXQA 4EV2A 1SIHA 2YX9A 3BNEA 1QALA 2GBWB 1W6YA 1QVF2 1W02A 2GU3A 2OQEC 1VQ43 3X3YA 1RRHA 3B7CA 3F8HA 3RGAA 2RFRA 2D42A 4HM3B 1JB4A 1JKGA 1EG9B 5TGNA 1SIIA 3SVAA 5JPUA 4N6TA 3UL6A 4BTWA 1YGEA 3NM7A 2UX0A 4WP5A 3M8CA 1IT7A 1UI7A 2ZL8A 1WMOA 2XF3A 4RNZA 5AIFA 1YJ93 4WHAA 3I0YA 3EBYA 3JUPA 1E97A 3ROBA 1YJN3 4HM4B 1YHQ3 4RZMA 3CCM3 2KCDA 1AR0A 1ISKA 4MMXB 1Q824 5KP4A 1IVWA 4N3VA 3VSYA 5IG0A 1TU5A 4L8PA 5STDA 4IT7A 3NBBA 1Y4KA 1W00A 4EC6A 1F8NA 1SJWA 5IG4A 3KKGA 4LGQA 3V99A 1NU3A 2KXGA 4HM8B 2W6JH 1JKGB 3PS8A 4O02B 3HZPA 4FMBA 2OCTA 4RBNA 4O2HA 2CG0A 3N9HA 2ML5A 3X42A 3WOEB 3EJVA 3VF1A 1ULIB 1JV2B 3UJMA 1IVUA 1VQN3 3TDGA 1ZO2A 4XBXA 3K7CA 5HGRA 5FGOA 4HM6B 3Q90A 3UL5A 1VQ83 2KRTA 3B4OA 5JBSA 1IQXA 3WMDA 3KIIA 2OTL3 4JF8A 5AYSC 1QJGA 4EV5A 5CK6A 2XSHB 3CMA3 5BVBA 3DXOA 4R4KA 3FG4A 2F99A 3PCSA 3BNDA 2W9PA 3MHEA 4J9AA 2C11A 4XM4A 1RKYA 3PGBA 1W6GA 1FGOA 3EN8A 1MNLA 1IQ8A 2RSXA 1A2KA 3CXC2 1FGRA 4XDWA 1STFI 2IUKA 3STDA 1JB5A 1JRQA 3KE7A 1YIJ3 1LNHA 1UI8A 4I4KA 1GY6A 3OXAA 4IIAA 2WOHA 2W9QA 3GZBA 3LTBA 5IG3A 1RRLA 4KFDA 1UUWB 1CQSA 3F40A 2W0QA 1O7MB 1W01A 2GU1A 1OGZA 2Z6BA 3MG3A 1DVDA 1OPYA 3EF8A 2HMMB 4IPBA 3CNMA 3G8ZA 3MG1A 1EA2A 5D81A 1G96A 3SLUA 5IG5A 5AYRB 2OOVA 1N9JA 1GYBA 2XR8B 1OF5A 1KWIA 2P38A 4HVNA 1HU9A 2V1LA 2FGTA 3DMCA 1ROVA 1W7CA 4G1MB 1OHPA 1JJ22 2WOFA 1IK3A 2P0XA 1FUWA 2BMQB 1JN5B 3CU3A 2CWVA 3ER7A 1SPUA 2F98A 3X40A 1QMAA 2LYXA 1KQS2 3J7Yd 3NV0B 4EXRA 2BNGA 3GAXA 2XRXB 2HMOB 2JDIH 4Q53A 3WOFB 3NQZA 1BUQA 1FA3A 3IMAB 3CCR3 2CHCA 3Q1CA 1IU7A 2BHMA 2HMLB 2K0MA 3JVCA 1PFPA 3BNBA 1Q814 3T0UA 1ZX2A 2CWTA 3K0ZA 1YI23 3CCU3 4HM1B 1VQM3 2CKFB 1D6ZA 3WA2X 1N8R4 4HZ9B 1FGMA 1NWWA 5EEOA 7STDA 3MG2A 3FZWA 1A2VA 1Q42A 3RGRA 1IV7A 3IJEB 1N8QA 1VQ63 1VQ53 1K28A 5ELUA 2CFDA 2L4VA 2CC3A 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DVD A;  1N5H A;  1CYV A;  1M9G A;  2CH9 A;  3Q2P A;  1A67 A;  3MWZ A;  5EQL A;  2BO9 B;  3L0R A;  1G96 A;  3LH4 A;  1R4C A;  3PYJ A;  4EYC A;  1ROA A;  2W9P A;  3QRD A;  3NX0 A;  1CYU A;  1N9J A;  3KFQ C;  1KWI A;  2O9U X;  4TX4 A;  1DVC A;  5LC7 A;  1IV9 A;  1LXE A;  3SVA A;  4N6O B;  3K9M C;  1NB5 I;  3S67 A;  1MNL A;  5LC6 A;  4IT7 A;  3KSE D;  1EQK A;  5A0O B;  1FUW A;  1TIJ A;  4N6T A;  3UL6 A;  1STF I;  1A90 A;  5ELJ A;  4LZI A;  1GD3 A;  4N6U A;  1GD4 A;  1N5P A;  1CEW I;  1NB3 I;  1WNH A;  3PXM A;  1IV7 A;  4N6V 0;  4N6M A;  2KXG A;  3PS8 A;  3UL5 A;  1FA3 A;  1MOL A;  2W9Q A;  4N6N B;  5ELU A;  4ZM8 A;  4N6L A;  3GAX A;  1RN7 A;  2OCT A;  1PFP A;  1YVB I;  4CCV A;  3IMA B; 
#chains in the Genus database with same CATH topology
 1SQW A;  3I56 3;  1YIT 3;  1HYF A;  1G02 A;  1M9G A;  3RDE A;  1OGX A;  2YFL B;  5IW9 A;  2Q07 A;  3NHX A;  2CFL A;  3F9S A;  5D82 A;  1K73 4;  1RGC A;  3A76 A;  4HAA A;  3CCS 3;  1B3S A;  2H0H A;  3EBT A;  1ROA A;  2R41 A;  3LZA A;  2D1W A;  2CFG A;  3NX0 A;  3S29 A;  3X3Z A;  4TX4 A;  1BAN A;  3JUN A;  2W2C A;  3EB8 A;  3V98 A;  1HZ1 A;  3LYG A;  1KC8 4;  3GZX B;  2E2U A;  4FCJ A;  3WA3 A;  2QA4 3;  2A15 A;  1BSD A;  2STD A;  2IMJ A;  3DGL A;  1GD4 A;  1IQY A;  1N5P A;  3KZT A;  3DGY A;  3SXX A;  3GZY B;  4EW5 A;  1LVN A;  3NUV A;  3EE1 A;  2OWP A;  1PY3 A;  2XEP A;  1Z1S A;  1RTU A;  5D83 A;  1OF5 B;  3F8X A;  1GS3 A;  1MWT A;  1I8V A;  1RGH A;  3F7X A;  4CCV A;  2W56 A;  3DH2 A;  3G0K A;  4MMZ B;  1K41 A;  3D5I A;  3S5C A;  1PU4 A;  3EX9 A;  3CCE 3;  1YVS A;  3G71 3;  1RMS A;  1WMN A;  3CD6 3;  5IEP A;  4EYC A;  4KT3 B;  5JPP A;  5KP1 A;  2GEY A;  1GOU A;  1I3F A;  2XGL A;  3KFQ C;  4H61 A;  1S72 3;  3S28 A;  1DVC A;  1E3V A;  1I0X A;  1J2B A;  1YNV X;  3CC7 3;  2GEX A;  1LOV A;  1LNI A;  1RGL A;  2QIY A;  2W56 B;  3F14 A;  3JUO A;  1RNT A;  1AQZ A;  1FZU A;  3GRD A;  1B20 A;  3LTC A;  2P09 A;  2XSO B;  3FF0 A;  2KF6 A;  2CG1 A;  4WFO A;  1YVB I;  4BTX A;  1US1 A;  4L7K A;  4X2O A;  1FGT A;  1GY7 A;  1X1W A;  3B4P A;  2FNQ A;  3FCS B;  2UUG C;  4NRE A;  5DRV A;  2IUJ A;  1Q86 4;  1RNB A;  2MF7 A;  4FMD A;  5I97 A;  3K5T A;  2PNC A;  1TUH A;  1UDI I;  1WTH A;  1R4C A;  2IY2 A;  2H0I A;  4X2H A;  3VGN A;  4K1V A;  3DUK A;  4LEH A;  4CDL A;  4HM0 B;  1GSP A;  1JN5 A;  5CF1 A;  4DKI A;  3CCJ 3;  1VQK 3;  1MWR A;  4BTY A;  1M90 4;  3EQQ B;  3EC9 A;  1BGS A;  1OH0 A;  1ULJ B;  5CF2 A;  2GBX B;  2F5W A;  4HOH A;  6STD A;  5AEU B;  3T8U A;  2CFK A;  1QVG 2;  1MOL A;  4LYL B;  3ALA A;  4BL2 A;  6RNT A;  1D6Y A;  4R9K A;  5IEN A;  3AGN A;  1BSA A;  1UCI A;  1N5H A;  3LTA A;  3Q2P A;  1W4N A;  2Y73 A;  4K90 B;  1RGF A;  1VQL 3;  3MYT A;  4NHF A;  1BRH A;  1EKM A;  3PYJ A;  1KD1 4;  5FW5 A;  1FYS A;  3N8B A;  1O7G B;  2Z76 A;  4KZ1 A;  4FMC A;  3ZG0 A;  4HM7 B;  3V92 A;  1OHS A;  4MEI A;  1G0T A;  3K9M C;  4J8T A;  4JRF A;  4R1K A;  1LOW A;  1OHO A;  5IER A;  3ECF A;  3KSE D;  2OTJ 3;  3U1W A;  1RGA A;  2W03 A;  1IVV A;  2XGN A;  4WWU C;  4N6V 0;  1JBS A;  4XBY A;  3FLJ A;  8CHO A;  2K3D A;  3IPT A;  4OVM A;  5IF6 A;  4WYK B;  2OQE A;  4XDV A;  2WGQ A;  4CJN A;  4FCM A;  3NV0 A;  3DGO A;  1UGI A;  3GZR A;  2F86 B;  4OUQ A;  1A67 A;  1NDO B;  3AHW A;  4ORL A;  3WOD G;  1GY5 A;  5AI1 A;  2Z77 A;  1VQO 3;  1Q7Y 4;  2H0G A;  1BAO A;  1DMN A;  2BU4 A;  3FF2 A;  3MPH A;  1TTO A;  1HKX A;  4HJL B;  3H51 A;  2OOV C;  4XB5 A;  2O3O A;  3DY5 A;  1O7W B;  2F56 A;  2K54 A;  2AAE A;  1W2B 2;  2GXF A;  3BIR A;  1AVK A;  3LXU X;  4HKV B;  3URP A;  1B27 A;  3OX9 A;  1RDS A;  1UCK A;  3PXM A;  1GMQ A;  3X3X A;  1STD A;  3U97 A;  4L8O A;  4ZM8 A;  2XFT A;  1LOY A;  1WQL B;  1BU4 A;  2ZDJ A;  3D3L A;  1OUN A;  1DET A;  1RGG A;  4GL6 A;  1M1X B;  1D6U A;  3OWY A;  2QEX 3;  3HI7 A;  1DE3 A;  4BIR A;  1BRN L;  2CK3 H;  1WMP A;  3CME 3;  2BT3 A;  2B1X B;  3CCL 3;  3LML A;  3K63 A;  3OWS A;  1EEJ A;  3GSP A;  3PZW A;  3WDG B;  3T8N A;  3NBR A;  3FKA A;  1AV4 A;  1N9E A;  4AKZ A;  1VQ9 3;  1I2G A;  3CC4 3;  1YJW 3;  4MMY B;  2RGQ A;  2I9W A;  1OAC A;  1I0V A;  2JQ5 A;  3G4S 3;  5ELJ A;  1GD3 A;  3B8L A;  2CFW A;  1NB3 I;  3EN1 B;  1S5A A;  3KSP A;  1GOY A;  2IA7 A;  1Q40 A;  1BNR A;  4N6N B;  4N6L A;  3CPO A;  3NM2 A;  5KP3 A;  1AVL A;  1DMQ A;  4LSO A;  1B2S A;  1LOX A;  4HBR A;  5DRE A;  3OW2 2;  2KF4 A;  1OCV A;  3CCQ 3;  2M7O A;  1CYV A;  3NXJ A;  3OWU A;  3NBJ A;  3AMO B;  2C10 A;  2INX A;  5AIG A;  3AMO A;  1VQ7 3;  3JUQ A;  3CC2 3;  1CYU A;  2ZA4 A;  2MC8 A;  3UNL A;  2O9U X;  1BVI A;  2FXT A;  5CLK A;  1IV9 A;  1BNF A;  1JNQ A;  1LXE A;  2ML6 A;  3A5E A;  3D4A A;  1T2I A;  3G16 A;  4STD A;  3S67 A;  3FG3 A;  3LOY A;  5AII A;  4K61 A;  1DYU A;  2CWU A;  1FGQ A;  1AY7 A;  3DZL A;  4H3U A;  2HMN B;  2E2V A;  1TRP A;  1ZS7 A;  1JBT A;  1BUJ A;  4LMI A;  1WNH A;  1T5Y A;  4HM5 B;  1K9M 4;  4OK0 A;  2XH9 A;  3FGY A;  3EHC A;  3DM8 A;  1Q40 B;  5M19 A;  1MWU A;  4AKY A;  7GSP A;  3HK4 A;  3D5G A;  4KVH A;  3SOA A;  3ZFZ A;  2F4Y A;  2LQV A;  3OV4 A;  1I3I A;  3D9R A;  4NPB A;  1QAK A;  2KF3 A;  1JB2 A;  2WO0 A;  2BO9 B;  3X41 A;  1IT8 A;  1O7P B;  3AHS A;  3SOY A;  3O8Y A;  4GB5 A;  1TFK A;  4HZB B;  1TJD A;  1UCJ A;  1UW1 A;  1RJO A;  4N6O B;  1NJI 4;  3H3H A;  2HMK B;  4O8S A;  4I5Q A;  2BMO B;  3BLZ A;  3HOH A;  5G1K A;  3FG1 A;  3SX1 A;  1W5Z A;  1LQM B;  3F7S A;  1TP6 A;  1W2Z A;  4MJD A;  5A0O B;  3MKI A;  1UUV B;  1V57 A;  2Y74 A;  4N6M A;  5AIH A;  1O7N B;  2C4B A;  4FR9 A;  4QWT A;  3JUM A;  1BNG A;  4RNT A;  1VQP 3;  1X1X A;  3SED A;  2BMR B;  2E2T A;  2RCD A;  1M1K 4;  4FMA A;  2PZV A;  4PEJ A;  1W6C A;  1I70 A;  5IEO A;  1EUI C;  1K8A 4;  4J5K A;  2CH9 A;  1IVX A;  1T2H A;  2R4I A;  4KFF A;  1R4Y A;  4R80 A;  3MWZ A;  3NQY A;  1B2U A;  1C7H A;  3E99 A;  5G2G A;  4KFE A;  3WHO A;  2CW9 A;  1RSN A;  3HIG A;  4O3V A;  1VZZ A;  1IDP A;  1RGK A;  3LTD A;  3LT9 A;  1O7H B;  5LC7 A;  5AEW B;  1TFO A;  2W04 A;  1RCL A;  1NB5 I;  3QK9 A;  1BIR A;  1MGR A;  3BB9 A;  3LT8 A;  5LC6 A;  3N54 B;  5CXO A;  9RNT A;  2J8X B;  4LZI A;  3KN4 A;  3PCR A;  4HM2 B;  1JZO A;  1CH0 A;  2B24 B;  3CNX A;  3GWR A;  4WYK A;  4HYZ A;  2HMJ B;  3CCV 3;  1RN7 A;  4EBG A;  3HX8 A;  3FSD A;  5EVH A;  3AGO A;  4RNY A;  3UB1 A;  2P05 A;  3DGN A;  2WGO A;  5EQL A;  1DMM A;  3L0R A;  1ASK A;  4FCZ A;  3S27 A;  3LH4 A;  2CIU A;  4AEQ A;  3G6E 3;  1U5O A;  3BNC A;  3QRD A;  4R9L A;  1NO3 A;  2QGU A;  2YFI B;  3DGM A;  3CPW 2;  2Z7A A;  1V74 A;  4GHO A;  4GSP A;  1QAF A;  1T3B A;  4U13 A;  1X1U A;  3D79 A;  1TIJ A;  1A90 A;  5M18 A;  1U8C B;  4N6U A;  1CEW I;  1E3R A;  1KSI A;  3HII A;  3I55 3;  2XFS A;  1L5G B;  1RHL A;  3FH1 A;  3MSO A;  4K1U A;  2YFJ B;  4XBT A;  2SBL A;  2P0M A;  5BXQ A;  4EV2 A;  1SIH A;  2YX9 A;  2BIR A;  1QAL A;  2GBW B;  1B2Z A;  3BNE A;  3WR2 A;  1W6Y A;  4J5G A;  1QVF 2;  1BRK A;  1W02 A;  2GU3 A;  2OQE C;  1VQ4 3;  3X3Y A;  1RRH A;  3B7C A;  3F8H A;  3RGA A;  1BNJ A;  2RFR A;  2D42 A;  1BRG A;  4HM3 B;  1JB4 A;  1JKG A;  1EG9 B;  5TGN A;  1SII A;  1BOX A;  3SVA A;  2KAA A;  5JPU A;  4BL3 A;  1UGH I;  4N6T A;  3UL6 A;  1RCK A;  4BTW A;  1YGE A;  3NM7 A;  2UX0 A;  4WP5 A;  3M8C A;  1IT7 A;  1UI7 A;  2ZL8 A;  1C54 A;  4ILF A;  1WMO A;  2XF3 A;  4RNZ A;  5AIF A;  1YJ9 3;  4WHA A;  3I0Y A;  3EBY A;  3JUP A;  1E97 A;  3ROB A;  1YJN 3;  4HM4 B;  1YHQ 3;  6GSP A;  4RZM A;  3RNT A;  3CCM 3;  1JBR A;  2KCD A;  1AR0 A;  5BIR A;  1GOV A;  1TRQ A;  4MMX B;  1ISK A;  1Q82 4;  5KP4 A;  1IVW A;  4N3V A;  3VSY A;  1B2M A;  5IG0 A;  1BSC A;  1B2X A;  4L8P A;  4IT7 A;  3NBB A;  5STD A;  1Y4K A;  1TU5 A;  1W00 A;  1A2P A;  4EC6 A;  1F8N A;  1SJW A;  5IG4 A;  3KKG A;  4LGQ A;  1PYL A;  3V99 A;  1NU3 A;  2KXG A;  4HM8 B;  2W6J H;  1JKG B;  3PS8 A;  1GMR A;  1JZD A;  1UCL A;  4O02 B;  3HZP A;  4FMB A;  2CX0 A;  2OCT A;  4RBN A;  4O2H A;  1BRI A;  2CG0 A;  1MWS A;  3N9H A;  2ML5 A;  2ZHX B;  5G1L A;  1BNE A;  3X42 A;  3WOE B;  3SYU A;  3EJV A;  3VF1 A;  1BRS A;  1ULI B;  1JV2 B;  1ZGX A;  3UJM A;  1IVU A;  2F5M A;  1VQN 3;  3TDG A;  1BRJ A;  1Q7H A;  1ZO2 A;  4XBX A;  3K7C A;  5HGR A;  5RNT A;  5FGO A;  1BNS A;  4HM6 B;  1IYY A;  1SAR A;  3Q90 A;  3UL5 A;  1X1Y A;  1BNI A;  1RGE A;  1VQ8 3;  2KRT A;  2RNT A;  3B4O A;  5HOH A;  5JBS A;  1IQX A;  5GSP A;  3BU4 A;  3WMD A;  3KII A;  2OTL 3;  4JF8 A;  5AYS C;  1QJG A;  2IYJ A;  2KF5 A;  1BSE A;  5CK6 A;  4EV5 A;  2HOH A;  2XSH B;  3CMA 3;  5BVB A;  3DXO A;  4R4K A;  1RLS A;  1RN1 A;  3FG4 A;  2F99 A;  3PCS A;  3BND A;  1B21 A;  2W9P A;  3MHE A;  1BSB A;  2C11 A;  4J9A A;  4XM4 A;  7RNT A;  1NNV A;  1RKY A;  3PGB A;  1W6G A;  1FGO A;  3EN8 A;  1MNL A;  1IQ8 A;  2RSX A;  1A2K A;  3CXC 2;  1FGR A;  4XDW A;  1STF I;  2IUK A;  3STD A;  1JB5 A;  1JRQ A;  2UGI A;  3KE7 A;  1YIJ 3;  1LNH A;  1UI8 A;  4I4K A;  1GY6 A;  3OXA A;  4IIA A;  2WOH A;  2W9Q A;  3GZB A;  3LTB A;  5IG3 A;  1RRL A;  4KFD A;  1UUW B;  1CQS A;  3F40 A;  4CPK A;  2W0Q A;  2SAR A;  3ZG5 A;  1O7M B;  1Q9E A;  1W01 A;  2GU1 A;  1OGZ A;  2L1S A;  2Z6B A;  3MG3 A;  1DVD A;  1OPY A;  3EF8 A;  2HMM B;  4IPB A;  3CNM A;  3G8Z A;  3MG1 A;  1EA2 A;  5D81 A;  1FW7 A;  1G96 A;  1GMP A;  3SLU A;  5IG5 A;  5AYR B;  2OOV A;  1N9J A;  1GYB A;  1OF5 A;  1KWI A;  2P38 A;  2XR8 B;  4HVN A;  1HU9 A;  2V1L A;  1ROV A;  2FGT A;  3DMC A;  1W7C A;  4G1M B;  1OHP A;  1JJ2 2;  2WOF A;  1IK3 A;  1MGW A;  2P0X A;  1FUW A;  1FUT A;  5M1A A;  2BMQ B;  2CWV A;  1JN5 B;  3CU3 A;  1RN4 A;  3ER7 A;  1SPU A;  1I2E A;  2F98 A;  3X40 A;  1QMA A;  1LRA A;  2LYX A;  1KQS 2;  3J7Y d;  3NV0 B;  1EQK A;  1UUG B;  1V58 A;  4EXR A;  2BNG A;  3GAX A;  2XRX B;  2HMO B;  2JDI H;  4Q53 A;  3WOF B;  3NQZ A;  1BUQ A;  1FA3 A;  3IMA B;  2AAD A;  4BU4 A;  3CCR 3;  2CHC A;  3Q1C A;  1IU7 A;  2BHM A;  2HML B;  2K0M A;  3JVC A;  3BNB A;  1Q81 4;  3T0U A;  1ZX2 A;  2CWT A;  3K0Z A;  1YI2 3;  3CCU 3;  4HM1 B;  8RNT A;  1VQM 3;  1YGW A;  2CKF B;  1D6Z A;  3WA2 X;  1N8R 4;  1I2F A;  2GSP A;  4HZ9 B;  5BU4 A;  1FGM A;  1NWW A;  5EEO A;  7STD A;  3MG2 A;  3FZW A;  1A2V A;  1Q42 A;  3RGR A;  1IV7 A;  3IJE B;  2RBI A;  1N8Q A;  1LQG C;  1VQ6 3;  1VQQ A;  1FUS A;  1K28 A;  3Q3F A;  5ELU A;  2CFD A;  2L4V A;  1VQ5 3;  2CC3 A;  2CX1 A;  1PFP A;  3KCH A; 
#chains in the Genus database with same CATH homology
 1SQW A;  3I56 3;  1YIT 3;  3RDE A;  1M9G A;  1OGX A;  2YFL B;  5IW9 A;  2Q07 A;  3NHX A;  2CFL A;  3F9S A;  5D82 A;  1K73 4;  3A76 A;  3CCS 3;  3EBT A;  1ROA A;  3LZA A;  2D1W A;  2CFG A;  3NX0 A;  3S29 A;  3X3Z A;  4TX4 A;  3JUN A;  2W2C A;  3EB8 A;  3V98 A;  1KC8 4;  3LYG A;  3GZX B;  2E2U A;  4FCJ A;  3WA3 A;  2QA4 3;  2A15 A;  2STD A;  2IMJ A;  3DGL A;  1N5P A;  1GD4 A;  1IQY A;  3KZT A;  3SXX A;  3GZY B;  1LVN A;  3NUV A;  3EE1 A;  2OWP A;  2XEP A;  1Z1S A;  5D83 A;  1OF5 B;  3F8X A;  1GS3 A;  3F7X A;  4CCV A;  2W56 A;  3G0K A;  4MMZ B;  1K41 A;  3S5C A;  1PU4 A;  3EX9 A;  3CCE 3;  3G71 3;  1WMN A;  3CD6 3;  5IEP A;  4EYC A;  5JPP A;  5KP1 A;  2GEY A;  2XGL A;  4H61 A;  3KFQ C;  3S28 A;  1DVC A;  1E3V A;  1J2B A;  3CC7 3;  2GEX A;  2W56 B;  2QIY A;  3JUO A;  3F14 A;  3GRD A;  3LTC A;  2P09 A;  2XSO B;  3FF0 A;  2CG1 A;  4WFO A;  1YVB I;  4BTX A;  1US1 A;  4L7K A;  4X2O A;  1FGT A;  1GY7 A;  3B4P A;  2FNQ A;  3FCS B;  4NRE A;  5DRV A;  2IUJ A;  1Q86 4;  2MF7 A;  4FMD A;  5I97 A;  3K5T A;  2PNC A;  1TUH A;  1WTH A;  1R4C A;  4X2H A;  3VGN A;  4K1V A;  3DUK A;  4LEH A;  4CDL A;  4HM0 B;  1JN5 A;  5CF1 A;  3CCJ 3;  1VQK 3;  4BTY A;  1M90 4;  3EQQ B;  3EC9 A;  1OH0 A;  1ULJ B;  5CF2 A;  2GBX B;  6STD A;  5AEU B;  3T8U A;  2CFK A;  1QVG 2;  1MOL A;  3ALA A;  1D6Y A;  4R9K A;  5IEN A;  1N5H A;  3LTA A;  3Q2P A;  1W4N A;  2Y73 A;  4K90 B;  1VQL 3;  3MYT A;  4NHF A;  1EKM A;  3PYJ A;  1KD1 4;  5FW5 A;  3N8B A;  1O7G B;  2Z76 A;  4KZ1 A;  4FMC A;  4HM7 B;  3V92 A;  1OHS A;  4MEI A;  3K9M C;  4J8T A;  4R1K A;  4JRF A;  1OHO A;  5IER A;  3ECF A;  3KSE D;  2OTJ 3;  2W03 A;  1IVV A;  2XGN A;  4WWU C;  4N6V 0;  4XBY A;  3FLJ A;  8CHO A;  3IPT A;  4OVM A;  5IF6 A;  4WYK B;  2OQE A;  4XDV A;  2WGQ A;  4FCM A;  3NV0 A;  3DGO A;  3GZR A;  2F86 B;  4OUQ A;  1A67 A;  1NDO B;  4ORL A;  3WOD G;  1GY5 A;  5AI1 A;  2Z77 A;  1VQO 3;  1Q7Y 4;  1DMN A;  3FF2 A;  3MPH A;  1HKX A;  4HJL B;  3H51 A;  2OOV C;  4XB5 A;  2O3O A;  3DY5 A;  1O7W B;  2K54 A;  1W2B 2;  2GXF A;  1AVK A;  3LXU X;  4HKV B;  3OX9 A;  3PXM A;  3X3X A;  1STD A;  3U97 A;  4L8O A;  4ZM8 A;  2XFT A;  3D3L A;  1WQL B;  2ZDJ A;  1OUN A;  4GL6 A;  1M1X B;  1D6U A;  3OWY A;  2QEX 3;  3HI7 A;  2CK3 H;  1WMP A;  3CME 3;  2BT3 A;  2B1X B;  3CCL 3;  3LML A;  3K63 A;  3OWS A;  3WDG B;  3PZW A;  3T8N A;  3NBR A;  3FKA A;  1AV4 A;  1N9E A;  4AKZ A;  1VQ9 3;  3CC4 3;  1YJW 3;  4MMY B;  2RGQ A;  2I9W A;  1OAC A;  3G4S 3;  2JQ5 A;  5ELJ A;  1GD3 A;  3B8L A;  2CFW A;  1NB3 I;  3EN1 B;  1S5A A;  3KSP A;  2IA7 A;  1Q40 A;  4N6N B;  4N6L A;  3CPO A;  3NM2 A;  5KP3 A;  1AVL A;  1DMQ A;  4LSO A;  1LOX A;  4HBR A;  5DRE A;  3OW2 2;  1OCV A;  3CCQ 3;  2M7O A;  1CYV A;  3NXJ A;  3OWU A;  3NBJ A;  3AMO B;  2C10 A;  2INX A;  5AIG A;  3AMO A;  1VQ7 3;  3JUQ A;  3CC2 3;  1CYU A;  2MC8 A;  3UNL A;  2O9U X;  3U1W A;  2FXT A;  5CLK A;  1IV9 A;  1LXE A;  1JNQ A;  2ML6 A;  3G16 A;  4STD A;  3S67 A;  3FG3 A;  3LOY A;  5AII A;  4K61 A;  1DYU A;  1FGQ A;  2CWU A;  3DZL A;  4H3U A;  2HMN B;  2E2V A;  4LMI A;  1WNH A;  1T5Y A;  4HM5 B;  1K9M 4;  4OK0 A;  2XH9 A;  3FGY A;  3EHC A;  3DM8 A;  1Q40 B;  4AKY A;  3HK4 A;  4KVH A;  3SOA A;  3OV4 A;  2LQV A;  3D9R A;  1QAK A;  1JB2 A;  2WO0 A;  2BO9 B;  3X41 A;  1IT8 A;  1O7P B;  3SOY A;  3O8Y A;  4GB5 A;  1TFK A;  4HZB B;  1UW1 A;  1RJO A;  4N6O B;  1NJI 4;  3H3H A;  2HMK B;  4O8S A;  2BMO B;  3BLZ A;  3SX1 A;  1EQK A;  3FG1 A;  5A0O B;  1W5Z A;  3F7S A;  1S72 3;  1TP6 A;  1W2Z A;  4MJD A;  3MKI A;  1UUV B;  5AIH A;  4N6M A;  1O7N B;  4FR9 A;  4QWT A;  3JUM A;  1VQP 3;  3SED A;  2BMR B;  2E2T A;  2RCD A;  1M1K 4;  4FMA A;  2PZV A;  4PEJ A;  1W6C A;  5IEO A;  1K8A 4;  4R80 A;  2CH9 A;  1IVX A;  2R4I A;  4KFF A;  3MWZ A;  3NQY A;  1C7H A;  3E99 A;  5G2G A;  4KFE A;  2CW9 A;  3HIG A;  4O3V A;  1VZZ A;  1IDP A;  3LTD A;  5LC7 A;  3LT9 A;  1O7H B;  5AEW B;  1TFO A;  2W04 A;  1NB5 I;  3QK9 A;  3BB9 A;  5LC6 A;  3LT8 A;  3N54 B;  5CXO A;  4LZI A;  3KN4 A;  3PCR A;  4HM2 B;  3GWR A;  2B24 B;  3CNX A;  4WYK A;  4HYZ A;  2HMJ B;  3CCV 3;  1RN7 A;  4EBG A;  3HX8 A;  3FSD A;  5EVH A;  4RNY A;  3UB1 A;  2P05 A;  3DGN A;  2WGO A;  5EQL A;  1DMM A;  3L0R A;  1ASK A;  4FCZ A;  3S27 A;  3LH4 A;  2CIU A;  4AEQ A;  3G6E 3;  1U5O A;  3BNC A;  3QRD A;  4R9L A;  1NO3 A;  2QGU A;  2YFI B;  3DGM A;  3CPW 2;  2Z7A A;  1V74 A;  1QAF A;  4U13 A;  1TIJ A;  1A90 A;  1U8C B;  4N6U A;  1CEW I;  1E3R A;  1KSI A;  3HII A;  3I55 3;  2XFS A;  1L5G B;  3FH1 A;  3MSO A;  4K1U A;  2YFJ B;  4XBT A;  2SBL A;  2P0M A;  5BXQ A;  4EV2 A;  1SIH A;  2YX9 A;  3BNE A;  1QAL A;  2GBW B;  1W6Y A;  1QVF 2;  1W02 A;  2GU3 A;  2OQE C;  1VQ4 3;  3X3Y A;  1RRH A;  3B7C A;  3F8H A;  3RGA A;  2RFR A;  2D42 A;  4HM3 B;  1JB4 A;  1JKG A;  1EG9 B;  5TGN A;  1SII A;  3SVA A;  5JPU A;  4N6T A;  3UL6 A;  4BTW A;  1YGE A;  3NM7 A;  2UX0 A;  4WP5 A;  3M8C A;  1IT7 A;  1UI7 A;  2ZL8 A;  1WMO A;  2XF3 A;  4RNZ A;  5AIF A;  1YJ9 3;  4WHA A;  3I0Y A;  3EBY A;  3JUP A;  1E97 A;  3ROB A;  1YJN 3;  4HM4 B;  1YHQ 3;  4RZM A;  3CCM 3;  2KCD A;  1AR0 A;  1ISK A;  4MMX B;  1Q82 4;  5KP4 A;  1IVW A;  4N3V A;  3VSY A;  5IG0 A;  1TU5 A;  4L8P A;  5STD A;  4IT7 A;  3NBB A;  1Y4K A;  1W00 A;  4EC6 A;  1F8N A;  1SJW A;  5IG4 A;  3KKG A;  4LGQ A;  3V99 A;  1NU3 A;  2KXG A;  4HM8 B;  2W6J H;  1JKG B;  3PS8 A;  4O02 B;  3HZP A;  4FMB A;  2OCT A;  4RBN A;  4O2H A;  2CG0 A;  3N9H A;  2ML5 A;  3X42 A;  3WOE B;  3EJV A;  3VF1 A;  1ULI B;  1JV2 B;  3UJM A;  1IVU A;  1VQN 3;  3TDG A;  1ZO2 A;  4XBX A;  3K7C A;  5HGR A;  5FGO A;  4HM6 B;  3Q90 A;  3UL5 A;  1VQ8 3;  2KRT A;  3B4O A;  5JBS A;  1IQX A;  3WMD A;  3KII A;  2OTL 3;  4JF8 A;  5AYS C;  1QJG A;  4EV5 A;  5CK6 A;  2XSH B;  3CMA 3;  5BVB A;  3DXO A;  4R4K A;  3FG4 A;  2F99 A;  3PCS A;  3BND A;  2W9P A;  3MHE A;  4J9A A;  2C11 A;  4XM4 A;  1RKY A;  3PGB A;  1W6G A;  1FGO A;  3EN8 A;  1MNL A;  1IQ8 A;  2RSX A;  1A2K A;  3CXC 2;  1FGR A;  4XDW A;  1STF I;  2IUK A;  3STD A;  1JB5 A;  1JRQ A;  3KE7 A;  1YIJ 3;  1LNH A;  1UI8 A;  4I4K A;  1GY6 A;  3OXA A;  4IIA A;  2WOH A;  2W9Q A;  3GZB A;  3LTB A;  5IG3 A;  1RRL A;  4KFD A;  1UUW B;  1CQS A;  3F40 A;  2W0Q A;  1O7M B;  1W01 A;  2GU1 A;  1OGZ A;  2Z6B A;  3MG3 A;  1DVD A;  1OPY A;  3EF8 A;  2HMM B;  4IPB A;  3CNM A;  3G8Z A;  3MG1 A;  1EA2 A;  5D81 A;  1G96 A;  3SLU A;  5IG5 A;  5AYR B;  2OOV A;  1N9J A;  1GYB A;  2XR8 B;  1OF5 A;  1KWI A;  2P38 A;  4HVN A;  1HU9 A;  2V1L A;  2FGT A;  3DMC A;  1ROV A;  1W7C A;  4G1M B;  1OHP A;  1JJ2 2;  2WOF A;  1IK3 A;  2P0X A;  1FUW A;  2BMQ B;  1JN5 B;  3CU3 A;  2CWV A;  3ER7 A;  1SPU A;  2F98 A;  3X40 A;  1QMA A;  2LYX A;  1KQS 2;  3J7Y d;  3NV0 B;  4EXR A;  2BNG A;  3GAX A;  2XRX B;  2HMO B;  2JDI H;  4Q53 A;  3WOF B;  3NQZ A;  1BUQ A;  1FA3 A;  3IMA B;  3CCR 3;  2CHC A;  3Q1C A;  1IU7 A;  2BHM A;  2HML B;  2K0M A;  3JVC A;  1PFP A;  3BNB A;  1Q81 4;  3T0U A;  1ZX2 A;  2CWT A;  3K0Z A;  1YI2 3;  3CCU 3;  4HM1 B;  1VQM 3;  2CKF B;  1D6Z A;  3WA2 X;  1N8R 4;  4HZ9 B;  1FGM A;  1NWW A;  5EEO A;  7STD A;  3MG2 A;  3FZW A;  1A2V A;  1Q42 A;  3RGR A;  1IV7 A;  3IJE B;  1N8Q A;  1VQ6 3;  1VQ5 3;  1K28 A;  5ELU A;  2CFD A;  2L4V A;  2CC3 A;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...