2CIUA

Structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM21 MITOCHONDRIA
publication title The Tim21 Binding Domain Connects the Preprotein Translocases of Both Mitochondrial Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ciuA00
2MF7A 2CIUA
chains in the Genus database with same CATH superfamily
2KF6A 3U97A 5BU4A 3CCU3 1B2ZA 1D6UA 1W01A 2BHMA 2BMOB 1ZX2A 5AI1A 3QRDA 2STDA 3NBBA 1ULIB 1RRHA 1KC84 1WMNA 1TFKA 2SBLA 1B2XA 1IV7A 1LNHA 1O7GB 3CPOA 1RGHA 1SQWA 4MMYB 1VQ83 1IYYA 1GY7A 1AQZA 3LMLA 3BNEA 2ZL8A 3RGRA 4KT3B 1V57A 4CJNA 3K5TA 3T8NA 4HM8B 2BMQB 8RNTA 1W00A 2BU4A 1R4CA 3CMA3 1YJW3 1BNJA 1JRQA 2CC3A 5D81A 2W56B 2GBWB 2KXGA 3MG2A 2QGUA 1GOYA 4ZM8A 3DGNA 4FMCA 4XM4A 1Q824 5EQLA 2CW9A 2YFJB 3WDGB 1CYUA 4K90B 1C54A 3DXOA 2YFIB 1GY5A 1G96A 1T5YA 3LYGA 4HVNA 2E2UA 4IPBA 2XR8B 1I70A 1I2FA 3Q1CA 4HOHA 3FLJA 4N6UA 3SXXA 2A15A 1RKYA 1K8A4 2C10A 1N5PA 2CFGA 1UUVB 2C4BA 4XDWA 4XBYA 2H0GA 1DE3A 3AHWA 3CC73 1BAOA 3HX8A 4HM1B 1OHPA 1SPUA 4LYLB 5CLKA 3WMDA 1GMRA 3LTCA 4I4KA 1WQLB 1R4YA 4CDLA 1X1WA 2Z6BA 3X3XA 1KWIA 3IPTA 3ZFZA 3G8ZA 3EBYA 3OXAA 3CCV3 2KF4A 4FCJA 3AGNA 3A5EA 1HU9A 2XGLA 1S5AA 3EHCA 2CWUA 4MEIA 2J8XB 5M19A 3LTAA 3JUNA 3CPW2 2GU1A 1STFI 3KSPA 2XF3A 3F40A 3ER7A 4RNZA 1BRSA 1QAFA 1UGIA 2XGNA 1ZGXA 1JBSA 3EN8A 1TJDA 2CFLA 4JF8A 1UW1A 1BNFA 3D5IA 3J7Yd 3FG4A 3CCR3 3IJEB 1UI8A 3HZPA 1ISKA 1RGLA 3V92A 3N8BA 5IG0A 1W02A 4G1MB 1E3VA 6RNTA 3BB9A 4XDVA 3SEDA 2F86B 3F8HA 3WA2X 1Q9EA 4BTWA 4EXRA 5IEPA 2FGTA 1LQMB 3SLUA 4L7KA 1BRGA 2INXA 3STDA 2E2VA 3DGMA 1RTUA 1M9GA 2YX9A 4FCZA 1EEJA 4HAAA 2W2CA 4WHAA 5FW5A 1KQS2 4R1KA 1RN7A 4I5QA 6STDA 2HMKB 1QVF2 2W0QA 2CHCA 2O3OA 1IK3A 2CFDA 5GSPA 1MWUA 3KIIA 1AVLA 1J2BA 1CH0A 1AV4A 2GU3A 1TU5A 2HMOB 3NQZA 3GZRA 5KP1A 1KD14 1FUTA 2WOFA 4FR9A 3CCM3 3CC43 1BRHA 2B24B 1DMQA 1JJ22 3CNMA 3AGOA 4ORLA 3Q3FA 4RZMA 1A2VA 1W6CA 1FGQA 2BNGA 4MJDA 1N9JA 5LC6A 1QJGA 4AKZA 1EG9B 1U5OA 1IQ8A 1GSPA 4K61A 1OF5B 5CK6A 4EV2A 1FUWA 1RHLA 1UCLA 3HOHA 3NM2A 3FZWA 5STDA 4LMIA 3S29A 3EC9A 5M18A 1LVNA 4OK0A 1BRNL 4N6V0 1ROVA 3KN4A 3IMAB 2RFRA 4DKIA 1MWSA 3PZWA 1GYBA 2HMLB 3D4AA 2OWPA 3DZLA 4BIRA 1JN5B 5ELUA 1GY6A 1VQQA 7STDA 3GRDA 1QALA 2PZVA 2UGIA 3LOYA 1T2IA 2W56A 1BUQA 1W4NA 2RCDA 3M8CA 1EKMA 3AMOB 5AIFA 1RDSA 1V74A 3D9RA 3QK9A 1JBTA 1RSNA 2R4IA 3HK4A 2HOHA 5G1KA 3G16A 3WOEB 1UCKA 3H51A 1NO3A 4HYZA 3D3LA 1NB5I 3BU4A 5IG5A 3RNTA 2OOVC 3PGBA 4EBGA 1LOYA 5ELJA 3S28A 2L4VA 3E99A 4LSOA 1DVCA 2UX0A 2W6JH 4FMBA 3SYUA 3FF0A 1BSDA 1I2EA 1UUWB 5EVHA 1T3BA 1E3RA 1GS3A 1YHQ3 1RRLA 4AEQA 1YGWA 2JQ5A 5IERA 3SOAA 1FGMA 1TIJA 1WMPA 4RBNA 5CF2A 5M1AA 3Q2PA 1GOUA 3URPA 3F8XA 1RJOA 1RGEA 3DGOA 3MWZA 3LH4A 3O8YA 4HZBB 4NREA 2H0IA 1BOXA 3WOFB 3B8LA 3FGYA 2BIRA 1GD3A 3FG3A 3JUOA 3CCQ3 1EQKA 4HZ9B 1OCVA 1IVXA 1FGRA 3BIRA 1RN4A 2CFWA 2CX0A 2XEPA 1LXEA 1FA3A 5IG3A 3LTDA 3UL6A 2RGQA 2ZA4A 5HGRA 3G4S3 3JUMA 1QMAA 1VZZA 3FF2A 3PYJA 3BNCA 3ROBA 5A0OB 1JKGB 2GBXB 3KE7A 2CKFB 2WO0A 2RNTA 1OH0A 3BLZA 3NBJA 1C7HA 1RGFA 2IA7A 2Z76A 1I8VA 3JVCA 3T0UA 5HOHA 2MF7A 4LEHA 3EBTA 3WODG 4J5KA 2XRXB 1YGEA 5AYRB 1GOVA 3LT8A 1VQK3 2UUGC 4K1UA 3PCRA 2KF5A 2BO9B 4J8TA 2D1WA 2CFKA 4H61A 3FKAA 1N8QA 4N6MA 2HMNB 4PEJA 1K28A 4GHOA 1NWWA 1TP6A 4N6NB 5JPUA 1HZ1A 4HBRA 3NXJA 1SIIA 2W03A 5IW9A 6GSPA 1BVIA 2W9PA 2H0HA 2KRTA 4OVMA 3I563 2P05A 3UNLA 2AADA 1M1XB 2SARA 2IUJA 1SARA 1HYFA 3KKGA 1QAKA 5JBSA 2L1SA 2Z77A 1MNLA 3PCSA 2PNCA 3OV4A 3PXMA 2IUKA 3X3YA 2ZHXB 3GZXB 1I3IA 2QIYA 1N5HA 1OF5A 4O8SA 3UL5A 1RNBA 2ML5A 1I3FA 2GSPA 4K1VA 1FW7A 2O9UX 1UI7A 1BRJA 1DYUA 4TX4A 3NBRA 1W2ZA 4IIAA 2XFTA 4WWUC 3UB1A 4HM3B 1YVBI 1JB2A 1D6ZA 3GWRA 4L8OA 4R4KA 3DH2A 1T2HA 1OGXA 3FCSB 3Q90A 3X40A 1BSCA 1RGAA 1Z1SA 4HJLB 4CPKA 1BIRA 4H3UA 1NB3I 3FSDA 2F99A 5RNTA 1JB4A 3OWYA 2KCDA 1G0TA 4NHFA 4NPBA 1UCJA 1DETA 1AR0A 2ZDJA 3BNBA 2OQEA 1TFOA 1VQ73 4ILFA 3K63A 1UGHI 2OQEC 1B3SA 1TTOA 4LZIA 3CC23 3X42A 1W7CA 3DY5A 4JRFA 3TDGA 1BRKA 1FZUA 3L0RA 3GSPA 3ECFA 5AIGA 3WHOA 3DGLA 1W2B2 2WOHA 3B7CA 4STDA 1BUJA 3I553 4HM0B 1UDII 2Q07A 3F9SA 1DMNA 2FNQA 3FH1A 1BRIA 1IVWA 1K41A 1MWRA 4HM6B 3WR2A 1IT8A 3GAXA 4BL3A 2P09A 1B2MA 3MSOA 2CWTA 2JDIH 3NHXA 3V98A 1RMSA 1RN1A 7GSPA 3BNDA 2IY2A 1W6YA 2LQVA 1NU3A 2CX1A 4KVHA 4EC6A 5DRVA 1Q42A 2XSHB 3G6E3 3NQYA 1EA2A 3CU3A 1A2PA 1E97A 2V1LA 4FMAA 3JUPA 4CCVA 3HIIA 2F4YA 3CME3 1ZO2A 3NM7A 1W5ZA 1LOVA 2MC8A 4GSPA 1DMMA 1TUHA 3NV0B 3OX9A 1IT7A 5LC7A 4FCMA 2OOVA 3CCS3 1WTHA 4EYCA 5AIHA 5AEWB 1K734 1JKGA 1Q7HA 4O2HA 2K3DA 1Q864 1LNIA 3KFQC 4WP5A 1RGCA 3S5CA 1IVUA 4N6TA 1U8CB 4BTYA 2IMJA 2M7OA 1A2KA 4X2OA 1OGZA 1I2GA 2WGOA 3EF8A 1O7WB 3ALAA 1MWTA 3H3HA 3LT9A 4RNYA 4U13A 4XB5A 5IEOA 1B2UA 1VQ53 3MG3A 2F5WA 1BNGA 1NNVA 1AY7A 1PY3A 3WA3A 9RNTA 3KSED 4O02B 1I0XA 3D79A 4HM2B 3VF1A 5FGOA 1G02A 4KZ1A 2F56A 4N3VA 3ZG0A 3LTBA 1B20A 5IG4A 1IVVA 2YFLB 2CK3H 1TRQA 1QVG2 3N9HA 4O3VA 1VQ43 3MHEA 3SVAA 1B21A 4XBTA 1VQ93 1YNVX 1V58A 1VQN3 1ULJB 1MGWA 3B4PA 1TRPA 4R9KA 2AAEA 3DGYA 1PU4A 1IQYA 1OHSA 4WYKB 4BL2A 2W04A 1YIJ3 1X1YA 1Q814 1BNRA 1I0VA 1Q40B 2KF3A 4HM5B 2QA43 1RNTA 1HKXA 3MG1A 3EJVA 3CCE3 4J9AA 5TGNA 3N54B 1LOWA 1BU4A 2R41A 2I9WA 1RCLA 3EE1A 3U1WA 4IT7A 4QWTA 1GMPA 1OPYA 5I97A 2F5MA 3PS8A 4HM4B 2BT3A 3CNXA 1YIT3 2C11A 3AHSA 1VQL3 2P0XA 1FYSA 1CYVA 3F7SA 1W6GA 4R9LA 1BSEA 4HKVB 2OTJ3 3GZBA 4R80A 2OCTA 1B2SA 1BNSA 2E2TA 4GB5A 4BU4A 3S27A 1GMQA 5D82A 1O7PB 3VSYA 1NJI4 1MOLA 1NDOB 3LXUX 3KCHA 1VQ63 1D6YA 1DVDA 3UJMA 1N8R4 5KP4A 3CXC2 1JB5A 3K0ZA 1FGOA 3D5GA 1ASKA 3EB8A 3S67A 5CF1A 2RBIA 1ROAA 2W9QA 3VGNA 2B1XB 1KSIA 5EEOA 5BXQA 3EQQB 2CG0A 3X41A 1A90A 5G1LA 4WFOA 2XH9A 3G0KA 4XBXA 3RGAA 1JBRA 1ZS7A 1M904 1YI23 4MMZB 1L5GB 5IENA 1JN5A 1IDPA 5IF6A 3V99A 3DUKA 1CEWI 1BNIA 5JPPA 1VQO3 1A67A 2Z7AA 3GZYB 5KP3A 3ZG5A 4OUQA 1LOXA 2LYXA 1F8NA 5AYSC 1MGRA 2HMMB 1OUNA 3HIGA 3I0YA 1SIHA 4KFDA 4KFEA 3SOYA 1JZOA 1VQM3 3AMOA 3T8UA 1Y4KA 2HMJB 4Q53A 3SX1A 1WMOA 4RNTA 2K54A 1X1XA 1UCIA 5CXOA 3NV0A 3EX9A 3MYTA 4BTXA 4LGQA 3CCL3 1Q7Y4 3DMCA 1O7MB 4AKYA 1OACA 1BNEA 1AVKA 3CCJ3 1BSAA 1GD4A 1RCKA 1OHOA 1YVSA 2BMRB 3F14A 1BGSA 1O7HB 3NUVA 3F7XA 1IV9A 3K9MC 5AIIA 1EUIC 1SJWA 2QEX3 1IU7A 2F98A 2KAAA 4X2HA 1B27A 3RDEA 1STDA 4EV5A 4KFFA 5D83A 2CH9A 3B4OA 1YJ93 1UUGB 1RLSA 2RSXA 1PFPA 1RGKA 1CQSA 5DREA 3OW22 2CIUA 5AEUB 1PYLA 1IQXA 3A76A 2GEXA 1X1UA 1US1A 3DM8A 1JNQA 2XSOB 1BANA 2P0MA 1M1K4 4EW5A 1LRAA 3OWSA 1LQGC 2Y73A 1N9EA 2XFSA 3KZTA 3MKIA 1K9M4 1RGGA 2D42A 7RNTA 1YJN3 1S723 5G2GA 4N6OB 4N6LA 1JZDA 2Y74A 1VQP3 3MPHA 5BVBA 3EN1B 3LZAA 2CG1A 1WNHA 2K0MA 1FUSA 2IYJA 3OWUA 3K7CA 4GL6A 4WYKA 1FGTA 4J5GA 2FXTA 1JV2B 2GEYA 3X3ZA 3JUQA 1Q40A 3CD63 4FMDA 3G713 2GXFA 4L8PA 2P38A 1O7NB 4HM7B 1BSBA 2OTL3 2CWVA 3HI7A 5BIRA 2ML6A 8CHOA 3FG1A 4MMXB 3NX0A 2WGQA
chains in the Genus database with same CATH topology
3U97A 3CCU3 1D6UA 1W01A 2BHMA 2BMOB 1ZX2A 5AI1A 3QRDA 2STDA 3NBBA 1ULIB 1RRHA 1KC84 1WMNA 1TFKA 2SBLA 1IV7A 1LNHA 3CPOA 1O7GB 1SQWA 4MMYB 1VQ83 1GY7A 3LMLA 3BNEA 2ZL8A 3RGRA 3K5TA 3T8NA 4HM8B 2BMQB 1W00A 1R4CA 3CMA3 1YJW3 1JRQA 2CC3A 5D81A 2W56B 2GBWB 2KXGA 3MG2A 2QGUA 4ZM8A 3DGNA 4FMCA 4XM4A 1Q824 5EQLA 2CW9A 2YFJB 3WDGB 1CYUA 4K90B 3DXOA 2YFIB 1GY5A 1G96A 1T5YA 3LYGA 4HVNA 2E2UA 4IPBA 2XR8B 3Q1CA 3SXXA 3FLJA 4N6UA 2A15A 1RKYA 1K8A4 2C10A 1N5PA 2CFGA 1UUVB 4XDWA 4XBYA 3CC73 3HX8A 4HM1B 1OHPA 1SPUA 5CLKA 3WMDA 3LTCA 4I4KA 1WQLB 4CDLA 2Z6BA 3X3XA 1KWIA 3IPTA 3G8ZA 3EBYA 3OXAA 3CCV3 4FCJA 1HU9A 2XGLA 1S5AA 3EHCA 2CWUA 4MEIA 3LTAA 3JUNA 3CPW2 2GU1A 1STFI 3KSPA 2XF3A 3F40A 3ER7A 4RNZA 1QAFA 2XGNA 3EN8A 4JF8A 2CFLA 1UW1A 3J7Yd 3FG4A 3CCR3 3IJEB 1UI8A 3HZPA 1ISKA 3V92A 3N8BA 5IG0A 1W02A 4G1MB 1E3VA 3BB9A 4XDVA 3SEDA 2F86B 3F8HA 3WA2X 4BTWA 4EXRA 5IEPA 2FGTA 3SLUA 4L7KA 2INXA 3STDA 2E2VA 3DGMA 1KQS2 1M9GA 2YX9A 4FCZA 4WHAA 2W2CA 5FW5A 4R1KA 1RN7A 6STDA 2HMKB 1QVF2 2W0QA 2CHCA 2O3OA 1IK3A 2CFDA 1J2BA 3KIIA 1AVLA 1TU5A 1AV4A 2GU3A 2HMOB 3NQZA 3GZRA 5KP1A 1KD14 2WOFA 4FR9A 3CCM3 3CC43 2B24B 1DMQA 1JJ22 3CNMA 4ORLA 4RZMA 1A2VA 1W6CA 1FGQA 2BNGA 4MJDA 1N9JA 5LC6A 1QJGA 4AKZA 1EG9B 1U5OA 1IQ8A 4K61A 5CK6A 1OF5B 4EV2A 1FUWA 3NM2A 3FZWA 5STDA 4LMIA 3S29A 3EC9A 1LVNA 4OK0A 4N6V0 1ROVA 3KN4A 3IMAB 2RFRA 3PZWA 1GYBA 2HMLB 2OWPA 3DZLA 1JN5B 5ELUA 1GY6A 7STDA 3GRDA 1QALA 2PZVA 3LOYA 2W56A 1BUQA 1W4NA 2RCDA 3M8CA 1EKMA 3AMOB 5AIFA 1V74A 3D9RA 3QK9A 2R4IA 3HK4A 3G16A 3WOEB 3H51A 1NO3A 4HYZA 3D3LA 1NB5I 5IG5A 2OOVC 3PGBA 4EBGA 5ELJA 3S28A 2L4VA 3E99A 4LSOA 1DVCA 2UX0A 2W6JH 4FMBA 3FF0A 1UUWB 5EVHA 1E3RA 1GS3A 1YHQ3 1RRLA 4AEQA 2JQ5A 5IERA 3SOAA 1FGMA 1TIJA 1WMPA 4RBNA 5CF2A 3Q2PA 3F8XA 1RJOA 3MWZA 3DGOA 3LH4A 3O8YA 4HZBB 4NREA 3WOFB 3B8LA 3FGYA 3FG3A 1GD3A 3JUOA 3CCQ3 1EQKA 4HZ9B 1OCVA 1IVXA 1FGRA 2CFWA 2XEPA 1LXEA 1FA3A 5IG3A 3LTDA 3UL6A 2RGQA 5HGRA 3G4S3 3JUMA 1QMAA 1VZZA 3FF2A 3PYJA 3BNCA 3ROBA 5A0OB 1JKGB 2GBXB 3KE7A 2CKFB 2WO0A 1OH0A 3BLZA 3NBJA 1C7HA 2IA7A 2Z76A 3JVCA 3T0UA 2MF7A 4LEHA 3EBTA 3WODG 2XRXB 1YGEA 5AYRB 3LT8A 1VQK3 4K1UA 3PCRA 2BO9B 4J8TA 2D1WA 2CFKA 4H61A 3FKAA 1N8QA 4N6MA 2HMNB 4PEJA 1K28A 1NWWA 1TP6A 4N6NB 5JPUA 4HBRA 3NXJA 1SIIA 2W03A 5IW9A 3I563 2W9PA 2KRTA 4OVMA 2P05A 3UNLA 1M1XB 2IUJA 3KKGA 1QAKA 5JBSA 2Z77A 1MNLA 3PCSA 2PNCA 3OV4A 3PXMA 2IUKA 3X3YA 3GZXB 2QIYA 4O8SA 1N5HA 1OF5A 3UL5A 2ML5A 4K1VA 2O9UX 1UI7A 1DYUA 4TX4A 3NBRA 1W2ZA 4IIAA 2XFTA 4WWUC 3UB1A 4HM3B 1YVBI 1JB2A 1D6ZA 3GWRA 4L8OA 4R4KA 3FCSB 1OGXA 3Q90A 3X40A 1Z1SA 4HJLB 4H3UA 1NB3I 3FSDA 2F99A 1JB4A 3OWYA 2KCDA 4NHFA 1AR0A 2ZDJA 3BNBA 2OQEA 1TFOA 3K63A 2OQEC 3CC23 4LZIA 3X42A 1W7CA 3DY5A 4JRFA 3TDGA 3L0RA 5AIGA 3ECFA 3DGLA 1W2B2 2WOHA 3B7CA 4STDA 3I553 4HM0B 2Q07A 3F9SA 1DMNA 2FNQA 3FH1A 1IVWA 1K41A 4HM6B 1IT8A 3GAXA 2P09A 3MSOA 2CWTA 2JDIH 3NHXA 3V98A 3BNDA 1W6YA 2LQVA 1NU3A 4KVHA 4EC6A 5DRVA 1Q42A 2XSHB 3G6E3 3NQYA 1EA2A 3CU3A 1E97A 2V1LA 4FMAA 3JUPA 4CCVA 3HIIA 3CME3 1ZO2A 3NM7A 1W5ZA 2MC8A 1DMMA 1TUHA 3NV0B 3OX9A 1IT7A 5LC7A 4FCMA 2OOVA 3CCS3 1WTHA 4EYCA 5AIHA 5AEWB 1K734 1JKGA 4O2HA 1Q864 3KFQC 4WP5A 3S5CA 1IVUA 4N6TA 1U8CB 4BTYA 2IMJA 2M7OA 1A2KA 4X2OA 1OGZA 2WGOA 3EF8A 1O7WB 3ALAA 3H3HA 3LT9A 4RNYA 4U13A 4XB5A 5IEOA 1VQ53 3MG3A 3WA3A 3KSED 4O02B 4HM2B 3VF1A 5FGOA 4KZ1A 4N3VA 3LTBA 5IG4A 1IVVA 2YFLB 2CK3H 1QVG2 3N9HA 4O3VA 1VQ43 3MHEA 3SVAA 4XBTA 1VQ93 1VQN3 1ULJB 3B4PA 4R9KA 1PU4A 1IQYA 1OHSA 4WYKB 2W04A 1YIJ3 1Q814 1Q40B 4HM5B 2QA43 1HKXA 3MG1A 3EJVA 3CCE3 4J9AA 5TGNA 3N54B 2I9WA 3EE1A 3U1WA 4IT7A 4QWTA 5I97A 1OPYA 3PS8A 4HM4B 2BT3A 3CNXA 1YIT3 2C11A 1VQL3 2P0XA 1CYVA 3F7SA 1W6GA 4R9LA 4HKVB 2OTJ3 3GZBA 4R80A 2OCTA 2E2TA 4GB5A 3S27A 5D82A 3VSYA 1O7PB 1NJI4 1MOLA 1NDOB 3LXUX 1VQ63 1D6YA 1DVDA 3UJMA 1N8R4 5KP4A 3CXC2 1JB5A 3K0ZA 1FGOA 1ASKA 3EB8A 3S67A 5CF1A 1ROAA 2W9QA 3VGNA 2B1XB 1KSIA 5EEOA 5BXQA 3EQQB 2CG0A 3X41A 1A90A 4WFOA 2XH9A 3G0KA 4XBXA 3RGAA 1M904 1YI23 4MMZB 1L5GB 5IENA 1JN5A 1IDPA 5IF6A 3V99A 3DUKA 1CEWI 5JPPA 1VQO3 1A67A 2Z7AA 3GZYB 5KP3A 4OUQA 1LOXA 2LYXA 1F8NA 5AYSC 3SOYA 2HMMB 1OUNA 3HIGA 3I0YA 1SIHA 4KFDA 4KFEA 1VQ73 1VQM3 3AMOA 3T8UA 1Y4KA 2HMJB 4Q53A 3SX1A 1WMOA 2K54A 5CXOA 3NV0A 3EX9A 3MYTA 4BTXA 4LGQA 3CCL3 1Q7Y4 3DMCA 1O7MB 4AKYA 1OACA 1AVKA 3CCJ3 1GD4A 1OHOA 2BMRB 3F14A 3NUVA 1O7HB 3F7XA 1IV9A 3K9MC 5AIIA 1SJWA 2QEX3 1IU7A 2F98A 4X2HA 3RDEA 1STDA 4EV5A 4KFFA 5D83A 2CH9A 3B4OA 1YJ93 2RSXA 1PFPA 1CQSA 5DREA 3OW22 2CIUA 5AEUB 1IQXA 3A76A 2GEXA 1US1A 3DM8A 1JNQA 2XSOB 1M1K4 2P0MA 3OWSA 2Y73A 1N9EA 2XFSA 3KZTA 3MKIA 1K9M4 2D42A 1YJN3 1S723 5G2GA 4N6OB 4N6LA 2Y74A 1VQP3 3MPHA 5BVBA 3EN1B 3LZAA 2CG1A 1WNHA 2K0MA 3OWUA 3K7CA 4GL6A 4WYKA 1FGTA 3X3ZA 2FXTA 1JV2B 2GEYA 3JUQA 1Q40A 3CD63 4FMDA 3G713 2GXFA 4L8PA 2P38A 1O7NB 4HM7B 2OTL3 2CWVA 3HI7A 8CHOA 2ML6A 3FG1A 4MMXB 3NX0A 2WGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF7 A;  2CIU A; 
#chains in the Genus database with same CATH topology
 2KF6 A;  3U97 A;  5BU4 A;  3CCU 3;  1B2Z A;  1D6U A;  1W01 A;  2BHM A;  2BMO B;  1ZX2 A;  5AI1 A;  3QRD A;  2STD A;  3NBB A;  1ULI B;  1RRH A;  1KC8 4;  1WMN A;  1TFK A;  2SBL A;  1B2X A;  1IV7 A;  1LNH A;  1O7G B;  3CPO A;  1RGH A;  1SQW A;  4MMY B;  1VQ8 3;  1IYY A;  1GY7 A;  1AQZ A;  3LML A;  3BNE A;  2ZL8 A;  3RGR A;  4KT3 B;  1V57 A;  4CJN A;  3K5T A;  3T8N A;  4HM8 B;  2BMQ B;  8RNT A;  1W00 A;  2BU4 A;  1R4C A;  3CMA 3;  1YJW 3;  1BNJ A;  1JRQ A;  2CC3 A;  5D81 A;  2W56 B;  2GBW B;  2KXG A;  3MG2 A;  2QGU A;  1GOY A;  4ZM8 A;  3DGN A;  4FMC A;  4XM4 A;  1Q82 4;  5EQL A;  2CW9 A;  2YFJ B;  3WDG B;  1CYU A;  4K90 B;  1C54 A;  3DXO A;  2YFI B;  1GY5 A;  1G96 A;  1T5Y A;  3LYG A;  4HVN A;  2E2U A;  4IPB A;  2XR8 B;  1I70 A;  1I2F A;  3Q1C A;  4HOH A;  3FLJ A;  4N6U A;  3SXX A;  2A15 A;  1RKY A;  1K8A 4;  2C10 A;  1N5P A;  2CFG A;  1UUV B;  2C4B A;  4XDW A;  4XBY A;  2H0G A;  1DE3 A;  3AHW A;  3CC7 3;  1BAO A;  3HX8 A;  4HM1 B;  1OHP A;  1SPU A;  4LYL B;  5CLK A;  3WMD A;  1GMR A;  3LTC A;  4I4K A;  1WQL B;  1R4Y A;  4CDL A;  1X1W A;  2Z6B A;  3X3X A;  1KWI A;  3IPT A;  3ZFZ A;  3G8Z A;  3EBY A;  3OXA A;  3CCV 3;  2KF4 A;  4FCJ A;  3AGN A;  3A5E A;  1HU9 A;  2XGL A;  1S5A A;  3EHC A;  2CWU A;  4MEI A;  2J8X B;  5M19 A;  3LTA A;  3JUN A;  3CPW 2;  2GU1 A;  1STF I;  3KSP A;  2XF3 A;  3F40 A;  3ER7 A;  4RNZ A;  1BRS A;  1QAF A;  1UGI A;  2XGN A;  1ZGX A;  1JBS A;  3EN8 A;  1TJD A;  2CFL A;  4JF8 A;  1UW1 A;  1BNF A;  3D5I A;  3J7Y d;  3FG4 A;  3CCR 3;  3IJE B;  1UI8 A;  3HZP A;  1ISK A;  1RGL A;  3V92 A;  3N8B A;  5IG0 A;  1W02 A;  4G1M B;  1E3V A;  6RNT A;  3BB9 A;  4XDV A;  3SED A;  2F86 B;  3F8H A;  3WA2 X;  1Q9E A;  4BTW A;  4EXR A;  5IEP A;  2FGT A;  1LQM B;  3SLU A;  4L7K A;  1BRG A;  2INX A;  3STD A;  2E2V A;  3DGM A;  1RTU A;  1M9G A;  2YX9 A;  4FCZ A;  1EEJ A;  4HAA A;  2W2C A;  4WHA A;  5FW5 A;  1KQS 2;  4R1K A;  1RN7 A;  4I5Q A;  6STD A;  2HMK B;  1QVF 2;  2W0Q A;  2CHC A;  2O3O A;  1IK3 A;  2CFD A;  5GSP A;  1MWU A;  3KII A;  1AVL A;  1J2B A;  1CH0 A;  1AV4 A;  2GU3 A;  1TU5 A;  2HMO B;  3NQZ A;  3GZR A;  5KP1 A;  1KD1 4;  1FUT A;  2WOF A;  4FR9 A;  3CCM 3;  3CC4 3;  1BRH A;  2B24 B;  1DMQ A;  1JJ2 2;  3CNM A;  3AGO A;  4ORL A;  3Q3F A;  4RZM A;  1A2V A;  1W6C A;  1FGQ A;  2BNG A;  4MJD A;  1N9J A;  5LC6 A;  1QJG A;  4AKZ A;  1EG9 B;  1U5O A;  1IQ8 A;  1GSP A;  4K61 A;  1OF5 B;  5CK6 A;  4EV2 A;  1FUW A;  1RHL A;  1UCL A;  3HOH A;  3NM2 A;  3FZW A;  5STD A;  4LMI A;  3S29 A;  3EC9 A;  5M18 A;  1LVN A;  4OK0 A;  1BRN L;  4N6V 0;  1ROV A;  3KN4 A;  3IMA B;  2RFR A;  4DKI A;  1MWS A;  3PZW A;  1GYB A;  2HML B;  3D4A A;  2OWP A;  3DZL A;  4BIR A;  1JN5 B;  5ELU A;  1GY6 A;  1VQQ A;  7STD A;  3GRD A;  1QAL A;  2PZV A;  2UGI A;  3LOY A;  1T2I A;  2W56 A;  1BUQ A;  1W4N A;  2RCD A;  3M8C A;  1EKM A;  3AMO B;  5AIF A;  1RDS A;  1V74 A;  3D9R A;  3QK9 A;  1JBT A;  1RSN A;  2R4I A;  3HK4 A;  2HOH A;  5G1K A;  3G16 A;  3WOE B;  1UCK A;  3H51 A;  1NO3 A;  4HYZ A;  3D3L A;  1NB5 I;  3BU4 A;  5IG5 A;  3RNT A;  2OOV C;  3PGB A;  4EBG A;  1LOY A;  5ELJ A;  3S28 A;  2L4V A;  3E99 A;  4LSO A;  1DVC A;  2UX0 A;  2W6J H;  4FMB A;  3SYU A;  3FF0 A;  1BSD A;  1I2E A;  1UUW B;  5EVH A;  1T3B A;  1E3R A;  1GS3 A;  1YHQ 3;  1RRL A;  4AEQ A;  1YGW A;  2JQ5 A;  5IER A;  3SOA A;  1FGM A;  1TIJ A;  1WMP A;  4RBN A;  5CF2 A;  5M1A A;  3Q2P A;  1GOU A;  3URP A;  3F8X A;  1RJO A;  1RGE A;  3DGO A;  3MWZ A;  3LH4 A;  3O8Y A;  4HZB B;  4NRE A;  2H0I A;  1BOX A;  3WOF B;  3B8L A;  3FGY A;  2BIR A;  1GD3 A;  3FG3 A;  3JUO A;  3CCQ 3;  1EQK A;  4HZ9 B;  1OCV A;  1IVX A;  1FGR A;  3BIR A;  1RN4 A;  2CFW A;  2CX0 A;  2XEP A;  1LXE A;  1FA3 A;  5IG3 A;  3LTD A;  3UL6 A;  2RGQ A;  2ZA4 A;  5HGR A;  3G4S 3;  3JUM A;  1QMA A;  1VZZ A;  3FF2 A;  3PYJ A;  3BNC A;  3ROB A;  5A0O B;  1JKG B;  2GBX B;  3KE7 A;  2CKF B;  2WO0 A;  2RNT A;  1OH0 A;  3BLZ A;  3NBJ A;  1C7H A;  1RGF A;  2IA7 A;  2Z76 A;  1I8V A;  3JVC A;  3T0U A;  5HOH A;  2MF7 A;  4LEH A;  3EBT A;  3WOD G;  4J5K A;  2XRX B;  1YGE A;  5AYR B;  1GOV A;  3LT8 A;  1VQK 3;  2UUG C;  4K1U A;  3PCR A;  2KF5 A;  2BO9 B;  4J8T A;  2D1W A;  2CFK A;  4H61 A;  3FKA A;  1N8Q A;  4N6M A;  2HMN B;  4PEJ A;  1K28 A;  4GHO A;  1NWW A;  1TP6 A;  4N6N B;  5JPU A;  1HZ1 A;  4HBR A;  3NXJ A;  1SII A;  2W03 A;  5IW9 A;  6GSP A;  1BVI A;  2W9P A;  2H0H A;  2KRT A;  4OVM A;  3I56 3;  2P05 A;  3UNL A;  2AAD A;  1M1X B;  2SAR A;  2IUJ A;  1SAR A;  1HYF A;  3KKG A;  1QAK A;  5JBS A;  2L1S A;  2Z77 A;  1MNL A;  3PCS A;  2PNC A;  3OV4 A;  3PXM A;  2IUK A;  3X3Y A;  2ZHX B;  3GZX B;  1I3I A;  2QIY A;  1N5H A;  1OF5 A;  4O8S A;  3UL5 A;  1RNB A;  2ML5 A;  1I3F A;  2GSP A;  4K1V A;  1FW7 A;  2O9U X;  1UI7 A;  1BRJ A;  1DYU A;  4TX4 A;  3NBR A;  1W2Z A;  4IIA A;  2XFT A;  4WWU C;  3UB1 A;  4HM3 B;  1YVB I;  1JB2 A;  1D6Z A;  3GWR A;  4L8O A;  4R4K A;  3DH2 A;  1T2H A;  1OGX A;  3FCS B;  3Q90 A;  3X40 A;  1BSC A;  1RGA A;  1Z1S A;  4HJL B;  4CPK A;  1BIR A;  4H3U A;  1NB3 I;  3FSD A;  2F99 A;  5RNT A;  1JB4 A;  3OWY A;  2KCD A;  1G0T A;  4NHF A;  4NPB A;  1UCJ A;  1DET A;  1AR0 A;  2ZDJ A;  3BNB A;  2OQE A;  1TFO A;  1VQ7 3;  4ILF A;  3K63 A;  1UGH I;  2OQE C;  1B3S A;  1TTO A;  4LZI A;  3CC2 3;  3X42 A;  1W7C A;  3DY5 A;  4JRF A;  3TDG A;  1BRK A;  1FZU A;  3L0R A;  3GSP A;  3ECF A;  5AIG A;  3WHO A;  3DGL A;  1W2B 2;  2WOH A;  3B7C A;  4STD A;  1BUJ A;  3I55 3;  4HM0 B;  1UDI I;  2Q07 A;  3F9S A;  1DMN A;  2FNQ A;  3FH1 A;  1BRI A;  1IVW A;  1K41 A;  1MWR A;  4HM6 B;  3WR2 A;  1IT8 A;  3GAX A;  4BL3 A;  2P09 A;  1B2M A;  3MSO A;  2CWT A;  2JDI H;  3NHX A;  3V98 A;  1RMS A;  1RN1 A;  7GSP A;  3BND A;  2IY2 A;  1W6Y A;  2LQV A;  1NU3 A;  2CX1 A;  4KVH A;  4EC6 A;  5DRV A;  1Q42 A;  2XSH B;  3G6E 3;  3NQY A;  1EA2 A;  3CU3 A;  1A2P A;  1E97 A;  2V1L A;  4FMA A;  3JUP A;  4CCV A;  3HII A;  2F4Y A;  3CME 3;  1ZO2 A;  3NM7 A;  1W5Z A;  1LOV A;  2MC8 A;  4GSP A;  1DMM A;  1TUH A;  3NV0 B;  3OX9 A;  1IT7 A;  5LC7 A;  4FCM A;  2OOV A;  3CCS 3;  1WTH A;  4EYC A;  5AIH A;  5AEW B;  1K73 4;  1JKG A;  1Q7H A;  4O2H A;  2K3D A;  1Q86 4;  1LNI A;  3KFQ C;  4WP5 A;  1RGC A;  3S5C A;  1IVU A;  4N6T A;  1U8C B;  4BTY A;  2IMJ A;  2M7O A;  1A2K A;  4X2O A;  1OGZ A;  1I2G A;  2WGO A;  3EF8 A;  1O7W B;  3ALA A;  1MWT A;  3H3H A;  3LT9 A;  4RNY A;  4U13 A;  4XB5 A;  5IEO A;  1B2U A;  1VQ5 3;  3MG3 A;  2F5W A;  1BNG A;  1NNV A;  1AY7 A;  1PY3 A;  3WA3 A;  9RNT A;  3KSE D;  4O02 B;  1I0X A;  3D79 A;  4HM2 B;  3VF1 A;  5FGO A;  1G02 A;  4KZ1 A;  2F56 A;  4N3V A;  3ZG0 A;  3LTB A;  1B20 A;  5IG4 A;  1IVV A;  2YFL B;  2CK3 H;  1TRQ A;  1QVG 2;  3N9H A;  4O3V A;  1VQ4 3;  3MHE A;  3SVA A;  1B21 A;  4XBT A;  1VQ9 3;  1YNV X;  1V58 A;  1VQN 3;  1ULJ B;  1MGW A;  3B4P A;  1TRP A;  4R9K A;  2AAE A;  3DGY A;  1PU4 A;  1IQY A;  1OHS A;  4WYK B;  4BL2 A;  2W04 A;  1YIJ 3;  1X1Y A;  1Q81 4;  1BNR A;  1I0V A;  1Q40 B;  2KF3 A;  4HM5 B;  2QA4 3;  1RNT A;  1HKX A;  3MG1 A;  3EJV A;  3CCE 3;  4J9A A;  5TGN A;  3N54 B;  1LOW A;  1BU4 A;  2R41 A;  2I9W A;  1RCL A;  3EE1 A;  3U1W A;  4IT7 A;  4QWT A;  1GMP A;  1OPY A;  5I97 A;  2F5M A;  3PS8 A;  4HM4 B;  2BT3 A;  3CNX A;  1YIT 3;  2C11 A;  3AHS A;  1VQL 3;  2P0X A;  1FYS A;  1CYV A;  3F7S A;  1W6G A;  4R9L A;  1BSE A;  4HKV B;  2OTJ 3;  3GZB A;  4R80 A;  2OCT A;  1B2S A;  1BNS A;  2E2T A;  4GB5 A;  4BU4 A;  3S27 A;  1GMQ A;  5D82 A;  1O7P B;  3VSY A;  1NJI 4;  1MOL A;  1NDO B;  3LXU X;  3KCH A;  1VQ6 3;  1D6Y A;  1DVD A;  3UJM A;  1N8R 4;  5KP4 A;  3CXC 2;  1JB5 A;  3K0Z A;  1FGO A;  3D5G A;  1ASK A;  3EB8 A;  3S67 A;  5CF1 A;  2RBI A;  1ROA A;  2W9Q A;  3VGN A;  2B1X B;  1KSI A;  5EEO A;  5BXQ A;  3EQQ B;  2CG0 A;  3X41 A;  1A90 A;  5G1L A;  4WFO A;  2XH9 A;  3G0K A;  4XBX A;  3RGA A;  1JBR A;  1ZS7 A;  1M90 4;  1YI2 3;  4MMZ B;  1L5G B;  5IEN A;  1JN5 A;  1IDP A;  5IF6 A;  3V99 A;  3DUK A;  1CEW I;  1BNI A;  5JPP A;  1VQO 3;  1A67 A;  2Z7A A;  3GZY B;  5KP3 A;  3ZG5 A;  4OUQ A;  1LOX A;  2LYX A;  1F8N A;  5AYS C;  1MGR A;  2HMM B;  1OUN A;  3HIG A;  3I0Y A;  1SIH A;  4KFD A;  4KFE A;  3SOY A;  1JZO A;  1VQM 3;  3AMO A;  3T8U A;  1Y4K A;  2HMJ B;  4Q53 A;  3SX1 A;  1WMO A;  4RNT A;  2K54 A;  1X1X A;  1UCI A;  5CXO A;  3NV0 A;  3EX9 A;  3MYT A;  4BTX A;  4LGQ A;  3CCL 3;  1Q7Y 4;  3DMC A;  1O7M B;  4AKY A;  1OAC A;  1BNE A;  1AVK A;  3CCJ 3;  1BSA A;  1GD4 A;  1RCK A;  1OHO A;  1YVS A;  2BMR B;  3F14 A;  1BGS A;  1O7H B;  3NUV A;  3F7X A;  1IV9 A;  3K9M C;  5AII A;  1EUI C;  1SJW A;  2QEX 3;  1IU7 A;  2F98 A;  2KAA A;  4X2H A;  1B27 A;  3RDE A;  1STD A;  4EV5 A;  4KFF A;  5D83 A;  2CH9 A;  3B4O A;  1YJ9 3;  1UUG B;  1RLS A;  2RSX A;  1PFP A;  1RGK A;  1CQS A;  5DRE A;  3OW2 2;  2CIU A;  5AEU B;  1PYL A;  1IQX A;  3A76 A;  2GEX A;  1X1U A;  1US1 A;  3DM8 A;  1JNQ A;  2XSO B;  1BAN A;  2P0M A;  1M1K 4;  4EW5 A;  1LRA A;  3OWS A;  1LQG C;  2Y73 A;  1N9E A;  2XFS A;  3KZT A;  3MKI A;  1K9M 4;  1RGG A;  2D42 A;  7RNT A;  1YJN 3;  1S72 3;  5G2G A;  4N6O B;  4N6L A;  1JZD A;  2Y74 A;  1VQP 3;  3MPH A;  5BVB A;  3EN1 B;  3LZA A;  2CG1 A;  1WNH A;  2K0M A;  1FUS A;  2IYJ A;  3OWU A;  3K7C A;  4GL6 A;  4WYK A;  1FGT A;  4J5G A;  2FXT A;  1JV2 B;  2GEY A;  3X3Z A;  3JUQ A;  1Q40 A;  3CD6 3;  4FMD A;  3G71 3;  2GXF A;  4L8P A;  2P38 A;  1O7N B;  4HM7 B;  1BSB A;  2OTL 3;  2CWV A;  3HI7 A;  5BIR A;  2ML6 A;  8CHO A;  3FG1 A;  4MMX B;  3NX0 A;  2WGQ A; 
#chains in the Genus database with same CATH homology
 3U97 A;  3CCU 3;  1D6U A;  1W01 A;  2BHM A;  2BMO B;  1ZX2 A;  5AI1 A;  3QRD A;  2STD A;  3NBB A;  1ULI B;  1RRH A;  1KC8 4;  1WMN A;  1TFK A;  2SBL A;  1IV7 A;  1LNH A;  3CPO A;  1O7G B;  1SQW A;  4MMY B;  1VQ8 3;  1GY7 A;  3LML A;  3BNE A;  2ZL8 A;  3RGR A;  3K5T A;  3T8N A;  4HM8 B;  2BMQ B;  1W00 A;  1R4C A;  3CMA 3;  1YJW 3;  1JRQ A;  2CC3 A;  5D81 A;  2W56 B;  2GBW B;  2KXG A;  3MG2 A;  2QGU A;  4ZM8 A;  3DGN A;  4FMC A;  4XM4 A;  1Q82 4;  5EQL A;  2CW9 A;  2YFJ B;  3WDG B;  1CYU A;  4K90 B;  3DXO A;  2YFI B;  1GY5 A;  1G96 A;  1T5Y A;  3LYG A;  4HVN A;  2E2U A;  4IPB A;  2XR8 B;  3Q1C A;  3SXX A;  3FLJ A;  4N6U A;  2A15 A;  1RKY A;  1K8A 4;  2C10 A;  1N5P A;  2CFG A;  1UUV B;  4XDW A;  4XBY A;  3CC7 3;  3HX8 A;  4HM1 B;  1OHP A;  1SPU A;  5CLK A;  3WMD A;  3LTC A;  4I4K A;  1WQL B;  4CDL A;  2Z6B A;  3X3X A;  1KWI A;  3IPT A;  3G8Z A;  3EBY A;  3OXA A;  3CCV 3;  4FCJ A;  1HU9 A;  2XGL A;  1S5A A;  3EHC A;  2CWU A;  4MEI A;  3LTA A;  3JUN A;  3CPW 2;  2GU1 A;  1STF I;  3KSP A;  2XF3 A;  3F40 A;  3ER7 A;  4RNZ A;  1QAF A;  2XGN A;  3EN8 A;  4JF8 A;  2CFL A;  1UW1 A;  3J7Y d;  3FG4 A;  3CCR 3;  3IJE B;  1UI8 A;  3HZP A;  1ISK A;  3V92 A;  3N8B A;  5IG0 A;  1W02 A;  4G1M B;  1E3V A;  3BB9 A;  4XDV A;  3SED A;  2F86 B;  3F8H A;  3WA2 X;  4BTW A;  4EXR A;  5IEP A;  2FGT A;  3SLU A;  4L7K A;  2INX A;  3STD A;  2E2V A;  3DGM A;  1KQS 2;  1M9G A;  2YX9 A;  4FCZ A;  4WHA A;  2W2C A;  5FW5 A;  4R1K A;  1RN7 A;  6STD A;  2HMK B;  1QVF 2;  2W0Q A;  2CHC A;  2O3O A;  1IK3 A;  2CFD A;  1J2B A;  3KII A;  1AVL A;  1TU5 A;  1AV4 A;  2GU3 A;  2HMO B;  3NQZ A;  3GZR A;  5KP1 A;  1KD1 4;  2WOF A;  4FR9 A;  3CCM 3;  3CC4 3;  2B24 B;  1DMQ A;  1JJ2 2;  3CNM A;  4ORL A;  4RZM A;  1A2V A;  1W6C A;  1FGQ A;  2BNG A;  4MJD A;  1N9J A;  5LC6 A;  1QJG A;  4AKZ A;  1EG9 B;  1U5O A;  1IQ8 A;  4K61 A;  5CK6 A;  1OF5 B;  4EV2 A;  1FUW A;  3NM2 A;  3FZW A;  5STD A;  4LMI A;  3S29 A;  3EC9 A;  1LVN A;  4OK0 A;  4N6V 0;  1ROV A;  3KN4 A;  3IMA B;  2RFR A;  3PZW A;  1GYB A;  2HML B;  2OWP A;  3DZL A;  1JN5 B;  5ELU A;  1GY6 A;  7STD A;  3GRD A;  1QAL A;  2PZV A;  3LOY A;  2W56 A;  1BUQ A;  1W4N A;  2RCD A;  3M8C A;  1EKM A;  3AMO B;  5AIF A;  1V74 A;  3D9R A;  3QK9 A;  2R4I A;  3HK4 A;  3G16 A;  3WOE B;  3H51 A;  1NO3 A;  4HYZ A;  3D3L A;  1NB5 I;  5IG5 A;  2OOV C;  3PGB A;  4EBG A;  5ELJ A;  3S28 A;  2L4V A;  3E99 A;  4LSO A;  1DVC A;  2UX0 A;  2W6J H;  4FMB A;  3FF0 A;  1UUW B;  5EVH A;  1E3R A;  1GS3 A;  1YHQ 3;  1RRL A;  4AEQ A;  2JQ5 A;  5IER A;  3SOA A;  1FGM A;  1TIJ A;  1WMP A;  4RBN A;  5CF2 A;  3Q2P A;  3F8X A;  1RJO A;  3MWZ A;  3DGO A;  3LH4 A;  3O8Y A;  4HZB B;  4NRE A;  3WOF B;  3B8L A;  3FGY A;  3FG3 A;  1GD3 A;  3JUO A;  3CCQ 3;  1EQK A;  4HZ9 B;  1OCV A;  1IVX A;  1FGR A;  2CFW A;  2XEP A;  1LXE A;  1FA3 A;  5IG3 A;  3LTD A;  3UL6 A;  2RGQ A;  5HGR A;  3G4S 3;  3JUM A;  1QMA A;  1VZZ A;  3FF2 A;  3PYJ A;  3BNC A;  3ROB A;  5A0O B;  1JKG B;  2GBX B;  3KE7 A;  2CKF B;  2WO0 A;  1OH0 A;  3BLZ A;  3NBJ A;  1C7H A;  2IA7 A;  2Z76 A;  3JVC A;  3T0U A;  2MF7 A;  4LEH A;  3EBT A;  3WOD G;  2XRX B;  1YGE A;  5AYR B;  3LT8 A;  1VQK 3;  4K1U A;  3PCR A;  2BO9 B;  4J8T A;  2D1W A;  2CFK A;  4H61 A;  3FKA A;  1N8Q A;  4N6M A;  2HMN B;  4PEJ A;  1K28 A;  1NWW A;  1TP6 A;  4N6N B;  5JPU A;  4HBR A;  3NXJ A;  1SII A;  2W03 A;  5IW9 A;  3I56 3;  2W9P A;  2KRT A;  4OVM A;  2P05 A;  3UNL A;  1M1X B;  2IUJ A;  3KKG A;  1QAK A;  5JBS A;  2Z77 A;  1MNL A;  3PCS A;  2PNC A;  3OV4 A;  3PXM A;  2IUK A;  3X3Y A;  3GZX B;  2QIY A;  4O8S A;  1N5H A;  1OF5 A;  3UL5 A;  2ML5 A;  4K1V A;  2O9U X;  1UI7 A;  1DYU A;  4TX4 A;  3NBR A;  1W2Z A;  4IIA A;  2XFT A;  4WWU C;  3UB1 A;  4HM3 B;  1YVB I;  1JB2 A;  1D6Z A;  3GWR A;  4L8O A;  4R4K A;  3FCS B;  1OGX A;  3Q90 A;  3X40 A;  1Z1S A;  4HJL B;  4H3U A;  1NB3 I;  3FSD A;  2F99 A;  1JB4 A;  3OWY A;  2KCD A;  4NHF A;  1AR0 A;  2ZDJ A;  3BNB A;  2OQE A;  1TFO A;  3K63 A;  2OQE C;  3CC2 3;  4LZI A;  3X42 A;  1W7C A;  3DY5 A;  4JRF A;  3TDG A;  3L0R A;  5AIG A;  3ECF A;  3DGL A;  1W2B 2;  2WOH A;  3B7C A;  4STD A;  3I55 3;  4HM0 B;  2Q07 A;  3F9S A;  1DMN A;  2FNQ A;  3FH1 A;  1IVW A;  1K41 A;  4HM6 B;  1IT8 A;  3GAX A;  2P09 A;  3MSO A;  2CWT A;  2JDI H;  3NHX A;  3V98 A;  3BND A;  1W6Y A;  2LQV A;  1NU3 A;  4KVH A;  4EC6 A;  5DRV A;  1Q42 A;  2XSH B;  3G6E 3;  3NQY A;  1EA2 A;  3CU3 A;  1E97 A;  2V1L A;  4FMA A;  3JUP A;  4CCV A;  3HII A;  3CME 3;  1ZO2 A;  3NM7 A;  1W5Z A;  2MC8 A;  1DMM A;  1TUH A;  3NV0 B;  3OX9 A;  1IT7 A;  5LC7 A;  4FCM A;  2OOV A;  3CCS 3;  1WTH A;  4EYC A;  5AIH A;  5AEW B;  1K73 4;  1JKG A;  4O2H A;  1Q86 4;  3KFQ C;  4WP5 A;  3S5C A;  1IVU A;  4N6T A;  1U8C B;  4BTY A;  2IMJ A;  2M7O A;  1A2K A;  4X2O A;  1OGZ A;  2WGO A;  3EF8 A;  1O7W B;  3ALA A;  3H3H A;  3LT9 A;  4RNY A;  4U13 A;  4XB5 A;  5IEO A;  1VQ5 3;  3MG3 A;  3WA3 A;  3KSE D;  4O02 B;  4HM2 B;  3VF1 A;  5FGO A;  4KZ1 A;  4N3V A;  3LTB A;  5IG4 A;  1IVV A;  2YFL B;  2CK3 H;  1QVG 2;  3N9H A;  4O3V A;  1VQ4 3;  3MHE A;  3SVA A;  4XBT A;  1VQ9 3;  1VQN 3;  1ULJ B;  3B4P A;  4R9K A;  1PU4 A;  1IQY A;  1OHS A;  4WYK B;  2W04 A;  1YIJ 3;  1Q81 4;  1Q40 B;  4HM5 B;  2QA4 3;  1HKX A;  3MG1 A;  3EJV A;  3CCE 3;  4J9A A;  5TGN A;  3N54 B;  2I9W A;  3EE1 A;  3U1W A;  4IT7 A;  4QWT A;  5I97 A;  1OPY A;  3PS8 A;  4HM4 B;  2BT3 A;  3CNX A;  1YIT 3;  2C11 A;  1VQL 3;  2P0X A;  1CYV A;  3F7S A;  1W6G A;  4R9L A;  4HKV B;  2OTJ 3;  3GZB A;  4R80 A;  2OCT A;  2E2T A;  4GB5 A;  3S27 A;  5D82 A;  3VSY A;  1O7P B;  1NJI 4;  1MOL A;  1NDO B;  3LXU X;  1VQ6 3;  1D6Y A;  1DVD A;  3UJM A;  1N8R 4;  5KP4 A;  3CXC 2;  1JB5 A;  3K0Z A;  1FGO A;  1ASK A;  3EB8 A;  3S67 A;  5CF1 A;  1ROA A;  2W9Q A;  3VGN A;  2B1X B;  1KSI A;  5EEO A;  5BXQ A;  3EQQ B;  2CG0 A;  3X41 A;  1A90 A;  4WFO A;  2XH9 A;  3G0K A;  4XBX A;  3RGA A;  1M90 4;  1YI2 3;  4MMZ B;  1L5G B;  5IEN A;  1JN5 A;  1IDP A;  5IF6 A;  3V99 A;  3DUK A;  1CEW I;  5JPP A;  1VQO 3;  1A67 A;  2Z7A A;  3GZY B;  5KP3 A;  4OUQ A;  1LOX A;  2LYX A;  1F8N A;  5AYS C;  3SOY A;  2HMM B;  1OUN A;  3HIG A;  3I0Y A;  1SIH A;  4KFD A;  4KFE A;  1VQ7 3;  1VQM 3;  3AMO A;  3T8U A;  1Y4K A;  2HMJ B;  4Q53 A;  3SX1 A;  1WMO A;  2K54 A;  5CXO A;  3NV0 A;  3EX9 A;  3MYT A;  4BTX A;  4LGQ A;  3CCL 3;  1Q7Y 4;  3DMC A;  1O7M B;  4AKY A;  1OAC A;  1AVK A;  3CCJ 3;  1GD4 A;  1OHO A;  2BMR B;  3F14 A;  3NUV A;  1O7H B;  3F7X A;  1IV9 A;  3K9M C;  5AII A;  1SJW A;  2QEX 3;  1IU7 A;  2F98 A;  4X2H A;  3RDE A;  1STD A;  4EV5 A;  4KFF A;  5D83 A;  2CH9 A;  3B4O A;  1YJ9 3;  2RSX A;  1PFP A;  1CQS A;  5DRE A;  3OW2 2;  2CIU A;  5AEU B;  1IQX A;  3A76 A;  2GEX A;  1US1 A;  3DM8 A;  1JNQ A;  2XSO B;  1M1K 4;  2P0M A;  3OWS A;  2Y73 A;  1N9E A;  2XFS A;  3KZT A;  3MKI A;  1K9M 4;  2D42 A;  1YJN 3;  1S72 3;  5G2G A;  4N6O B;  4N6L A;  2Y74 A;  1VQP 3;  3MPH A;  5BVB A;  3EN1 B;  3LZA A;  2CG1 A;  1WNH A;  2K0M A;  3OWU A;  3K7C A;  4GL6 A;  4WYK A;  1FGT A;  3X3Z A;  2FXT A;  1JV2 B;  2GEY A;  3JUQ A;  1Q40 A;  3CD6 3;  4FMD A;  3G71 3;  2GXF A;  4L8P A;  2P38 A;  1O7N B;  4HM7 B;  2OTL 3;  2CWV A;  3HI7 A;  8CHO A;  2ML6 A;  3FG1 A;  4MMX B;  3NX0 A;  2WGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...