2CIUA

Structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
b'SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM21 MITOCHONDRIA
publication title The Tim21 Binding Domain Connects the Preprotein Translocases of Both Mitochondrial Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ciuA00
2MF7A 2CIUA
chains in the Genus database with same CATH superfamily
1KQS2 3WHOA 5BXQA 1IDPA 1MWRA 2CFKA 3CU3A 1LRAA 3B4OA 1BNGA 4HJLB 4RNTA 1K8A4 4KFDA 5DRVA 7GSPA 4L7KA 1RMSA 4XB5A 3OXAA 1MGRA 3LMLA 1B20A 1BNSA 2PZVA 4NREA 2XEPA 2HMKB 1X1WA 2W56A 4QWTA 1AR0A 2CHCA 4GL6A 1HZ1A 2WGQA 4FCZA 5CF2A 1UCLA 3DMCA 4XM4A 1FGQA 1RSNA 3G713 1OGXA 2E2TA 1QMAA 5D81A 2C10A 3UL5A 1M904 1YVBI 1RCLA 1MWUA 4KZ1A 2GEYA 1R4CA 3HX8A 3KSED 3HOHA 3V98A 2UGIA 3CPW2 3QRDA 1D6UA 4EV2A 2F5WA 1J2BA 2Z76A 3G16A 1PU4A 3X3YA 2SBLA 1FGOA 5AEWB 3CD63 2P09A 2QA43 2C4BA 2HMLB 3D3LA 1AY7A 1ZX2A 1I0VA 1NWWA 5BVBA 3GZXB 3FCSB 1JKGB 5G2GA 1A2PA 3D5IA 1A2KA 1V57A 4OK0A 1ULJB 2W0QA 1MOLA 1Q7HA 1FW7A 1V74A 3BNCA 1UCIA 1ZGXA 2KF6A 1BAOA 1STFI 3FSDA 3M8CA 4LGQA 1UDII 5D82A 4N3VA 5BIRA 4BL3A 4HM8B 2IUKA 3CCS3 4R9KA 3D4AA 2ML5A 1ISKA 3CC23 1E3RA 2PNCA 4BTYA 2CKFB 1TJDA 3E99A 2ZDJA 3LTAA 1O7HB 4HM5B 1JV2B 1DMQA 1HKXA 3FF0A 1A2VA 3KN4A 2I9WA 1YHQ3 1LXEA 1PFPA 1UUWB 1BRSA 1NNVA 4TX4A 3J7Yd 3EQQB 2GU3A 3D5GA 3F8HA 3K63A 1I2EA 2Z77A 1WNHA 3GZYB 1N9JA 4N6LA 3CC43 3S67A 4I4KA 4K61A 1RDSA 5STDA 3S5CA 1O7GB 1IV9A 3ALAA 4N6TA 3D9RA 4NPBA 4MJDA 1B2SA 3LOYA 3WODG 2E2UA 1IT8A 2F4YA 3UJMA 3CCR3 3FF2A 1BRJA 1D6YA 3MSOA 3JUPA 3D79A 4N6MA 3N54B 4EC6A 2OWPA 1I0XA 1LNIA 1O7PB 4KFEA 5AYSC 1TFOA 1IK3A 3X41A 1ZS7A 2ZA4A 3GRDA 4J8TA 1S723 1BU4A 1RGFA 3AHSA 3JUQA 1UI7A 2F56A 3NQZA 4EYCA 4K1UA 4FCJA 3X42A 8RNTA 5KP1A 1GMQA 5IG3A 3FKAA 1NJI4 5LC7A 7STDA 1BUQA 1BNJA 1JB4A 1KSIA 2GXFA 3LTCA 3NQYA 4XBYA 1M9GA 3GZRA 1NB3I 3NUVA 2FNQA 4RBNA 4HZBB 1I3IA 2F86B 2E2VA 3WOEB 1ASKA 2IA7A 1VQO3 1QALA 1LOYA 5CXOA 1OACA 1U8CB 3DUKA 3BLZA 3EJVA 3B4PA 3FH1A 1W00A 3K9MC 1QVG2 1BUJA 2CFDA 3FG4A 1RGLA 2F99A 2KAAA 3CXC2 3CCV3 3EHCA 3KIIA 5FGOA 1G02A 4HM0B 1JB5A 5IEPA 4O02B 3AGNA 1GOYA 1GD3A 1SJWA 3ECFA 3MG3A 3VSYA 1VQ63 4R80A 3I553 1D6ZA 1OHPA 3RDEA 9RNTA 2RBIA 1RGHA 1T3BA 1GMPA 1B2XA 1TTOA 3UNLA 3CMA3 1W6YA 3F8XA 1N5PA 2FXTA 2OTL3 1M1XB 1F8NA 1RHLA 3IMAB 2KF4A 2XH9A 2K54A 1JB2A 6STDA 1STDA 1ROVA 3AMOA 4O8SA 1SARA 2K3DA 2V1LA 3KKGA 5EQLA 5A0OB 1VQM3 2P0XA 5IENA 1AQZA 3GSPA 3NBRA 3ROBA 4DKIA 1YI23 5M18A 3FLJA 1X1YA 3DXOA 3CCL3 2F5MA 2INXA 1JJ22 5IF6A 5DREA 1EG9B 3EF8A 4Q53A 3BNDA 1C7HA 2AAEA 3AMOB 4GHOA 1GYBA 4WFOA 4H3UA 2XF3A 1NB5I 1BNRA 2P38A 2KXGA 4FCMA 1G96A 4WWUC 2CWUA 2J8XB 3L0RA 3UB1A 1BRGA 1FUTA 1AVKA 2W56B 2UUGC 3I563 4HM1B 3HI7A 1RCKA 3ZG0A 2KCDA 1EA2A 1BSCA 1RGAA 3DGNA 2QIYA 2WGOA 5EVHA 3B8LA 1W4NA 1BRKA 1WMNA 3G0KA 5G1LA 1BRNL 1YJN3 4LEHA 2BNGA 1EQKA 1E3VA 1VQP3 3CCE3 4EW5A 2WO0A 2XSOB 2BMOB 3DGLA 3G8ZA 4R1KA 4MEIA 1RNTA 4HBRA 3BU4A 1QJGA 3JUMA 3BB9A 3NM7A 3Q3FA 3F7XA 1LOWA 3WDGB 3SX1A 1VZZA 2STDA 4R9LA 3SXXA 5AIFA 3DGMA 5AYRB 1JBSA 1AVLA 3SEDA 2Z6BA 2QGUA 5JPPA 5G1KA 4ORLA 2JQ5A 4H61A 1CYVA 1UW1A 2HMJB 3OV4A 2OTJ3 4WHAA 1UUVB 4EV5A 1JBRA 1AV4A 4CCVA 1SIHA 2W6JH 3KE7A 4J9AA 1QAKA 2B1XB 1SPUA 3NBBA 3S29A 5BU4A 1JZDA 3RGAA 1N8QA 1DVDA 1CQSA 3OWYA 3NBJA 1K9M4 2F98A 1RLSA 5M1AA 2IYJA 3EN8A 2W04A 3JUOA 4MMYB 1BANA 1RGKA 5CK6A 5D83A 2IY2A 4EXRA 1B2ZA 1N5HA 2P05A 1VQ43 3MPHA 3G4S3 1TUHA 2XSHB 3A76A 1OGZA 3K7CA 1YGWA 4CPKA 2HMOB 5M19A 2GU1A 1W6CA 1YJW3 2ZL8A 4X2OA 1FZUA 1B2MA 1WQLB 1IVXA 2LQVA 3FG3A 3PS8A 2OQEC 3DY5A 1RGEA 3NX0A 2GSPA 3N8BA 4FMDA 5FW5A 4STDA 1BRIA 3MKIA 3N9HA 2HOHA 3WA2X 1VQN3 2BMRB 1NO3A 1GD4A 3BIRA 4BTWA 1NDOB 3MG1A 4AKZA 3K5TA 1IYYA 4AEQA 4FR9A 4LSOA 3SOYA 5IERA 1YJ93 1US1A 2CX1A 2O3OA 1V58A 2Y74A 1I70A 4FMBA 4J5KA 5GSPA 3RNTA 4HAAA 1CYUA 2HMMB 5KP3A 3HIIA 1IVUA 4WP5A 3IPTA 3NV0A 4HM4B 1GOUA 4XBXA 3T8UA 1B21A 2YFJB 2XGNA 4HVNA 1OH0A 3WA3A 5AEUB 3SVAA 3LZAA 3V92A 2RFRA 3K0ZA 1KWIA 2L4VA 1PYLA 1DMMA 1FUSA 2OCTA 1W7CA 3AGOA 3EB8A 1A90A 1CEWI 5IW9A 1EEJA 3F9SA 1ROAA 1K41A 1WTHA 3NXJA 3CPOA 1Q814 1TFKA 2W9PA 3EN1B 4JRFA 3KCHA 3KSPA 1RGCA 1UCKA 3BNBA 4HKVB 1N8R4 1B2UA 2RGQA 4RNYA 3SLUA 1Q42A 5EEOA 4BU4A 1VQQA 1T2IA 5CLKA 3T0UA 4I5QA 1NU3A 2GBXB 3FG1A 3U1WA 4BL2A 2MF7A 4WYKA 1X1UA 3ZFZA 2Y73A 3JVCA 4LMIA 1DE3A 1Q9EA 1B27A 1GY7A 3DM8A 4HZ9B 2CFWA 4MMXB 5IG5A 2KF5A 2R41A 1BOXA 1FUWA 3NHXA 1W2ZA 2CWTA 1T2HA 1LQGC 2CC3A 3HZPA 2CFGA 1JN5B 3A5EA 3EBTA 1HU9A 3O8YA 3OX9A 1Q40A 5AIGA 5RNTA 1A67A 1JN5A 1EUIC 1W6GA 2XFTA 2H0GA 3HK4A 3UL6A 4HM3B 1O7WB 2A15A 1RNBA 1W02A 1ZO2A 3FZWA 4ILFA 4XDVA 2BMQB 1DYUA 3CCU3 1BSAA 3MHEA 2L1SA 1GSPA 3CCJ3 5IEOA 1SIIA 4RZMA 2YFIB 1LOXA 2HMNB 2YFLB 5HOHA 1UGIA 2XRXB 4U13A 4XBTA 2LYXA 1KD14 3CME3 1MGWA 1MNLA 1YGEA 3SYUA 1W01A 2CWVA 4PEJA 4IIAA 1U5OA 1I2FA 3WR2A 1LOVA 1DETA 2SARA 2W03A 5ELUA 1GMRA 2KRTA 1O7MB 2WOHA 4R4KA 4LZIA 3S28A 4ZM8A 1B3SA 3G6E3 5AI1A 2BO9B 4K1VA 1IU7A 1IT7A 2CH9A 1OF5A 3FGYA 5AIHA 1FGRA 3LT8A 1L5GB 3S27A 3T8NA 7RNTA 3KFQC 2BT3A 3LYGA 8CHOA 3Q1CA 1RN1A 2GEXA 3B7CA 1PY3A 2AADA 2BU4A 2FGTA 1G0TA 2W2CA 4N6NB 1T5YA 2ZHXB 1VQ53 4J5GA 2RCDA 3NM2A 1R4YA 3DZLA 2B24B 3EBYA 1JKGA 1TRPA 2BIRA 3BNEA 4N6OB 4HOHA 2K0MA 2UX0A 3F7SA 3HIGA 1BSDA 1RRHA 1GS3A 1OF5B 1OHOA 4NHFA 2MC8A 2YX9A 3F40A 1Y4KA 1JZOA 4L8PA 3ER7A 3CCM3 1W2B2 3VF1A 1BVIA 3JUNA 1C54A 2M7OA 3AHWA 3MYTA 3OWUA 1M1K4 4X2HA 1VQ83 4EBGA 1OHSA 3MG2A 4FMAA 2D1WA 3Q90A 1LNHA 1K28A 1IVWA 3LH4A 3LT9A 4MMZB 3Q2PA 3H51A 1IQ8A 3OWSA 5JPUA 3EX9A 2P0MA 3H3HA 1YIJ3 2H0IA 1VQL3 1YNVX 1OUNA 4OVMA 1GY6A 1I2GA 3DH2A 4N6V0 3GZBA 1QAFA 3PCSA 5JBSA 3OW22 3ZG5A 3CC73 4L8OA 4KFFA 5LC6A 3TDGA 1N9EA 4CJNA 1RTUA 3EE1A 4O2HA 5CF1A 3LTBA 1BSEA 1BSBA 3CNXA 3PZWA 4OUQA 2CX0A 2OOVA 3WOFB 4N6UA 5TGNA 1O7NB 1UCJA 3I0YA 4FMCA 3X3XA 3GAXA 6GSPA 2W9QA 3IJEB 3U97A 1MWTA 1DMNA 1VQK3 1BIRA 1BNEA 1RGGA 3PGBA 4HM7B 4O3VA 1RJOA 1LVNA 1TRQA 3PCRA 1RN4A 3V99A 2XR8B 1Q864 1ULIB 2WOFA 1UUGB 1WMPA 3GWRA 1EKMA 2ML6A 4HM6B 4BTXA 5KP4A 1HYFA 3EC9A 5AIIA 1YIT3 1I8VA 1X1XA 1K734 1JNQA 1RN7A 3F14A 1W5ZA 1IQXA 1TP6A 1Z1SA 2XFSA 2CK3H 2RNTA 4G1MB 3RGRA 1VQ93 3MWZA 4CDLA 1SQWA 4KT3B 2JDIH 1YVSA 5IG0A 4IPBA 4GB5A 1FGMA 5IG4A 4IT7A 4K90B 1KC84 2XGLA 3QK9A 5I97A 2CFLA 4GSPA 1FGTA 4XDWA 2GBWB 1E97A 1Q824 1BNFA 2CG1A 2KF3A 3DGYA 3NV0B 2CIUA 3DGOA 1DVCA 3LXUX 1CH0A 1OPYA 2OQEA 1BNIA 1IVVA 1BGSA 2OOVC 4JF8A 1WMOA 3X3ZA 2Q07A 3WMDA 1VQ73 3PXMA 2D42A 1IQYA 1I3FA 1JRQA 1Q7Y4 3KZTA 1TU5A 1RRLA 3CNMA 2BHMA 1OCVA 3URPA 2IUJA 1BRHA 3STDA 2IMJA 3VGNA 2O9UX 4RNZA 1TIJA 1RKYA 5HGRA 6RNTA 3CCQ3 2C11A 3SOAA 4WYKB 1JBTA 1UGHI 5ELJA 4HYZA 2H0HA 1QVF2 1S5AA 1IV7A 2Z7AA 4LYLB 2CG0A 1GOVA 3X40A 1MWSA 4HM2B 2RSXA 1UI8A 2QEX3 1FA3A 1GY5A 4BIRA 2R4IA 1Q40B 3LTDA 1FYSA 4AKYA 1LQMB 2CW9A 3PYJA 4KVHA
chains in the Genus database with same CATH topology
1KQS2 5BXQA 1IDPA 2CFKA 3CU3A 1K8A4 3B4OA 4HJLB 4KFDA 5DRVA 4L7KA 4XB5A 3OXAA 3LMLA 2PZVA 4NREA 2XEPA 2HMKB 2W56A 4QWTA 1AR0A 2CHCA 4GL6A 2WGQA 4FCZA 5CF2A 3DMCA 4XM4A 1FGQA 3G713 1OGXA 2E2TA 1QMAA 5D81A 2C10A 3UL5A 1M904 1YVBI 4KZ1A 2GEYA 1R4CA 3HX8A 3KSED 3V98A 3CPW2 3QRDA 1D6UA 4EV2A 1J2BA 2Z76A 3G16A 1PU4A 3X3YA 2SBLA 1FGOA 5AEWB 3CD63 2P09A 2QA43 2HMLB 3D3LA 1ZX2A 1NWWA 5BVBA 3GZXB 3FCSB 1JKGB 5G2GA 1A2KA 4OK0A 1ULJB 2W0QA 1MOLA 1V74A 3BNCA 3M8CA 3FSDA 5D82A 1STFI 4LGQA 4N3VA 4HM8B 2IUKA 3CCS3 4R9KA 2ML5A 1ISKA 3CC23 1E3RA 2PNCA 4BTYA 2CKFB 3E99A 2ZDJA 3LTAA 1O7HB 4HM5B 1JV2B 1DMQA 1HKXA 3FF0A 1A2VA 3KN4A 2I9WA 1YHQ3 1LXEA 1PFPA 1UUWB 4TX4A 3J7Yd 3EQQB 2GU3A 3F8HA 3K63A 3GZYB 2Z77A 1WNHA 3CC43 1N9JA 4N6LA 3S67A 4I4KA 4K61A 5STDA 3S5CA 1O7GB 1IV9A 3ALAA 4N6TA 3D9RA 4MJDA 3LOYA 3WODG 2E2UA 1IT8A 3UJMA 3CCR3 3FF2A 1D6YA 3MSOA 3JUPA 4N6MA 3N54B 4EC6A 2OWPA 1O7PB 4KFEA 5AYSC 1TFOA 1IK3A 3X41A 3GRDA 4J8TA 1S723 3JUQA 1UI7A 3NQZA 4EYCA 4K1UA 4FCJA 3X42A 5KP1A 5IG3A 1NJI4 3FKAA 5LC7A 7STDA 1BUQA 1JB4A 1KSIA 2GXFA 3LTCA 3NQYA 4XBYA 1M9GA 3GZRA 1NB3I 3NUVA 2FNQA 4RBNA 4HZBB 2F86B 2E2VA 3WOEB 1ASKA 2IA7A 1VQO3 1QALA 5CXOA 1OACA 1U8CB 3DUKA 3BLZA 3EJVA 3B4PA 3FH1A 1W00A 3K9MC 1QVG2 2CFDA 3FG4A 2F99A 3CXC2 3CCV3 3EHCA 3KIIA 5FGOA 4HM0B 1JB5A 5IEPA 4O02B 1SJWA 1GD3A 3ECFA 3MG3A 3VSYA 1VQ63 4R80A 3I553 1D6ZA 1OHPA 3RDEA 3UNLA 3CMA3 1W6YA 3F8XA 1N5PA 2FXTA 2OTL3 1M1XB 1F8NA 3IMAB 2XH9A 2K54A 1JB2A 6STDA 1STDA 1ROVA 3AMOA 4O8SA 5A0OB 1VQM3 2V1LA 3KKGA 5EQLA 2P0XA 5IENA 1YI23 3NBRA 3ROBA 3FLJA 3DXOA 3CCL3 2INXA 1JJ22 5IF6A 5DREA 1EG9B 3EF8A 4Q53A 3BNDA 1C7HA 3AMOB 1GYBA 4WFOA 4H3UA 2XF3A 1NB5I 2P38A 2KXGA 4FCMA 1G96A 4WWUC 2CWUA 3UB1A 3L0RA 1AVKA 2W56B 3I563 4HM1B 3HI7A 2KCDA 1EA2A 3DGNA 2QIYA 2WGOA 3B8LA 1W4NA 3G0KA 1WMNA 1YJN3 4LEHA 2BNGA 1EQKA 1E3VA 1VQP3 3CCE3 2WO0A 2XSOB 2BMOB 3DGLA 3G8ZA 4R1KA 4MEIA 4HBRA 1QJGA 3JUMA 3BB9A 3NM7A 3F7XA 3WDGB 3SX1A 1VZZA 2STDA 4R9LA 3SXXA 5AIFA 3DGMA 5AYRB 1AVLA 3SEDA 2Z6BA 2QGUA 5JPPA 4ORLA 2JQ5A 4H61A 1CYVA 1UW1A 2HMJB 3OV4A 2OTJ3 4WHAA 1UUVB 1AV4A 4CCVA 1SIHA 2W6JH 3KE7A 4J9AA 1QAKA 2B1XB 1SPUA 3NBBA 3S29A 3RGAA 1N8QA 1DVDA 1CQSA 3OWYA 3NBJA 1K9M4 2F98A 4MMYB 3EN8A 2W04A 3JUOA 4EXRA 5CK6A 4EV5A 5D83A 1CYUA 1N5HA 2P05A 1VQ43 3MPHA 3G4S3 1TUHA 2XSHB 3A76A 1OGZA 3K7CA 2HMOB 2GU1A 1W6CA 1YJW3 2ZL8A 4X2OA 1WQLB 1IVXA 2LQVA 3FG3A 3PS8A 2OQEC 3DY5A 3NX0A 3N8BA 4FMDA 5FW5A 4STDA 3MKIA 3WA2X 1VQN3 2BMRB 1NO3A 1GD4A 4BTWA 1NDOB 3MG1A 4AKZA 3K5TA 4AEQA 4FR9A 4LSOA 3SOYA 5IERA 1YJ93 1US1A 2O3OA 2Y74A 4FMBA 2HMMB 5KP3A 3HIIA 1IVUA 4WP5A 3IPTA 3NV0A 4HM4B 4XBXA 3T8UA 2YFJB 2XGNA 4HVNA 1OH0A 3WA3A 5AEUB 3SVAA 3LZAA 3V92A 2RFRA 3K0ZA 1KWIA 2L4VA 2OCTA 1DMMA 3N9HA 1W7CA 1A90A 3EB8A 1CEWI 5IW9A 3F9SA 1ROAA 1K41A 1WTHA 3NXJA 3CPOA 1Q814 1TFKA 2W9PA 3EN1B 4JRFA 3KSPA 3BNBA 4HKVB 1N8R4 2RGQA 4RNYA 3SLUA 1Q42A 5EEOA 3T0UA 5CLKA 1NU3A 2GBXB 3FG1A 3U1WA 2MF7A 4WYKA 2Y73A 3JVCA 4LMIA 4MMXB 1GY7A 3DM8A 4HZ9B 2CFWA 5IG5A 1FUWA 3NHXA 1W2ZA 2CWTA 2CC3A 3HZPA 2CFGA 3O8YA 1A67A 3EBTA 1HU9A 3OX9A 5AIGA 1Q40A 1JN5A 3UL6A 1W6GA 2XFTA 3HK4A 4HM3B 1O7WB 2A15A 1W02A 1ZO2A 3FZWA 4XDVA 2BMQB 1DYUA 3CCU3 3MHEA 3CCJ3 5IEOA 1SIIA 4RZMA 2YFIB 1LOXA 2HMNB 2YFLB 2XRXB 4U13A 4XBTA 2LYXA 1KD14 3CME3 1MNLA 1YGEA 1W01A 2CWVA 4PEJA 4IIAA 1U5OA 2W03A 5ELUA 2KRTA 1O7MB 2WOHA 4R4KA 4LZIA 3S28A 4ZM8A 3G6E3 5AI1A 2BO9B 4K1VA 1IU7A 1IT7A 2CH9A 1OF5A 3FGYA 5AIHA 1FGRA 3LT8A 1L5GB 3S27A 3T8NA 3KFQC 2BT3A 3LYGA 8CHOA 3Q1CA 5EVHA 2GEXA 3B7CA 2FGTA 2W2CA 4N6NB 2OQEA 2IUJA 1VQ53 1T5YA 2RCDA 3NM2A 3DZLA 2B24B 3EBYA 1JKGA 3BNEA 4N6OB 2K0MA 2UX0A 3F7SA 3HIGA 1RRHA 1GS3A 1OF5B 1OHOA 4NHFA 2MC8A 2YX9A 3F40A 1Y4KA 3CCM3 4L8PA 3ER7A 1W2B2 3VF1A 3JUNA 2M7OA 3MYTA 3OWUA 1VQ83 1M1K4 4X2HA 4EBGA 1OHSA 3MG2A 4FMAA 2D1WA 3Q90A 1LNHA 1K28A 1IVWA 3LH4A 3LT9A 4MMZB 3Q2PA 3H51A 1IQ8A 3OWSA 5JPUA 3EX9A 2P0MA 3H3HA 1YIJ3 1VQL3 4OVMA 1OUNA 1GY6A 4N6V0 3GZBA 1QAFA 3PCSA 5JBSA 3OW22 3CC73 4L8OA 4KFFA 5LC6A 3TDGA 1N9EA 3EE1A 4O2HA 5CF1A 3LTBA 3CNXA 3PZWA 2OOVA 4OUQA 3WOFB 4N6UA 5TGNA 1O7NB 3I0YA 4FMCA 3X3XA 3GAXA 2W9QA 3IJEB 3U97A 1DMNA 1VQK3 3PGBA 4HM7B 4O3VA 1RJOA 1LVNA 3PCRA 3V99A 2XR8B 1Q864 1ULIB 2WOFA 1WMPA 3GWRA 1EKMA 2ML6A 4HM6B 4BTXA 5KP4A 3EC9A 5AIIA 1YIT3 1K734 1JNQA 1RN7A 3F14A 1W5ZA 1IQXA 1TP6A 1Z1SA 2XFSA 2CK3H 4G1MB 3RGRA 1VQ93 3MWZA 4CDLA 1SQWA 2JDIH 5IG0A 4IPBA 4GB5A 1FGMA 5IG4A 4IT7A 4K90B 1KC84 2XGLA 3QK9A 5I97A 2CFLA 1FGTA 4XDWA 2GBWB 1E97A 1Q824 2CG1A 3NV0B 2CIUA 3DGOA 1DVCA 3LXUX 1OPYA 1IVVA 2OOVC 4JF8A 1WMOA 3X3ZA 2Q07A 3WMDA 1VQ73 3PXMA 2D42A 1IQYA 1JRQA 1Q7Y4 3KZTA 1TU5A 1RRLA 3CNMA 2BHMA 1OCVA 3STDA 2IMJA 3VGNA 2O9UX 4RNZA 1TIJA 1RKYA 5HGRA 3CCQ3 2C11A 3SOAA 4WYKB 5ELJA 4HYZA 1QVF2 1S5AA 1IV7A 2Z7AA 2CG0A 3X40A 2QEX3 4HM2B 2RSXA 1UI8A 1FA3A 1GY5A 2R4IA 1Q40B 3LTDA 4AKYA 1JN5B 2CW9A 3PYJA 4KVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF7 A;  2CIU A; 
#chains in the Genus database with same CATH topology
 1KQS 2;  3WHO A;  5BXQ A;  1IDP A;  1MWR A;  2CFK A;  3CU3 A;  1LRA A;  3B4O A;  1BNG A;  4HJL B;  4RNT A;  1K8A 4;  4KFD A;  5DRV A;  7GSP A;  4L7K A;  1RMS A;  4XB5 A;  3OXA A;  1MGR A;  3LML A;  1B20 A;  1BNS A;  2PZV A;  4NRE A;  2XEP A;  2HMK B;  1X1W A;  2W56 A;  4QWT A;  1AR0 A;  2CHC A;  4GL6 A;  1HZ1 A;  2WGQ A;  4FCZ A;  5CF2 A;  1UCL A;  3DMC A;  4XM4 A;  1FGQ A;  1RSN A;  3G71 3;  1OGX A;  2E2T A;  1QMA A;  5D81 A;  2C10 A;  3UL5 A;  1M90 4;  1YVB I;  1RCL A;  1MWU A;  4KZ1 A;  2GEY A;  1R4C A;  3HX8 A;  3KSE D;  3HOH A;  3V98 A;  2UGI A;  3CPW 2;  3QRD A;  1D6U A;  4EV2 A;  2F5W A;  1J2B A;  2Z76 A;  3G16 A;  1PU4 A;  3X3Y A;  2SBL A;  1FGO A;  5AEW B;  3CD6 3;  2P09 A;  2QA4 3;  2C4B A;  2HML B;  3D3L A;  1AY7 A;  1ZX2 A;  1I0V A;  1NWW A;  5BVB A;  3GZX B;  3FCS B;  1JKG B;  5G2G A;  1A2P A;  3D5I A;  1A2K A;  1V57 A;  4OK0 A;  1ULJ B;  2W0Q A;  1MOL A;  1Q7H A;  1FW7 A;  1V74 A;  3BNC A;  1UCI A;  1ZGX A;  2KF6 A;  1BAO A;  1STF I;  3FSD A;  3M8C A;  4LGQ A;  1UDI I;  5D82 A;  4N3V A;  5BIR A;  4BL3 A;  4HM8 B;  2IUK A;  3CCS 3;  4R9K A;  3D4A A;  2ML5 A;  1ISK A;  3CC2 3;  1E3R A;  2PNC A;  4BTY A;  2CKF B;  1TJD A;  3E99 A;  2ZDJ A;  3LTA A;  1O7H B;  4HM5 B;  1JV2 B;  1DMQ A;  1HKX A;  3FF0 A;  1A2V A;  3KN4 A;  2I9W A;  1YHQ 3;  1LXE A;  1PFP A;  1UUW B;  1BRS A;  1NNV A;  4TX4 A;  3J7Y d;  3EQQ B;  2GU3 A;  3D5G A;  3F8H A;  3K63 A;  1I2E A;  2Z77 A;  1WNH A;  3GZY B;  1N9J A;  4N6L A;  3CC4 3;  3S67 A;  4I4K A;  4K61 A;  1RDS A;  5STD A;  3S5C A;  1O7G B;  1IV9 A;  3ALA A;  4N6T A;  3D9R A;  4NPB A;  4MJD A;  1B2S A;  3LOY A;  3WOD G;  2E2U A;  1IT8 A;  2F4Y A;  3UJM A;  3CCR 3;  3FF2 A;  1BRJ A;  1D6Y A;  3MSO A;  3JUP A;  3D79 A;  4N6M A;  3N54 B;  4EC6 A;  2OWP A;  1I0X A;  1LNI A;  1O7P B;  4KFE A;  5AYS C;  1TFO A;  1IK3 A;  3X41 A;  1ZS7 A;  2ZA4 A;  3GRD A;  4J8T A;  1S72 3;  1BU4 A;  1RGF A;  3AHS A;  3JUQ A;  1UI7 A;  2F56 A;  3NQZ A;  4EYC A;  4K1U A;  4FCJ A;  3X42 A;  8RNT A;  5KP1 A;  1GMQ A;  5IG3 A;  3FKA A;  1NJI 4;  5LC7 A;  7STD A;  1BUQ A;  1BNJ A;  1JB4 A;  1KSI A;  2GXF A;  3LTC A;  3NQY A;  4XBY A;  1M9G A;  3GZR A;  1NB3 I;  3NUV A;  2FNQ A;  4RBN A;  4HZB B;  1I3I A;  2F86 B;  2E2V A;  3WOE B;  1ASK A;  2IA7 A;  1VQO 3;  1QAL A;  1LOY A;  5CXO A;  1OAC A;  1U8C B;  3DUK A;  3BLZ A;  3EJV A;  3B4P A;  3FH1 A;  1W00 A;  3K9M C;  1QVG 2;  1BUJ A;  2CFD A;  3FG4 A;  1RGL A;  2F99 A;  2KAA A;  3CXC 2;  3CCV 3;  3EHC A;  3KII A;  5FGO A;  1G02 A;  4HM0 B;  1JB5 A;  5IEP A;  4O02 B;  3AGN A;  1GOY A;  1GD3 A;  1SJW A;  3ECF A;  3MG3 A;  3VSY A;  1VQ6 3;  4R80 A;  3I55 3;  1D6Z A;  1OHP A;  3RDE A;  9RNT A;  2RBI A;  1RGH A;  1T3B A;  1GMP A;  1B2X A;  1TTO A;  3UNL A;  3CMA 3;  1W6Y A;  3F8X A;  1N5P A;  2FXT A;  2OTL 3;  1M1X B;  1F8N A;  1RHL A;  3IMA B;  2KF4 A;  2XH9 A;  2K54 A;  1JB2 A;  6STD A;  1STD A;  1ROV A;  3AMO A;  4O8S A;  1SAR A;  2K3D A;  2V1L A;  3KKG A;  5EQL A;  5A0O B;  1VQM 3;  2P0X A;  5IEN A;  1AQZ A;  3GSP A;  3NBR A;  3ROB A;  4DKI A;  1YI2 3;  5M18 A;  3FLJ A;  1X1Y A;  3DXO A;  3CCL 3;  2F5M A;  2INX A;  1JJ2 2;  5IF6 A;  5DRE A;  1EG9 B;  3EF8 A;  4Q53 A;  3BND A;  1C7H A;  2AAE A;  3AMO B;  4GHO A;  1GYB A;  4WFO A;  4H3U A;  2XF3 A;  1NB5 I;  1BNR A;  2P38 A;  2KXG A;  4FCM A;  1G96 A;  4WWU C;  2CWU A;  2J8X B;  3L0R A;  3UB1 A;  1BRG A;  1FUT A;  1AVK A;  2W56 B;  2UUG C;  3I56 3;  4HM1 B;  3HI7 A;  1RCK A;  3ZG0 A;  2KCD A;  1EA2 A;  1BSC A;  1RGA A;  3DGN A;  2QIY A;  2WGO A;  5EVH A;  3B8L A;  1W4N A;  1BRK A;  1WMN A;  3G0K A;  5G1L A;  1BRN L;  1YJN 3;  4LEH A;  2BNG A;  1EQK A;  1E3V A;  1VQP 3;  3CCE 3;  4EW5 A;  2WO0 A;  2XSO B;  2BMO B;  3DGL A;  3G8Z A;  4R1K A;  4MEI A;  1RNT A;  4HBR A;  3BU4 A;  1QJG A;  3JUM A;  3BB9 A;  3NM7 A;  3Q3F A;  3F7X A;  1LOW A;  3WDG B;  3SX1 A;  1VZZ A;  2STD A;  4R9L A;  3SXX A;  5AIF A;  3DGM A;  5AYR B;  1JBS A;  1AVL A;  3SED A;  2Z6B A;  2QGU A;  5JPP A;  5G1K A;  4ORL A;  2JQ5 A;  4H61 A;  1CYV A;  1UW1 A;  2HMJ B;  3OV4 A;  2OTJ 3;  4WHA A;  1UUV B;  4EV5 A;  1JBR A;  1AV4 A;  4CCV A;  1SIH A;  2W6J H;  3KE7 A;  4J9A A;  1QAK A;  2B1X B;  1SPU A;  3NBB A;  3S29 A;  5BU4 A;  1JZD A;  3RGA A;  1N8Q A;  1DVD A;  1CQS A;  3OWY A;  3NBJ A;  1K9M 4;  2F98 A;  1RLS A;  5M1A A;  2IYJ A;  3EN8 A;  2W04 A;  3JUO A;  4MMY B;  1BAN A;  1RGK A;  5CK6 A;  5D83 A;  2IY2 A;  4EXR A;  1B2Z A;  1N5H A;  2P05 A;  1VQ4 3;  3MPH A;  3G4S 3;  1TUH A;  2XSH B;  3A76 A;  1OGZ A;  3K7C A;  1YGW A;  4CPK A;  2HMO B;  5M19 A;  2GU1 A;  1W6C A;  1YJW 3;  2ZL8 A;  4X2O A;  1FZU A;  1B2M A;  1WQL B;  1IVX A;  2LQV A;  3FG3 A;  3PS8 A;  2OQE C;  3DY5 A;  1RGE A;  3NX0 A;  2GSP A;  3N8B A;  4FMD A;  5FW5 A;  4STD A;  1BRI A;  3MKI A;  3N9H A;  2HOH A;  3WA2 X;  1VQN 3;  2BMR B;  1NO3 A;  1GD4 A;  3BIR A;  4BTW A;  1NDO B;  3MG1 A;  4AKZ A;  3K5T A;  1IYY A;  4AEQ A;  4FR9 A;  4LSO A;  3SOY A;  5IER A;  1YJ9 3;  1US1 A;  2CX1 A;  2O3O A;  1V58 A;  2Y74 A;  1I70 A;  4FMB A;  4J5K A;  5GSP A;  3RNT A;  4HAA A;  1CYU A;  2HMM B;  5KP3 A;  3HII A;  1IVU A;  4WP5 A;  3IPT A;  3NV0 A;  4HM4 B;  1GOU A;  4XBX A;  3T8U A;  1B21 A;  2YFJ B;  2XGN A;  4HVN A;  1OH0 A;  3WA3 A;  5AEU B;  3SVA A;  3LZA A;  3V92 A;  2RFR A;  3K0Z A;  1KWI A;  2L4V A;  1PYL A;  1DMM A;  1FUS A;  2OCT A;  1W7C A;  3AGO A;  3EB8 A;  1A90 A;  1CEW I;  5IW9 A;  1EEJ A;  3F9S A;  1ROA A;  1K41 A;  1WTH A;  3NXJ A;  3CPO A;  1Q81 4;  1TFK A;  2W9P A;  3EN1 B;  4JRF A;  3KCH A;  3KSP A;  1RGC A;  1UCK A;  3BNB A;  4HKV B;  1N8R 4;  1B2U A;  2RGQ A;  4RNY A;  3SLU A;  1Q42 A;  5EEO A;  4BU4 A;  1VQQ A;  1T2I A;  5CLK A;  3T0U A;  4I5Q A;  1NU3 A;  2GBX B;  3FG1 A;  3U1W A;  4BL2 A;  2MF7 A;  4WYK A;  1X1U A;  3ZFZ A;  2Y73 A;  3JVC A;  4LMI A;  1DE3 A;  1Q9E A;  1B27 A;  1GY7 A;  3DM8 A;  4HZ9 B;  2CFW A;  4MMX B;  5IG5 A;  2KF5 A;  2R41 A;  1BOX A;  1FUW A;  3NHX A;  1W2Z A;  2CWT A;  1T2H A;  1LQG C;  2CC3 A;  3HZP A;  2CFG A;  1JN5 B;  3A5E A;  3EBT A;  1HU9 A;  3O8Y A;  3OX9 A;  1Q40 A;  5AIG A;  5RNT A;  1A67 A;  1JN5 A;  1EUI C;  1W6G A;  2XFT A;  2H0G A;  3HK4 A;  3UL6 A;  4HM3 B;  1O7W B;  2A15 A;  1RNB A;  1W02 A;  1ZO2 A;  3FZW A;  4ILF A;  4XDV A;  2BMQ B;  1DYU A;  3CCU 3;  1BSA A;  3MHE A;  2L1S A;  1GSP A;  3CCJ 3;  5IEO A;  1SII A;  4RZM A;  2YFI B;  1LOX A;  2HMN B;  2YFL B;  5HOH A;  1UGI A;  2XRX B;  4U13 A;  4XBT A;  2LYX A;  1KD1 4;  3CME 3;  1MGW A;  1MNL A;  1YGE A;  3SYU A;  1W01 A;  2CWV A;  4PEJ A;  4IIA A;  1U5O A;  1I2F A;  3WR2 A;  1LOV A;  1DET A;  2SAR A;  2W03 A;  5ELU A;  1GMR A;  2KRT A;  1O7M B;  2WOH A;  4R4K A;  4LZI A;  3S28 A;  4ZM8 A;  1B3S A;  3G6E 3;  5AI1 A;  2BO9 B;  4K1V A;  1IU7 A;  1IT7 A;  2CH9 A;  1OF5 A;  3FGY A;  5AIH A;  1FGR A;  3LT8 A;  1L5G B;  3S27 A;  3T8N A;  7RNT A;  3KFQ C;  2BT3 A;  3LYG A;  8CHO A;  3Q1C A;  1RN1 A;  2GEX A;  3B7C A;  1PY3 A;  2AAD A;  2BU4 A;  2FGT A;  1G0T A;  2W2C A;  4N6N B;  1T5Y A;  2ZHX B;  1VQ5 3;  4J5G A;  2RCD A;  3NM2 A;  1R4Y A;  3DZL A;  2B24 B;  3EBY A;  1JKG A;  1TRP A;  2BIR A;  3BNE A;  4N6O B;  4HOH A;  2K0M A;  2UX0 A;  3F7S A;  3HIG A;  1BSD A;  1RRH A;  1GS3 A;  1OF5 B;  1OHO A;  4NHF A;  2MC8 A;  2YX9 A;  3F40 A;  1Y4K A;  1JZO A;  4L8P A;  3ER7 A;  3CCM 3;  1W2B 2;  3VF1 A;  1BVI A;  3JUN A;  1C54 A;  2M7O A;  3AHW A;  3MYT A;  3OWU A;  1M1K 4;  4X2H A;  1VQ8 3;  4EBG A;  1OHS A;  3MG2 A;  4FMA A;  2D1W A;  3Q90 A;  1LNH A;  1K28 A;  1IVW A;  3LH4 A;  3LT9 A;  4MMZ B;  3Q2P A;  3H51 A;  1IQ8 A;  3OWS A;  5JPU A;  3EX9 A;  2P0M A;  3H3H A;  1YIJ 3;  2H0I A;  1VQL 3;  1YNV X;  1OUN A;  4OVM A;  1GY6 A;  1I2G A;  3DH2 A;  4N6V 0;  3GZB A;  1QAF A;  3PCS A;  5JBS A;  3OW2 2;  3ZG5 A;  3CC7 3;  4L8O A;  4KFF A;  5LC6 A;  3TDG A;  1N9E A;  4CJN A;  1RTU A;  3EE1 A;  4O2H A;  5CF1 A;  3LTB A;  1BSE A;  1BSB A;  3CNX A;  3PZW A;  4OUQ A;  2CX0 A;  2OOV A;  3WOF B;  4N6U A;  5TGN A;  1O7N B;  1UCJ A;  3I0Y A;  4FMC A;  3X3X A;  3GAX A;  6GSP A;  2W9Q A;  3IJE B;  3U97 A;  1MWT A;  1DMN A;  1VQK 3;  1BIR A;  1BNE A;  1RGG A;  3PGB A;  4HM7 B;  4O3V A;  1RJO A;  1LVN A;  1TRQ A;  3PCR A;  1RN4 A;  3V99 A;  2XR8 B;  1Q86 4;  1ULI B;  2WOF A;  1UUG B;  1WMP A;  3GWR A;  1EKM A;  2ML6 A;  4HM6 B;  4BTX A;  5KP4 A;  1HYF A;  3EC9 A;  5AII A;  1YIT 3;  1I8V A;  1X1X A;  1K73 4;  1JNQ A;  1RN7 A;  3F14 A;  1W5Z A;  1IQX A;  1TP6 A;  1Z1S A;  2XFS A;  2CK3 H;  2RNT A;  4G1M B;  3RGR A;  1VQ9 3;  3MWZ A;  4CDL A;  1SQW A;  4KT3 B;  2JDI H;  1YVS A;  5IG0 A;  4IPB A;  4GB5 A;  1FGM A;  5IG4 A;  4IT7 A;  4K90 B;  1KC8 4;  2XGL A;  3QK9 A;  5I97 A;  2CFL A;  4GSP A;  1FGT A;  4XDW A;  2GBW B;  1E97 A;  1Q82 4;  1BNF A;  2CG1 A;  2KF3 A;  3DGY A;  3NV0 B;  2CIU A;  3DGO A;  1DVC A;  3LXU X;  1CH0 A;  1OPY A;  2OQE A;  1BNI A;  1IVV A;  1BGS A;  2OOV C;  4JF8 A;  1WMO A;  3X3Z A;  2Q07 A;  3WMD A;  1VQ7 3;  3PXM A;  2D42 A;  1IQY A;  1I3F A;  1JRQ A;  1Q7Y 4;  3KZT A;  1TU5 A;  1RRL A;  3CNM A;  2BHM A;  1OCV A;  3URP A;  2IUJ A;  1BRH A;  3STD A;  2IMJ A;  3VGN A;  2O9U X;  4RNZ A;  1TIJ A;  1RKY A;  5HGR A;  6RNT A;  3CCQ 3;  2C11 A;  3SOA A;  4WYK B;  1JBT A;  1UGH I;  5ELJ A;  4HYZ A;  2H0H A;  1QVF 2;  1S5A A;  1IV7 A;  2Z7A A;  4LYL B;  2CG0 A;  1GOV A;  3X40 A;  1MWS A;  4HM2 B;  2RSX A;  1UI8 A;  2QEX 3;  1FA3 A;  1GY5 A;  4BIR A;  2R4I A;  1Q40 B;  3LTD A;  1FYS A;  4AKY A;  1LQM B;  2CW9 A;  3PYJ A;  4KVH A; 
#chains in the Genus database with same CATH homology
 1KQS 2;  5BXQ A;  1IDP A;  2CFK A;  3CU3 A;  1K8A 4;  3B4O A;  4HJL B;  4KFD A;  5DRV A;  4L7K A;  4XB5 A;  3OXA A;  3LML A;  2PZV A;  4NRE A;  2XEP A;  2HMK B;  2W56 A;  4QWT A;  1AR0 A;  2CHC A;  4GL6 A;  2WGQ A;  4FCZ A;  5CF2 A;  3DMC A;  4XM4 A;  1FGQ A;  3G71 3;  1OGX A;  2E2T A;  1QMA A;  5D81 A;  2C10 A;  3UL5 A;  1M90 4;  1YVB I;  4KZ1 A;  2GEY A;  1R4C A;  3HX8 A;  3KSE D;  3V98 A;  3CPW 2;  3QRD A;  1D6U A;  4EV2 A;  1J2B A;  2Z76 A;  3G16 A;  1PU4 A;  3X3Y A;  2SBL A;  1FGO A;  5AEW B;  3CD6 3;  2P09 A;  2QA4 3;  2HML B;  3D3L A;  1ZX2 A;  1NWW A;  5BVB A;  3GZX B;  3FCS B;  1JKG B;  5G2G A;  1A2K A;  4OK0 A;  1ULJ B;  2W0Q A;  1MOL A;  1V74 A;  3BNC A;  3M8C A;  3FSD A;  5D82 A;  1STF I;  4LGQ A;  4N3V A;  4HM8 B;  2IUK A;  3CCS 3;  4R9K A;  2ML5 A;  1ISK A;  3CC2 3;  1E3R A;  2PNC A;  4BTY A;  2CKF B;  3E99 A;  2ZDJ A;  3LTA A;  1O7H B;  4HM5 B;  1JV2 B;  1DMQ A;  1HKX A;  3FF0 A;  1A2V A;  3KN4 A;  2I9W A;  1YHQ 3;  1LXE A;  1PFP A;  1UUW B;  4TX4 A;  3J7Y d;  3EQQ B;  2GU3 A;  3F8H A;  3K63 A;  3GZY B;  2Z77 A;  1WNH A;  3CC4 3;  1N9J A;  4N6L A;  3S67 A;  4I4K A;  4K61 A;  5STD A;  3S5C A;  1O7G B;  1IV9 A;  3ALA A;  4N6T A;  3D9R A;  4MJD A;  3LOY A;  3WOD G;  2E2U A;  1IT8 A;  3UJM A;  3CCR 3;  3FF2 A;  1D6Y A;  3MSO A;  3JUP A;  4N6M A;  3N54 B;  4EC6 A;  2OWP A;  1O7P B;  4KFE A;  5AYS C;  1TFO A;  1IK3 A;  3X41 A;  3GRD A;  4J8T A;  1S72 3;  3JUQ A;  1UI7 A;  3NQZ A;  4EYC A;  4K1U A;  4FCJ A;  3X42 A;  5KP1 A;  5IG3 A;  1NJI 4;  3FKA A;  5LC7 A;  7STD A;  1BUQ A;  1JB4 A;  1KSI A;  2GXF A;  3LTC A;  3NQY A;  4XBY A;  1M9G A;  3GZR A;  1NB3 I;  3NUV A;  2FNQ A;  4RBN A;  4HZB B;  2F86 B;  2E2V A;  3WOE B;  1ASK A;  2IA7 A;  1VQO 3;  1QAL A;  5CXO A;  1OAC A;  1U8C B;  3DUK A;  3BLZ A;  3EJV A;  3B4P A;  3FH1 A;  1W00 A;  3K9M C;  1QVG 2;  2CFD A;  3FG4 A;  2F99 A;  3CXC 2;  3CCV 3;  3EHC A;  3KII A;  5FGO A;  4HM0 B;  1JB5 A;  5IEP A;  4O02 B;  1SJW A;  1GD3 A;  3ECF A;  3MG3 A;  3VSY A;  1VQ6 3;  4R80 A;  3I55 3;  1D6Z A;  1OHP A;  3RDE A;  3UNL A;  3CMA 3;  1W6Y A;  3F8X A;  1N5P A;  2FXT A;  2OTL 3;  1M1X B;  1F8N A;  3IMA B;  2XH9 A;  2K54 A;  1JB2 A;  6STD A;  1STD A;  1ROV A;  3AMO A;  4O8S A;  5A0O B;  1VQM 3;  2V1L A;  3KKG A;  5EQL A;  2P0X A;  5IEN A;  1YI2 3;  3NBR A;  3ROB A;  3FLJ A;  3DXO A;  3CCL 3;  2INX A;  1JJ2 2;  5IF6 A;  5DRE A;  1EG9 B;  3EF8 A;  4Q53 A;  3BND A;  1C7H A;  3AMO B;  1GYB A;  4WFO A;  4H3U A;  2XF3 A;  1NB5 I;  2P38 A;  2KXG A;  4FCM A;  1G96 A;  4WWU C;  2CWU A;  3UB1 A;  3L0R A;  1AVK A;  2W56 B;  3I56 3;  4HM1 B;  3HI7 A;  2KCD A;  1EA2 A;  3DGN A;  2QIY A;  2WGO A;  3B8L A;  1W4N A;  3G0K A;  1WMN A;  1YJN 3;  4LEH A;  2BNG A;  1EQK A;  1E3V A;  1VQP 3;  3CCE 3;  2WO0 A;  2XSO B;  2BMO B;  3DGL A;  3G8Z A;  4R1K A;  4MEI A;  4HBR A;  1QJG A;  3JUM A;  3BB9 A;  3NM7 A;  3F7X A;  3WDG B;  3SX1 A;  1VZZ A;  2STD A;  4R9L A;  3SXX A;  5AIF A;  3DGM A;  5AYR B;  1AVL A;  3SED A;  2Z6B A;  2QGU A;  5JPP A;  4ORL A;  2JQ5 A;  4H61 A;  1CYV A;  1UW1 A;  2HMJ B;  3OV4 A;  2OTJ 3;  4WHA A;  1UUV B;  1AV4 A;  4CCV A;  1SIH A;  2W6J H;  3KE7 A;  4J9A A;  1QAK A;  2B1X B;  1SPU A;  3NBB A;  3S29 A;  3RGA A;  1N8Q A;  1DVD A;  1CQS A;  3OWY A;  3NBJ A;  1K9M 4;  2F98 A;  4MMY B;  3EN8 A;  2W04 A;  3JUO A;  4EXR A;  5CK6 A;  4EV5 A;  5D83 A;  1CYU A;  1N5H A;  2P05 A;  1VQ4 3;  3MPH A;  3G4S 3;  1TUH A;  2XSH B;  3A76 A;  1OGZ A;  3K7C A;  2HMO B;  2GU1 A;  1W6C A;  1YJW 3;  2ZL8 A;  4X2O A;  1WQL B;  1IVX A;  2LQV A;  3FG3 A;  3PS8 A;  2OQE C;  3DY5 A;  3NX0 A;  3N8B A;  4FMD A;  5FW5 A;  4STD A;  3MKI A;  3WA2 X;  1VQN 3;  2BMR B;  1NO3 A;  1GD4 A;  4BTW A;  1NDO B;  3MG1 A;  4AKZ A;  3K5T A;  4AEQ A;  4FR9 A;  4LSO A;  3SOY A;  5IER A;  1YJ9 3;  1US1 A;  2O3O A;  2Y74 A;  4FMB A;  2HMM B;  5KP3 A;  3HII A;  1IVU A;  4WP5 A;  3IPT A;  3NV0 A;  4HM4 B;  4XBX A;  3T8U A;  2YFJ B;  2XGN A;  4HVN A;  1OH0 A;  3WA3 A;  5AEU B;  3SVA A;  3LZA A;  3V92 A;  2RFR A;  3K0Z A;  1KWI A;  2L4V A;  2OCT A;  1DMM A;  3N9H A;  1W7C A;  1A90 A;  3EB8 A;  1CEW I;  5IW9 A;  3F9S A;  1ROA A;  1K41 A;  1WTH A;  3NXJ A;  3CPO A;  1Q81 4;  1TFK A;  2W9P A;  3EN1 B;  4JRF A;  3KSP A;  3BNB A;  4HKV B;  1N8R 4;  2RGQ A;  4RNY A;  3SLU A;  1Q42 A;  5EEO A;  3T0U A;  5CLK A;  1NU3 A;  2GBX B;  3FG1 A;  3U1W A;  2MF7 A;  4WYK A;  2Y73 A;  3JVC A;  4LMI A;  4MMX B;  1GY7 A;  3DM8 A;  4HZ9 B;  2CFW A;  5IG5 A;  1FUW A;  3NHX A;  1W2Z A;  2CWT A;  2CC3 A;  3HZP A;  2CFG A;  3O8Y A;  1A67 A;  3EBT A;  1HU9 A;  3OX9 A;  5AIG A;  1Q40 A;  1JN5 A;  3UL6 A;  1W6G A;  2XFT A;  3HK4 A;  4HM3 B;  1O7W B;  2A15 A;  1W02 A;  1ZO2 A;  3FZW A;  4XDV A;  2BMQ B;  1DYU A;  3CCU 3;  3MHE A;  3CCJ 3;  5IEO A;  1SII A;  4RZM A;  2YFI B;  1LOX A;  2HMN B;  2YFL B;  2XRX B;  4U13 A;  4XBT A;  2LYX A;  1KD1 4;  3CME 3;  1MNL A;  1YGE A;  1W01 A;  2CWV A;  4PEJ A;  4IIA A;  1U5O A;  2W03 A;  5ELU A;  2KRT A;  1O7M B;  2WOH A;  4R4K A;  4LZI A;  3S28 A;  4ZM8 A;  3G6E 3;  5AI1 A;  2BO9 B;  4K1V A;  1IU7 A;  1IT7 A;  2CH9 A;  1OF5 A;  3FGY A;  5AIH A;  1FGR A;  3LT8 A;  1L5G B;  3S27 A;  3T8N A;  3KFQ C;  2BT3 A;  3LYG A;  8CHO A;  3Q1C A;  5EVH A;  2GEX A;  3B7C A;  2FGT A;  2W2C A;  4N6N B;  2OQE A;  2IUJ A;  1VQ5 3;  1T5Y A;  2RCD A;  3NM2 A;  3DZL A;  2B24 B;  3EBY A;  1JKG A;  3BNE A;  4N6O B;  2K0M A;  2UX0 A;  3F7S A;  3HIG A;  1RRH A;  1GS3 A;  1OF5 B;  1OHO A;  4NHF A;  2MC8 A;  2YX9 A;  3F40 A;  1Y4K A;  3CCM 3;  4L8P A;  3ER7 A;  1W2B 2;  3VF1 A;  3JUN A;  2M7O A;  3MYT A;  3OWU A;  1VQ8 3;  1M1K 4;  4X2H A;  4EBG A;  1OHS A;  3MG2 A;  4FMA A;  2D1W A;  3Q90 A;  1LNH A;  1K28 A;  1IVW A;  3LH4 A;  3LT9 A;  4MMZ B;  3Q2P A;  3H51 A;  1IQ8 A;  3OWS A;  5JPU A;  3EX9 A;  2P0M A;  3H3H A;  1YIJ 3;  1VQL 3;  4OVM A;  1OUN A;  1GY6 A;  4N6V 0;  3GZB A;  1QAF A;  3PCS A;  5JBS A;  3OW2 2;  3CC7 3;  4L8O A;  4KFF A;  5LC6 A;  3TDG A;  1N9E A;  3EE1 A;  4O2H A;  5CF1 A;  3LTB A;  3CNX A;  3PZW A;  2OOV A;  4OUQ A;  3WOF B;  4N6U A;  5TGN A;  1O7N B;  3I0Y A;  4FMC A;  3X3X A;  3GAX A;  2W9Q A;  3IJE B;  3U97 A;  1DMN A;  1VQK 3;  3PGB A;  4HM7 B;  4O3V A;  1RJO A;  1LVN A;  3PCR A;  3V99 A;  2XR8 B;  1Q86 4;  1ULI B;  2WOF A;  1WMP A;  3GWR A;  1EKM A;  2ML6 A;  4HM6 B;  4BTX A;  5KP4 A;  3EC9 A;  5AII A;  1YIT 3;  1K73 4;  1JNQ A;  1RN7 A;  3F14 A;  1W5Z A;  1IQX A;  1TP6 A;  1Z1S A;  2XFS A;  2CK3 H;  4G1M B;  3RGR A;  1VQ9 3;  3MWZ A;  4CDL A;  1SQW A;  2JDI H;  5IG0 A;  4IPB A;  4GB5 A;  1FGM A;  5IG4 A;  4IT7 A;  4K90 B;  1KC8 4;  2XGL A;  3QK9 A;  5I97 A;  2CFL A;  1FGT A;  4XDW A;  2GBW B;  1E97 A;  1Q82 4;  2CG1 A;  3NV0 B;  2CIU A;  3DGO A;  1DVC A;  3LXU X;  1OPY A;  1IVV A;  2OOV C;  4JF8 A;  1WMO A;  3X3Z A;  2Q07 A;  3WMD A;  1VQ7 3;  3PXM A;  2D42 A;  1IQY A;  1JRQ A;  1Q7Y 4;  3KZT A;  1TU5 A;  1RRL A;  3CNM A;  2BHM A;  1OCV A;  3STD A;  2IMJ A;  3VGN A;  2O9U X;  4RNZ A;  1TIJ A;  1RKY A;  5HGR A;  3CCQ 3;  2C11 A;  3SOA A;  4WYK B;  5ELJ A;  4HYZ A;  1QVF 2;  1S5A A;  1IV7 A;  2Z7A A;  2CG0 A;  3X40 A;  2QEX 3;  4HM2 B;  2RSX A;  1UI8 A;  1FA3 A;  1GY5 A;  2R4I A;  1Q40 B;  3LTD A;  4AKY A;  1JN5 B;  2CW9 A;  3PYJ A;  4KVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...