2CIUA

Structure of the ims domain of the mitochondrial import protein tim21 from s. cerevisiae
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
123
structure length
123
Chain Sequence
SGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKPKLHPVSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tim21 Binding Domain Connects the Preprotein Translocases of Both Mitochondrial Membranes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM21 MITOCHONDRIA
total genus 24
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-03-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.320 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2ciuA00
2MF7A 2CIUA
chains in the Genus database with same CATH superfamily
1BNJA 1BRSA 3AHSA 1EUIC 3AMOB 3F40A 3NUVA 3EN1B 4NHFA 9RNTA 1DVCA 1KD14 4N6TA 3X3XA 2XGLA 3S27A 4I4KA 1JBTA 3FCSB 2XRXB 1Q40B 1T3BA 3GZRA 4MMZB 1VQ83 1O7GB 2CX0A 4H3UA 4RZMA 4WYKB 1UUGB 5RNTA 3FG4A 2PNCA 4RBNA 4TX4A 2XSOB 3NQYA 2PZVA 2STDA 3BLZA 3H3HA 2Q07A 2Y73A 1RJOA 4LGQA 1N5PA 4K61A 2E2TA 1NWWA 1GD4A 5IEOA 3BU4A 1GY5A 1BAOA 1RDSA 1T5YA 1UI7A 2YFIB 2GU3A 1BVIA 4AKYA 4N6V0 1ZX2A 4EV5A 1L5GB 1WMOA 2L1SA 4K1UA 4OK0A 2C10A 3Q3FA 4O8SA 1ZO2A 3NHXA 2UX0A 5GSPA 1VQ93 3GZBA 4EV2A 1AQZA 2J8XB 3LOYA 1LQGC 5CF2A 1AR0A 5JBSA 1TTOA 2OTL3 2CK3H 4HM5B 4HM7B 2IUKA 2KF6A 1C54A 4ILFA 2BU4A 2RNTA 1OH0A 3MG1A 1W6YA 2KAAA 1A2PA 1BGSA 1JB5A 2KF5A 2LYXA 5AEWB 1LRAA 5M18A 3BIRA 3LH4A 4HM1B 1RN1A 3BNCA 2V1LA 3K5TA 3Q90A 1I2FA 3K0ZA 1T2HA 4J5KA 1LVNA 1K734 1DMMA 4NREA 1Q7Y4 3KSED 1US1A 2FGTA 2XH9A 2OWPA 1C7HA 3FG1A 3PCRA 2OOVA 5EQLA 3FF2A 3PZWA 4N6OB 4AEQA 2CFGA 3MSOA 1IU7A 2MF7A 3CCS3 1WMNA 3UJMA 4MEIA 1TU5A 4XBXA 3FGYA 2HMMB 3B7CA 3ALAA 2W56B 5LC6A 1QMAA 2BMQB 4FR9A 2WGQA 2H0IA 4IIAA 1E3VA 2L4VA 1W6CA 3CCE3 3MHEA 4LYLB 4N3VA 1OPYA 1O7PB 1NU3A 3SXXA 1T2IA 2JDIH 2P09A 3FG3A 2P0MA 4WWUC 2GBWB 1OUNA 1BSEA 4WYKA 8RNTA 1V58A 2XR8B 1RGHA 2FNQA 4HM3B 2CH9A 8CHOA 1Q824 3CMA3 4N6UA 1A90A 1PFPA 1V57A 2F5MA 3DXOA 1QALA 4FCMA 3CME3 1YNVX 1JKGB 2B1XB 3PGBA 1M1XB 1O7WB 1GSPA 1X1UA 2YX9A 1I0VA 3DGNA 3K63A 1D6YA 1LXEA 5IERA 1OF5A 3F8HA 3IPTA 4IPBA 2RGQA 1RRLA 2CFLA 1JZOA 3KFQC 4FMAA 5EEOA 3OV4A 4X2HA 1X1XA 1UDII 2FXTA 3DZLA 1RNBA 2W2CA 4OUQA 3G0KA 4N6MA 5IG0A 1A67A 1GY6A 2Z7AA 1BRKA 1ROAA 1SIHA 1IVVA 2IUJA 6GSPA 3JUPA 2HOHA 2YFLB 1W02A 2F86B 1A2KA 7RNTA 2CW9A 3N54B 3RGAA 5CK6A 1RGKA 2XSHB 1B2XA 1K8A4 2CG0A 1MWTA 1IT8A 3FZWA 2ZHXB 3JUOA 2GBXB 1SARA 1HU9A 3CCV3 3GWRA 5ELUA 1WNHA 1GMQA 2KF4A 3CCU3 2Z76A 1DMQA 3D5IA 2UUGC 4R9KA 4O02B 1LOYA 2P0XA 2GU1A 1BANA 2OTJ3 5BU4A 4K1VA 5M1AA 1TFKA 1Q9EA 1BRGA 1O7NB 2OCTA 2WO0A 1STDA 3NX0A 3STDA 3UNLA 5IG5A 2RBIA 2HMLB 3GAXA 3G6E3 1M904 2BMOB 1OHSA 1CYUA 2O3OA 2ZL8A 1BOXA 1IQ8A 1BRJA 1IDPA 1PYLA 2M7OA 2W6JH 1BNFA 5ELJA 4HYZA 3NXJA 1JBRA 1CYVA 1UUWB 2BHMA 1BSBA 2SARA 3EJVA 2CFKA 1BIRA 1UCLA 3IJEB 3EX9A 1YJW3 1N9EA 4O3VA 1S723 3M8CA 1OF5B 2KF3A 3AMOA 2W9QA 3CNMA 2UGIA 3SOYA 4JF8A 1BSDA 3JUMA 1N5HA 3DM8A 2F56A 2OQEA 3CXC2 2B24B 3CPOA 1UGIA 2BIRA 4GHOA 3ECFA 5AIGA 3CNXA 1MWSA 1IV7A 1UI8A 2GEYA 2W9PA 1X1WA 1I3IA 3LYGA 2F98A 4QWTA 4BTYA 4XB5A 2CWTA 1I3FA 6RNTA 2W56A 1O7HB 3RGRA 4FMDA 1BSCA 3SVAA 4ORLA 4HM2B 2IY2A 1FUWA 3S67A 4LMIA 1JBSA 1BNSA 1G96A 5FGOA 3ZFZA 4R9LA 3PCSA 3KN4A 3JUNA 1EKMA 1JJ22 5DRVA 1IYYA 1CQSA 2W0QA 1NJI4 2D1WA 4NPBA 3CC73 1NB5I 3F9SA 1B20A 1KWIA 1YHQ3 5TGNA 1TUHA 3ROBA 1D6ZA 2SBLA 3T0UA 1GS3A 1FZUA 1B2UA 2RCDA 3S28A 4J5GA 1FGQA 1CEWI 2E2VA 5KP4A 2H0GA 1LOVA 4XBYA 3SOAA 4HOHA 3U97A 4RNZA 1N8R4 1FGRA 1Q40A 4BIRA 1STFI 5IW9A 1DYUA 2WOFA 1B27A 1YJN3 4HBRA 1UCJA 1PY3A 1Q7HA 3WODG 1RKYA 3RDEA 1M9GA 2IA7A 1YI23 1EA2A 1OACA 3CD63 3DGOA 1NDOB 3NM7A 5AIFA 1W7CA 3AHWA 1ZS7A 3L0RA 4H61A 5FW5A 2H0HA 5KP1A 1VQ73 2CWUA 1RN7A 3V99A 1B3SA 4X2OA 1LQMB 2XFTA 3NV0B 1GOUA 1YVSA 1FGMA 5IG3A 3T8NA 4FMCA 1W4NA 2BMRB 3X41A 3LTCA 5IG4A 1DMNA 1RSNA 2GSPA 1MOLA 4BTWA 1JV2B 2O9UX 2Z77A 3FKAA 3URPA 7STDA 1KQS2 1W01A 3FH1A 2ZA4A 1VQO3 5IF6A 3HOHA 4L7KA 1ULJB 4CJNA 3SEDA 5JPPA 1VQN3 1IT7A 3HX8A 3NBJA 2XGNA 3OX9A 3N8BA 1J2BA 4J8TA 1GOVA 1RGFA 1OHPA 3WR2A 1QAFA 3F7SA 1YIJ3 3WA3A 1ASKA 4EYCA 1IVWA 2Y74A 3DGYA 1YGEA 4KFDA 3WOFB 1IK3A 1RGCA 1VQQA 3G16A 1NB3I 4BL2A 2XFSA 4HVNA 5A0OB 1BNEA 4U13A 3DUKA 3LXUX 5DREA 1IVXA 2HMJB 2ZDJA 1W2B2 4GL6A 3CC43 2BO9B 4KFEA 4K90B 1LOWA 4EBGA 3O8YA 1AVLA 3MYTA 5AIIA 4BTXA 3KE7A 1GY7A 2KRTA 3EN8A 3D9RA 3OWUA 1KC84 3F14A 3JVCA 1UW1A 1Y4KA 1Q864 3KZTA 1S5AA 1X1YA 2K3DA 1QVF2 1Q814 4IT7A 4CDLA 3BB9A 1DVDA 2AAEA 1W2ZA 3A5EA 3F7XA 1Z1SA 2QGUA 3CCL3 1I2GA 3A76A 1RGGA 1JNQA 4FCJA 1RTUA 1WMPA 3FLJA 3LTDA 3X40A 4FMBA 4GB5A 4RNTA 3OWSA 1KSIA 3EBYA 3HIIA 4LZIA 4R4KA 1B21A 3X42A 2JQ5A 3DGLA 1JB2A 3RNTA 3LTAA 4BL3A 2D42A 1OGZA 2K0MA 3LZAA 1VQ63 2A15A 5LC7A 1BNIA 2CFDA 1JRQA 3AGNA 3HIGA 1VQK3 1BU4A 3OXAA 3WOEB 3LTBA 3CCM3 1GOYA 1B2ZA 2KXGA 3EB8A 1YIT3 3PYJA 1BRHA 2GEXA 3DY5A 4LEHA 1RHLA 4O2HA 4HZBB 3NBRA 4OVMA 3UL6A 1LOXA 2CKFB 3MKIA 1Q42A 1JB4A 4KZ1A 4BU4A 1GYBA 4N6NB 4CCVA 2CC3A 2AADA 3F8XA 2F4YA 4MMXB 5D83A 1VQ43 2K54A 2Z6BA 3OW22 2ML6A 1BUJA 5KP3A 1RLSA 5AYRB 4LSOA 1E97A 2XF3A 1BRNL 3S29A 4HKVB 3SLUA 2F5WA 1RCKA 5CXOA 3V92A 1JN5B 2RSXA 3NQZA 5AYSC 7GSPA 4I5QA 3WA2X 5IENA 3LT9A 5BVBA 3VSYA 5BXQA 3PXMA 1SJWA 2WGOA 3JUQA 1V74A 3EQQB 4J9AA 3X3YA 4G1MB 5G2GA 3MWZA 3SYUA 3Q2PA 4DKIA 1ISKA 3CCQ3 4EXRA 4ZM8A 5AEUB 1E3RA 1FW7A 1IQXA 2OQEC 3QK9A 1QAKA 3ER7A 3KSPA 1RGAA 1SQWA 4N6LA 1RCLA 2R41A 2MC8A 3U1WA 3CCJ3 3IMAB 1G02A 3G4S3 4XM4A 2C4BA 5CLKA 1GD3A 1U5OA 4XBTA 1UGHI 3T8UA 4XDWA 1JKGA 1DETA 4L8OA 1ROVA 3G8ZA 3Q1CA 3CCR3 2INXA 1M1K4 3D3LA 3D79A 3HZPA 3ZG0A 1YVBI 5CF1A 2YFJB 1WQLB 3I553 1GMRA 1EG9B 4HM6B 3MG3A 1RN4A 1TRPA 3I0YA 3DMCA 3NBBA 1TJDA 4KFFA 3GSPA 4EW5A 1MWRA 1UUVB 3EF8A 4RNYA 3KIIA 1ULIB 1W5ZA 1UCIA 4R1KA 3WMDA 3VF1A 1I0XA 1OGXA 2BNGA 4FCZA 3E99A 2QIYA 4HZ9B 1W00A 1R4CA 3WHOA 3EHCA 5M19A 1EQKA 2HMOB 1ZGXA 3GZYB 1D6UA 5I97A 2KCDA 2C11A 4HM0B 6STDA 1YJ93 1MWUA 3KCHA 3D5GA 3V98A 4HM4B 5AI1A 1NO3A 2I9WA 2CIUA 1R4YA 3BNEA 2CWVA 3EBTA 3PS8A 3NV0A 2QEX3 1AY7A 1FYSA 4EC6A 2E2UA 1BSAA 4WHAA 1EEJA 5AIHA 3HI7A 1VQL3 1DE3A 3EC9A 1BNGA 5JPUA 1LNHA 1MNLA 1TP6A 5STDA 2CHCA 1FGTA 1CH0A 1HKXA 1MGRA 3B4OA 1OHOA 2RFRA 1AV4A 1O7MB 2OOVC 1VQP3 3OWYA 2BT3A 1G0TA 1MGWA 1TIJA 3MPHA 2CG1A 3B8LA 1BRIA 3UB1A 3GZXB 1BUQA 5D82A 3TDGA 3D4AA 2IYJA 3I563 1K28A 1RRHA 4L8PA 3MG2A 3HK4A 1HZ1A 1SIIA 5HGRA 1W6GA 1JN5A 4KVHA 4PEJA 4CPKA 1N8QA 3CU3A 1NNVA 2IMJA 1I8VA 4MMYB 1IV9A 5EVHA 3X3ZA 1BNRA 1YGWA 3DGMA 1FUTA 1TRQA 3BNDA 5IEPA 1B2MA 3BNBA 4WFOA 3J7Yd 1FGOA 1F8NA 3AGOA 3SX1A 3UL5A 2HMKB 3CC23 2QA43 3H51A 1VQM3 3FF0A 1TFOA 3LMLA 2W04A 3EE1A 5HOHA 3CPW2 4AKZA 3GRDA 1A2VA 3G713 1RNTA 1I70A 1QJGA 1K9M4 4WP5A 3ZG5A 3FSDA 3KKGA 1VQ53 1SPUA 1I2EA 4MJDA 1RMSA 5BIRA 4KT3B 1OCVA 4HAAA 4STDA 1WTHA 1N9JA 2CX1A 2P38A 2HMNB 4HJLB 2CFWA 1FUSA 1RGEA 1UCKA 1FA3A 1HYFA 1AVKA 4GSPA 2XEPA 4XDVA 5G1KA 5G1LA 1VZZA 2P05A 2ML5A 4Q53A 1JZDA 4R80A 3N9HA 3WDGB 1QVG2 1GMPA 2R4IA 3B4PA 4JRFA 1K41A 4HM8B 1IVUA 2W03A 1LNIA 2GXFA 1B2SA 2WOHA 3QRDA 3DH2A 1RGLA 3VGNA 3NM2A 1PU4A 2F99A 1U8CB 3K7CA 5D81A 3K9MC 1IQYA 3S5CA 2LQVA 3LT8A
chains in the Genus database with same CATH topology
4NHFA 3AMOB 3F40A 3NUVA 3EN1B 1DVCA 1KD14 4N6TA 3X3XA 2XGLA 3S27A 4I4KA 3FCSB 2XRXB 1Q40B 3GZRA 4MMZB 1VQ83 1O7GB 4H3UA 4RZMA 4WYKB 3FG4A 2PNCA 4RBNA 4TX4A 2XSOB 3NQYA 2PZVA 2STDA 3BLZA 3H3HA 2Q07A 2Y73A 1RJOA 4LGQA 1N5PA 4K61A 2E2TA 1NWWA 1GD4A 5IEOA 1GY5A 2YFIB 1T5YA 1UI7A 2GU3A 4AKYA 4N6V0 1ZX2A 4EV5A 1L5GB 1WMOA 4K1UA 4OK0A 2C10A 4O8SA 1ZO2A 3NHXA 2UX0A 1VQ93 3GZBA 4EV2A 3LOYA 5CF2A 1AR0A 5JBSA 2CK3H 4HM5B 4HM7B 2IUKA 1OH0A 3MG1A 1W6YA 1JB5A 2LYXA 5AEWB 3LH4A 4HM1B 3BNCA 2V1LA 3K5TA 3Q90A 3K0ZA 1LVNA 1K734 1DMMA 4NREA 1Q7Y4 3KSED 1US1A 2FGTA 2XH9A 2OWPA 1C7HA 3FG1A 3PCRA 2OOVA 5EQLA 3FF2A 3PZWA 4N6OB 4AEQA 2CFGA 3MSOA 1IU7A 2MF7A 3CCS3 1WMNA 3UJMA 4MEIA 1TU5A 4XBXA 3FGYA 2HMMB 3B7CA 3ALAA 2W56B 5LC6A 1QMAA 2BMQB 4FR9A 2WGQA 4IIAA 3CCE3 1E3VA 2L4VA 1W6CA 3MHEA 4N3VA 1OPYA 1O7PB 1NU3A 3SXXA 2JDIH 2P09A 3FG3A 2P0MA 4WWUC 2GBWB 1OUNA 4WYKA 2XR8B 4HM3B 2FNQA 8CHOA 2CH9A 1Q824 1A90A 3CMA3 4N6UA 1PFPA 3DXOA 1QALA 4FCMA 3CME3 1JKGB 2B1XB 3PGBA 1M1XB 1O7WB 2YX9A 3DGNA 3K63A 1D6YA 1LXEA 5IERA 1OF5A 3F8HA 3IPTA 4IPBA 2RGQA 1RRLA 2CFLA 3KFQC 4FMAA 5EEOA 3OV4A 4X2HA 2FXTA 3DZLA 2W2CA 4OUQA 3G0KA 4N6MA 5IG0A 1A67A 1GY6A 2Z7AA 1ROAA 1SIHA 1IVVA 2IUJA 3JUPA 2YFLB 1W02A 2F86B 1A2KA 2CW9A 3N54B 3RGAA 5CK6A 2XSHB 1K8A4 2CG0A 1IT8A 3FZWA 3JUOA 2GBXB 1HU9A 3CCV3 3GWRA 5ELUA 1WNHA 3CCU3 2Z76A 1DMQA 4R9KA 4O02B 2P0XA 2GU1A 2OTJ3 4K1VA 1TFKA 1O7NB 2OCTA 2WO0A 1STDA 3NX0A 3STDA 3UNLA 5IG5A 3G6E3 2HMLB 3GAXA 1M904 2BMOB 1OHSA 1CYUA 2O3OA 2ZL8A 1IDPA 1IQ8A 2M7OA 1YJ93 2W6JH 5ELJA 4HYZA 3NXJA 1CYVA 1UUWB 2BHMA 3IJEB 3EJVA 1YJW3 2CFKA 3EX9A 1N9EA 4O3VA 1S723 3M8CA 1OF5B 3AMOA 2W9QA 3CNMA 3SOYA 4JF8A 3JUMA 1N5HA 3DM8A 2OQEA 3CXC2 2B24B 3CPOA 3ECFA 5AIGA 3CNXA 1IV7A 1UI8A 2GEYA 2W9PA 3LYGA 4BTYA 2F98A 4QWTA 4XB5A 2CWTA 2W56A 1O7HB 3RGRA 4FMDA 3SVAA 4ORLA 4HM2B 1FUWA 3S67A 4LMIA 1G96A 5FGOA 4R9LA 3PCSA 3KN4A 3JUNA 1EKMA 1JJ22 5DRVA 1CQSA 2W0QA 1NJI4 2D1WA 3CC73 1NB5I 3F9SA 1KWIA 1YHQ3 5TGNA 1TUHA 3ROBA 1D6ZA 2SBLA 3T0UA 1GS3A 2RCDA 3S28A 1FGQA 1CEWI 2E2VA 5KP4A 4XBYA 3SOAA 3U97A 4RNZA 1N8R4 1FGRA 1Q40A 1STFI 5IW9A 1DYUA 2WOFA 1YJN3 4HBRA 3WODG 1RKYA 3RDEA 1M9GA 2IA7A 1YI23 1EA2A 1OACA 3CD63 3DGOA 1NDOB 3NM7A 5AIFA 1W7CA 4H61A 3L0RA 5FW5A 5KP1A 1VQ73 2CWUA 1RN7A 3V99A 4X2OA 2XFTA 3NV0B 1FGMA 5IG3A 3T8NA 4FMCA 1W4NA 2BMRB 3X41A 3LTCA 5IG4A 1DMNA 1MOLA 4BTWA 1JV2B 2O9UX 2Z77A 3FKAA 7STDA 1KQS2 1W01A 3FH1A 1VQO3 5IF6A 4L7KA 1ULJB 3SEDA 5JPPA 1VQN3 1IT7A 3HX8A 3NBJA 2XGNA 3OX9A 3N8BA 1J2BA 4J8TA 1YIJ3 1OHPA 1QAFA 3F7SA 3WA3A 1ASKA 4EYCA 1IVWA 2Y74A 1YGEA 4KFDA 3WOFB 1IK3A 3G16A 1NB3I 2XFSA 4HVNA 5A0OB 4U13A 3DUKA 3LXUX 5DREA 1IVXA 2HMJB 2ZDJA 1W2B2 4GL6A 3CC43 2BO9B 4KFEA 4K90B 4EBGA 3O8YA 1AVLA 3MYTA 5AIIA 4BTXA 3KE7A 1GY7A 2KRTA 3EN8A 3D9RA 3OWUA 1KC84 3F14A 3JVCA 1UW1A 1Y4KA 1Q864 3KZTA 1S5AA 1QVF2 1Q814 4IT7A 4CDLA 3BB9A 1DVDA 1W2ZA 3F7XA 1Z1SA 2QGUA 3CCL3 3A76A 1JNQA 4FCJA 1WMPA 3FLJA 3LTDA 3X40A 4FMBA 4GB5A 3OWSA 1KSIA 3EBYA 3HIIA 4LZIA 4R4KA 3X42A 3DGLA 2JQ5A 1JB2A 3LTAA 2D42A 1OGZA 2K0MA 3LZAA 1VQ63 2A15A 5LC7A 2CFDA 3HIGA 1JRQA 1VQK3 3CCM3 3OXAA 3WOEB 3LTBA 1YIT3 2KXGA 3EB8A 3PYJA 2GEXA 3DY5A 4LEHA 4O2HA 4HZBB 3NBRA 4OVMA 3UL6A 1LOXA 2CKFB 3MKIA 1Q42A 1JB4A 4KZ1A 1GYBA 4N6NB 4CCVA 2CC3A 3F8XA 4MMXB 5D83A 2K54A 2Z6BA 3OW22 2ML6A 5KP3A 5AYRB 4LSOA 1E97A 2XF3A 3S29A 4HKVB 3SLUA 3V92A 5CXOA 1JN5B 2RSXA 3NQZA 5AYSC 3WA2X 5IENA 3LT9A 5BVBA 3VSYA 5BXQA 3PXMA 1SJWA 2WGOA 3JUQA 1V74A 3EQQB 4J9AA 3X3YA 4G1MB 5G2GA 3MWZA 3Q2PA 1ISKA 3CCQ3 4EXRA 4ZM8A 1E3RA 1IQXA 2OQEC 3QK9A 1QAKA 3ER7A 3KSPA 1SQWA 4N6LA 2MC8A 3U1WA 5AEUB 3CCJ3 3IMAB 3G4S3 4XM4A 5CLKA 1GD3A 1U5OA 4XBTA 3T8UA 4XDWA 1JKGA 4L8OA 1ROVA 3G8ZA 3Q1CA 3CCR3 2INXA 1M1K4 3D3LA 3HZPA 1YVBI 5CF1A 2YFJB 1WQLB 3I553 1EG9B 4HM6B 3MG3A 3I0YA 3DMCA 3NBBA 4KFFA 1UUVB 3EF8A 4RNYA 3KIIA 1ULIB 1W5ZA 4R1KA 3WMDA 3VF1A 1OGXA 2BNGA 4FCZA 3E99A 2QIYA 4HZ9B 1W00A 1R4CA 3EHCA 1EQKA 2HMOB 3GZYB 1D6UA 5I97A 2KCDA 2C11A 4HM0B 6STDA 3V98A 4HM4B 5AI1A 1NO3A 2I9WA 2CIUA 3BNEA 3PS8A 2CWVA 3EBTA 3NV0A 2QEX3 4EC6A 2E2UA 5AIHA 4WHAA 3HI7A 1VQL3 3EC9A 5JPUA 1LNHA 1MNLA 1TP6A 5STDA 2CHCA 1FGTA 1HKXA 3B4OA 1OHOA 2RFRA 1AV4A 1O7MB 2OOVC 1VQP3 3OWYA 2BT3A 1TIJA 3MPHA 2CG1A 3B8LA 3UB1A 3GZXB 1BUQA 5D82A 3TDGA 3I563 1K28A 1RRHA 4L8PA 3MG2A 3HK4A 1SIIA 5HGRA 1W6GA 1JN5A 4KVHA 4PEJA 1N8QA 3CU3A 2IMJA 4MMYB 1IV9A 5EVHA 3X3ZA 3DGMA 3BNDA 5IEPA 3BNBA 4WFOA 3J7Yd 1FGOA 1F8NA 3SX1A 3UL5A 2HMKB 3CC23 2QA43 3H51A 1VQM3 3FF0A 1TFOA 3LMLA 2W04A 3EE1A 3CPW2 4AKZA 3GRDA 1A2VA 3G713 1QJGA 1K9M4 4WP5A 3FSDA 3KKGA 1VQ53 1SPUA 4MJDA 1OCVA 4STDA 1WTHA 1N9JA 4HJLB 2P38A 2HMNB 2CFWA 1FA3A 2OTL3 1AVKA 1VQ43 2XEPA 4XDVA 3WDGB 1VZZA 2P05A 2ML5A 4Q53A 4R80A 3N9HA 1QVG2 2R4IA 3B4PA 4JRFA 1K41A 4HM8B 1IVUA 2W03A 2GXFA 2WOHA 3QRDA 3VGNA 3NM2A 1PU4A 2F99A 1U8CB 3K7CA 5D81A 3K9MC 1IQYA 3S5CA 2LQVA 3LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MF7 A;  2CIU A; 
#chains in the Genus database with same CATH topology
 1BNJ A;  1BRS A;  3AHS A;  1EUI C;  3AMO B;  3F40 A;  3NUV A;  3EN1 B;  4NHF A;  9RNT A;  1DVC A;  1KD1 4;  4N6T A;  3X3X A;  2XGL A;  3S27 A;  4I4K A;  1JBT A;  3FCS B;  2XRX B;  1Q40 B;  1T3B A;  3GZR A;  4MMZ B;  1VQ8 3;  1O7G B;  2CX0 A;  4H3U A;  4RZM A;  4WYK B;  1UUG B;  5RNT A;  3FG4 A;  2PNC A;  4RBN A;  4TX4 A;  2XSO B;  3NQY A;  2PZV A;  2STD A;  3BLZ A;  3H3H A;  2Q07 A;  2Y73 A;  1RJO A;  4LGQ A;  1N5P A;  4K61 A;  2E2T A;  1NWW A;  1GD4 A;  5IEO A;  3BU4 A;  1GY5 A;  1BAO A;  1RDS A;  1T5Y A;  1UI7 A;  2YFI B;  2GU3 A;  1BVI A;  4AKY A;  4N6V 0;  1ZX2 A;  4EV5 A;  1L5G B;  1WMO A;  2L1S A;  4K1U A;  4OK0 A;  2C10 A;  3Q3F A;  4O8S A;  1ZO2 A;  3NHX A;  2UX0 A;  5GSP A;  1VQ9 3;  3GZB A;  4EV2 A;  1AQZ A;  2J8X B;  3LOY A;  1LQG C;  5CF2 A;  1AR0 A;  5JBS A;  1TTO A;  2OTL 3;  2CK3 H;  4HM5 B;  4HM7 B;  2IUK A;  2KF6 A;  1C54 A;  4ILF A;  2BU4 A;  2RNT A;  1OH0 A;  3MG1 A;  1W6Y A;  2KAA A;  1A2P A;  1BGS A;  1JB5 A;  2KF5 A;  2LYX A;  5AEW B;  1LRA A;  5M18 A;  3BIR A;  3LH4 A;  4HM1 B;  1RN1 A;  3BNC A;  2V1L A;  3K5T A;  3Q90 A;  1I2F A;  3K0Z A;  1T2H A;  4J5K A;  1LVN A;  1K73 4;  1DMM A;  4NRE A;  1Q7Y 4;  3KSE D;  1US1 A;  2FGT A;  2XH9 A;  2OWP A;  1C7H A;  3FG1 A;  3PCR A;  2OOV A;  5EQL A;  3FF2 A;  3PZW A;  4N6O B;  4AEQ A;  2CFG A;  3MSO A;  1IU7 A;  2MF7 A;  3CCS 3;  1WMN A;  3UJM A;  4MEI A;  1TU5 A;  4XBX A;  3FGY A;  2HMM B;  3B7C A;  3ALA A;  2W56 B;  5LC6 A;  1QMA A;  2BMQ B;  4FR9 A;  2WGQ A;  2H0I A;  4IIA A;  1E3V A;  2L4V A;  1W6C A;  3CCE 3;  3MHE A;  4LYL B;  4N3V A;  1OPY A;  1O7P B;  1NU3 A;  3SXX A;  1T2I A;  2JDI H;  2P09 A;  3FG3 A;  2P0M A;  4WWU C;  2GBW B;  1OUN A;  1BSE A;  4WYK A;  8RNT A;  1V58 A;  2XR8 B;  1RGH A;  2FNQ A;  4HM3 B;  2CH9 A;  8CHO A;  1Q82 4;  3CMA 3;  4N6U A;  1A90 A;  1PFP A;  1V57 A;  2F5M A;  3DXO A;  1QAL A;  4FCM A;  3CME 3;  1YNV X;  1JKG B;  2B1X B;  3PGB A;  1M1X B;  1O7W B;  1GSP A;  1X1U A;  2YX9 A;  1I0V A;  3DGN A;  3K63 A;  1D6Y A;  1LXE A;  5IER A;  1OF5 A;  3F8H A;  3IPT A;  4IPB A;  2RGQ A;  1RRL A;  2CFL A;  1JZO A;  3KFQ C;  4FMA A;  5EEO A;  3OV4 A;  4X2H A;  1X1X A;  1UDI I;  2FXT A;  3DZL A;  1RNB A;  2W2C A;  4OUQ A;  3G0K A;  4N6M A;  5IG0 A;  1A67 A;  1GY6 A;  2Z7A A;  1BRK A;  1ROA A;  1SIH A;  1IVV A;  2IUJ A;  6GSP A;  3JUP A;  2HOH A;  2YFL B;  1W02 A;  2F86 B;  1A2K A;  7RNT A;  2CW9 A;  3N54 B;  3RGA A;  5CK6 A;  1RGK A;  2XSH B;  1B2X A;  1K8A 4;  2CG0 A;  1MWT A;  1IT8 A;  3FZW A;  2ZHX B;  3JUO A;  2GBX B;  1SAR A;  1HU9 A;  3CCV 3;  3GWR A;  5ELU A;  1WNH A;  1GMQ A;  2KF4 A;  3CCU 3;  2Z76 A;  1DMQ A;  3D5I A;  2UUG C;  4R9K A;  4O02 B;  1LOY A;  2P0X A;  2GU1 A;  1BAN A;  2OTJ 3;  5BU4 A;  4K1V A;  5M1A A;  1TFK A;  1Q9E A;  1BRG A;  1O7N B;  2OCT A;  2WO0 A;  1STD A;  3NX0 A;  3STD A;  3UNL A;  5IG5 A;  2RBI A;  2HML B;  3GAX A;  3G6E 3;  1M90 4;  2BMO B;  1OHS A;  1CYU A;  2O3O A;  2ZL8 A;  1BOX A;  1IQ8 A;  1BRJ A;  1IDP A;  1PYL A;  2M7O A;  2W6J H;  1BNF A;  5ELJ A;  4HYZ A;  3NXJ A;  1JBR A;  1CYV A;  1UUW B;  2BHM A;  1BSB A;  2SAR A;  3EJV A;  2CFK A;  1BIR A;  1UCL A;  3IJE B;  3EX9 A;  1YJW 3;  1N9E A;  4O3V A;  1S72 3;  3M8C A;  1OF5 B;  2KF3 A;  3AMO A;  2W9Q A;  3CNM A;  2UGI A;  3SOY A;  4JF8 A;  1BSD A;  3JUM A;  1N5H A;  3DM8 A;  2F56 A;  2OQE A;  3CXC 2;  2B24 B;  3CPO A;  1UGI A;  2BIR A;  4GHO A;  3ECF A;  5AIG A;  3CNX A;  1MWS A;  1IV7 A;  1UI8 A;  2GEY A;  2W9P A;  1X1W A;  1I3I A;  3LYG A;  2F98 A;  4QWT A;  4BTY A;  4XB5 A;  2CWT A;  1I3F A;  6RNT A;  2W56 A;  1O7H B;  3RGR A;  4FMD A;  1BSC A;  3SVA A;  4ORL A;  4HM2 B;  2IY2 A;  1FUW A;  3S67 A;  4LMI A;  1JBS A;  1BNS A;  1G96 A;  5FGO A;  3ZFZ A;  4R9L A;  3PCS A;  3KN4 A;  3JUN A;  1EKM A;  1JJ2 2;  5DRV A;  1IYY A;  1CQS A;  2W0Q A;  1NJI 4;  2D1W A;  4NPB A;  3CC7 3;  1NB5 I;  3F9S A;  1B20 A;  1KWI A;  1YHQ 3;  5TGN A;  1TUH A;  3ROB A;  1D6Z A;  2SBL A;  3T0U A;  1GS3 A;  1FZU A;  1B2U A;  2RCD A;  3S28 A;  4J5G A;  1FGQ A;  1CEW I;  2E2V A;  5KP4 A;  2H0G A;  1LOV A;  4XBY A;  3SOA A;  4HOH A;  3U97 A;  4RNZ A;  1N8R 4;  1FGR A;  1Q40 A;  4BIR A;  1STF I;  5IW9 A;  1DYU A;  2WOF A;  1B27 A;  1YJN 3;  4HBR A;  1UCJ A;  1PY3 A;  1Q7H A;  3WOD G;  1RKY A;  3RDE A;  1M9G A;  2IA7 A;  1YI2 3;  1EA2 A;  1OAC A;  3CD6 3;  3DGO A;  1NDO B;  3NM7 A;  5AIF A;  1W7C A;  3AHW A;  1ZS7 A;  3L0R A;  4H61 A;  5FW5 A;  2H0H A;  5KP1 A;  1VQ7 3;  2CWU A;  1RN7 A;  3V99 A;  1B3S A;  4X2O A;  1LQM B;  2XFT A;  3NV0 B;  1GOU A;  1YVS A;  1FGM A;  5IG3 A;  3T8N A;  4FMC A;  1W4N A;  2BMR B;  3X41 A;  3LTC A;  5IG4 A;  1DMN A;  1RSN A;  2GSP A;  1MOL A;  4BTW A;  1JV2 B;  2O9U X;  2Z77 A;  3FKA A;  3URP A;  7STD A;  1KQS 2;  1W01 A;  3FH1 A;  2ZA4 A;  1VQO 3;  5IF6 A;  3HOH A;  4L7K A;  1ULJ B;  4CJN A;  3SED A;  5JPP A;  1VQN 3;  1IT7 A;  3HX8 A;  3NBJ A;  2XGN A;  3OX9 A;  3N8B A;  1J2B A;  4J8T A;  1GOV A;  1RGF A;  1OHP A;  3WR2 A;  1QAF A;  3F7S A;  1YIJ 3;  3WA3 A;  1ASK A;  4EYC A;  1IVW A;  2Y74 A;  3DGY A;  1YGE A;  4KFD A;  3WOF B;  1IK3 A;  1RGC A;  1VQQ A;  3G16 A;  1NB3 I;  4BL2 A;  2XFS A;  4HVN A;  5A0O B;  1BNE A;  4U13 A;  3DUK A;  3LXU X;  5DRE A;  1IVX A;  2HMJ B;  2ZDJ A;  1W2B 2;  4GL6 A;  3CC4 3;  2BO9 B;  4KFE A;  4K90 B;  1LOW A;  4EBG A;  3O8Y A;  1AVL A;  3MYT A;  5AII A;  4BTX A;  3KE7 A;  1GY7 A;  2KRT A;  3EN8 A;  3D9R A;  3OWU A;  1KC8 4;  3F14 A;  3JVC A;  1UW1 A;  1Y4K A;  1Q86 4;  3KZT A;  1S5A A;  1X1Y A;  2K3D A;  1QVF 2;  1Q81 4;  4IT7 A;  4CDL A;  3BB9 A;  1DVD A;  2AAE A;  1W2Z A;  3A5E A;  3F7X A;  1Z1S A;  2QGU A;  3CCL 3;  1I2G A;  3A76 A;  1RGG A;  1JNQ A;  4FCJ A;  1RTU A;  1WMP A;  3FLJ A;  3LTD A;  3X40 A;  4FMB A;  4GB5 A;  4RNT A;  3OWS A;  1KSI A;  3EBY A;  3HII A;  4LZI A;  4R4K A;  1B21 A;  3X42 A;  2JQ5 A;  3DGL A;  1JB2 A;  3RNT A;  3LTA A;  4BL3 A;  2D42 A;  1OGZ A;  2K0M A;  3LZA A;  1VQ6 3;  2A15 A;  5LC7 A;  1BNI A;  2CFD A;  1JRQ A;  3AGN A;  3HIG A;  1VQK 3;  1BU4 A;  3OXA A;  3WOE B;  3LTB A;  3CCM 3;  1GOY A;  1B2Z A;  2KXG A;  3EB8 A;  1YIT 3;  3PYJ A;  1BRH A;  2GEX A;  3DY5 A;  4LEH A;  1RHL A;  4O2H A;  4HZB B;  3NBR A;  4OVM A;  3UL6 A;  1LOX A;  2CKF B;  3MKI A;  1Q42 A;  1JB4 A;  4KZ1 A;  4BU4 A;  1GYB A;  4N6N B;  4CCV A;  2CC3 A;  2AAD A;  3F8X A;  2F4Y A;  4MMX B;  5D83 A;  1VQ4 3;  2K54 A;  2Z6B A;  3OW2 2;  2ML6 A;  1BUJ A;  5KP3 A;  1RLS A;  5AYR B;  4LSO A;  1E97 A;  2XF3 A;  1BRN L;  3S29 A;  4HKV B;  3SLU A;  2F5W A;  1RCK A;  5CXO A;  3V92 A;  1JN5 B;  2RSX A;  3NQZ A;  5AYS C;  7GSP A;  4I5Q A;  3WA2 X;  5IEN A;  3LT9 A;  5BVB A;  3VSY A;  5BXQ A;  3PXM A;  1SJW A;  2WGO A;  3JUQ A;  1V74 A;  3EQQ B;  4J9A A;  3X3Y A;  4G1M B;  5G2G A;  3MWZ A;  3SYU A;  3Q2P A;  4DKI A;  1ISK A;  3CCQ 3;  4EXR A;  4ZM8 A;  5AEU B;  1E3R A;  1FW7 A;  1IQX A;  2OQE C;  3QK9 A;  1QAK A;  3ER7 A;  3KSP A;  1RGA A;  1SQW A;  4N6L A;  1RCL A;  2R41 A;  2MC8 A;  3U1W A;  3CCJ 3;  3IMA B;  1G02 A;  3G4S 3;  4XM4 A;  2C4B A;  5CLK A;  1GD3 A;  1U5O A;  4XBT A;  1UGH I;  3T8U A;  4XDW A;  1JKG A;  1DET A;  4L8O A;  1ROV A;  3G8Z A;  3Q1C A;  3CCR 3;  2INX A;  1M1K 4;  3D3L A;  3D79 A;  3HZP A;  3ZG0 A;  1YVB I;  5CF1 A;  2YFJ B;  1WQL B;  3I55 3;  1GMR A;  1EG9 B;  4HM6 B;  3MG3 A;  1RN4 A;  1TRP A;  3I0Y A;  3DMC A;  3NBB A;  1TJD A;  4KFF A;  3GSP A;  4EW5 A;  1MWR A;  1UUV B;  3EF8 A;  4RNY A;  3KII A;  1ULI B;  1W5Z A;  1UCI A;  4R1K A;  3WMD A;  3VF1 A;  1I0X A;  1OGX A;  2BNG A;  4FCZ A;  3E99 A;  2QIY A;  4HZ9 B;  1W00 A;  1R4C A;  3WHO A;  3EHC A;  5M19 A;  1EQK A;  2HMO B;  1ZGX A;  3GZY B;  1D6U A;  5I97 A;  2KCD A;  2C11 A;  4HM0 B;  6STD A;  1YJ9 3;  1MWU A;  3KCH A;  3D5G A;  3V98 A;  4HM4 B;  5AI1 A;  1NO3 A;  2I9W A;  2CIU A;  1R4Y A;  3BNE A;  2CWV A;  3EBT A;  3PS8 A;  3NV0 A;  2QEX 3;  1AY7 A;  1FYS A;  4EC6 A;  2E2U A;  1BSA A;  4WHA A;  1EEJ A;  5AIH A;  3HI7 A;  1VQL 3;  1DE3 A;  3EC9 A;  1BNG A;  5JPU A;  1LNH A;  1MNL A;  1TP6 A;  5STD A;  2CHC A;  1FGT A;  1CH0 A;  1HKX A;  1MGR A;  3B4O A;  1OHO A;  2RFR A;  1AV4 A;  1O7M B;  2OOV C;  1VQP 3;  3OWY A;  2BT3 A;  1G0T A;  1MGW A;  1TIJ A;  3MPH A;  2CG1 A;  3B8L A;  1BRI A;  3UB1 A;  3GZX B;  1BUQ A;  5D82 A;  3TDG A;  3D4A A;  2IYJ A;  3I56 3;  1K28 A;  1RRH A;  4L8P A;  3MG2 A;  3HK4 A;  1HZ1 A;  1SII A;  5HGR A;  1W6G A;  1JN5 A;  4KVH A;  4PEJ A;  4CPK A;  1N8Q A;  3CU3 A;  1NNV A;  2IMJ A;  1I8V A;  4MMY B;  1IV9 A;  5EVH A;  3X3Z A;  1BNR A;  1YGW A;  3DGM A;  1FUT A;  1TRQ A;  3BND A;  5IEP A;  1B2M A;  3BNB A;  4WFO A;  3J7Y d;  1FGO A;  1F8N A;  3AGO A;  3SX1 A;  3UL5 A;  2HMK B;  3CC2 3;  2QA4 3;  3H51 A;  1VQM 3;  3FF0 A;  1TFO A;  3LML A;  2W04 A;  3EE1 A;  5HOH A;  3CPW 2;  4AKZ A;  3GRD A;  1A2V A;  3G71 3;  1RNT A;  1I70 A;  1QJG A;  1K9M 4;  4WP5 A;  3ZG5 A;  3FSD A;  3KKG A;  1VQ5 3;  1SPU A;  1I2E A;  4MJD A;  1RMS A;  5BIR A;  4KT3 B;  1OCV A;  4HAA A;  4STD A;  1WTH A;  1N9J A;  2CX1 A;  2P38 A;  2HMN B;  4HJL B;  2CFW A;  1FUS A;  1RGE A;  1UCK A;  1FA3 A;  1HYF A;  1AVK A;  4GSP A;  2XEP A;  4XDV A;  5G1K A;  5G1L A;  1VZZ A;  2P05 A;  2ML5 A;  4Q53 A;  1JZD A;  4R80 A;  3N9H A;  3WDG B;  1QVG 2;  1GMP A;  2R4I A;  3B4P A;  4JRF A;  1K41 A;  4HM8 B;  1IVU A;  2W03 A;  1LNI A;  2GXF A;  1B2S A;  2WOH A;  3QRD A;  3DH2 A;  1RGL A;  3VGN A;  3NM2 A;  1PU4 A;  2F99 A;  1U8C B;  3K7C A;  5D81 A;  3K9M C;  1IQY A;  3S5C A;  2LQV A;  3LT8 A; 
#chains in the Genus database with same CATH homology
 4NHF A;  3AMO B;  3F40 A;  3NUV A;  3EN1 B;  1DVC A;  1KD1 4;  4N6T A;  3X3X A;  2XGL A;  3S27 A;  4I4K A;  3FCS B;  2XRX B;  1Q40 B;  3GZR A;  4MMZ B;  1VQ8 3;  1O7G B;  4H3U A;  4RZM A;  4WYK B;  3FG4 A;  2PNC A;  4RBN A;  4TX4 A;  2XSO B;  3NQY A;  2PZV A;  2STD A;  3BLZ A;  3H3H A;  2Q07 A;  2Y73 A;  1RJO A;  4LGQ A;  1N5P A;  4K61 A;  2E2T A;  1NWW A;  1GD4 A;  5IEO A;  1GY5 A;  2YFI B;  1T5Y A;  1UI7 A;  2GU3 A;  4AKY A;  4N6V 0;  1ZX2 A;  4EV5 A;  1L5G B;  1WMO A;  4K1U A;  4OK0 A;  2C10 A;  4O8S A;  1ZO2 A;  3NHX A;  2UX0 A;  1VQ9 3;  3GZB A;  4EV2 A;  3LOY A;  5CF2 A;  1AR0 A;  5JBS A;  2CK3 H;  4HM5 B;  4HM7 B;  2IUK A;  1OH0 A;  3MG1 A;  1W6Y A;  1JB5 A;  2LYX A;  5AEW B;  3LH4 A;  4HM1 B;  3BNC A;  2V1L A;  3K5T A;  3Q90 A;  3K0Z A;  1LVN A;  1K73 4;  1DMM A;  4NRE A;  1Q7Y 4;  3KSE D;  1US1 A;  2FGT A;  2XH9 A;  2OWP A;  1C7H A;  3FG1 A;  3PCR A;  2OOV A;  5EQL A;  3FF2 A;  3PZW A;  4N6O B;  4AEQ A;  2CFG A;  3MSO A;  1IU7 A;  2MF7 A;  3CCS 3;  1WMN A;  3UJM A;  4MEI A;  1TU5 A;  4XBX A;  3FGY A;  2HMM B;  3B7C A;  3ALA A;  2W56 B;  5LC6 A;  1QMA A;  2BMQ B;  4FR9 A;  2WGQ A;  4IIA A;  3CCE 3;  1E3V A;  2L4V A;  1W6C A;  3MHE A;  4N3V A;  1OPY A;  1O7P B;  1NU3 A;  3SXX A;  2JDI H;  2P09 A;  3FG3 A;  2P0M A;  4WWU C;  2GBW B;  1OUN A;  4WYK A;  2XR8 B;  4HM3 B;  2FNQ A;  8CHO A;  2CH9 A;  1Q82 4;  1A90 A;  3CMA 3;  4N6U A;  1PFP A;  3DXO A;  1QAL A;  4FCM A;  3CME 3;  1JKG B;  2B1X B;  3PGB A;  1M1X B;  1O7W B;  2YX9 A;  3DGN A;  3K63 A;  1D6Y A;  1LXE A;  5IER A;  1OF5 A;  3F8H A;  3IPT A;  4IPB A;  2RGQ A;  1RRL A;  2CFL A;  3KFQ C;  4FMA A;  5EEO A;  3OV4 A;  4X2H A;  2FXT A;  3DZL A;  2W2C A;  4OUQ A;  3G0K A;  4N6M A;  5IG0 A;  1A67 A;  1GY6 A;  2Z7A A;  1ROA A;  1SIH A;  1IVV A;  2IUJ A;  3JUP A;  2YFL B;  1W02 A;  2F86 B;  1A2K A;  2CW9 A;  3N54 B;  3RGA A;  5CK6 A;  2XSH B;  1K8A 4;  2CG0 A;  1IT8 A;  3FZW A;  3JUO A;  2GBX B;  1HU9 A;  3CCV 3;  3GWR A;  5ELU A;  1WNH A;  3CCU 3;  2Z76 A;  1DMQ A;  4R9K A;  4O02 B;  2P0X A;  2GU1 A;  2OTJ 3;  4K1V A;  1TFK A;  1O7N B;  2OCT A;  2WO0 A;  1STD A;  3NX0 A;  3STD A;  3UNL A;  5IG5 A;  3G6E 3;  2HML B;  3GAX A;  1M90 4;  2BMO B;  1OHS A;  1CYU A;  2O3O A;  2ZL8 A;  1IDP A;  1IQ8 A;  2M7O A;  1YJ9 3;  2W6J H;  5ELJ A;  4HYZ A;  3NXJ A;  1CYV A;  1UUW B;  2BHM A;  3IJE B;  3EJV A;  1YJW 3;  2CFK A;  3EX9 A;  1N9E A;  4O3V A;  1S72 3;  3M8C A;  1OF5 B;  3AMO A;  2W9Q A;  3CNM A;  3SOY A;  4JF8 A;  3JUM A;  1N5H A;  3DM8 A;  2OQE A;  3CXC 2;  2B24 B;  3CPO A;  3ECF A;  5AIG A;  3CNX A;  1IV7 A;  1UI8 A;  2GEY A;  2W9P A;  3LYG A;  4BTY A;  2F98 A;  4QWT A;  4XB5 A;  2CWT A;  2W56 A;  1O7H B;  3RGR A;  4FMD A;  3SVA A;  4ORL A;  4HM2 B;  1FUW A;  3S67 A;  4LMI A;  1G96 A;  5FGO A;  4R9L A;  3PCS A;  3KN4 A;  3JUN A;  1EKM A;  1JJ2 2;  5DRV A;  1CQS A;  2W0Q A;  1NJI 4;  2D1W A;  3CC7 3;  1NB5 I;  3F9S A;  1KWI A;  1YHQ 3;  5TGN A;  1TUH A;  3ROB A;  1D6Z A;  2SBL A;  3T0U A;  1GS3 A;  2RCD A;  3S28 A;  1FGQ A;  1CEW I;  2E2V A;  5KP4 A;  4XBY A;  3SOA A;  3U97 A;  4RNZ A;  1N8R 4;  1FGR A;  1Q40 A;  1STF I;  5IW9 A;  1DYU A;  2WOF A;  1YJN 3;  4HBR A;  3WOD G;  1RKY A;  3RDE A;  1M9G A;  2IA7 A;  1YI2 3;  1EA2 A;  1OAC A;  3CD6 3;  3DGO A;  1NDO B;  3NM7 A;  5AIF A;  1W7C A;  4H61 A;  3L0R A;  5FW5 A;  5KP1 A;  1VQ7 3;  2CWU A;  1RN7 A;  3V99 A;  4X2O A;  2XFT A;  3NV0 B;  1FGM A;  5IG3 A;  3T8N A;  4FMC A;  1W4N A;  2BMR B;  3X41 A;  3LTC A;  5IG4 A;  1DMN A;  1MOL A;  4BTW A;  1JV2 B;  2O9U X;  2Z77 A;  3FKA A;  7STD A;  1KQS 2;  1W01 A;  3FH1 A;  1VQO 3;  5IF6 A;  4L7K A;  1ULJ B;  3SED A;  5JPP A;  1VQN 3;  1IT7 A;  3HX8 A;  3NBJ A;  2XGN A;  3OX9 A;  3N8B A;  1J2B A;  4J8T A;  1YIJ 3;  1OHP A;  1QAF A;  3F7S A;  3WA3 A;  1ASK A;  4EYC A;  1IVW A;  2Y74 A;  1YGE A;  4KFD A;  3WOF B;  1IK3 A;  3G16 A;  1NB3 I;  2XFS A;  4HVN A;  5A0O B;  4U13 A;  3DUK A;  3LXU X;  5DRE A;  1IVX A;  2HMJ B;  2ZDJ A;  1W2B 2;  4GL6 A;  3CC4 3;  2BO9 B;  4KFE A;  4K90 B;  4EBG A;  3O8Y A;  1AVL A;  3MYT A;  5AII A;  4BTX A;  3KE7 A;  1GY7 A;  2KRT A;  3EN8 A;  3D9R A;  3OWU A;  1KC8 4;  3F14 A;  3JVC A;  1UW1 A;  1Y4K A;  1Q86 4;  3KZT A;  1S5A A;  1QVF 2;  1Q81 4;  4IT7 A;  4CDL A;  3BB9 A;  1DVD A;  1W2Z A;  3F7X A;  1Z1S A;  2QGU A;  3CCL 3;  3A76 A;  1JNQ A;  4FCJ A;  1WMP A;  3FLJ A;  3LTD A;  3X40 A;  4FMB A;  4GB5 A;  3OWS A;  1KSI A;  3EBY A;  3HII A;  4LZI A;  4R4K A;  3X42 A;  3DGL A;  2JQ5 A;  1JB2 A;  3LTA A;  2D42 A;  1OGZ A;  2K0M A;  3LZA A;  1VQ6 3;  2A15 A;  5LC7 A;  2CFD A;  3HIG A;  1JRQ A;  1VQK 3;  3CCM 3;  3OXA A;  3WOE B;  3LTB A;  1YIT 3;  2KXG A;  3EB8 A;  3PYJ A;  2GEX A;  3DY5 A;  4LEH A;  4O2H A;  4HZB B;  3NBR A;  4OVM A;  3UL6 A;  1LOX A;  2CKF B;  3MKI A;  1Q42 A;  1JB4 A;  4KZ1 A;  1GYB A;  4N6N B;  4CCV A;  2CC3 A;  3F8X A;  4MMX B;  5D83 A;  2K54 A;  2Z6B A;  3OW2 2;  2ML6 A;  5KP3 A;  5AYR B;  4LSO A;  1E97 A;  2XF3 A;  3S29 A;  4HKV B;  3SLU A;  3V92 A;  5CXO A;  1JN5 B;  2RSX A;  3NQZ A;  5AYS C;  3WA2 X;  5IEN A;  3LT9 A;  5BVB A;  3VSY A;  5BXQ A;  3PXM A;  1SJW A;  2WGO A;  3JUQ A;  1V74 A;  3EQQ B;  4J9A A;  3X3Y A;  4G1M B;  5G2G A;  3MWZ A;  3Q2P A;  1ISK A;  3CCQ 3;  4EXR A;  4ZM8 A;  1E3R A;  1IQX A;  2OQE C;  3QK9 A;  1QAK A;  3ER7 A;  3KSP A;  1SQW A;  4N6L A;  2MC8 A;  3U1W A;  5AEU B;  3CCJ 3;  3IMA B;  3G4S 3;  4XM4 A;  5CLK A;  1GD3 A;  1U5O A;  4XBT A;  3T8U A;  4XDW A;  1JKG A;  4L8O A;  1ROV A;  3G8Z A;  3Q1C A;  3CCR 3;  2INX A;  1M1K 4;  3D3L A;  3HZP A;  1YVB I;  5CF1 A;  2YFJ B;  1WQL B;  3I55 3;  1EG9 B;  4HM6 B;  3MG3 A;  3I0Y A;  3DMC A;  3NBB A;  4KFF A;  1UUV B;  3EF8 A;  4RNY A;  3KII A;  1ULI B;  1W5Z A;  4R1K A;  3WMD A;  3VF1 A;  1OGX A;  2BNG A;  4FCZ A;  3E99 A;  2QIY A;  4HZ9 B;  1W00 A;  1R4C A;  3EHC A;  1EQK A;  2HMO B;  3GZY B;  1D6U A;  5I97 A;  2KCD A;  2C11 A;  4HM0 B;  6STD A;  3V98 A;  4HM4 B;  5AI1 A;  1NO3 A;  2I9W A;  2CIU A;  3BNE A;  3PS8 A;  2CWV A;  3EBT A;  3NV0 A;  2QEX 3;  4EC6 A;  2E2U A;  5AIH A;  4WHA A;  3HI7 A;  1VQL 3;  3EC9 A;  5JPU A;  1LNH A;  1MNL A;  1TP6 A;  5STD A;  2CHC A;  1FGT A;  1HKX A;  3B4O A;  1OHO A;  2RFR A;  1AV4 A;  1O7M B;  2OOV C;  1VQP 3;  3OWY A;  2BT3 A;  1TIJ A;  3MPH A;  2CG1 A;  3B8L A;  3UB1 A;  3GZX B;  1BUQ A;  5D82 A;  3TDG A;  3I56 3;  1K28 A;  1RRH A;  4L8P A;  3MG2 A;  3HK4 A;  1SII A;  5HGR A;  1W6G A;  1JN5 A;  4KVH A;  4PEJ A;  1N8Q A;  3CU3 A;  2IMJ A;  4MMY B;  1IV9 A;  5EVH A;  3X3Z A;  3DGM A;  3BND A;  5IEP A;  3BNB A;  4WFO A;  3J7Y d;  1FGO A;  1F8N A;  3SX1 A;  3UL5 A;  2HMK B;  3CC2 3;  2QA4 3;  3H51 A;  1VQM 3;  3FF0 A;  1TFO A;  3LML A;  2W04 A;  3EE1 A;  3CPW 2;  4AKZ A;  3GRD A;  1A2V A;  3G71 3;  1QJG A;  1K9M 4;  4WP5 A;  3FSD A;  3KKG A;  1VQ5 3;  1SPU A;  4MJD A;  1OCV A;  4STD A;  1WTH A;  1N9J A;  4HJL B;  2P38 A;  2HMN B;  2CFW A;  1FA3 A;  2OTL 3;  1AVK A;  1VQ4 3;  2XEP A;  4XDV A;  3WDG B;  1VZZ A;  2P05 A;  2ML5 A;  4Q53 A;  4R80 A;  3N9H A;  1QVG 2;  2R4I A;  3B4P A;  4JRF A;  1K41 A;  4HM8 B;  1IVU A;  2W03 A;  2GXF A;  2WOH A;  3QRD A;  3VGN A;  3NM2 A;  1PU4 A;  2F99 A;  1U8C B;  3K7C A;  5D81 A;  3K9M C;  1IQY A;  3S5C A;  2LQV A;  3LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...