5CK6A

Crystal structure of sz348 in complex with cyclopentene oxide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
b'HHHHHHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal structure of SZ348 in complex with cyclopentene oxide
rcsb
source organism Rhodococcus erythropolis
molecule tags Hydrolase
total genus 42
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ck6A00
2JQ5A 5AIHA 3WMDA 1BUQA 8CHOA 3G16A 3UNLA 5AIGA 2BNGA 4HJLB 1VZZA 1WQLB 1OHSA 2XSHB 1OPYA 2A15A 3HK4A 5AEWB 4HZBB 4HM8B 3BLZA 1EG9B 2YFLB 1GY7A 2QIYA 5IG5A 4HZ9B 3GZYB 1A2KA 3EN1B 4HM4B 5IENA 4IIAA 2HMNB 2HMJB 2RFRA 5D82A 2GEXA 2W2CA 4KVHA 1O7WB 1UUVB 2GXFA 4HKVB 5CF2A 4HM5B 3JUPA 3OWYA 4U13A 5HGRA 2INXA 3MSOA 1QMAA 1JKGA 4HM7B 4XM4A 3SEDA 3H3HA 2B1XB 5CF1A 3MG1A 1OF5B 1OUNA 3GZBA 3JUOA 4R9LA 1ISKA 5AEUB 1IDPA 4PEJA 2PZVA 1ZX2A 4Q53A 3STDA 3E99A 3F8HA 4XDVA 4XBYA 3T8UA 3S5CA 5G2GA 3K7CA 3NM2A 5D81A 3FF0A 1JB2A 1SJWA 1O7PB 4J9AA 2IMJA 3SOAA 3B7CA 5TGNA 1OGZA 1W01A 3B8LA 5CLKA 2F86B 3T8NA 2Z7AA 4FCJA 4J8TA 3GZRA 3EJVA 1JN5B 3GZXB 1OH0A 1K41A 2XR8B 1EA2A 1E97A 3OV4A 5IF6A 3OXAA 5AIIA 4FCMA 3DXOA 3KKGA 5BXQA 4XB5A 4OVMA 3GWRA 2QGUA 2STDA 3KSPA 3LZAA 5JPUA 1O7HB 3JUNA 1TUHA 4XDWA 5CXOA 1JKGB 1NU3A 2YFIB 1TP6A 5IERA 1DMMA 5EVHA 2CHCA 5KP1A 5AIFA 3CNMA 3F14A 1STDA 3EF8A 4HVNA 3F9SA 1JN5A 4HM3B 1HKXA 5KP4A 2GBXB 7STDA 2Z76A 4ORLA 3NXJA 3DM8A 3Q90A 3A76A 3I0YA 3ECFA 3ER7A 5IEPA 1ASKA 4HM2B 1GY5A 3JUQA 3VSYA 3CU3A 3NHXA 5KP3A 4GB5A 1DMQA 4WP5A 1GS3A 3FSDA 2HMKB 4XBXA 2HMMB 2CKFB 2I9WA 3F7SA 3FKAA 3MYTA 1DMNA 5IG4A 1GY6A 3MG2A 1QJGA 1Q42A 1JB5A 4N3VA 2B24B 1JB4A 2HMOB 4LGQA 4LMIA 4R1KA 3MG3A 4X2OA 2F98A 1W6YA 1U5OA 3UJMA 1W00A 4HM1B 3EN8A 4L7KA 4RZMA 1S5AA 4WYKA 1NDOB 3RGAA 3NUVA 3HZPA 4LEHA 1OCVA 5D83A 2XSOB 1OHPA 3CPOA 3OWUA 2BMQB 4STDA 3D9RA 3B4OA 2Z77A 2BMOB 1ULJB 4K1UA 3G8ZA 2HMLB 5IG3A 3IPTA 1Q40A 2R4IA 4L8OA 1NWWA 3H51A 1W02A 5FW5A 3SOYA 3BB9A 3FGYA 3EHCA 5JPPA 1GYBA 3OWSA 3F8XA 3HX8A 2K54A 1AR0A 3EX9A 4R9KA 1E3RA 3EQQB 3FH1A 5IG0A 2XRXB 3NV0A 1E3VA 4CDLA 3FF2A 4L8PA 2YFJB 5DRVA 5CK6A 3F7XA 4I4KA 3G0KA 3DMCA 3NBRA 5STDA 2OWPA 3EBYA 4XBTA 3VGNA 3MHEA 4OUQA 1O7GB 3M8CA 1OHOA 4WYKB 3EC9A 3DUKA 5AI1A 1CQSA 3K0ZA 4X2HA 2UX0A 5IEOA 2GEYA 1Q40B 5DREA 1C7HA 2BMRB 2RGQA 3B4PA 3OX9A 4HM6B 3RGRA 3ROBA 3FZWA 3EBTA 5BVBA 3GRDA 3F40A 1Z1SA 1UUWB 3CNXA 3DZLA 1O7MB 3KE7A 1ULIB 6STDA 4H3UA 2GBWB 3FLJA 3KZTA 2RCDA 1ZO2A 4WWUC 3MKIA 3NV0B 2F99A 1O7NB 1OF5A 1OGXA 3JUMA 4HM0B 3LYGA 4MJDA 4K1VA
chains in the Genus database with same CATH superfamily
1NO3A 3X42A 4AKYA 1V74A 1UGIA 4BTXA 2JQ5A 1BSBA 2FGTA 5AIHA 3WMDA 1RNBA 1BUQA 1BRSA 8CHOA 3G16A 1RDSA 1WNHA 3HIIA 3UNLA 3CCU3 3X3XA 3WDGB 2E2UA 1G0TA 1Q814 5AIGA 2BNGA 4HJLB 3CCL3 1VZZA 2XH9A 2XGNA 1EUIC 1WQLB 4KFEA 1OHSA 4N6MA 3ZFZA 3HOHA 3U1WA 3GSPA 3X3ZA 1IQXA 2XSHB 1J2BA 3EB8A 2CX0A 1OPYA 1QVF2 1NNVA 4HYZA 2A15A 2WO0A 3IJEB 3HK4A 1SIIA 5AEWB 1B2ZA 8RNTA 3V92A 3V99A 4HZBB 5G1KA 1IVWA 4HM8B 2CX1A 3BLZA 1EG9B 4NHFA 2YFLB 5ELUA 1GY7A 2W04A 2P05A 2QIYA 5IG5A 3DGMA 3A5EA 2QA43 4HZ9B 3GZYB 4JF8A 3KCHA 3LXUX 1UCJA 1BOXA 2XEPA 1RCLA 1KD14 4OK0A 2CWVA 1A2KA 3EN1B 4HM4B 4EXRA 5IENA 4IIAA 2HMNB 2HMJB 1CYVA 2RFRA 4EW5A 1FZUA 1Q7Y4 3FG1A 2K3DA 5D82A 3ZG5A 1N9EA 1GD3A 2GEXA 1HYFA 2W2CA 3BNDA 4KVHA 3CPW2 4RNTA 2K0MA 2XFTA 4ZM8A 1O7WB 3CCJ3 1UUVB 1QAKA 1GSPA 4MMZB 2W03A 2R41A 2P38A 2GXFA 1EKMA 2LQVA 3L0RA 3D4AA 1GOVA 2OQEC 9RNTA 4HKVB 5EEOA 1RHLA 3PYJA 1MWSA 7GSPA 5CF2A 1BSCA 1HZ1A 1MWUA 2AADA 4HM5B 3G6E3 2W6JH 3KN4A 4BU4A 3JUPA 2GSPA 1VQ83 3OWYA 2KAAA 1YIT3 5HOHA 1RRHA 2BT3A 4U13A 1B2UA 1K9M4 5HGRA 2INXA 3CC23 3MSOA 1BSEA 1IQYA 2KF4A 1AQZA 1LOYA 1QMAA 3K9MC 5AYRB 1JKGA 4NREA 1RKYA 1LNHA 4HM7B 4XM4A 2OOVA 3H3HA 3SEDA 2B1XB 4MMYB 5CF1A 3DGYA 2RBIA 2CFLA 3MG1A 1YI23 1OF5B 3D79A 1W2ZA 1OUNA 1DVCA 6GSPA 2XGLA 1G02A 2GU3A 1SIHA 1B2XA 1W4NA 3GZBA 2ZHXB 1X1YA 3FG4A 1BNEA 1BU4A 3JUOA 3QK9A 1GMPA 3D3LA 4R9LA 5AEUB 4EBGA 4AKZA 1ISKA 1IDPA 1LXEA 2LYXA 3BNEA 3LTCA 4PEJA 2PZVA 1BRKA 2XF3A 1F8NA 3VF1A 1BSAA 1ZX2A 1I0XA 4Q53A 1VQ73 3STDA 1IQ8A 3E99A 3F8HA 4XDVA 5BIRA 4XBYA 1TTOA 2CK3H 2D42A 3T8UA 1RLSA 2MF7A 1NB3I 5G2GA 3S5CA 1CYUA 3K7CA 2OOVC 3NM2A 1UCLA 1Q864 5D81A 3FF0A 1JB2A 1SJWA 1TJDA 1VQN3 1O7PB 3WA3A 1M904 2IMJA 4J9AA 3SOAA 1JNQA 4BL2A 1B27A 3CC43 1UI7A 4I5QA 3S27A 2KCDA 3B7CA 4KT3B 3WR2A 5EQLA 3DGNA 3CXC2 1FW7A 2CH9A 5TGNA 3K5TA 2MC8A 1VQ63 2GU1A 3I563 4FMCA 3AMOA 2CWUA 1OGZA 1W01A 3B8LA 5CLKA 1VQO3 4G1MB 1GD4A 2F86B 3T8NA 2Z7AA 1I0VA 1GMQA 1KWIA 3LT9A 4HAAA 3UB1A 4R80A 1Q7HA 1BANA 1G96A 4FCJA 4J8TA 4K61A 3JVCA 4O3VA 4FR9A 5LC6A 3URPA 2HOHA 1S723 3X3YA 1MOLA 3GZRA 3PZWA 1B2SA 3EJVA 2CFKA 1JN5B 1R4YA 3GZXB 1JRQA 2KXGA 3D5GA 1OH0A 2W56A 1K41A 2W9PA 1I2EA 1EQKA 1BVIA 2SARA 1BRHA 2XR8B 3Q3FA 4JRFA 1OACA 1JJ22 1EA2A 4N6OB 1E97A 3OV4A 5IF6A 3G713 1ZS7A 1I3IA 3OXAA 1SQWA 5AIIA 1PYLA 1KC84 3KFQC 3X40A 1A67A 4FCMA 1M1K4 3DXOA 2KF6A 3KKGA 1VQM3 4FMBA 3MPHA 1BAOA 3CCR3 2Z6BA 5BXQA 1IK3A 4GHOA 1BNFA 4XB5A 1MNLA 2RNTA 4OVMA 2BHMA 2D1WA 2QGUA 2STDA 3GWRA 3KSPA 3LZAA 2WOFA 4EYCA 4RNYA 2Q07A 3SX1A 1A2PA 1O7HB 3JUNA 1TUHA 2JDIH 3BNCA 1BNRA 1BRNL 1JV2B 2F4YA 4XDWA 5CXOA 4N6TA 2OQEA 3CCS3 1JKGB 1NU3A 2YFIB 3NM7A 2KF5A 1TP6A 4O2HA 1MWTA 4BIRA 1VQL3 5IERA 1DMMA 1T2HA 5EVHA 2CHCA 1X1WA 2C4BA 2CW9A 1DVDA 4O8SA 1B3SA 5KP1A 1FA3A 4N6UA 5AIFA 1YVBI 2KRTA 1RGHA 3CNMA 3F14A 3NQYA 1VQ43 1STDA 3EF8A 4HVNA 3RDEA 2WOHA 3UL5A 3F9SA 1YIJ3 1VQ53 4R4KA 1JN5A 4HM3B 2IUJA 1YVSA 1HKXA 1RCKA 1I70A 2GBXB 7STDA 5KP4A 2Z76A 1UI8A 4K90B 2ML6A 4ORLA 2BU4A 1TU5A 3NXJA 4KFFA 3DM8A 1N8QA 1FGMA 3Q90A 1AY7A 1FUTA 1I3FA 3A76A 3T0UA 1YNVX 1V57A 3I0YA 1IT7A 4TX4A 2WGQA 3ECFA 3ER7A 5IEPA 3CC73 4EC6A 1W7CA 1T2IA 3J7Yd 1RN1A 1ASKA 1B21A 1A2VA 2J8XB 4HM2B 4WHAA 1SPUA 4NPBA 1GY5A 1SARA 3JUQA 5FGOA 3VSYA 4N6NB 2H0GA 3CU3A 3NHXA 2Y74A 5KP3A 3PGBA 4GB5A 1DMQA 2IYJA 5JPUA 3I553 5M18A 1BGSA 1IT8A 1DETA 1U8CB 4WP5A 6RNTA 3AMOB 3O8YA 1GS3A 1FGTA 1T5YA 3FSDA 1DE3A 2HMKB 1FUWA 4XBXA 1V58A 2HMMB 1RGCA 2Y73A 2CG0A 1MGWA 1TIJA 1FUSA 2CKFB 2PNCA 3PCRA 2I9WA 3F7SA 3N8BA 1RGAA 3FKAA 3MYTA 4FMDA 1LQMB 1FGOA 2IA7A 5IW9A 2IY2A 1RSNA 2CFGA 2P09A 3AGNA 2W56B 2E2TA 3PS8A 1QVG2 1DMNA 2F56A 3SXXA 5IG4A 1GY6A 1PY3A 1MWRA 1VQQA 3MG2A 1QJGA 3EE1A 2L4VA 3HIGA 1Q42A 1JB5A 3D5IA 1LNIA 3SYUA 2ZL8A 4N3VA 2SBLA 3PXMA 2B24B 1N8R4 1JB4A 2C11A 1BRGA 2HMOB 4LGQA 3CCV3 3V98A 1VQP3 1TFOA 1JZOA 3LTDA 1WTHA 4LMIA 1LQGC 4R1KA 3MG3A 1BSDA 5GSPA 4X2OA 1BIRA 2F98A 1W6YA 1U5OA 5M19A 4J5KA 3KIIA 1W00A 4RBNA 3UJMA 3OW22 2UUGC 4HM1B 2C10A 3EN8A 3S67A 4KZ1A 1BUJA 1UUGB 4L7KA 4RZMA 1S5AA 3DY5A 4IPBA 3N9HA 5M1AA 1JZDA 1UGHI 3DGLA 4WYKA 3QRDA 1NDOB 3RGAA 2IUKA 3NUVA 3LOYA 1RGFA 3HZPA 4J5GA 4LEHA 4CPKA 1OCVA 3AGOA 4O02B 1RGGA 5D83A 2XSOB 2O9UX 1B20A 1OHPA 3X41A 3CPOA 3OWUA 1WMOA 1AV4A 1AVLA 3DH2A 3LH4A 3FG3A 3G4S3 2BMQB 3D9RA 3MWZA 1YGEA 1KSIA 2Z77A 2BMOB 3B4OA 4STDA 3AHWA 3LMLA 4MMXB 3U97A 1N5PA 1ULJB 5BU4A 2WGOA 4K1UA 3G8ZA 2HMLB 5IG3A 3IPTA 1Q40A 2R4IA 1GOYA 1BNGA 3IMAB 1NB5I 4KFDA 4L8OA 1NWWA 3H51A 1Q824 2P0MA 4BTWA 2UGIA 1W02A 5FW5A 4BTYA 1T3BA 2ML5A 2KF3A 3SOYA 4CCVA 1RGLA 1NJI4 1YJN3 1UDII 1W6CA 3BB9A 3NX0A 3WOEB 1WMNA 1GMRA 5RNTA 3FGYA 3EHCA 3CCE3 2CFDA 5JPPA 1EEJA 1IVVA 1GYBA 2L1SA 1YJW3 1W2B2 1JBSA 3OWSA 3F8XA 3HX8A 3WODG 4AEQA 3LT8A 4FCZA 2K54A 2E2VA 4LZIA 3RNTA 1AR0A 1IYYA 2ZA4A 3EX9A 4WFOA 2YX9A 5I97A 3KSED 4HBRA 1D6UA 2M7OA 4R9KA 3SVAA 1E3RA 2F5WA 2O3OA 3EQQB 3FH1A 1IVUA 2FXTA 5IG0A 1VQ93 1UCKA 2XRXB 1YHQ3 2ZDJA 3LTAA 1DYUA 4FMAA 1CH0A 4ILFA 1WMPA 3NV0A 3WOFB 1IV7A 1E3VA 1KQS2 1JBRA 2AAEA 5JBSA 1LOVA 1BNSA 1LOWA 4CDLA 2RSXA 3FF2A 2BIRA 4L8PA 2BO9B 2YFJB 5DRVA 2H0IA 1US1A 5CK6A 1PU4A 1C54A 3F7XA 1VQK3 3SLUA 2CC3A 1Y4KA 1IVXA 1BRIA 1D6ZA 4I4KA 1ZGXA 3G0KA 3UL6A 3DMCA 1RGEA 3CD63 1LRAA 2CIUA 3ALAA 3NBRA 2CFWA 5STDA 2OWPA 1RJOA 2V1LA 3EBYA 1YGWA 4MEIA 4XBTA 3VGNA 1X1UA 3MHEA 3GAXA 3CCQ3 4RNZA 1YJ93 3WA2X 4OUQA 1M9GA 1K28A 1O7GB 2FNQA 3M8CA 3NQZA 5G1LA 1W5ZA 1OHOA 1IV9A 4CJNA 2OCTA 1MGRA 4WYKB 4N6V0 2P0XA 1FYSA 1AVKA 1K734 1JBTA 1RRLA 3EC9A 1A90A 3BIRA 4IT7A 1GOUA 3DUKA 2CG1A 1ROVA 5AI1A 3Q2PA 1K8A4 3LTBA 4N6LA 1CQSA 3K0ZA 1RTUA 4X2HA 1I2FA 2UX0A 5IEOA 1M1XB 3CME3 3TDGA 1D6YA 2GEYA 4QWTA 7RNTA 1RNTA 3Q1CA 1CEWI 2W0QA 1Q40B 1TRPA 1RN4A 4LYLB 3S28A 4H61A 4BL3A 1Q9EA 4EV5A 1UW1A 5DREA 1C7HA 2BMRB 2RGQA 5AYSC 3CCM3 3B4PA 3OX9A 4HM6B 3AHSA 3RGRA 3FCSB 3ZG0A 3S29A 4EV2A 1BNJA 1STFI 3ROBA 2QEX3 1L5GB 1QAFA 3FZWA 3EBTA 1R4CA 3HI7A 5BVBA 2OTJ3 3GRDA 1N5HA 4GSPA 1W6GA 3F40A 1TRQA 3NBBA 4LSOA 1RN7A 2CWTA 1Z1SA 3K63A 1UUWB 3PCSA 3CNXA 2XFSA 1BRJA 3DGOA 1LVNA 1LOXA 1UCIA 3DZLA 1O7MB 2H0HA 3KE7A 1FGQA 5LC7A 1ULIB 3BNBA 1IU7A 1RMSA 6STDA 3CMA3 1N9JA 3BU4A 4H3UA 1QALA 1X1XA 1I8VA 2GBWB 4GL6A 4DKIA 3N54B 3FLJA 1PFPA 3KZTA 1FGRA 4HOHA 2RCDA 1ZO2A 4WWUC 1HU9A 3WHOA 3MKIA 3NV0B 2F99A 1O7NB 1OF5A 2OTL3 1I2GA 1OGXA 3JUMA 5A0OB 1B2MA 2W9QA 1BNIA 1RGKA 1ROAA 5ELJA 3NBJA 4HM0B 3LYGA 4MJDA 1TFKA 4K1VA 2F5MA
chains in the Genus database with same CATH topology
1NO3A 3X42A 4AKYA 1V74A 4BTXA 2JQ5A 2FGTA 5AIHA 3WMDA 1BUQA 8CHOA 3G16A 3CCU3 1WNHA 3HIIA 3UNLA 3X3XA 3WDGB 2E2UA 1Q814 5AIGA 2BNGA 4HJLB 3CCL3 1VZZA 2XH9A 2XGNA 1WQLB 4KFEA 1OHSA 4N6MA 3U1WA 3X3ZA 1IQXA 2XSHB 1J2BA 3EB8A 1OPYA 1QVF2 4HYZA 2A15A 2WO0A 3IJEB 3HK4A 1SIIA 5AEWB 3V92A 3V99A 4HZBB 1IVWA 4HM8B 3BLZA 1EG9B 4NHFA 2YFLB 5ELUA 1GY7A 2W04A 2P05A 2QIYA 5IG5A 3DGMA 2QA43 4HZ9B 3GZYB 4JF8A 3LXUX 2XEPA 1KD14 4OK0A 2CWVA 1A2KA 3EN1B 4HM4B 4EXRA 5IENA 4IIAA 2HMNB 2HMJB 1CYVA 2RFRA 1Q7Y4 3FG1A 5D82A 1N9EA 1GD3A 2GEXA 2W2CA 3BNDA 4KVHA 3CPW2 4ZM8A 2K0MA 2XFTA 1O7WB 3CCJ3 1UUVB 1QAKA 4MMZB 2W03A 2P38A 2GXFA 1EKMA 2LQVA 3L0RA 2OQEC 4HKVB 5EEOA 3PYJA 5CF2A 4HM5B 3G6E3 2W6JH 3KN4A 1VQ83 3JUPA 3OWYA 1YIT3 1RRHA 2BT3A 4U13A 1K9M4 5HGRA 2INXA 3CC23 3MSOA 1IQYA 1QMAA 3K9MC 5AYRB 1JKGA 4NREA 1RKYA 1LNHA 4HM7B 4XM4A 2OOVA 3H3HA 3SEDA 2B1XB 4MMYB 5CF1A 2CFLA 3MG1A 1YI23 1OF5B 1W2ZA 1OUNA 1DVCA 2XGLA 2GU3A 1SIHA 1W4NA 3GZBA 3FG4A 3JUOA 3QK9A 4R9LA 3D3LA 5AEUB 1ISKA 4EBGA 4AKZA 1IDPA 1LXEA 2LYXA 3BNEA 3LTCA 4PEJA 2PZVA 2XF3A 3VF1A 1F8NA 1ZX2A 4Q53A 1VQ73 3STDA 1IQ8A 3E99A 3F8HA 4XDVA 4XBYA 2CK3H 2D42A 3T8UA 2MF7A 1NB3I 5G2GA 3S5CA 1CYUA 3K7CA 2OOVC 3NM2A 1Q864 5D81A 3FF0A 1JB2A 1SJWA 1VQN3 1O7PB 3WA3A 1M904 2IMJA 4J9AA 3SOAA 1JNQA 3CC43 1UI7A 3S27A 2KCDA 3B7CA 5EQLA 3DGNA 3CXC2 2CH9A 5TGNA 3K5TA 2MC8A 1VQ63 2GU1A 3I563 4FMCA 3AMOA 2CWUA 1OGZA 1W01A 3B8LA 5CLKA 1VQO3 4G1MB 1GD4A 2F86B 3T8NA 2Z7AA 3UB1A 3LT9A 1KWIA 4R80A 1G96A 4FCJA 4J8TA 4K61A 3JVCA 4O3VA 4FR9A 5LC6A 1S723 3X3YA 1MOLA 3GZRA 3PZWA 3EJVA 2CFKA 1JN5B 3GZXB 1JRQA 2KXGA 2W9PA 1OH0A 1K41A 2W56A 1EQKA 2XR8B 4JRFA 1OACA 1JJ22 1EA2A 4N6OB 1E97A 3OV4A 5IF6A 3G713 3OXAA 1SQWA 5AIIA 1KC84 3KFQC 3X40A 1A67A 4FCMA 1M1K4 3DXOA 3KKGA 1VQM3 4FMBA 3MPHA 3CCR3 2Z6BA 5BXQA 1IK3A 4XB5A 1MNLA 4OVMA 2BHMA 2D1WA 2QGUA 2STDA 3GWRA 3KSPA 3LZAA 2WOFA 4EYCA 4RNYA 2Q07A 3SX1A 1O7HB 3JUNA 1TUHA 2JDIH 3BNCA 1JV2B 4XDWA 5CXOA 4N6TA 2OQEA 3CCS3 1JKGB 1NU3A 2YFIB 3NM7A 1TP6A 4O2HA 1VQL3 5IERA 1DMMA 5EVHA 2CHCA 2CW9A 1DVDA 4O8SA 5KP1A 1FA3A 4N6UA 5AIFA 1YVBI 2KRTA 3CNMA 3F14A 3NQYA 1VQ43 1STDA 3EF8A 4HVNA 3RDEA 2WOHA 3UL5A 3F9SA 1YIJ3 1VQ53 4R4KA 1JN5A 4HM3B 2IUJA 1HKXA 5KP4A 2GBXB 7STDA 2Z76A 1UI8A 4K90B 2ML6A 4ORLA 1TU5A 3NXJA 4KFFA 3DM8A 1N8QA 1FGMA 3Q90A 3T0UA 3A76A 3I0YA 1IT7A 4TX4A 2WGQA 3ECFA 3ER7A 5IEPA 3CC73 4EC6A 1W7CA 3J7Yd 1ASKA 1A2VA 4HM2B 4WHAA 1SPUA 1GY5A 3JUQA 5FGOA 3VSYA 4N6NB 3CU3A 3NHXA 2Y74A 5KP3A 3PGBA 4GB5A 1DMQA 5JPUA 3I553 1IT8A 1U8CB 4WP5A 3AMOB 3O8YA 1GS3A 1FGTA 1T5YA 3FSDA 2HMKB 1FUWA 4XBXA 2HMMB 2Y73A 2CG0A 1TIJA 2CKFB 2PNCA 3PCRA 2I9WA 3F7SA 3N8BA 3FKAA 3MYTA 4FMDA 1FGOA 2IA7A 5IW9A 2CFGA 2P09A 2W56B 2E2TA 3PS8A 1QVG2 1DMNA 3SXXA 5IG4A 1GY6A 3MG2A 1QJGA 3EE1A 2L4VA 3HIGA 1Q42A 1JB5A 2ZL8A 4N3VA 2SBLA 3PXMA 2B24B 1N8R4 1JB4A 2C11A 2HMOB 4LGQA 3CCV3 3V98A 1VQP3 1TFOA 3LTDA 1WTHA 4LMIA 4R1KA 3MG3A 4X2OA 2F98A 1W6YA 1U5OA 4RBNA 3KIIA 1W00A 3UJMA 3OW22 4HM1B 2C10A 3EN8A 3S67A 4KZ1A 4L7KA 4RZMA 1S5AA 3DY5A 4IPBA 3N9HA 3DGLA 4WYKA 3QRDA 1NDOB 3RGAA 2IUKA 3NUVA 3LOYA 3HZPA 4LEHA 1OCVA 4O02B 5D83A 2XSOB 2O9UX 3X41A 1OHPA 3CPOA 3OWUA 1WMOA 1AV4A 1AVLA 3LH4A 3FG3A 3G4S3 2BMQB 3D9RA 3MWZA 1YGEA 1KSIA 2Z77A 2BMOB 3B4OA 4STDA 3LMLA 4MMXB 3U97A 1N5PA 1ULJB 2WGOA 4K1UA 3G8ZA 2HMLB 5IG3A 3IPTA 1Q40A 2R4IA 3IMAB 1NB5I 4KFDA 4L8OA 1NWWA 3H51A 1Q824 2P0MA 4BTWA 1W02A 5FW5A 4BTYA 4CCVA 2ML5A 3SOYA 1NJI4 1YJN3 1W6CA 3BB9A 3NX0A 3WOEB 1WMNA 3FGYA 3EHCA 3CCE3 2CFDA 5JPPA 1IVVA 1GYBA 1YJW3 1W2B2 3OWSA 3F8XA 3HX8A 3WODG 4AEQA 3LT8A 4FCZA 2K54A 2E2VA 4LZIA 1AR0A 3EX9A 4WFOA 2YX9A 5I97A 3KSED 4HBRA 1D6UA 2M7OA 4R9KA 3SVAA 1E3RA 3EQQB 2O3OA 3FH1A 1IVUA 2FXTA 5IG0A 1VQ93 2XRXB 1YHQ3 2ZDJA 3LTAA 1DYUA 4FMAA 1WMPA 3NV0A 3WOFB 1IV7A 1E3VA 1KQS2 5JBSA 4CDLA 2RSXA 3FF2A 4L8PA 2BO9B 2YFJB 5DRVA 5CK6A 1US1A 1PU4A 3F7XA 1VQK3 3SLUA 2CC3A 1Y4KA 1IVXA 1D6ZA 4I4KA 3UL6A 3G0KA 3DMCA 3CD63 2CIUA 3ALAA 3NBRA 2CFWA 5STDA 2OWPA 1RJOA 2V1LA 3EBYA 4MEIA 4XBTA 3VGNA 3MHEA 3GAXA 3CCQ3 4RNZA 1YJ93 3WA2X 4OUQA 1M9GA 1K28A 1O7GB 2FNQA 3M8CA 3NQZA 1W5ZA 1OHOA 1IV9A 2OCTA 4WYKB 4N6V0 2P0XA 1K734 1AVKA 1RRLA 3EC9A 1A90A 4IT7A 3DUKA 2CG1A 1ROVA 5AI1A 3Q2PA 1K8A4 3LTBA 4N6LA 1CQSA 3K0ZA 4X2HA 2UX0A 5IEOA 1M1XB 3CME3 3TDGA 1D6YA 2GEYA 4QWTA 3Q1CA 1CEWI 2W0QA 1Q40B 3S28A 4H61A 4EV5A 1UW1A 5DREA 1C7HA 2BMRB 2RGQA 5AYSC 3CCM3 3B4PA 3OX9A 4HM6B 3RGRA 3FCSB 3S29A 4EV2A 1STFI 3ROBA 2QEX3 1L5GB 1QAFA 3FZWA 3EBTA 1R4CA 3HI7A 5BVBA 2OTJ3 3GRDA 1N5HA 1W6GA 3F40A 3NBBA 4LSOA 1RN7A 2CWTA 1Z1SA 3K63A 1UUWB 3PCSA 3CNXA 2XFSA 3DGOA 1LVNA 1LOXA 3DZLA 1O7MB 3KE7A 5LC7A 1FGQA 1ULIB 3BNBA 1IU7A 6STDA 3CMA3 1N9JA 4H3UA 1QALA 2GBWB 4GL6A 3N54B 3FLJA 1PFPA 3KZTA 1FGRA 2RCDA 1ZO2A 4WWUC 1HU9A 3MKIA 3NV0B 2F99A 1O7NB 1OF5A 2OTL3 1OGXA 3JUMA 5A0OB 2W9QA 1ROAA 5ELJA 3NBJA 4HM0B 3LYGA 4MJDA 1TFKA 4K1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQ5 A;  5AIH A;  3WMD A;  1BUQ A;  8CHO A;  3G16 A;  3UNL A;  5AIG A;  2BNG A;  4HJL B;  1VZZ A;  1WQL B;  1OHS A;  2XSH B;  1OPY A;  2A15 A;  3HK4 A;  5AEW B;  4HZB B;  4HM8 B;  3BLZ A;  1EG9 B;  2YFL B;  1GY7 A;  2QIY A;  5IG5 A;  4HZ9 B;  3GZY B;  1A2K A;  3EN1 B;  4HM4 B;  5IEN A;  4IIA A;  2HMN B;  2HMJ B;  2RFR A;  5D82 A;  2GEX A;  2W2C A;  4KVH A;  1O7W B;  1UUV B;  2GXF A;  4HKV B;  5CF2 A;  4HM5 B;  3JUP A;  3OWY A;  4U13 A;  5HGR A;  2INX A;  3MSO A;  1QMA A;  1JKG A;  4HM7 B;  4XM4 A;  3SED A;  3H3H A;  2B1X B;  5CF1 A;  3MG1 A;  1OF5 B;  1OUN A;  3GZB A;  3JUO A;  4R9L A;  1ISK A;  5AEU B;  1IDP A;  4PEJ A;  2PZV A;  1ZX2 A;  4Q53 A;  3STD A;  3E99 A;  3F8H A;  4XDV A;  4XBY A;  3T8U A;  3S5C A;  5G2G A;  3K7C A;  3NM2 A;  5D81 A;  3FF0 A;  1JB2 A;  1SJW A;  1O7P B;  4J9A A;  2IMJ A;  3SOA A;  3B7C A;  5TGN A;  1OGZ A;  1W01 A;  3B8L A;  5CLK A;  2F86 B;  3T8N A;  2Z7A A;  4FCJ A;  4J8T A;  3GZR A;  3EJV A;  1JN5 B;  3GZX B;  1OH0 A;  1K41 A;  2XR8 B;  1EA2 A;  1E97 A;  3OV4 A;  5IF6 A;  3OXA A;  5AII A;  4FCM A;  3DXO A;  3KKG A;  5BXQ A;  4XB5 A;  4OVM A;  3GWR A;  2QGU A;  2STD A;  3KSP A;  3LZA A;  5JPU A;  1O7H B;  3JUN A;  1TUH A;  4XDW A;  5CXO A;  1JKG B;  1NU3 A;  2YFI B;  1TP6 A;  5IER A;  1DMM A;  5EVH A;  2CHC A;  5KP1 A;  5AIF A;  3CNM A;  3F14 A;  1STD A;  3EF8 A;  4HVN A;  3F9S A;  1JN5 A;  4HM3 B;  1HKX A;  5KP4 A;  2GBX B;  7STD A;  2Z76 A;  4ORL A;  3NXJ A;  3DM8 A;  3Q90 A;  3A76 A;  3I0Y A;  3ECF A;  3ER7 A;  5IEP A;  1ASK A;  4HM2 B;  1GY5 A;  3JUQ A;  3VSY A;  3CU3 A;  3NHX A;  5KP3 A;  4GB5 A;  1DMQ A;  4WP5 A;  1GS3 A;  3FSD A;  2HMK B;  4XBX A;  2HMM B;  2CKF B;  2I9W A;  3F7S A;  3FKA A;  3MYT A;  1DMN A;  5IG4 A;  1GY6 A;  3MG2 A;  1QJG A;  1Q42 A;  1JB5 A;  4N3V A;  2B24 B;  1JB4 A;  2HMO B;  4LGQ A;  4LMI A;  4R1K A;  3MG3 A;  4X2O A;  2F98 A;  1W6Y A;  1U5O A;  3UJM A;  1W00 A;  4HM1 B;  3EN8 A;  4L7K A;  4RZM A;  1S5A A;  4WYK A;  1NDO B;  3RGA A;  3NUV A;  3HZP A;  4LEH A;  1OCV A;  5D83 A;  2XSO B;  1OHP A;  3CPO A;  3OWU A;  2BMQ B;  4STD A;  3D9R A;  3B4O A;  2Z77 A;  2BMO B;  1ULJ B;  4K1U A;  3G8Z A;  2HML B;  5IG3 A;  3IPT A;  1Q40 A;  2R4I A;  4L8O A;  1NWW A;  3H51 A;  1W02 A;  5FW5 A;  3SOY A;  3BB9 A;  3FGY A;  3EHC A;  5JPP A;  1GYB A;  3OWS A;  3F8X A;  3HX8 A;  2K54 A;  1AR0 A;  3EX9 A;  4R9K A;  1E3R A;  3EQQ B;  3FH1 A;  5IG0 A;  2XRX B;  3NV0 A;  1E3V A;  4CDL A;  3FF2 A;  4L8P A;  2YFJ B;  5DRV A;  5CK6 A;  3F7X A;  4I4K A;  3G0K A;  3DMC A;  3NBR A;  5STD A;  2OWP A;  3EBY A;  4XBT A;  3VGN A;  3MHE A;  4OUQ A;  1O7G B;  3M8C A;  1OHO A;  4WYK B;  3EC9 A;  3DUK A;  5AI1 A;  1CQS A;  3K0Z A;  4X2H A;  2UX0 A;  5IEO A;  2GEY A;  1Q40 B;  5DRE A;  1C7H A;  2BMR B;  2RGQ A;  3B4P A;  3OX9 A;  4HM6 B;  3RGR A;  3ROB A;  3FZW A;  3EBT A;  5BVB A;  3GRD A;  3F40 A;  1Z1S A;  1UUW B;  3CNX A;  3DZL A;  1O7M B;  3KE7 A;  1ULI B;  6STD A;  4H3U A;  2GBW B;  3FLJ A;  3KZT A;  2RCD A;  1ZO2 A;  4WWU C;  3MKI A;  3NV0 B;  2F99 A;  1O7N B;  1OF5 A;  1OGX A;  3JUM A;  4HM0 B;  3LYG A;  4MJD A;  4K1V A; 
#chains in the Genus database with same CATH topology
 1NO3 A;  3X42 A;  4AKY A;  1V74 A;  1UGI A;  4BTX A;  2JQ5 A;  1BSB A;  2FGT A;  5AIH A;  3WMD A;  1RNB A;  1BUQ A;  1BRS A;  8CHO A;  3G16 A;  1RDS A;  1WNH A;  3HII A;  3UNL A;  3CCU 3;  3X3X A;  3WDG B;  2E2U A;  1G0T A;  1Q81 4;  5AIG A;  2BNG A;  4HJL B;  3CCL 3;  1VZZ A;  2XH9 A;  2XGN A;  1EUI C;  1WQL B;  4KFE A;  1OHS A;  4N6M A;  3ZFZ A;  3HOH A;  3U1W A;  3GSP A;  3X3Z A;  1IQX A;  2XSH B;  1J2B A;  3EB8 A;  2CX0 A;  1OPY A;  1QVF 2;  1NNV A;  4HYZ A;  2A15 A;  2WO0 A;  3IJE B;  3HK4 A;  1SII A;  5AEW B;  1B2Z A;  8RNT A;  3V92 A;  3V99 A;  4HZB B;  5G1K A;  1IVW A;  4HM8 B;  2CX1 A;  3BLZ A;  1EG9 B;  4NHF A;  2YFL B;  5ELU A;  1GY7 A;  2W04 A;  2P05 A;  2QIY A;  5IG5 A;  3DGM A;  3A5E A;  2QA4 3;  4HZ9 B;  3GZY B;  4JF8 A;  3KCH A;  3LXU X;  1UCJ A;  1BOX A;  2XEP A;  1RCL A;  1KD1 4;  4OK0 A;  2CWV A;  1A2K A;  3EN1 B;  4HM4 B;  4EXR A;  5IEN A;  4IIA A;  2HMN B;  2HMJ B;  1CYV A;  2RFR A;  4EW5 A;  1FZU A;  1Q7Y 4;  3FG1 A;  2K3D A;  5D82 A;  3ZG5 A;  1N9E A;  1GD3 A;  2GEX A;  1HYF A;  2W2C A;  3BND A;  4KVH A;  3CPW 2;  4RNT A;  2K0M A;  2XFT A;  4ZM8 A;  1O7W B;  3CCJ 3;  1UUV B;  1QAK A;  1GSP A;  4MMZ B;  2W03 A;  2R41 A;  2P38 A;  2GXF A;  1EKM A;  2LQV A;  3L0R A;  3D4A A;  1GOV A;  2OQE C;  9RNT A;  4HKV B;  5EEO A;  1RHL A;  3PYJ A;  1MWS A;  7GSP A;  5CF2 A;  1BSC A;  1HZ1 A;  1MWU A;  2AAD A;  4HM5 B;  3G6E 3;  2W6J H;  3KN4 A;  4BU4 A;  3JUP A;  2GSP A;  1VQ8 3;  3OWY A;  2KAA A;  1YIT 3;  5HOH A;  1RRH A;  2BT3 A;  4U13 A;  1B2U A;  1K9M 4;  5HGR A;  2INX A;  3CC2 3;  3MSO A;  1BSE A;  1IQY A;  2KF4 A;  1AQZ A;  1LOY A;  1QMA A;  3K9M C;  5AYR B;  1JKG A;  4NRE A;  1RKY A;  1LNH A;  4HM7 B;  4XM4 A;  2OOV A;  3H3H A;  3SED A;  2B1X B;  4MMY B;  5CF1 A;  3DGY A;  2RBI A;  2CFL A;  3MG1 A;  1YI2 3;  1OF5 B;  3D79 A;  1W2Z A;  1OUN A;  1DVC A;  6GSP A;  2XGL A;  1G02 A;  2GU3 A;  1SIH A;  1B2X A;  1W4N A;  3GZB A;  2ZHX B;  1X1Y A;  3FG4 A;  1BNE A;  1BU4 A;  3JUO A;  3QK9 A;  1GMP A;  3D3L A;  4R9L A;  5AEU B;  4EBG A;  4AKZ A;  1ISK A;  1IDP A;  1LXE A;  2LYX A;  3BNE A;  3LTC A;  4PEJ A;  2PZV A;  1BRK A;  2XF3 A;  1F8N A;  3VF1 A;  1BSA A;  1ZX2 A;  1I0X A;  4Q53 A;  1VQ7 3;  3STD A;  1IQ8 A;  3E99 A;  3F8H A;  4XDV A;  5BIR A;  4XBY A;  1TTO A;  2CK3 H;  2D42 A;  3T8U A;  1RLS A;  2MF7 A;  1NB3 I;  5G2G A;  3S5C A;  1CYU A;  3K7C A;  2OOV C;  3NM2 A;  1UCL A;  1Q86 4;  5D81 A;  3FF0 A;  1JB2 A;  1SJW A;  1TJD A;  1VQN 3;  1O7P B;  3WA3 A;  1M90 4;  2IMJ A;  4J9A A;  3SOA A;  1JNQ A;  4BL2 A;  1B27 A;  3CC4 3;  1UI7 A;  4I5Q A;  3S27 A;  2KCD A;  3B7C A;  4KT3 B;  3WR2 A;  5EQL A;  3DGN A;  3CXC 2;  1FW7 A;  2CH9 A;  5TGN A;  3K5T A;  2MC8 A;  1VQ6 3;  2GU1 A;  3I56 3;  4FMC A;  3AMO A;  2CWU A;  1OGZ A;  1W01 A;  3B8L A;  5CLK A;  1VQO 3;  4G1M B;  1GD4 A;  2F86 B;  3T8N A;  2Z7A A;  1I0V A;  1GMQ A;  1KWI A;  3LT9 A;  4HAA A;  3UB1 A;  4R80 A;  1Q7H A;  1BAN A;  1G96 A;  4FCJ A;  4J8T A;  4K61 A;  3JVC A;  4O3V A;  4FR9 A;  5LC6 A;  3URP A;  2HOH A;  1S72 3;  3X3Y A;  1MOL A;  3GZR A;  3PZW A;  1B2S A;  3EJV A;  2CFK A;  1JN5 B;  1R4Y A;  3GZX B;  1JRQ A;  2KXG A;  3D5G A;  1OH0 A;  2W56 A;  1K41 A;  2W9P A;  1I2E A;  1EQK A;  1BVI A;  2SAR A;  1BRH A;  2XR8 B;  3Q3F A;  4JRF A;  1OAC A;  1JJ2 2;  1EA2 A;  4N6O B;  1E97 A;  3OV4 A;  5IF6 A;  3G71 3;  1ZS7 A;  1I3I A;  3OXA A;  1SQW A;  5AII A;  1PYL A;  1KC8 4;  3KFQ C;  3X40 A;  1A67 A;  4FCM A;  1M1K 4;  3DXO A;  2KF6 A;  3KKG A;  1VQM 3;  4FMB A;  3MPH A;  1BAO A;  3CCR 3;  2Z6B A;  5BXQ A;  1IK3 A;  4GHO A;  1BNF A;  4XB5 A;  1MNL A;  2RNT A;  4OVM A;  2BHM A;  2D1W A;  2QGU A;  2STD A;  3GWR A;  3KSP A;  3LZA A;  2WOF A;  4EYC A;  4RNY A;  2Q07 A;  3SX1 A;  1A2P A;  1O7H B;  3JUN A;  1TUH A;  2JDI H;  3BNC A;  1BNR A;  1BRN L;  1JV2 B;  2F4Y A;  4XDW A;  5CXO A;  4N6T A;  2OQE A;  3CCS 3;  1JKG B;  1NU3 A;  2YFI B;  3NM7 A;  2KF5 A;  1TP6 A;  4O2H A;  1MWT A;  4BIR A;  1VQL 3;  5IER A;  1DMM A;  1T2H A;  5EVH A;  2CHC A;  1X1W A;  2C4B A;  2CW9 A;  1DVD A;  4O8S A;  1B3S A;  5KP1 A;  1FA3 A;  4N6U A;  5AIF A;  1YVB I;  2KRT A;  1RGH A;  3CNM A;  3F14 A;  3NQY A;  1VQ4 3;  1STD A;  3EF8 A;  4HVN A;  3RDE A;  2WOH A;  3UL5 A;  3F9S A;  1YIJ 3;  1VQ5 3;  4R4K A;  1JN5 A;  4HM3 B;  2IUJ A;  1YVS A;  1HKX A;  1RCK A;  1I70 A;  2GBX B;  7STD A;  5KP4 A;  2Z76 A;  1UI8 A;  4K90 B;  2ML6 A;  4ORL A;  2BU4 A;  1TU5 A;  3NXJ A;  4KFF A;  3DM8 A;  1N8Q A;  1FGM A;  3Q90 A;  1AY7 A;  1FUT A;  1I3F A;  3A76 A;  3T0U A;  1YNV X;  1V57 A;  3I0Y A;  1IT7 A;  4TX4 A;  2WGQ A;  3ECF A;  3ER7 A;  5IEP A;  3CC7 3;  4EC6 A;  1W7C A;  1T2I A;  3J7Y d;  1RN1 A;  1ASK A;  1B21 A;  1A2V A;  2J8X B;  4HM2 B;  4WHA A;  1SPU A;  4NPB A;  1GY5 A;  1SAR A;  3JUQ A;  5FGO A;  3VSY A;  4N6N B;  2H0G A;  3CU3 A;  3NHX A;  2Y74 A;  5KP3 A;  3PGB A;  4GB5 A;  1DMQ A;  2IYJ A;  5JPU A;  3I55 3;  5M18 A;  1BGS A;  1IT8 A;  1DET A;  1U8C B;  4WP5 A;  6RNT A;  3AMO B;  3O8Y A;  1GS3 A;  1FGT A;  1T5Y A;  3FSD A;  1DE3 A;  2HMK B;  1FUW A;  4XBX A;  1V58 A;  2HMM B;  1RGC A;  2Y73 A;  2CG0 A;  1MGW A;  1TIJ A;  1FUS A;  2CKF B;  2PNC A;  3PCR A;  2I9W A;  3F7S A;  3N8B A;  1RGA A;  3FKA A;  3MYT A;  4FMD A;  1LQM B;  1FGO A;  2IA7 A;  5IW9 A;  2IY2 A;  1RSN A;  2CFG A;  2P09 A;  3AGN A;  2W56 B;  2E2T A;  3PS8 A;  1QVG 2;  1DMN A;  2F56 A;  3SXX A;  5IG4 A;  1GY6 A;  1PY3 A;  1MWR A;  1VQQ A;  3MG2 A;  1QJG A;  3EE1 A;  2L4V A;  3HIG A;  1Q42 A;  1JB5 A;  3D5I A;  1LNI A;  3SYU A;  2ZL8 A;  4N3V A;  2SBL A;  3PXM A;  2B24 B;  1N8R 4;  1JB4 A;  2C11 A;  1BRG A;  2HMO B;  4LGQ A;  3CCV 3;  3V98 A;  1VQP 3;  1TFO A;  1JZO A;  3LTD A;  1WTH A;  4LMI A;  1LQG C;  4R1K A;  3MG3 A;  1BSD A;  5GSP A;  4X2O A;  1BIR A;  2F98 A;  1W6Y A;  1U5O A;  5M19 A;  4J5K A;  3KII A;  1W00 A;  4RBN A;  3UJM A;  3OW2 2;  2UUG C;  4HM1 B;  2C10 A;  3EN8 A;  3S67 A;  4KZ1 A;  1BUJ A;  1UUG B;  4L7K A;  4RZM A;  1S5A A;  3DY5 A;  4IPB A;  3N9H A;  5M1A A;  1JZD A;  1UGH I;  3DGL A;  4WYK A;  3QRD A;  1NDO B;  3RGA A;  2IUK A;  3NUV A;  3LOY A;  1RGF A;  3HZP A;  4J5G A;  4LEH A;  4CPK A;  1OCV A;  3AGO A;  4O02 B;  1RGG A;  5D83 A;  2XSO B;  2O9U X;  1B20 A;  1OHP A;  3X41 A;  3CPO A;  3OWU A;  1WMO A;  1AV4 A;  1AVL A;  3DH2 A;  3LH4 A;  3FG3 A;  3G4S 3;  2BMQ B;  3D9R A;  3MWZ A;  1YGE A;  1KSI A;  2Z77 A;  2BMO B;  3B4O A;  4STD A;  3AHW A;  3LML A;  4MMX B;  3U97 A;  1N5P A;  1ULJ B;  5BU4 A;  2WGO A;  4K1U A;  3G8Z A;  2HML B;  5IG3 A;  3IPT A;  1Q40 A;  2R4I A;  1GOY A;  1BNG A;  3IMA B;  1NB5 I;  4KFD A;  4L8O A;  1NWW A;  3H51 A;  1Q82 4;  2P0M A;  4BTW A;  2UGI A;  1W02 A;  5FW5 A;  4BTY A;  1T3B A;  2ML5 A;  2KF3 A;  3SOY A;  4CCV A;  1RGL A;  1NJI 4;  1YJN 3;  1UDI I;  1W6C A;  3BB9 A;  3NX0 A;  3WOE B;  1WMN A;  1GMR A;  5RNT A;  3FGY A;  3EHC A;  3CCE 3;  2CFD A;  5JPP A;  1EEJ A;  1IVV A;  1GYB A;  2L1S A;  1YJW 3;  1W2B 2;  1JBS A;  3OWS A;  3F8X A;  3HX8 A;  3WOD G;  4AEQ A;  3LT8 A;  4FCZ A;  2K54 A;  2E2V A;  4LZI A;  3RNT A;  1AR0 A;  1IYY A;  2ZA4 A;  3EX9 A;  4WFO A;  2YX9 A;  5I97 A;  3KSE D;  4HBR A;  1D6U A;  2M7O A;  4R9K A;  3SVA A;  1E3R A;  2F5W A;  2O3O A;  3EQQ B;  3FH1 A;  1IVU A;  2FXT A;  5IG0 A;  1VQ9 3;  1UCK A;  2XRX B;  1YHQ 3;  2ZDJ A;  3LTA A;  1DYU A;  4FMA A;  1CH0 A;  4ILF A;  1WMP A;  3NV0 A;  3WOF B;  1IV7 A;  1E3V A;  1KQS 2;  1JBR A;  2AAE A;  5JBS A;  1LOV A;  1BNS A;  1LOW A;  4CDL A;  2RSX A;  3FF2 A;  2BIR A;  4L8P A;  2BO9 B;  2YFJ B;  5DRV A;  2H0I A;  1US1 A;  5CK6 A;  1PU4 A;  1C54 A;  3F7X A;  1VQK 3;  3SLU A;  2CC3 A;  1Y4K A;  1IVX A;  1BRI A;  1D6Z A;  4I4K A;  1ZGX A;  3G0K A;  3UL6 A;  3DMC A;  1RGE A;  3CD6 3;  1LRA A;  2CIU A;  3ALA A;  3NBR A;  2CFW A;  5STD A;  2OWP A;  1RJO A;  2V1L A;  3EBY A;  1YGW A;  4MEI A;  4XBT A;  3VGN A;  1X1U A;  3MHE A;  3GAX A;  3CCQ 3;  4RNZ A;  1YJ9 3;  3WA2 X;  4OUQ A;  1M9G A;  1K28 A;  1O7G B;  2FNQ A;  3M8C A;  3NQZ A;  5G1L A;  1W5Z A;  1OHO A;  1IV9 A;  4CJN A;  2OCT A;  1MGR A;  4WYK B;  4N6V 0;  2P0X A;  1FYS A;  1AVK A;  1K73 4;  1JBT A;  1RRL A;  3EC9 A;  1A90 A;  3BIR A;  4IT7 A;  1GOU A;  3DUK A;  2CG1 A;  1ROV A;  5AI1 A;  3Q2P A;  1K8A 4;  3LTB A;  4N6L A;  1CQS A;  3K0Z A;  1RTU A;  4X2H A;  1I2F A;  2UX0 A;  5IEO A;  1M1X B;  3CME 3;  3TDG A;  1D6Y A;  2GEY A;  4QWT A;  7RNT A;  1RNT A;  3Q1C A;  1CEW I;  2W0Q A;  1Q40 B;  1TRP A;  1RN4 A;  4LYL B;  3S28 A;  4H61 A;  4BL3 A;  1Q9E A;  4EV5 A;  1UW1 A;  5DRE A;  1C7H A;  2BMR B;  2RGQ A;  5AYS C;  3CCM 3;  3B4P A;  3OX9 A;  4HM6 B;  3AHS A;  3RGR A;  3FCS B;  3ZG0 A;  3S29 A;  4EV2 A;  1BNJ A;  1STF I;  3ROB A;  2QEX 3;  1L5G B;  1QAF A;  3FZW A;  3EBT A;  1R4C A;  3HI7 A;  5BVB A;  2OTJ 3;  3GRD A;  1N5H A;  4GSP A;  1W6G A;  3F40 A;  1TRQ A;  3NBB A;  4LSO A;  1RN7 A;  2CWT A;  1Z1S A;  3K63 A;  1UUW B;  3PCS A;  3CNX A;  2XFS A;  1BRJ A;  3DGO A;  1LVN A;  1LOX A;  1UCI A;  3DZL A;  1O7M B;  2H0H A;  3KE7 A;  1FGQ A;  5LC7 A;  1ULI B;  3BNB A;  1IU7 A;  1RMS A;  6STD A;  3CMA 3;  1N9J A;  3BU4 A;  4H3U A;  1QAL A;  1X1X A;  1I8V A;  2GBW B;  4GL6 A;  4DKI A;  3N54 B;  3FLJ A;  1PFP A;  3KZT A;  1FGR A;  4HOH A;  2RCD A;  1ZO2 A;  4WWU C;  1HU9 A;  3WHO A;  3MKI A;  3NV0 B;  2F99 A;  1O7N B;  1OF5 A;  2OTL 3;  1I2G A;  1OGX A;  3JUM A;  5A0O B;  1B2M A;  2W9Q A;  1BNI A;  1RGK A;  1ROA A;  5ELJ A;  3NBJ A;  4HM0 B;  3LYG A;  4MJD A;  1TFK A;  4K1V A;  2F5M A; 
#chains in the Genus database with same CATH homology
 1NO3 A;  3X42 A;  4AKY A;  1V74 A;  4BTX A;  2JQ5 A;  2FGT A;  5AIH A;  3WMD A;  1BUQ A;  8CHO A;  3G16 A;  3CCU 3;  1WNH A;  3HII A;  3UNL A;  3X3X A;  3WDG B;  2E2U A;  1Q81 4;  5AIG A;  2BNG A;  4HJL B;  3CCL 3;  1VZZ A;  2XH9 A;  2XGN A;  1WQL B;  4KFE A;  1OHS A;  4N6M A;  3U1W A;  3X3Z A;  1IQX A;  2XSH B;  1J2B A;  3EB8 A;  1OPY A;  1QVF 2;  4HYZ A;  2A15 A;  2WO0 A;  3IJE B;  3HK4 A;  1SII A;  5AEW B;  3V92 A;  3V99 A;  4HZB B;  1IVW A;  4HM8 B;  3BLZ A;  1EG9 B;  4NHF A;  2YFL B;  5ELU A;  1GY7 A;  2W04 A;  2P05 A;  2QIY A;  5IG5 A;  3DGM A;  2QA4 3;  4HZ9 B;  3GZY B;  4JF8 A;  3LXU X;  2XEP A;  1KD1 4;  4OK0 A;  2CWV A;  1A2K A;  3EN1 B;  4HM4 B;  4EXR A;  5IEN A;  4IIA A;  2HMN B;  2HMJ B;  1CYV A;  2RFR A;  1Q7Y 4;  3FG1 A;  5D82 A;  1N9E A;  1GD3 A;  2GEX A;  2W2C A;  3BND A;  4KVH A;  3CPW 2;  4ZM8 A;  2K0M A;  2XFT A;  1O7W B;  3CCJ 3;  1UUV B;  1QAK A;  4MMZ B;  2W03 A;  2P38 A;  2GXF A;  1EKM A;  2LQV A;  3L0R A;  2OQE C;  4HKV B;  5EEO A;  3PYJ A;  5CF2 A;  4HM5 B;  3G6E 3;  2W6J H;  3KN4 A;  1VQ8 3;  3JUP A;  3OWY A;  1YIT 3;  1RRH A;  2BT3 A;  4U13 A;  1K9M 4;  5HGR A;  2INX A;  3CC2 3;  3MSO A;  1IQY A;  1QMA A;  3K9M C;  5AYR B;  1JKG A;  4NRE A;  1RKY A;  1LNH A;  4HM7 B;  4XM4 A;  2OOV A;  3H3H A;  3SED A;  2B1X B;  4MMY B;  5CF1 A;  2CFL A;  3MG1 A;  1YI2 3;  1OF5 B;  1W2Z A;  1OUN A;  1DVC A;  2XGL A;  2GU3 A;  1SIH A;  1W4N A;  3GZB A;  3FG4 A;  3JUO A;  3QK9 A;  4R9L A;  3D3L A;  5AEU B;  1ISK A;  4EBG A;  4AKZ A;  1IDP A;  1LXE A;  2LYX A;  3BNE A;  3LTC A;  4PEJ A;  2PZV A;  2XF3 A;  3VF1 A;  1F8N A;  1ZX2 A;  4Q53 A;  1VQ7 3;  3STD A;  1IQ8 A;  3E99 A;  3F8H A;  4XDV A;  4XBY A;  2CK3 H;  2D42 A;  3T8U A;  2MF7 A;  1NB3 I;  5G2G A;  3S5C A;  1CYU A;  3K7C A;  2OOV C;  3NM2 A;  1Q86 4;  5D81 A;  3FF0 A;  1JB2 A;  1SJW A;  1VQN 3;  1O7P B;  3WA3 A;  1M90 4;  2IMJ A;  4J9A A;  3SOA A;  1JNQ A;  3CC4 3;  1UI7 A;  3S27 A;  2KCD A;  3B7C A;  5EQL A;  3DGN A;  3CXC 2;  2CH9 A;  5TGN A;  3K5T A;  2MC8 A;  1VQ6 3;  2GU1 A;  3I56 3;  4FMC A;  3AMO A;  2CWU A;  1OGZ A;  1W01 A;  3B8L A;  5CLK A;  1VQO 3;  4G1M B;  1GD4 A;  2F86 B;  3T8N A;  2Z7A A;  3UB1 A;  3LT9 A;  1KWI A;  4R80 A;  1G96 A;  4FCJ A;  4J8T A;  4K61 A;  3JVC A;  4O3V A;  4FR9 A;  5LC6 A;  1S72 3;  3X3Y A;  1MOL A;  3GZR A;  3PZW A;  3EJV A;  2CFK A;  1JN5 B;  3GZX B;  1JRQ A;  2KXG A;  2W9P A;  1OH0 A;  1K41 A;  2W56 A;  1EQK A;  2XR8 B;  4JRF A;  1OAC A;  1JJ2 2;  1EA2 A;  4N6O B;  1E97 A;  3OV4 A;  5IF6 A;  3G71 3;  3OXA A;  1SQW A;  5AII A;  1KC8 4;  3KFQ C;  3X40 A;  1A67 A;  4FCM A;  1M1K 4;  3DXO A;  3KKG A;  1VQM 3;  4FMB A;  3MPH A;  3CCR 3;  2Z6B A;  5BXQ A;  1IK3 A;  4XB5 A;  1MNL A;  4OVM A;  2BHM A;  2D1W A;  2QGU A;  2STD A;  3GWR A;  3KSP A;  3LZA A;  2WOF A;  4EYC A;  4RNY A;  2Q07 A;  3SX1 A;  1O7H B;  3JUN A;  1TUH A;  2JDI H;  3BNC A;  1JV2 B;  4XDW A;  5CXO A;  4N6T A;  2OQE A;  3CCS 3;  1JKG B;  1NU3 A;  2YFI B;  3NM7 A;  1TP6 A;  4O2H A;  1VQL 3;  5IER A;  1DMM A;  5EVH A;  2CHC A;  2CW9 A;  1DVD A;  4O8S A;  5KP1 A;  1FA3 A;  4N6U A;  5AIF A;  1YVB I;  2KRT A;  3CNM A;  3F14 A;  3NQY A;  1VQ4 3;  1STD A;  3EF8 A;  4HVN A;  3RDE A;  2WOH A;  3UL5 A;  3F9S A;  1YIJ 3;  1VQ5 3;  4R4K A;  1JN5 A;  4HM3 B;  2IUJ A;  1HKX A;  5KP4 A;  2GBX B;  7STD A;  2Z76 A;  1UI8 A;  4K90 B;  2ML6 A;  4ORL A;  1TU5 A;  3NXJ A;  4KFF A;  3DM8 A;  1N8Q A;  1FGM A;  3Q90 A;  3T0U A;  3A76 A;  3I0Y A;  1IT7 A;  4TX4 A;  2WGQ A;  3ECF A;  3ER7 A;  5IEP A;  3CC7 3;  4EC6 A;  1W7C A;  3J7Y d;  1ASK A;  1A2V A;  4HM2 B;  4WHA A;  1SPU A;  1GY5 A;  3JUQ A;  5FGO A;  3VSY A;  4N6N B;  3CU3 A;  3NHX A;  2Y74 A;  5KP3 A;  3PGB A;  4GB5 A;  1DMQ A;  5JPU A;  3I55 3;  1IT8 A;  1U8C B;  4WP5 A;  3AMO B;  3O8Y A;  1GS3 A;  1FGT A;  1T5Y A;  3FSD A;  2HMK B;  1FUW A;  4XBX A;  2HMM B;  2Y73 A;  2CG0 A;  1TIJ A;  2CKF B;  2PNC A;  3PCR A;  2I9W A;  3F7S A;  3N8B A;  3FKA A;  3MYT A;  4FMD A;  1FGO A;  2IA7 A;  5IW9 A;  2CFG A;  2P09 A;  2W56 B;  2E2T A;  3PS8 A;  1QVG 2;  1DMN A;  3SXX A;  5IG4 A;  1GY6 A;  3MG2 A;  1QJG A;  3EE1 A;  2L4V A;  3HIG A;  1Q42 A;  1JB5 A;  2ZL8 A;  4N3V A;  2SBL A;  3PXM A;  2B24 B;  1N8R 4;  1JB4 A;  2C11 A;  2HMO B;  4LGQ A;  3CCV 3;  3V98 A;  1VQP 3;  1TFO A;  3LTD A;  1WTH A;  4LMI A;  4R1K A;  3MG3 A;  4X2O A;  2F98 A;  1W6Y A;  1U5O A;  4RBN A;  3KII A;  1W00 A;  3UJM A;  3OW2 2;  4HM1 B;  2C10 A;  3EN8 A;  3S67 A;  4KZ1 A;  4L7K A;  4RZM A;  1S5A A;  3DY5 A;  4IPB A;  3N9H A;  3DGL A;  4WYK A;  3QRD A;  1NDO B;  3RGA A;  2IUK A;  3NUV A;  3LOY A;  3HZP A;  4LEH A;  1OCV A;  4O02 B;  5D83 A;  2XSO B;  2O9U X;  3X41 A;  1OHP A;  3CPO A;  3OWU A;  1WMO A;  1AV4 A;  1AVL A;  3LH4 A;  3FG3 A;  3G4S 3;  2BMQ B;  3D9R A;  3MWZ A;  1YGE A;  1KSI A;  2Z77 A;  2BMO B;  3B4O A;  4STD A;  3LML A;  4MMX B;  3U97 A;  1N5P A;  1ULJ B;  2WGO A;  4K1U A;  3G8Z A;  2HML B;  5IG3 A;  3IPT A;  1Q40 A;  2R4I A;  3IMA B;  1NB5 I;  4KFD A;  4L8O A;  1NWW A;  3H51 A;  1Q82 4;  2P0M A;  4BTW A;  1W02 A;  5FW5 A;  4BTY A;  4CCV A;  2ML5 A;  3SOY A;  1NJI 4;  1YJN 3;  1W6C A;  3BB9 A;  3NX0 A;  3WOE B;  1WMN A;  3FGY A;  3EHC A;  3CCE 3;  2CFD A;  5JPP A;  1IVV A;  1GYB A;  1YJW 3;  1W2B 2;  3OWS A;  3F8X A;  3HX8 A;  3WOD G;  4AEQ A;  3LT8 A;  4FCZ A;  2K54 A;  2E2V A;  4LZI A;  1AR0 A;  3EX9 A;  4WFO A;  2YX9 A;  5I97 A;  3KSE D;  4HBR A;  1D6U A;  2M7O A;  4R9K A;  3SVA A;  1E3R A;  3EQQ B;  2O3O A;  3FH1 A;  1IVU A;  2FXT A;  5IG0 A;  1VQ9 3;  2XRX B;  1YHQ 3;  2ZDJ A;  3LTA A;  1DYU A;  4FMA A;  1WMP A;  3NV0 A;  3WOF B;  1IV7 A;  1E3V A;  1KQS 2;  5JBS A;  4CDL A;  2RSX A;  3FF2 A;  4L8P A;  2BO9 B;  2YFJ B;  5DRV A;  5CK6 A;  1US1 A;  1PU4 A;  3F7X A;  1VQK 3;  3SLU A;  2CC3 A;  1Y4K A;  1IVX A;  1D6Z A;  4I4K A;  3UL6 A;  3G0K A;  3DMC A;  3CD6 3;  2CIU A;  3ALA A;  3NBR A;  2CFW A;  5STD A;  2OWP A;  1RJO A;  2V1L A;  3EBY A;  4MEI A;  4XBT A;  3VGN A;  3MHE A;  3GAX A;  3CCQ 3;  4RNZ A;  1YJ9 3;  3WA2 X;  4OUQ A;  1M9G A;  1K28 A;  1O7G B;  2FNQ A;  3M8C A;  3NQZ A;  1W5Z A;  1OHO A;  1IV9 A;  2OCT A;  4WYK B;  4N6V 0;  2P0X A;  1K73 4;  1AVK A;  1RRL A;  3EC9 A;  1A90 A;  4IT7 A;  3DUK A;  2CG1 A;  1ROV A;  5AI1 A;  3Q2P A;  1K8A 4;  3LTB A;  4N6L A;  1CQS A;  3K0Z A;  4X2H A;  2UX0 A;  5IEO A;  1M1X B;  3CME 3;  3TDG A;  1D6Y A;  2GEY A;  4QWT A;  3Q1C A;  1CEW I;  2W0Q A;  1Q40 B;  3S28 A;  4H61 A;  4EV5 A;  1UW1 A;  5DRE A;  1C7H A;  2BMR B;  2RGQ A;  5AYS C;  3CCM 3;  3B4P A;  3OX9 A;  4HM6 B;  3RGR A;  3FCS B;  3S29 A;  4EV2 A;  1STF I;  3ROB A;  2QEX 3;  1L5G B;  1QAF A;  3FZW A;  3EBT A;  1R4C A;  3HI7 A;  5BVB A;  2OTJ 3;  3GRD A;  1N5H A;  1W6G A;  3F40 A;  3NBB A;  4LSO A;  1RN7 A;  2CWT A;  1Z1S A;  3K63 A;  1UUW B;  3PCS A;  3CNX A;  2XFS A;  3DGO A;  1LVN A;  1LOX A;  3DZL A;  1O7M B;  3KE7 A;  5LC7 A;  1FGQ A;  1ULI B;  3BNB A;  1IU7 A;  6STD A;  3CMA 3;  1N9J A;  4H3U A;  1QAL A;  2GBW B;  4GL6 A;  3N54 B;  3FLJ A;  1PFP A;  3KZT A;  1FGR A;  2RCD A;  1ZO2 A;  4WWU C;  1HU9 A;  3MKI A;  3NV0 B;  2F99 A;  1O7N B;  1OF5 A;  2OTL 3;  1OGX A;  3JUM A;  5A0O B;  2W9Q A;  1ROA A;  5ELJ A;  3NBJ A;  4HM0 B;  3LYG A;  4MJD A;  1TFK A;  4K1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...