2CIUA

Structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tim21 Binding Domain Connects the Preprotein Translocases of Both Mitochondrial Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM21 MITOCHONDRIA
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ciuA00
2MF7A 2CIUA
chains in the Genus database with same CATH superfamily
4GL6A 4LMIA 4KZ1A 4N3VA 1W00A 3MG2A 2CX1A 2CKFB 3GZYB 1GY7A 2BMQB 6STDA 1LNHA 1A2VA 1W2ZA 3JVCA 1TP6A 1I2EA 2PNCA 3A76A 3STDA 3DGYA 1T2HA 3FLJA 1OHPA 2CG0A 2YX9A 1RCLA 1TFKA 3K63A 1I3FA 1K41A 2AAEA 1J2BA 1W6GA 3EHCA 3LTDA 1QMAA 2JDIH 1I70A 5D83A 1FGMA 1MNLA 1BSBA 1TUHA 2F56A 5AYSC 2CFKA 3EQQB 2L1SA 1O7NB 4BTXA 1WTHA 3S5CA 5IG0A 7STDA 1LOWA 2E2UA 1Y4KA 5IW9A 1EG9B 4H3UA 3LTAA 4ZM8A 4J9AA 2CFWA 3JUMA 1BNRA 1RN7A 3S28A 1B2XA 1UCIA 1TTOA 2XR8B 3K7CA 3X40A 1BIRA 1V74A 2YFIB 2PZVA 4K90B 3WOEB 1Q40B 1T5YA 2XH9A 2KF4A 4IT7A 3FGYA 4MEIA 4OK0A 4RNZA 4J5GA 1W02A 1MWTA 1BNFA 2GEXA 5LC6A 2IUJA 1IV9A 1UGHI 1LOYA 1MGWA 3BB9A 2KF3A 1WMOA 3NX0A 1QAFA 4L8PA 1JBTA 1HYFA 2HMMB 1B2MA 1UUGB 1STFI 3B4PA 4FMCA 1FYSA 2P0XA 9RNTA 1QVF2 1ASKA 1X1YA 3D4AA 4EW5A 2XSHB 2O9UX 1VZZA 3Q3FA 1IVXA 3CNXA 3DMCA 4MMYB 1KSIA 1WMNA 2F4YA 3SOAA 3GZBA 3DZLA 1PY3A 1LNIA 1NO3A 5CF2A 2A15A 1R4CA 2HMOB 3SX1A 3WDGB 3ER7A 3JUOA 1RGAA 2CWVA 1BUQA 2BMOB 3DGMA 3WMDA 2R4IA 4WHAA 1WQLB 3BNDA 2D42A 1IVWA 2BIRA 3BNEA 1DYUA 1SPUA 1UUWB 2I9WA 3UL5A 1BU4A 1BRGA 2SBLA 1GYBA 2E2TA 2F86B 3D79A 3DGLA 3KSPA 4FMBA 1CQSA 4LSOA 2ML6A 3NHXA 1JKGB 4RNYA 1D6ZA 2W6JH 3HIGA 1VQ93 4HAAA 3KE7A 5AIIA 3SEDA 3BIRA 1EKMA 1BSDA 1QAKA 4LYLB 1IV7A 2CFGA 3RGRA 3F14A 5FGOA 4HVNA 1IYYA 2K0MA 1SARA 1O7PB 4CPKA 5STDA 2IY2A 3GRDA 4HM4B 1A2KA 2RSXA 1W5ZA 3CCL3 1FUSA 1YHQ3 1UW1A 2C10A 1OHOA 2UGIA 4EBGA 1DETA 3FF0A 1ULJB 5BVBA 1UI8A 1QJGA 1HU9A 3U97A 1D6YA 1X1UA 2WOFA 3AGNA 3GZXB 3UL6A 4HZ9B 5JBSA 3UNLA 3NM2A 3CMA3 4IIAA 4N6OB 2KXGA 3ZFZA 3EC9A 2OOVC 3AGOA 2WO0A 1IU7A 1G96A 3SOYA 3RNTA 1PU4A 1NU3A 3CCR3 3M8CA 4EC6A 4EXRA 2P09A 2QA43 1VQL3 2C11A 2K3DA 5AI1A 1GD4A 1GOYA 1JZDA 2L4VA 4N6TA 5EVHA 2B24B 3LT9A 1RRLA 3HK4A 1JRQA 5IEPA 2KF5A 2P0MA 1A90A 1OACA 3VF1A 1TIJA 1OH0A 3F8HA 3V98A 1B27A 1RNTA 1N9JA 4O8SA 4KT3B 1GMRA 5LC7A 3Q1CA 1NNVA 1VQM3 4GHOA 4BTWA 5HOHA 3MG3A 4K1UA 4L7KA 4MMZB 1B2ZA 3CCV3 2AADA 2ZL8A 3MPHA 4K61A 1ZO2A 3CC43 3URPA 1RCKA 5JPPA 2C4BA 4ILFA 2ML5A 3FSDA 4JF8A 2MC8A 2BHMA 1VQK3 2W0QA 3F40A 1Q7Y4 1BSEA 2XRXB 3D9RA 1IVVA 1GSPA 1GY6A 3CC73 2H0IA 1W6CA 3MWZA 2QIYA 4XM4A 3F9SA 3K9MC 2WGOA 1TJDA 4R1KA 4HM3B 2GSPA 2UX0A 3NBRA 3PCRA 2W03A 1KQS2 2XGLA 3GAXA 1S723 1A2PA 1IDPA 1VQ63 4FMDA 1MOLA 3DY5A 1M1XB 3IPTA 3ALAA 1JB4A 2LYXA 3CU3A 2RGQA 3QRDA 1Q824 4WYKA 3PYJA 1SIIA 3NM7A 4AEQA 1R4YA 4DKIA 1ROVA 6RNTA 3G0KA 3T0UA 1PYLA 1OUNA 5EQLA 2W9QA 5AIGA 3NBJA 2R41A 3CCE3 3RDEA 1DE3A 4N6V0 1RGLA 3J7Yd 1Q9EA 4FCZA 4IPBA 3CXC2 5KP4A 1YGWA 2FXTA 1OPYA 2UUGC 3DUKA 3AMOB 5HGRA 1TU5A 1EQKA 2XEPA 5M19A 4BL2A 3MHEA 4OVMA 2CX0A 1LQGC 1US1A 1YGEA 1UGIA 1BNJA 4NPBA 4G1MB 1RHLA 3HI7A 5IG3A 2YFLB 1BVIA 3CCJ3 3K0ZA 1DMMA 1GOVA 1GMQA 2FNQA 3PZWA 3FCSB 3HZPA 2ZHXB 3D3LA 3OWYA 4N6UA 1GY5A 1FGQA 4HM2B 4R9KA 3VSYA 1IQYA 1W2B2 1BSCA 2E2VA 3X3XA 1T3BA 3F8XA 1I8VA 2HOHA 4BL3A 2HMLB 1TRQA 4O3VA 1HZ1A 4STDA 3G8ZA 1A67A 4N6NB 1JB2A 1AY7A 1W01A 2WOHA 3E99A 4O02B 3CD63 1JBRA 3BU4A 4U13A 1C54A 3S27A 3WOFB 1RKYA 2CFDA 4J8TA 2BNGA 3CPW2 2BU4A 3N9HA 6GSPA 2HMJB 3S29A 5FW5A 4NHFA 2QGUA 3K5TA 2W04A 3X3ZA 1ULIB 1Q7HA 1WNHA 1YVBI 2XFTA 1RN1A 2W9PA 3LTCA 1LVNA 4HJLB 4AKYA 1KD14 5IERA 2O3OA 1BNSA 4PEJA 1KC84 1OF5A 1U8CB 1K734 1UDII 1YVSA 3GSPA 3IJEB 3KIIA 1EUIC 3BLZA 5TGNA 1N5HA 3FZWA 4L8OA 3ZG0A 2GXFA 4O2HA 3WA3A 3DGOA 5BIRA 1AV4A 1VQQA 1I0VA 3DGNA 4XDVA 3LOYA 1W6YA 4Q53A 1JN5B 3G713 1DVCA 3LYGA 3MSOA 1IT7A 2GU1A 3A5EA 4N6LA 4NREA 4WFOA 1M904 1KWIA 1OGXA 4AKZA 1RGFA 3BNCA 1BUJA 1CEWI 1UCKA 1NWWA 2CIUA 1UCLA 4OUQA 1E3RA 3BNBA 1FA3A 3X41A 1F8NA 4HBRA 1GD3A 1JBSA 1B2UA 1FUTA 1JB5A 2W2CA 1FZUA 3TDGA 3UB1A 2SARA 3WA2X 2OQEA 1K28A 1BNEA 4WP5A 3FH1A 1JN5A 1L5GB 3SVAA 1E97A 1UI7A 5AIFA 1VQN3 1NB5I 1VQ53 1YJ93 4XBTA 4N6MA 2OWPA 2OTJ3 5BXQA 3F7XA 1MWSA 4CDLA 4XBYA 1Q864 1IK3A 5AEUB 1B2SA 3G6E3 4KFEA 3HIIA 1I0XA 1AR0A 1RLSA 7GSPA 1FGTA 1W4NA 3L0RA 1EA2A 3HOHA 3T8NA 1RGGA 3KCHA 4CCVA 1OHSA 4MJDA 2XF3A 4I4KA 3EN8A 1NB3I 1O7WB 1T2IA 1OCVA 2KRTA 1AVLA 3OW22 1EEJA 4HM1B 4BIRA 3F7SA 4HZBB 3FG4A 3AHSA 2QEX3 1UCJA 2W56B 1BNIA 1YJW3 1BNGA 2CW9A 2GEYA 3WHOA 3MG1A 3CNMA 1I3IA 4HM8B 3B7CA 1RGHA 1MGRA 4I5QA 1RGCA 2RFRA 1QALA 2CFLA 2F5WA 1Q814 4BU4A 1D6UA 2F99A 2H0GA 1ZGXA 3G16A 5ELJA 3I553 4XDWA 1MWRA 5DRVA 3WODG 3X42A 1CYVA 3Q90A 1N9EA 2RBIA 2Q07A 3KSED 4EV5A 1LRAA 1O7MB 8CHOA 3B4OA 5DREA 1V58A 4R80A 1JNQA 1I2FA 5A0OB 3AMOA 1NJI4 1B21A 1BRNL 4KVHA 3VGNA 5IG4A 2Z7AA 2CG1A 1IQXA 5ELUA 2RCDA 2Y73A 3LMLA 1RGKA 4MMXB 3AHWA 3EE1A 4KFDA 4RZMA 2B1XB 4HM6B 1VQP3 1K9M4 1B3SA 1NDOB 1IT8A 1RGEA 2J8XB 2Z76A 1JKGA 3CCU3 3I563 1VQ83 1YNVX 1OGZA 3EX9A 3IMAB 4FMAA 4EV2A 3N8BA 3LT8A 3DXOA 2FGTA 1GMPA 1STDA 4QWTA 3FG1A 3LH4A 5AEWB 2KAAA 1X1WA 2F5MA 3NQZA 2ZA4A 4FCJA 5RNTA 2CH9A 5GSPA 2OQEC 3FG3A 4ORLA 1V57A 1RNBA 1ZX2A 1N5PA 1RN4A 1LOXA 1UUVB 1ISKA 1G02A 2ZDJA 3JUQA 3I0YA 2BO9B 5I97A 5D82A 3H51A 4CJNA 1BAOA 2W56A 3JUNA 3JUPA 2GBXB 2K54A 1N8R4 3O8YA 1O7HB 3OXAA 4HKVB 4X2OA 1RTUA 2IYJA 4HM5B 5BU4A 1QVG2 2YFJB 2MF7A 1X1XA 3CCM3 1E3VA 3EN1B 3CC23 4FR9A 1BRIA 3MKIA 1RDSA 5KP1A 1Q42A 3EJVA 5G1KA 2GBWB 2HMNB 5IF6A 2WGQA 3V99A 3PCSA 3T8UA 1LQMB 3CCQ3 3CPOA 4HOHA 3OV4A 3V92A 3ECFA 1LXEA 3NBBA 1BSAA 3EB8A 3EF8A 3NUVA 3LTBA 1LOVA 1ZS7A 2CC3A 2CWUA 3U1WA 2P38A 2STDA 4XB5A 1AVKA 1IQ8A 2CHCA 3EBTA 4HYZA 1FGRA 2M7OA 3NQYA 1Z1SA 3SXXA 1BRHA 1U5OA 3CCS3 1WMPA 2GU3A 2XSOB 4HM7B 3NXJA 1W7CA 1YJN3 4GSPA 3NV0B 2OCTA 2KF6A 3FF2A 1RMSA 4R4KA 1YIT3 1BRSA 4LZIA 2D1WA 3EBYA 3SLUA 5IG5A 2KCDA 2IA7A 3KFQC 5G1LA 5AYRB 1BOXA 1FGOA 1BRKA 1BGSA 3ROBA 3H3HA 4LGQA 1DMNA 3LXUX 5CK6A 3RGAA 1O7GB 5G2GA 1YI23 1Q40A 3WR2A 1ROAA 2Z6BA 1PFPA 1N8QA 3CME3 3DH2A 8RNTA 1CH0A 2P05A 1OF5B 1GOUA 5AIHA 3X3YA 2XFSA 3OWUA 1VQ73 1RSNA 2CWTA 4WYKB 5IEOA 4BTYA 3GWRA 1VQ43 3D5IA 4RNTA 2OOVA 1FW7A 7RNTA 1DMQA 1TRPA 1RJOA 1B20A 1JZOA 5CLKA 1RRHA 3LZAA 2RNTA 3PS8A 4XBXA 5KP3A 1JJ22 1M9GA 4JRFA 1IVUA 1SJWA 1C7HA 2H0HA 3PXMA 3NV0A 4LEHA 1JV2B 4H61A 1YIJ3 3GZRA 2CK3H 5CF1A 3OWSA 3ZG5A 1CYUA 1MWUA 1SIHA 1BRJA 2IMJA 2INXA 3B8LA 5CXOA 3FKAA 2V1LA 4J5KA 3DM8A 2LQVA 4X2HA 1S5AA 3N54B 2Z77A 1BANA 4GB5A 5EEOA 1SQWA 3QK9A 4K1VA 4R9LA 3S67A 1VQO3 3OX9A 1G0TA 3MYTA 5D81A 1AQZA 5JPUA 2Y74A 1M1K4 3Q2PA 3KZTA 2IUKA 2F98A 3KN4A 5M1AA 1GS3A 4EYCA 3HX8A 1I2GA 5IENA 5M18A 1FUWA 4RBNA 4KFFA 4WWUC 2BMRB 1DVDA 1TFOA 4TX4A 3SYUA 1HKXA 2JQ5A 3KKGA 2BT3A 2HMKB 1K8A4 2OTL3 4FCMA 3G4S3 3D5GA 2XGNA 3PGBA 4HM0B 3UJMA
chains in the Genus database with same CATH topology
4GL6A 4LMIA 4KZ1A 4N3VA 1W00A 3MG2A 2CKFB 3GZYB 1GY7A 2BMQB 6STDA 1LNHA 1A2VA 1W2ZA 3JVCA 1TP6A 2PNCA 3A76A 3STDA 3FLJA 1OHPA 2CG0A 2YX9A 1TFKA 3K63A 1K41A 1J2BA 1W6GA 3EHCA 3LTDA 1QMAA 2JDIH 5D83A 1FGMA 1MNLA 1TUHA 5AYSC 2CFKA 3EQQB 1O7NB 4BTXA 1WTHA 3S5CA 5IG0A 7STDA 2E2UA 1Y4KA 5IW9A 1EG9B 4H3UA 3LTAA 4ZM8A 4J9AA 2CFWA 3JUMA 1RN7A 3S28A 2XR8B 3K7CA 3X40A 1V74A 2YFIB 2PZVA 4K90B 3WOEB 1Q40B 1T5YA 2XH9A 4MEIA 4IT7A 3FGYA 4OK0A 4RNZA 1W02A 2GEXA 5LC6A 2IUJA 1IV9A 3BB9A 3NX0A 1WMOA 1QAFA 4L8PA 2HMMB 1STFI 3B4PA 4FMCA 2P0XA 1QVF2 1ASKA 2XSHB 2O9UX 1VZZA 1IVXA 3DMCA 3CNXA 4MMYB 1KSIA 1WMNA 3SOAA 3GZBA 3DZLA 1NO3A 5CF2A 2A15A 1R4CA 2HMOB 3SX1A 3WDGB 3ER7A 3JUOA 1BUQA 2CWVA 2BMOB 3DGMA 3WMDA 2R4IA 4WHAA 1WQLB 3BNDA 2D42A 1IVWA 3BNEA 1DYUA 1SPUA 1UUWB 2I9WA 3UL5A 2SBLA 3DGLA 1GYBA 2E2TA 2F86B 3KSPA 4FMBA 1CQSA 4LSOA 2ML6A 3NHXA 1JKGB 4RNYA 1D6ZA 2W6JH 3HIGA 1VQ93 3KE7A 5AIIA 3SEDA 1EKMA 1QAKA 1IV7A 2CFGA 3RGRA 3F14A 5FGOA 4HVNA 2K0MA 1O7PB 5STDA 3GRDA 4HM4B 1A2KA 2RSXA 1W5ZA 3CCL3 1YHQ3 1UW1A 2C10A 1OHOA 4EBGA 3FF0A 1ULJB 5BVBA 1UI8A 1QJGA 1HU9A 3U97A 1D6YA 2WOFA 3GZXB 3UL6A 4HZ9B 5JBSA 3UNLA 3NM2A 3CMA3 4IIAA 4N6OB 2KXGA 3EC9A 2OOVC 2WO0A 1IU7A 1G96A 3SOYA 1PU4A 3CCR3 1NU3A 3M8CA 4EC6A 4EXRA 2P09A 2QA43 1VQL3 2C11A 5AI1A 1GD4A 2L4VA 4N6TA 5EVHA 2B24B 3LT9A 1RRLA 3HK4A 1JRQA 5IEPA 2P0MA 1A90A 1OACA 3VF1A 1TIJA 1OH0A 3F8HA 3V98A 1N9JA 4O8SA 5LC7A 3Q1CA 1VQM3 4BTWA 3MG3A 4K1UA 4L7KA 4MMZB 3CCV3 3MPHA 2ZL8A 4K61A 1ZO2A 3CC43 5JPPA 2ML5A 3FSDA 4JF8A 2MC8A 2BHMA 1VQK3 2W0QA 3F40A 1Q7Y4 2XRXB 3D9RA 1IVVA 1GY6A 3CC73 1W6CA 3MWZA 2QIYA 4XM4A 3F9SA 3K9MC 2WGOA 4R1KA 4HM3B 2UX0A 3NBRA 3PCRA 2W03A 1KQS2 2XGLA 3GAXA 1S723 1IDPA 1VQ63 4FMDA 1MOLA 3DY5A 1M1XB 3IPTA 3ALAA 1JB4A 2LYXA 3CU3A 2RGQA 3QRDA 1Q824 4WYKA 3PYJA 1SIIA 3NM7A 4AEQA 1ROVA 3G0KA 3T0UA 1OUNA 5EQLA 2W9QA 5AIGA 3NBJA 3CCE3 3RDEA 4N6V0 3J7Yd 4FCZA 4IPBA 3CXC2 5KP4A 2FXTA 3DUKA 1OPYA 5HGRA 1TU5A 3AMOB 1EQKA 2XEPA 3MHEA 4OVMA 1US1A 1YGEA 4G1MB 3HI7A 5IG3A 2YFLB 3CCJ3 3K0ZA 1DMMA 2FNQA 3PZWA 3FCSB 3HZPA 3D3LA 3OWYA 4N6UA 1GY5A 1FGQA 4HM2B 4R9KA 3VSYA 1IQYA 1W2B2 2E2VA 3X3XA 3F8XA 2HMLB 4O3VA 4STDA 3G8ZA 1A67A 4N6NB 1JB2A 1W01A 2WOHA 3E99A 4O02B 3CD63 4U13A 3S27A 3WOFB 1RKYA 2CFDA 4J8TA 2BNGA 3CPW2 3N9HA 2HMJB 3S29A 5FW5A 4NHFA 2QGUA 3K5TA 2W04A 3X3ZA 1ULIB 1WNHA 2XFTA 1YVBI 2W9PA 3LTCA 1LVNA 4HJLB 4AKYA 1KD14 5IERA 2O3OA 4PEJA 1KC84 1OF5A 1U8CB 1K734 3IJEB 3KIIA 3BLZA 5TGNA 1N5HA 3FZWA 4L8OA 2GXFA 4O2HA 3WA3A 3DGOA 1AV4A 3DGNA 4XDVA 3LOYA 1W6YA 4Q53A 1JN5B 3G713 1DVCA 3LYGA 3MSOA 1IT7A 2GU1A 4N6LA 4NREA 4WFOA 1M904 1KWIA 1OGXA 4AKZA 3BNCA 1CEWI 1NWWA 2CIUA 4OUQA 1E3RA 3BNBA 1FA3A 3X41A 1F8NA 4HBRA 1GD3A 1JB5A 3UB1A 2W2CA 3TDGA 3WA2X 2OQEA 1K28A 1L5GB 4WP5A 3FH1A 1JN5A 3SVAA 1E97A 1UI7A 5AIFA 1VQN3 1NB5I 1VQ53 1YJ93 4XBTA 4N6MA 2OWPA 2OTJ3 5BXQA 3F7XA 4CDLA 4XBYA 1Q864 1IK3A 5AEUB 3G6E3 4KFEA 3HIIA 1AR0A 1FGTA 1W4NA 3L0RA 1EA2A 3T8NA 4CCVA 1OHSA 4MJDA 2XF3A 4I4KA 3EN8A 1NB3I 1O7WB 2KRTA 1OCVA 1AVLA 3OW22 4HM1B 3F7SA 4HZBB 3FG4A 2QEX3 2W56B 1YJW3 2CW9A 2GEYA 3MG1A 3CNMA 4HM8B 3B7CA 2RFRA 1QALA 2CFLA 1Q814 1D6UA 2F99A 3G16A 3I553 5ELJA 4XDWA 5DRVA 3WODG 3X42A 1CYVA 3Q90A 1N9EA 3KSED 2Q07A 4EV5A 8CHOA 1O7MB 3B4OA 5DREA 4R80A 1JNQA 5A0OB 3AMOA 1NJI4 4KVHA 3VGNA 5IG4A 2Z7AA 2CG1A 1IQXA 5ELUA 2RCDA 2Y73A 3LMLA 4MMXB 3EE1A 4KFDA 4RZMA 2B1XB 4HM6B 1VQP3 1K9M4 1NDOB 1IT8A 2Z76A 1JKGA 3CCU3 3I563 1VQ83 1OGZA 3EX9A 3IMAB 4FMAA 4EV2A 3N8BA 3LT8A 3DXOA 2FGTA 1STDA 4QWTA 3FG1A 3LH4A 5AEWB 3NQZA 4FCJA 2CH9A 2OQEC 3FG3A 4ORLA 1ZX2A 1N5PA 1LOXA 1UUVB 1ISKA 2ZDJA 3JUQA 3I0YA 2BO9B 5I97A 5D82A 3H51A 2W56A 3JUNA 3JUPA 2GBXB 2K54A 1N8R4 3O8YA 1O7HB 3OXAA 4HKVB 4X2OA 4HM5B 1QVG2 2YFJB 2MF7A 3CCM3 1E3VA 3EN1B 3CC23 4FR9A 3MKIA 5KP1A 1Q42A 3EJVA 2GBWB 2HMNB 5IF6A 2WGQA 3V99A 3PCSA 3T8UA 3CCQ3 3CPOA 3OV4A 3V92A 3ECFA 1LXEA 3NBBA 3EB8A 3EF8A 3NUVA 3LTBA 2CC3A 2CWUA 3U1WA 2P38A 2STDA 4XB5A 1AVKA 1IQ8A 2CHCA 3EBTA 4HYZA 1FGRA 2M7OA 3NQYA 1Z1SA 3SXXA 1U5OA 3CCS3 1WMPA 2GU3A 2XSOB 4HM7B 3NXJA 1W7CA 1YJN3 3NV0B 2OCTA 3FF2A 4R4KA 1YIT3 4LZIA 2D1WA 3EBYA 3SLUA 5IG5A 2KCDA 2IA7A 3KFQC 5AYRB 1FGOA 3ROBA 3H3HA 4LGQA 1DMNA 3LXUX 5CK6A 3RGAA 1O7GB 5G2GA 1YI23 1Q40A 1ROAA 2Z6BA 1PFPA 1N8QA 3CME3 2P05A 1OF5B 3X3YA 5AIHA 2XFSA 3OWUA 1VQ73 2CWTA 5IEOA 4WYKB 4BTYA 3GWRA 1VQ43 2OOVA 1DMQA 1RJOA 5CLKA 1RRHA 3LZAA 3PS8A 4XBXA 5KP3A 1JJ22 1M9GA 4JRFA 1IVUA 1SJWA 1C7HA 3PXMA 3NV0A 4LEHA 1JV2B 4H61A 1YIJ3 3GZRA 2CK3H 5CF1A 3OWSA 1CYUA 1SIHA 2IMJA 2INXA 3B8LA 5CXOA 3FKAA 2V1LA 3DM8A 2LQVA 4X2HA 1S5AA 3N54B 2Z77A 4GB5A 5EEOA 1SQWA 3QK9A 4K1VA 4R9LA 3S67A 1VQO3 3OX9A 3MYTA 5D81A 5JPUA 2Y74A 1M1K4 3Q2PA 3KZTA 2IUKA 2F98A 3KN4A 1GS3A 4EYCA 3HX8A 5IENA 1FUWA 4RBNA 4KFFA 4WWUC 2BMRB 1DVDA 1TFOA 4TX4A 1HKXA 2JQ5A 3KKGA 2BT3A 2HMKB 1K8A4 2OTL3 4FCMA 3G4S3 2XGNA 3PGBA 4HM0B 3UJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF7 A;  2CIU A; 
#chains in the Genus database with same CATH topology
 4GL6 A;  4LMI A;  4KZ1 A;  4N3V A;  1W00 A;  3MG2 A;  2CX1 A;  2CKF B;  3GZY B;  1GY7 A;  2BMQ B;  6STD A;  1LNH A;  1A2V A;  1W2Z A;  3JVC A;  1TP6 A;  1I2E A;  2PNC A;  3A76 A;  3STD A;  3DGY A;  1T2H A;  3FLJ A;  1OHP A;  2CG0 A;  2YX9 A;  1RCL A;  1TFK A;  3K63 A;  1I3F A;  1K41 A;  2AAE A;  1J2B A;  1W6G A;  3EHC A;  3LTD A;  1QMA A;  2JDI H;  1I70 A;  5D83 A;  1FGM A;  1MNL A;  1BSB A;  1TUH A;  2F56 A;  5AYS C;  2CFK A;  3EQQ B;  2L1S A;  1O7N B;  4BTX A;  1WTH A;  3S5C A;  5IG0 A;  7STD A;  1LOW A;  2E2U A;  1Y4K A;  5IW9 A;  1EG9 B;  4H3U A;  3LTA A;  4ZM8 A;  4J9A A;  2CFW A;  3JUM A;  1BNR A;  1RN7 A;  3S28 A;  1B2X A;  1UCI A;  1TTO A;  2XR8 B;  3K7C A;  3X40 A;  1BIR A;  1V74 A;  2YFI B;  2PZV A;  4K90 B;  3WOE B;  1Q40 B;  1T5Y A;  2XH9 A;  2KF4 A;  4IT7 A;  3FGY A;  4MEI A;  4OK0 A;  4RNZ A;  4J5G A;  1W02 A;  1MWT A;  1BNF A;  2GEX A;  5LC6 A;  2IUJ A;  1IV9 A;  1UGH I;  1LOY A;  1MGW A;  3BB9 A;  2KF3 A;  1WMO A;  3NX0 A;  1QAF A;  4L8P A;  1JBT A;  1HYF A;  2HMM B;  1B2M A;  1UUG B;  1STF I;  3B4P A;  4FMC A;  1FYS A;  2P0X A;  9RNT A;  1QVF 2;  1ASK A;  1X1Y A;  3D4A A;  4EW5 A;  2XSH B;  2O9U X;  1VZZ A;  3Q3F A;  1IVX A;  3CNX A;  3DMC A;  4MMY B;  1KSI A;  1WMN A;  2F4Y A;  3SOA A;  3GZB A;  3DZL A;  1PY3 A;  1LNI A;  1NO3 A;  5CF2 A;  2A15 A;  1R4C A;  2HMO B;  3SX1 A;  3WDG B;  3ER7 A;  3JUO A;  1RGA A;  2CWV A;  1BUQ A;  2BMO B;  3DGM A;  3WMD A;  2R4I A;  4WHA A;  1WQL B;  3BND A;  2D42 A;  1IVW A;  2BIR A;  3BNE A;  1DYU A;  1SPU A;  1UUW B;  2I9W A;  3UL5 A;  1BU4 A;  1BRG A;  2SBL A;  1GYB A;  2E2T A;  2F86 B;  3D79 A;  3DGL A;  3KSP A;  4FMB A;  1CQS A;  4LSO A;  2ML6 A;  3NHX A;  1JKG B;  4RNY A;  1D6Z A;  2W6J H;  3HIG A;  1VQ9 3;  4HAA A;  3KE7 A;  5AII A;  3SED A;  3BIR A;  1EKM A;  1BSD A;  1QAK A;  4LYL B;  1IV7 A;  2CFG A;  3RGR A;  3F14 A;  5FGO A;  4HVN A;  1IYY A;  2K0M A;  1SAR A;  1O7P B;  4CPK A;  5STD A;  2IY2 A;  3GRD A;  4HM4 B;  1A2K A;  2RSX A;  1W5Z A;  3CCL 3;  1FUS A;  1YHQ 3;  1UW1 A;  2C10 A;  1OHO A;  2UGI A;  4EBG A;  1DET A;  3FF0 A;  1ULJ B;  5BVB A;  1UI8 A;  1QJG A;  1HU9 A;  3U97 A;  1D6Y A;  1X1U A;  2WOF A;  3AGN A;  3GZX B;  3UL6 A;  4HZ9 B;  5JBS A;  3UNL A;  3NM2 A;  3CMA 3;  4IIA A;  4N6O B;  2KXG A;  3ZFZ A;  3EC9 A;  2OOV C;  3AGO A;  2WO0 A;  1IU7 A;  1G96 A;  3SOY A;  3RNT A;  1PU4 A;  1NU3 A;  3CCR 3;  3M8C A;  4EC6 A;  4EXR A;  2P09 A;  2QA4 3;  1VQL 3;  2C11 A;  2K3D A;  5AI1 A;  1GD4 A;  1GOY A;  1JZD A;  2L4V A;  4N6T A;  5EVH A;  2B24 B;  3LT9 A;  1RRL A;  3HK4 A;  1JRQ A;  5IEP A;  2KF5 A;  2P0M A;  1A90 A;  1OAC A;  3VF1 A;  1TIJ A;  1OH0 A;  3F8H A;  3V98 A;  1B27 A;  1RNT A;  1N9J A;  4O8S A;  4KT3 B;  1GMR A;  5LC7 A;  3Q1C A;  1NNV A;  1VQM 3;  4GHO A;  4BTW A;  5HOH A;  3MG3 A;  4K1U A;  4L7K A;  4MMZ B;  1B2Z A;  3CCV 3;  2AAD A;  2ZL8 A;  3MPH A;  4K61 A;  1ZO2 A;  3CC4 3;  3URP A;  1RCK A;  5JPP A;  2C4B A;  4ILF A;  2ML5 A;  3FSD A;  4JF8 A;  2MC8 A;  2BHM A;  1VQK 3;  2W0Q A;  3F40 A;  1Q7Y 4;  1BSE A;  2XRX B;  3D9R A;  1IVV A;  1GSP A;  1GY6 A;  3CC7 3;  2H0I A;  1W6C A;  3MWZ A;  2QIY A;  4XM4 A;  3F9S A;  3K9M C;  2WGO A;  1TJD A;  4R1K A;  4HM3 B;  2GSP A;  2UX0 A;  3NBR A;  3PCR A;  2W03 A;  1KQS 2;  2XGL A;  3GAX A;  1S72 3;  1A2P A;  1IDP A;  1VQ6 3;  4FMD A;  1MOL A;  3DY5 A;  1M1X B;  3IPT A;  3ALA A;  1JB4 A;  2LYX A;  3CU3 A;  2RGQ A;  3QRD A;  1Q82 4;  4WYK A;  3PYJ A;  1SII A;  3NM7 A;  4AEQ A;  1R4Y A;  4DKI A;  1ROV A;  6RNT A;  3G0K A;  3T0U A;  1PYL A;  1OUN A;  5EQL A;  2W9Q A;  5AIG A;  3NBJ A;  2R41 A;  3CCE 3;  3RDE A;  1DE3 A;  4N6V 0;  1RGL A;  3J7Y d;  1Q9E A;  4FCZ A;  4IPB A;  3CXC 2;  5KP4 A;  1YGW A;  2FXT A;  1OPY A;  2UUG C;  3DUK A;  3AMO B;  5HGR A;  1TU5 A;  1EQK A;  2XEP A;  5M19 A;  4BL2 A;  3MHE A;  4OVM A;  2CX0 A;  1LQG C;  1US1 A;  1YGE A;  1UGI A;  1BNJ A;  4NPB A;  4G1M B;  1RHL A;  3HI7 A;  5IG3 A;  2YFL B;  1BVI A;  3CCJ 3;  3K0Z A;  1DMM A;  1GOV A;  1GMQ A;  2FNQ A;  3PZW A;  3FCS B;  3HZP A;  2ZHX B;  3D3L A;  3OWY A;  4N6U A;  1GY5 A;  1FGQ A;  4HM2 B;  4R9K A;  3VSY A;  1IQY A;  1W2B 2;  1BSC A;  2E2V A;  3X3X A;  1T3B A;  3F8X A;  1I8V A;  2HOH A;  4BL3 A;  2HML B;  1TRQ A;  4O3V A;  1HZ1 A;  4STD A;  3G8Z A;  1A67 A;  4N6N B;  1JB2 A;  1AY7 A;  1W01 A;  2WOH A;  3E99 A;  4O02 B;  3CD6 3;  1JBR A;  3BU4 A;  4U13 A;  1C54 A;  3S27 A;  3WOF B;  1RKY A;  2CFD A;  4J8T A;  2BNG A;  3CPW 2;  2BU4 A;  3N9H A;  6GSP A;  2HMJ B;  3S29 A;  5FW5 A;  4NHF A;  2QGU A;  3K5T A;  2W04 A;  3X3Z A;  1ULI B;  1Q7H A;  1WNH A;  1YVB I;  2XFT A;  1RN1 A;  2W9P A;  3LTC A;  1LVN A;  4HJL B;  4AKY A;  1KD1 4;  5IER A;  2O3O A;  1BNS A;  4PEJ A;  1KC8 4;  1OF5 A;  1U8C B;  1K73 4;  1UDI I;  1YVS A;  3GSP A;  3IJE B;  3KII A;  1EUI C;  3BLZ A;  5TGN A;  1N5H A;  3FZW A;  4L8O A;  3ZG0 A;  2GXF A;  4O2H A;  3WA3 A;  3DGO A;  5BIR A;  1AV4 A;  1VQQ A;  1I0V A;  3DGN A;  4XDV A;  3LOY A;  1W6Y A;  4Q53 A;  1JN5 B;  3G71 3;  1DVC A;  3LYG A;  3MSO A;  1IT7 A;  2GU1 A;  3A5E A;  4N6L A;  4NRE A;  4WFO A;  1M90 4;  1KWI A;  1OGX A;  4AKZ A;  1RGF A;  3BNC A;  1BUJ A;  1CEW I;  1UCK A;  1NWW A;  2CIU A;  1UCL A;  4OUQ A;  1E3R A;  3BNB A;  1FA3 A;  3X41 A;  1F8N A;  4HBR A;  1GD3 A;  1JBS A;  1B2U A;  1FUT A;  1JB5 A;  2W2C A;  1FZU A;  3TDG A;  3UB1 A;  2SAR A;  3WA2 X;  2OQE A;  1K28 A;  1BNE A;  4WP5 A;  3FH1 A;  1JN5 A;  1L5G B;  3SVA A;  1E97 A;  1UI7 A;  5AIF A;  1VQN 3;  1NB5 I;  1VQ5 3;  1YJ9 3;  4XBT A;  4N6M A;  2OWP A;  2OTJ 3;  5BXQ A;  3F7X A;  1MWS A;  4CDL A;  4XBY A;  1Q86 4;  1IK3 A;  5AEU B;  1B2S A;  3G6E 3;  4KFE A;  3HII A;  1I0X A;  1AR0 A;  1RLS A;  7GSP A;  1FGT A;  1W4N A;  3L0R A;  1EA2 A;  3HOH A;  3T8N A;  1RGG A;  3KCH A;  4CCV A;  1OHS A;  4MJD A;  2XF3 A;  4I4K A;  3EN8 A;  1NB3 I;  1O7W B;  1T2I A;  1OCV A;  2KRT A;  1AVL A;  3OW2 2;  1EEJ A;  4HM1 B;  4BIR A;  3F7S A;  4HZB B;  3FG4 A;  3AHS A;  2QEX 3;  1UCJ A;  2W56 B;  1BNI A;  1YJW 3;  1BNG A;  2CW9 A;  2GEY A;  3WHO A;  3MG1 A;  3CNM A;  1I3I A;  4HM8 B;  3B7C A;  1RGH A;  1MGR A;  4I5Q A;  1RGC A;  2RFR A;  1QAL A;  2CFL A;  2F5W A;  1Q81 4;  4BU4 A;  1D6U A;  2F99 A;  2H0G A;  1ZGX A;  3G16 A;  5ELJ A;  3I55 3;  4XDW A;  1MWR A;  5DRV A;  3WOD G;  3X42 A;  1CYV A;  3Q90 A;  1N9E A;  2RBI A;  2Q07 A;  3KSE D;  4EV5 A;  1LRA A;  1O7M B;  8CHO A;  3B4O A;  5DRE A;  1V58 A;  4R80 A;  1JNQ A;  1I2F A;  5A0O B;  3AMO A;  1NJI 4;  1B21 A;  1BRN L;  4KVH A;  3VGN A;  5IG4 A;  2Z7A A;  2CG1 A;  1IQX A;  5ELU A;  2RCD A;  2Y73 A;  3LML A;  1RGK A;  4MMX B;  3AHW A;  3EE1 A;  4KFD A;  4RZM A;  2B1X B;  4HM6 B;  1VQP 3;  1K9M 4;  1B3S A;  1NDO B;  1IT8 A;  1RGE A;  2J8X B;  2Z76 A;  1JKG A;  3CCU 3;  3I56 3;  1VQ8 3;  1YNV X;  1OGZ A;  3EX9 A;  3IMA B;  4FMA A;  4EV2 A;  3N8B A;  3LT8 A;  3DXO A;  2FGT A;  1GMP A;  1STD A;  4QWT A;  3FG1 A;  3LH4 A;  5AEW B;  2KAA A;  1X1W A;  2F5M A;  3NQZ A;  2ZA4 A;  4FCJ A;  5RNT A;  2CH9 A;  5GSP A;  2OQE C;  3FG3 A;  4ORL A;  1V57 A;  1RNB A;  1ZX2 A;  1N5P A;  1RN4 A;  1LOX A;  1UUV B;  1ISK A;  1G02 A;  2ZDJ A;  3JUQ A;  3I0Y A;  2BO9 B;  5I97 A;  5D82 A;  3H51 A;  4CJN A;  1BAO A;  2W56 A;  3JUN A;  3JUP A;  2GBX B;  2K54 A;  1N8R 4;  3O8Y A;  1O7H B;  3OXA A;  4HKV B;  4X2O A;  1RTU A;  2IYJ A;  4HM5 B;  5BU4 A;  1QVG 2;  2YFJ B;  2MF7 A;  1X1X A;  3CCM 3;  1E3V A;  3EN1 B;  3CC2 3;  4FR9 A;  1BRI A;  3MKI A;  1RDS A;  5KP1 A;  1Q42 A;  3EJV A;  5G1K A;  2GBW B;  2HMN B;  5IF6 A;  2WGQ A;  3V99 A;  3PCS A;  3T8U A;  1LQM B;  3CCQ 3;  3CPO A;  4HOH A;  3OV4 A;  3V92 A;  3ECF A;  1LXE A;  3NBB A;  1BSA A;  3EB8 A;  3EF8 A;  3NUV A;  3LTB A;  1LOV A;  1ZS7 A;  2CC3 A;  2CWU A;  3U1W A;  2P38 A;  2STD A;  4XB5 A;  1AVK A;  1IQ8 A;  2CHC A;  3EBT A;  4HYZ A;  1FGR A;  2M7O A;  3NQY A;  1Z1S A;  3SXX A;  1BRH A;  1U5O A;  3CCS 3;  1WMP A;  2GU3 A;  2XSO B;  4HM7 B;  3NXJ A;  1W7C A;  1YJN 3;  4GSP A;  3NV0 B;  2OCT A;  2KF6 A;  3FF2 A;  1RMS A;  4R4K A;  1YIT 3;  1BRS A;  4LZI A;  2D1W A;  3EBY A;  3SLU A;  5IG5 A;  2KCD A;  2IA7 A;  3KFQ C;  5G1L A;  5AYR B;  1BOX A;  1FGO A;  1BRK A;  1BGS A;  3ROB A;  3H3H A;  4LGQ A;  1DMN A;  3LXU X;  5CK6 A;  3RGA A;  1O7G B;  5G2G A;  1YI2 3;  1Q40 A;  3WR2 A;  1ROA A;  2Z6B A;  1PFP A;  1N8Q A;  3CME 3;  3DH2 A;  8RNT A;  1CH0 A;  2P05 A;  1OF5 B;  1GOU A;  5AIH A;  3X3Y A;  2XFS A;  3OWU A;  1VQ7 3;  1RSN A;  2CWT A;  4WYK B;  5IEO A;  4BTY A;  3GWR A;  1VQ4 3;  3D5I A;  4RNT A;  2OOV A;  1FW7 A;  7RNT A;  1DMQ A;  1TRP A;  1RJO A;  1B20 A;  1JZO A;  5CLK A;  1RRH A;  3LZA A;  2RNT A;  3PS8 A;  4XBX A;  5KP3 A;  1JJ2 2;  1M9G A;  4JRF A;  1IVU A;  1SJW A;  1C7H A;  2H0H A;  3PXM A;  3NV0 A;  4LEH A;  1JV2 B;  4H61 A;  1YIJ 3;  3GZR A;  2CK3 H;  5CF1 A;  3OWS A;  3ZG5 A;  1CYU A;  1MWU A;  1SIH A;  1BRJ A;  2IMJ A;  2INX A;  3B8L A;  5CXO A;  3FKA A;  2V1L A;  4J5K A;  3DM8 A;  2LQV A;  4X2H A;  1S5A A;  3N54 B;  2Z77 A;  1BAN A;  4GB5 A;  5EEO A;  1SQW A;  3QK9 A;  4K1V A;  4R9L A;  3S67 A;  1VQO 3;  3OX9 A;  1G0T A;  3MYT A;  5D81 A;  1AQZ A;  5JPU A;  2Y74 A;  1M1K 4;  3Q2P A;  3KZT A;  2IUK A;  2F98 A;  3KN4 A;  5M1A A;  1GS3 A;  4EYC A;  3HX8 A;  1I2G A;  5IEN A;  5M18 A;  1FUW A;  4RBN A;  4KFF A;  4WWU C;  2BMR B;  1DVD A;  1TFO A;  4TX4 A;  3SYU A;  1HKX A;  2JQ5 A;  3KKG A;  2BT3 A;  2HMK B;  1K8A 4;  2OTL 3;  4FCM A;  3G4S 3;  3D5G A;  2XGN A;  3PGB A;  4HM0 B;  3UJM A; 
#chains in the Genus database with same CATH homology
 4GL6 A;  4LMI A;  4KZ1 A;  4N3V A;  1W00 A;  3MG2 A;  2CKF B;  3GZY B;  1GY7 A;  2BMQ B;  6STD A;  1LNH A;  1A2V A;  1W2Z A;  3JVC A;  1TP6 A;  2PNC A;  3A76 A;  3STD A;  3FLJ A;  1OHP A;  2CG0 A;  2YX9 A;  1TFK A;  3K63 A;  1K41 A;  1J2B A;  1W6G A;  3EHC A;  3LTD A;  1QMA A;  2JDI H;  5D83 A;  1FGM A;  1MNL A;  1TUH A;  5AYS C;  2CFK A;  3EQQ B;  1O7N B;  4BTX A;  1WTH A;  3S5C A;  5IG0 A;  7STD A;  2E2U A;  1Y4K A;  5IW9 A;  1EG9 B;  4H3U A;  3LTA A;  4ZM8 A;  4J9A A;  2CFW A;  3JUM A;  1RN7 A;  3S28 A;  2XR8 B;  3K7C A;  3X40 A;  1V74 A;  2YFI B;  2PZV A;  4K90 B;  3WOE B;  1Q40 B;  1T5Y A;  2XH9 A;  4MEI A;  4IT7 A;  3FGY A;  4OK0 A;  4RNZ A;  1W02 A;  2GEX A;  5LC6 A;  2IUJ A;  1IV9 A;  3BB9 A;  3NX0 A;  1WMO A;  1QAF A;  4L8P A;  2HMM B;  1STF I;  3B4P A;  4FMC A;  2P0X A;  1QVF 2;  1ASK A;  2XSH B;  2O9U X;  1VZZ A;  1IVX A;  3DMC A;  3CNX A;  4MMY B;  1KSI A;  1WMN A;  3SOA A;  3GZB A;  3DZL A;  1NO3 A;  5CF2 A;  2A15 A;  1R4C A;  2HMO B;  3SX1 A;  3WDG B;  3ER7 A;  3JUO A;  1BUQ A;  2CWV A;  2BMO B;  3DGM A;  3WMD A;  2R4I A;  4WHA A;  1WQL B;  3BND A;  2D42 A;  1IVW A;  3BNE A;  1DYU A;  1SPU A;  1UUW B;  2I9W A;  3UL5 A;  2SBL A;  3DGL A;  1GYB A;  2E2T A;  2F86 B;  3KSP A;  4FMB A;  1CQS A;  4LSO A;  2ML6 A;  3NHX A;  1JKG B;  4RNY A;  1D6Z A;  2W6J H;  3HIG A;  1VQ9 3;  3KE7 A;  5AII A;  3SED A;  1EKM A;  1QAK A;  1IV7 A;  2CFG A;  3RGR A;  3F14 A;  5FGO A;  4HVN A;  2K0M A;  1O7P B;  5STD A;  3GRD A;  4HM4 B;  1A2K A;  2RSX A;  1W5Z A;  3CCL 3;  1YHQ 3;  1UW1 A;  2C10 A;  1OHO A;  4EBG A;  3FF0 A;  1ULJ B;  5BVB A;  1UI8 A;  1QJG A;  1HU9 A;  3U97 A;  1D6Y A;  2WOF A;  3GZX B;  3UL6 A;  4HZ9 B;  5JBS A;  3UNL A;  3NM2 A;  3CMA 3;  4IIA A;  4N6O B;  2KXG A;  3EC9 A;  2OOV C;  2WO0 A;  1IU7 A;  1G96 A;  3SOY A;  1PU4 A;  3CCR 3;  1NU3 A;  3M8C A;  4EC6 A;  4EXR A;  2P09 A;  2QA4 3;  1VQL 3;  2C11 A;  5AI1 A;  1GD4 A;  2L4V A;  4N6T A;  5EVH A;  2B24 B;  3LT9 A;  1RRL A;  3HK4 A;  1JRQ A;  5IEP A;  2P0M A;  1A90 A;  1OAC A;  3VF1 A;  1TIJ A;  1OH0 A;  3F8H A;  3V98 A;  1N9J A;  4O8S A;  5LC7 A;  3Q1C A;  1VQM 3;  4BTW A;  3MG3 A;  4K1U A;  4L7K A;  4MMZ B;  3CCV 3;  3MPH A;  2ZL8 A;  4K61 A;  1ZO2 A;  3CC4 3;  5JPP A;  2ML5 A;  3FSD A;  4JF8 A;  2MC8 A;  2BHM A;  1VQK 3;  2W0Q A;  3F40 A;  1Q7Y 4;  2XRX B;  3D9R A;  1IVV A;  1GY6 A;  3CC7 3;  1W6C A;  3MWZ A;  2QIY A;  4XM4 A;  3F9S A;  3K9M C;  2WGO A;  4R1K A;  4HM3 B;  2UX0 A;  3NBR A;  3PCR A;  2W03 A;  1KQS 2;  2XGL A;  3GAX A;  1S72 3;  1IDP A;  1VQ6 3;  4FMD A;  1MOL A;  3DY5 A;  1M1X B;  3IPT A;  3ALA A;  1JB4 A;  2LYX A;  3CU3 A;  2RGQ A;  3QRD A;  1Q82 4;  4WYK A;  3PYJ A;  1SII A;  3NM7 A;  4AEQ A;  1ROV A;  3G0K A;  3T0U A;  1OUN A;  5EQL A;  2W9Q A;  5AIG A;  3NBJ A;  3CCE 3;  3RDE A;  4N6V 0;  3J7Y d;  4FCZ A;  4IPB A;  3CXC 2;  5KP4 A;  2FXT A;  3DUK A;  1OPY A;  5HGR A;  1TU5 A;  3AMO B;  1EQK A;  2XEP A;  3MHE A;  4OVM A;  1US1 A;  1YGE A;  4G1M B;  3HI7 A;  5IG3 A;  2YFL B;  3CCJ 3;  3K0Z A;  1DMM A;  2FNQ A;  3PZW A;  3FCS B;  3HZP A;  3D3L A;  3OWY A;  4N6U A;  1GY5 A;  1FGQ A;  4HM2 B;  4R9K A;  3VSY A;  1IQY A;  1W2B 2;  2E2V A;  3X3X A;  3F8X A;  2HML B;  4O3V A;  4STD A;  3G8Z A;  1A67 A;  4N6N B;  1JB2 A;  1W01 A;  2WOH A;  3E99 A;  4O02 B;  3CD6 3;  4U13 A;  3S27 A;  3WOF B;  1RKY A;  2CFD A;  4J8T A;  2BNG A;  3CPW 2;  3N9H A;  2HMJ B;  3S29 A;  5FW5 A;  4NHF A;  2QGU A;  3K5T A;  2W04 A;  3X3Z A;  1ULI B;  1WNH A;  2XFT A;  1YVB I;  2W9P A;  3LTC A;  1LVN A;  4HJL B;  4AKY A;  1KD1 4;  5IER A;  2O3O A;  4PEJ A;  1KC8 4;  1OF5 A;  1U8C B;  1K73 4;  3IJE B;  3KII A;  3BLZ A;  5TGN A;  1N5H A;  3FZW A;  4L8O A;  2GXF A;  4O2H A;  3WA3 A;  3DGO A;  1AV4 A;  3DGN A;  4XDV A;  3LOY A;  1W6Y A;  4Q53 A;  1JN5 B;  3G71 3;  1DVC A;  3LYG A;  3MSO A;  1IT7 A;  2GU1 A;  4N6L A;  4NRE A;  4WFO A;  1M90 4;  1KWI A;  1OGX A;  4AKZ A;  3BNC A;  1CEW I;  1NWW A;  2CIU A;  4OUQ A;  1E3R A;  3BNB A;  1FA3 A;  3X41 A;  1F8N A;  4HBR A;  1GD3 A;  1JB5 A;  3UB1 A;  2W2C A;  3TDG A;  3WA2 X;  2OQE A;  1K28 A;  1L5G B;  4WP5 A;  3FH1 A;  1JN5 A;  3SVA A;  1E97 A;  1UI7 A;  5AIF A;  1VQN 3;  1NB5 I;  1VQ5 3;  1YJ9 3;  4XBT A;  4N6M A;  2OWP A;  2OTJ 3;  5BXQ A;  3F7X A;  4CDL A;  4XBY A;  1Q86 4;  1IK3 A;  5AEU B;  3G6E 3;  4KFE A;  3HII A;  1AR0 A;  1FGT A;  1W4N A;  3L0R A;  1EA2 A;  3T8N A;  4CCV A;  1OHS A;  4MJD A;  2XF3 A;  4I4K A;  3EN8 A;  1NB3 I;  1O7W B;  2KRT A;  1OCV A;  1AVL A;  3OW2 2;  4HM1 B;  3F7S A;  4HZB B;  3FG4 A;  2QEX 3;  2W56 B;  1YJW 3;  2CW9 A;  2GEY A;  3MG1 A;  3CNM A;  4HM8 B;  3B7C A;  2RFR A;  1QAL A;  2CFL A;  1Q81 4;  1D6U A;  2F99 A;  3G16 A;  3I55 3;  5ELJ A;  4XDW A;  5DRV A;  3WOD G;  3X42 A;  1CYV A;  3Q90 A;  1N9E A;  3KSE D;  2Q07 A;  4EV5 A;  8CHO A;  1O7M B;  3B4O A;  5DRE A;  4R80 A;  1JNQ A;  5A0O B;  3AMO A;  1NJI 4;  4KVH A;  3VGN A;  5IG4 A;  2Z7A A;  2CG1 A;  1IQX A;  5ELU A;  2RCD A;  2Y73 A;  3LML A;  4MMX B;  3EE1 A;  4KFD A;  4RZM A;  2B1X B;  4HM6 B;  1VQP 3;  1K9M 4;  1NDO B;  1IT8 A;  2Z76 A;  1JKG A;  3CCU 3;  3I56 3;  1VQ8 3;  1OGZ A;  3EX9 A;  3IMA B;  4FMA A;  4EV2 A;  3N8B A;  3LT8 A;  3DXO A;  2FGT A;  1STD A;  4QWT A;  3FG1 A;  3LH4 A;  5AEW B;  3NQZ A;  4FCJ A;  2CH9 A;  2OQE C;  3FG3 A;  4ORL A;  1ZX2 A;  1N5P A;  1LOX A;  1UUV B;  1ISK A;  2ZDJ A;  3JUQ A;  3I0Y A;  2BO9 B;  5I97 A;  5D82 A;  3H51 A;  2W56 A;  3JUN A;  3JUP A;  2GBX B;  2K54 A;  1N8R 4;  3O8Y A;  1O7H B;  3OXA A;  4HKV B;  4X2O A;  4HM5 B;  1QVG 2;  2YFJ B;  2MF7 A;  3CCM 3;  1E3V A;  3EN1 B;  3CC2 3;  4FR9 A;  3MKI A;  5KP1 A;  1Q42 A;  3EJV A;  2GBW B;  2HMN B;  5IF6 A;  2WGQ A;  3V99 A;  3PCS A;  3T8U A;  3CCQ 3;  3CPO A;  3OV4 A;  3V92 A;  3ECF A;  1LXE A;  3NBB A;  3EB8 A;  3EF8 A;  3NUV A;  3LTB A;  2CC3 A;  2CWU A;  3U1W A;  2P38 A;  2STD A;  4XB5 A;  1AVK A;  1IQ8 A;  2CHC A;  3EBT A;  4HYZ A;  1FGR A;  2M7O A;  3NQY A;  1Z1S A;  3SXX A;  1U5O A;  3CCS 3;  1WMP A;  2GU3 A;  2XSO B;  4HM7 B;  3NXJ A;  1W7C A;  1YJN 3;  3NV0 B;  2OCT A;  3FF2 A;  4R4K A;  1YIT 3;  4LZI A;  2D1W A;  3EBY A;  3SLU A;  5IG5 A;  2KCD A;  2IA7 A;  3KFQ C;  5AYR B;  1FGO A;  3ROB A;  3H3H A;  4LGQ A;  1DMN A;  3LXU X;  5CK6 A;  3RGA A;  1O7G B;  5G2G A;  1YI2 3;  1Q40 A;  1ROA A;  2Z6B A;  1PFP A;  1N8Q A;  3CME 3;  2P05 A;  1OF5 B;  3X3Y A;  5AIH A;  2XFS A;  3OWU A;  1VQ7 3;  2CWT A;  5IEO A;  4WYK B;  4BTY A;  3GWR A;  1VQ4 3;  2OOV A;  1DMQ A;  1RJO A;  5CLK A;  1RRH A;  3LZA A;  3PS8 A;  4XBX A;  5KP3 A;  1JJ2 2;  1M9G A;  4JRF A;  1IVU A;  1SJW A;  1C7H A;  3PXM A;  3NV0 A;  4LEH A;  1JV2 B;  4H61 A;  1YIJ 3;  3GZR A;  2CK3 H;  5CF1 A;  3OWS A;  1CYU A;  1SIH A;  2IMJ A;  2INX A;  3B8L A;  5CXO A;  3FKA A;  2V1L A;  3DM8 A;  2LQV A;  4X2H A;  1S5A A;  3N54 B;  2Z77 A;  4GB5 A;  5EEO A;  1SQW A;  3QK9 A;  4K1V A;  4R9L A;  3S67 A;  1VQO 3;  3OX9 A;  3MYT A;  5D81 A;  5JPU A;  2Y74 A;  1M1K 4;  3Q2P A;  3KZT A;  2IUK A;  2F98 A;  3KN4 A;  1GS3 A;  4EYC A;  3HX8 A;  5IEN A;  1FUW A;  4RBN A;  4KFF A;  4WWU C;  2BMR B;  1DVD A;  1TFO A;  4TX4 A;  1HKX A;  2JQ5 A;  3KKG A;  2BT3 A;  2HMK B;  1K8A 4;  2OTL 3;  4FCM A;  3G4S 3;  2XGN A;  3PGB A;  4HM0 B;  3UJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...