5CK6A

Crystal structure of sz348 in complex with cyclopentene oxide
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
154
structure length
154
Chain Sequence
HHHHHHTSKIEQPRWASKDSAAGAASTPDEKIVLEFMDALTSNDAAKLIEYFAEDTMYQNMPLPPAYGRDAVEQTLAGLFTVMSYDAVETFHIGSSNGLVYTERVDVLRALPTGKSYNVSVLGVFQLTEGKITGWRDYFDLREFEEAVDLPLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Limonene-1,2-epoxide hydrolase
publication title Crystal structure of SZ348 in complex with cyclopentene oxide
rcsb
source organism Rhodococcus erythropolis
total genus 42
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.3.2.8: Limonene-1,2-epoxide hydrolase.
pdb deposition date 2015-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07858 LEH Limonene-1,2-epoxide hydrolase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ck6A00
5CLKA 1EA2A 1OF5B 1OCVA 3EN8A 1O7GB 1ZX2A 3F7XA 3E99A 3LZAA 3HK4A 4LEHA 3KKGA 1GY5A 3GZXB 3JUNA 2HMOB 5CF2A 4Q53A 4HM3B 4LMIA 3OXAA 5IG4A 3OX9A 3Q90A 5DREA 4XM4A 2I9WA 5D81A 5IEPA 1TUHA 4XDVA 3MG1A 5IG3A 4IIAA 4FCMA 5KP4A 3FF0A 4R9LA 1IDPA 1VZZA 1S5AA 4HM5B 2QGUA 3H51A 3B7CA 3CNXA 3IPTA 3F8HA 4OUQA 4U13A 4KVHA 4XBXA 3SOAA 1OHOA 4R1KA 2BNGA 2HMLB 3UJMA 1K41A 3BLZA 4HM4B 3G0KA 2GXFA 3MG2A 4WP5A 1E3VA 5KP1A 3A76A 3ER7A 4J8TA 4OVMA 3EC9A 2W2CA 5CF1A 3D9RA 2A15A 3NXJA 3MHEA 3F14A 1Z1SA 1E97A 3EBYA 3GZBA 2STDA 4WYKA 3MG3A 1GYBA 5TGNA 4LGQA 1UUVB 3BB9A 3HZPA 3NM2A 2YFIB 3F9SA 3B4OA 3G16A 4H3UA 8CHOA 1BUQA 1DMQA 3NBRA 3EQQB 4K1UA 3UNLA 4FCJA 4XB5A 3KSPA 3RGRA 3K0ZA 1OUNA 3S5CA 5BXQA 1W6YA 3NV0A 1O7PB 3JUQA 2INXA 5JPPA 1DMNA 2B1XB 3MSOA 3DXOA 3NUVA 4L7KA 2Z77A 4HM2B 3SOYA 2F86B 2CKFB 1O7HB 2RCDA 1ULJB 3K7CA 1O7WB 4WYKB 2UX0A 5AI1A 1ISKA 2IMJA 2GBWB 3LYGA 5AIIA 2XR8B 4XDWA 1NDOB 1DMMA 4MJDA 4R9KA 4HM1B 5KP3A 3ECFA 1UUWB 2B24B 4HZ9B 3ROBA 4HM6B 3FLJA 3OWYA 1Q40A 5IENA 1QMAA 1JKGA 3CNMA 2PZVA 1NWWA 1OPYA 3NV0B 5JPUA 1GS3A 5AIGA 4HM7B 3KE7A 2OWPA 3NHXA 2JQ5A 5IEOA 3FH1A 1OHSA 5CXOA 3EJVA 2Z76A 5CK6A 1C7HA 4STDA 3KZTA 4ORLA 2F99A 2QIYA 4XBYA 3CU3A 3JUPA 3I0YA 2Z7AA 5D82A 2HMJB 5FW5A 1EG9B 2XRXB 4L8OA 2GEXA 3MKIA 3CPOA 3HX8A 2RGQA 1JB2A 4HJLB 3GZRA 1OH0A 1JB5A 4HKVB 2HMNB 1E3RA 1U5OA 4I4KA 2GEYA 5IF6A 4CDLA 3EX9A 1Q40B 3STDA 2CHCA 1JKGB 3F8XA 4HZBB 3DUKA 3B8LA 5AEWB 1OGZA 1W01A 3FZWA 2BMOB 1WQLB 3FF2A 5G2GA 1NU3A 3RGAA 3T8UA 3MYTA 3B4PA 3FGYA 4GB5A 1JB4A 5AIFA 1JN5A 1CQSA 3DMCA 3DZLA 4HM0B 2R4IA 3GRDA 1A2KA 1ZO2A 3OWSA 3G8ZA 5IERA 1STDA 2XSHB 3VGNA 3EF8A 3GWRA 3H3HA 1O7MB 3SEDA 3EHCA 1O7NB 2K54A 2HMMB 2RFRA 1ULIB 3OV4A 3F7SA 5DRVA 2HMKB 2YFJB 1OF5A 1ASKA 2BMQB 5HGRA 1W00A 5EVHA 5D83A 1SJWA 3FKAA 2BMRB 4XBTA 1QJGA 1GY6A 3JUMA 6STDA 4RZMA 5IG5A 5IG0A 5AEUB 3VSYA 3DM8A 3EBTA 1GY7A 3FSDA 2XSOB 4K1VA 1W02A 5AIHA 3OWUA 2GBXB 1JN5B 4WWUC 4HVNA 3M8CA 1HKXA 5BVBA 1AR0A 4N3VA 4J9AA 3WMDA 4L8PA 4PEJA 3T8NA 3F40A 4HM8B 1OGXA 1OHPA 2YFLB 3EN1B 4X2OA 3JUOA 7STDA 1Q42A 1TP6A 5STDA 2F98A 4X2HA 3GZYB
chains in the Genus database with same CATH superfamily
4K61A 5CLKA 1N5PA 3T0UA 1EA2A 1OF5B 2MC8A 1B21A 1OCVA 3NM7A 3QK9A 4BL2A 2WGOA 3EN8A 4GSPA 1LOVA 1A2VA 1O7GB 1WMNA 1ZX2A 1B2UA 3F7XA 4HBRA 2OOVA 1Q9EA 4LZIA 1SPUA 2LQVA 3E99A 1US1A 3LZAA 3CC43 3D3LA 1BUJA 1STFI 2YX9A 1TJDA 3HK4A 2H0HA 1I3FA 1UGIA 2WOFA 5G1LA 3EE1A 1JNQA 3MPHA 1IQYA 2ML5A 1UDII 4LEHA 1M1K4 4R80A 2OTJ3 2FXTA 3KKGA 1YGWA 3DGNA 2KF5A 1GY5A 3CCL3 9RNTA 1YVBI 4KFEA 2XFTA 1GMPA 1ZGXA 1T2IA 1BOXA 3KSED 1SQWA 3GZXB 4BTYA 2ZL8A 2D1WA 2KCDA 1I2FA 1DE3A 1X1YA 3JUNA 3NX0A 1M9GA 1K9M4 2HMOB 1ROVA 3CMA3 3KFQC 1MGRA 1RRLA 3CXC2 2Z6BA 4N6OB 7RNTA 1B2MA 5LC7A 1RGHA 1A67A 1LOYA 2LYXA 1PYLA 2Y74A 4O02B 1RGLA 5CF2A 4Q53A 1V57A 2ML6A 3WOEB 1VQ83 4HM3B 1HZ1A 2E2VA 1VQ73 1BRNL 4LMIA 5BU4A 3CCV3 3OXAA 5IG4A 4R4KA 1YNVX 1VQO3 3OX9A 3Q90A 5DREA 1JBRA 3RDEA 4XM4A 1EUIC 2I9WA 5JBSA 2ZDJA 1FYSA 1IQXA 1YGEA 2KRTA 1LQMB 1YVSA 3VGNA 5D81A 1HYFA 4RBNA 5IEPA 1TUHA 1WMOA 1FGTA 3MG1A 4I5QA 4XDVA 1RN7A 5IG3A 4IIAA 1BRHA 4H61A 1TU5A 1BANA 4FCMA 3WA2X 5KP4A 3FF0A 3AGNA 4R9LA 1IDPA 1JZOA 1VZZA 1S5AA 1Q7HA 4HM5B 1A2PA 2QGUA 3H51A 4GL6A 3B7CA 1SARA 4X2HA 3CNXA 3IPTA 3F8HA 4KFDA 4OUQA 4U13A 2P09A 4KVHA 4XBXA 1IVWA 3SOAA 3DGLA 1GD3A 2CFWA 4RNYA 1OHOA 1RGEA 4IT7A 4R1KA 1GOUA 2BNGA 1MGWA 2CWTA 2O9UX 3VF1A 1FGRA 4AKZA 4BU4A 2E2UA 1RGAA 2HMLB 1UCLA 3UJMA 3CCJ3 2IUJA 1M1XB 1BRJA 1K41A 1RDSA 3BLZA 3KN4A 2P0XA 4HM4B 3G0KA 2V1LA 1VQ63 2GXFA 5M18A 1NJI4 2XGLA 1VQ53 1RRHA 3MG2A 1DETA 3IMAB 2L4VA 1BAOA 1E3VA 2KXGA 2W03A 4WP5A 1IV7A 3FG4A 3Q1CA 1VQ43 1X1XA 2WO0A 1LOWA 5KP1A 1MOLA 1BIRA 4RNTA 3CC23 3A76A 3ER7A 2P0MA 4J8TA 4QWTA 4OVMA 1WMPA 3LOYA 3EC9A 2W2CA 1W6GA 5CF1A 1KWIA 3D9RA 2H0IA 4GHOA 4ILFA 2A15A 1R4YA 3NXJA 3MHEA 1IV9A 4WFOA 1W2B2 3V92A 2KAAA 3F14A 3WOFB 1N9JA 1Z1SA 1FGMA 1V74A 3ZG5A 1E97A 1G96A 3PYJA 2W0QA 3X42A 3EBYA 1SIHA 3CCS3 3GZBA 1VQ93 3J7Yd 3HI7A 4EXRA 1YIT3 1RHLA 2BO9B 2STDA 1DYUA 4WYKA 3CCR3 1UCKA 7GSPA 1VQQA 1W7CA 1LNIA 1R4CA 1N5HA 1BRSA 3FG1A 2W56A 3MG3A 1GYBA 5TGNA 6RNTA 1RKYA 1I3IA 4LGQA 1BSCA 1UUVB 3BB9A 3HZPA 1L5GB 2OQEC 1FW7A 3NM2A 2YFIB 1BNFA 3F9SA 4BTXA 3B4OA 3ZG0A 2O3OA 1QAKA 1RCLA 3X40A 3G16A 1D6ZA 1BSAA 4EYCA 4H3UA 1YJN3 1RN1A 8CHOA 1JZDA 2OTL3 3BIRA 1AQZA 1RN4A 1LXEA 4MMYB 4HAAA 1BUQA 2SBLA 1DMQA 2CH9A 2GSPA 2MF7A 3O8YA 3NBRA 3EQQB 3SLUA 4EW5A 3CME3 2FNQA 4K1UA 3UNLA 4FCJA 1BGSA 2P38A 3WODG 4XB5A 3KSPA 3RGRA 3K0ZA 1RMSA 4FMBA 1AV4A 1OUNA 3GAXA 1ZS7A 3S5CA 2BT3A 1YHQ3 1VQK3 1B27A 2AADA 4J5GA 5BXQA 2XF3A 4JF8A 3X3XA 1UGHI 1LVNA 3X41A 1W6YA 3NV0A 2AAEA 4BL3A 1YJW3 1YI23 3S29A 1GMRA 1O7PB 1RLSA 2CK3H 2INXA 2IY2A 3JUQA 5JPPA 4O2HA 2OCTA 3HIGA 3K5TA 1DMNA 1N8QA 2B1XB 5M1AA 3MSOA 1GMQA 2HOHA 3U1WA 1NB3I 2CWVA 3X3YA 6GSPA 3SVAA 1BNJA 4N6TA 3DXOA 3EB8A 3NUVA 4AKYA 1EQKA 1WTHA 4KT3B 1UI8A 4L7KA 2Z77A 4HM2B 3SOYA 1D6YA 1B2ZA 2CKFB 2F86B 3PZWA 1O7HB 1F8NA 3Q3FA 2RCDA 4MMXB 3CPW2 1UCJA 1ULJB 1AVKA 3K7CA 3BNBA 3WHOA 1MWUA 1UI7A 1O7WB 2CG0A 2RSXA 2F5MA 2W9PA 4NREA 4WYKB 3I553 4CJNA 2CFKA 4HOHA 5FGOA 1RGCA 2W56B 2UX0A 5AI1A 1ISKA 3AHWA 2IMJA 1TIJA 2GBWB 3LYGA 5AIIA 2QA43 3A5EA 3DGYA 3OW22 1YJ93 1TRPA 1FA3A 2XR8B 1RJOA 4XDWA 1EEJA 3NQZA 4IPBA 5LC6A 1NDOB 1DMMA 4MJDA 2L1SA 4R9KA 1IVVA 3UB1A 5A0OB 2IUKA 3BU4A 2QEX3 4HM1B 5KP3A 3CCM3 3ECFA 3LH4A 1UUWB 3N9HA 2B24B 2IYJA 1S723 4N6V0 3LTAA 3LTCA 4HZ9B 5GSPA 3KIIA 1GSPA 3D79A 3KCHA 1YIJ3 1W2ZA 1I0XA 3ROBA 1IU7A 2J8XB 3K9MC 4HM6B 4KZ1A 3FLJA 3FG3A 1Q40A 2RBIA 1RNTA 1I8VA 3OWYA 5IENA 1QMAA 4NHFA 1JKGA 5AYRB 3CNMA 2PZVA 2F4YA 3UL6A 4FMAA 1NWWA 1OPYA 5EQLA 1LQGC 1B2XA 3NV0B 5JPUA 1J2BA 1HU9A 1BRGA 1FUSA 2CWUA 1GS3A 3G713 3LTDA 5AIGA 5G1KA 4HM7B 1MWRA 2H0GA 1MWSA 1KSIA 1MWTA 3KE7A 1A90A 2OWPA 1K734 3SXXA 1T3BA 1Q864 3L0RA 4LSOA 3DGOA 3NHXA 2JQ5A 1BRIA 3S67A 1I2GA 4EV2A 2Q07A 5HOHA 5IEOA 3FH1A 4EBGA 3AGOA 1OHSA 2XGNA 5CXOA 2SARA 3D4AA 3EJVA 8RNTA 1MNLA 3LT9A 4BTWA 2Z76A 4WHAA 5CK6A 1W5ZA 1C7HA 1IYYA 3GSPA 2BIRA 3KZTA 3D5GA 4ORLA 2F99A 2CIUA 2QIYA 4STDA 4XBYA 2K0MA 3JUPA 3RNTA 1K8A4 3I0YA 1IVXA 2KF4A 1FUTA 1BSBA 4JRFA 1B20A 2Z7AA 1UW1A 4J5KA 5D82A 2HMJB 1RTUA 3G4S3 5FW5A 4EC6A 3N54B 1C54A 1CYUA 1EG9B 2XRXB 4L8OA 3PS8A 2CG1A 2GEXA 1PY3A 2K3DA 4N6MA 3MKIA 3CPOA 3HX8A 1BSEA 2OOVC 2CFLA 2RGQA 3BNEA 1U8CB 1B2SA 4HYZA 1JB2A 1LOXA 4HJLB 3GZRA 3IJEB 1CH0A 1OH0A 1BNGA 1JB5A 4HKVB 3ZFZA 1DVCA 3PCSA 3S27A 1NNVA 1Q824 2HMNB 1E3RA 1LRAA 1U5OA 2OQEA 1SIIA 4I4KA 1LNHA 1BSDA 2GEYA 5IF6A 2C10A 2CX1A 3EX9A 1CYVA 3K63A 1Q40B 3STDA 2CHCA 2FGTA 4MMZB 3SX1A 3TDGA 3WR2A 1JKGB 3F8XA 1AVLA 1QVF2 4HZBB 1UCIA 2CFDA 1M904 1QAFA 1BRKA 3BNDA 3DUKA 2C11A 3B8LA 1KQS2 1FGOA 2RNTA 3CCQ3 2UUGC 5AEWB 1OGZA 1W01A 3FZWA 3V98A 1I70A 1WNHA 2BMOB 2WGQA 3CCE3 2Y73A 1TFOA 5ELJA 1VQM3 4ZM8A 1WQLB 1Q814 1BNRA 1IQ8A 2F5WA 1JRQA 3FF2A 3I563 2W9QA 5G2GA 3WA3A 1QVG2 1NU3A 3WDGB 3NQYA 3RGAA 2GU1A 1RGKA 2C4BA 3JVCA 5ELUA 3T8UA 2BU4A 3X3ZA 3MYTA 3S28A 2R41A 2XFSA 4FR9A 4G1MB 5IW9A 3B4PA 3FGYA 1ROAA 3PGBA 1RCKA 4EV5A 3HIIA 4GB5A 1JB4A 2CC3A 1PU4A 1EKMA 4N6NB 3SYUA 1Q7Y4 5AIFA 1JN5A 1N8R4 1BNSA 1CQSA 3DMCA 3DZLA 4HM0B 1IVUA 2R4IA 3GRDA 4CCVA 1A2KA 1NB5I 1ZO2A 3ALAA 3OWSA 3G8ZA 1VQL3 1JBTA 5IERA 4N6LA 2M7OA 1STDA 1N9EA 1I2EA 2XSHB 3EF8A 3NBBA 3GWRA 3H3HA 1O7MB 3U97A 5RNTA 3BNCA 1RGGA 1KD14 3SEDA 1K28A 3EHCA 1G0TA 1RGFA 1O7NB 4LYLB 5BIRA 1FGQA 2ZA4A 4RNZA 2K54A 2HMMB 2W6JH 3AMOB 1IK3A 1AY7A 2RFRA 2KF6A 1PFPA 2W04A 1GD4A 2GU3A 1RNBA 3LMLA 2WOHA 1ULIB 3DGMA 3OV4A 2XEPA 2P05A 3F7SA 5DRVA 2HMKB 2YFJB 1OF5A 1ASKA 1BNIA 2BMQB 2PNCA 5HGRA 1RSNA 1W00A 3HOHA 5EVHA 5D83A 4FMCA 1X1UA 4DKIA 4CDLA 1SJWA 2BHMA 4N6UA 4MEIA 1TRQA 1OACA 3FKAA 2BMRB 4FMDA 1G02A 1QJGA 4XBTA 3Q2PA 1GY6A 1T5YA 3JUMA 2D42A 1W4NA 6STDA 4RZMA 5EEOA 5IG5A 1IT8A 1BVIA 2CW9A 2XH9A 5IG0A 4CPKA 4O8SA 5AEUB 3VSYA 1TFKA 1TTOA 3DM8A 3EBTA 3LTBA 1GOYA 3PXMA 1GY7A 2IA7A 3FSDA 3UL5A 4NPBA 1CEWI 3DY5A 1FZUA 2XSOB 2F56A 3LT8A 1B3SA 4K1VA 4OK0A 1W02A 5AIHA 1DVDA 2ZHXB 3PCRA 1W6CA 3OWUA 3V99A 4TX4A 2JDIH 4K90B 4BIRA 3FCSB 3D5IA 4AEQA 2GBXB 4O3VA 1BNEA 1JN5B 3URPA 4WWUC 5M19A 4HVNA 2CX0A 3M8CA 2E2TA 1GOVA 3AHSA 2CFGA 3LXUX 1JBSA 1HKXA 1VQP3 3QRDA 3G6E3 5BVBA 1UUGB 1VQN3 1AR0A 1JV2B 4N3VA 4J9AA 1FUWA 3MWZA 3WMDA 3CD63 1JJ22 4L8PA 4PEJA 3T8NA 3F40A 1T2HA 1V58A 3NBJA 1NO3A 3AMOA 1IT7A 3N8BA 2KF3A 4HM8B 1KC84 5I97A 1OGXA 1OHPA 1Y4KA 2YFLB 1BU4A 3CCU3 3EN1B 4X2OA 3DH2A 3JUOA 5AYSC 4FCZA 1Q42A 4KFFA 7STDA 1I0VA 1QALA 1TP6A 5STDA 1X1WA 2F98A 2UGIA 3CU3A 3CC73 3GZYB 1D6UA
chains in the Genus database with same CATH topology
4K61A 5CLKA 1N5PA 3T0UA 1EA2A 1OF5B 2MC8A 1OCVA 3NM7A 3QK9A 2WGOA 3EN8A 1A2VA 1O7GB 1WMNA 1ZX2A 3F7XA 4HBRA 2OOVA 4LZIA 1SPUA 2LQVA 3E99A 1US1A 3LZAA 3CC43 3D3LA 1STFI 2YX9A 3HK4A 2WOFA 3EE1A 1JNQA 3MPHA 1IQYA 2ML5A 4LEHA 1M1K4 4R80A 2OTJ3 2FXTA 3KKGA 3DGNA 1GY5A 3CCL3 1YVBI 4KFEA 2XFTA 3KSED 1SQWA 3GZXB 4BTYA 2ZL8A 2D1WA 2KCDA 3JUNA 3NX0A 1K9M4 1M9GA 2HMOB 1ROVA 3CMA3 3KFQC 1RRLA 3CXC2 2Z6BA 4N6OB 5LC7A 1A67A 2LYXA 2Y74A 4O02B 5CF2A 4Q53A 2ML6A 3WOEB 1VQ83 4HM3B 2E2VA 1VQ73 4LMIA 3CCV3 3OXAA 5IG4A 4R4KA 1VQO3 3OX9A 3Q90A 5DREA 3RDEA 4XM4A 2I9WA 5JBSA 2ZDJA 1IQXA 1YGEA 2KRTA 5D81A 4RBNA 5IEPA 1TUHA 1WMOA 1FGTA 3MG1A 4XDVA 1RN7A 5IG3A 4IIAA 4H61A 1TU5A 4FCMA 3WA2X 5KP4A 3FF0A 4R9LA 1IDPA 1VZZA 1S5AA 4HM5B 2QGUA 3H51A 4GL6A 3B7CA 4X2HA 3CNXA 3IPTA 3F8HA 4KFDA 4OUQA 4U13A 2P09A 4KVHA 4XBXA 1IVWA 3SOAA 3DGLA 1GD3A 2CFWA 4RNYA 1OHOA 4IT7A 4R1KA 3VF1A 2BNGA 2CWTA 2O9UX 1FGRA 4AKZA 2E2UA 2HMLB 3UJMA 3CCJ3 2IUJA 1M1XB 1K41A 3BLZA 3KN4A 2P0XA 4HM4B 3G0KA 2V1LA 1VQ63 2GXFA 1NJI4 2XGLA 1VQ53 1RRHA 3MG2A 3IMAB 4WP5A 2L4VA 1E3VA 2W03A 2KXGA 1IV7A 3FG4A 3Q1CA 1VQ43 2WO0A 5KP1A 1MOLA 3CC23 3A76A 3ER7A 2P0MA 4J8TA 4QWTA 4OVMA 1WMPA 3LOYA 3EC9A 2W2CA 1W6GA 5CF1A 1KWIA 3D9RA 2A15A 3NXJA 3MHEA 1IV9A 4WFOA 1W2B2 3V92A 3F14A 3WOFB 1N9JA 1Z1SA 1FGMA 1V74A 1E97A 1G96A 3PYJA 2W0QA 3X42A 3EBYA 1SIHA 3CCS3 3GZBA 1VQ93 3J7Yd 3HI7A 4EXRA 1YIT3 2STDA 2BO9B 4WYKA 1DYUA 3CCR3 1W7CA 1R4CA 1N5HA 3FG1A 3MG3A 2W56A 1RKYA 1GYBA 5TGNA 4LGQA 1UUVB 3BB9A 3HZPA 1L5GB 2OQEC 3NM2A 2YFIB 3F9SA 4BTXA 3B4OA 2O3OA 1QAKA 3X40A 3G16A 1D6ZA 4EYCA 4H3UA 1YJN3 8CHOA 2OTL3 1LXEA 4MMYB 1BUQA 2SBLA 1DMQA 2CH9A 2MF7A 3O8YA 3CME3 3NBRA 3EQQB 3SLUA 2FNQA 4K1UA 3UNLA 4FCJA 2P38A 3WODG 4XB5A 3KSPA 3RGRA 3K0ZA 4FMBA 1AV4A 1OUNA 3GAXA 3S5CA 2BT3A 1YHQ3 1VQK3 5BXQA 2XF3A 4JF8A 3X3XA 3X41A 1LVNA 1W6YA 3NV0A 1YJW3 1YI23 3S29A 1O7PB 3JUQA 2CK3H 2INXA 5JPPA 4O2HA 2OCTA 3HIGA 3K5TA 1DMNA 1N8QA 2B1XB 3MSOA 3U1WA 1NB3I 2CWVA 3X3YA 3SVAA 4N6TA 3DXOA 3EB8A 3NUVA 4AKYA 1EQKA 1WTHA 1UI8A 4L7KA 2Z77A 4HM2B 3SOYA 1D6YA 2F86B 2CKFB 3PZWA 1O7HB 1F8NA 2RCDA 4MMXB 3CPW2 1ULJB 1AVKA 3K7CA 3BNBA 2W9PA 1UI7A 1O7WB 2CG0A 2RSXA 4WYKB 4NREA 3I553 2CFKA 5FGOA 2W56B 2UX0A 5AI1A 1ISKA 2IMJA 1TIJA 2GBWB 3LYGA 5AIIA 2QA43 3OW22 1YJ93 1FA3A 2XR8B 1RJOA 4XDWA 3NQZA 4IPBA 5LC6A 1NDOB 1DMMA 4MJDA 4R9KA 1IVVA 3UB1A 5A0OB 2IUKA 2QEX3 4HM1B 5KP3A 3CCM3 3ECFA 3LH4A 1UUWB 3N9HA 2B24B 1S723 4N6V0 3LTAA 3LTCA 4HZ9B 3KIIA 1YIJ3 1W2ZA 3ROBA 1IU7A 3K9MC 4HM6B 4KZ1A 3FLJA 3FG3A 1Q40A 3OWYA 5IENA 1QMAA 4NHFA 1JKGA 5AYRB 3CNMA 2PZVA 3UL6A 4FMAA 1NWWA 1OPYA 5EQLA 1J2BA 3NV0B 5JPUA 1HU9A 2CWUA 1GS3A 3G713 3LTDA 5AIGA 4HM7B 1KSIA 3KE7A 1A90A 2OWPA 1K734 3SXXA 1Q864 3L0RA 4LSOA 3DGOA 3NHXA 2JQ5A 3S67A 4EV2A 2Q07A 5IEOA 3FH1A 4EBGA 1OHSA 2XGNA 5CXOA 3EJVA 1MNLA 3LT9A 4BTWA 2Z76A 4WHAA 5CK6A 1W5ZA 1C7HA 4STDA 3KZTA 4ORLA 2F99A 2CIUA 2QIYA 4XBYA 1K8A4 2K0MA 3JUPA 3I0YA 1IVXA 4JRFA 2Z7AA 1UW1A 5D82A 2HMJB 3G4S3 5FW5A 4EC6A 3N54B 1CYUA 1EG9B 2XRXB 4L8OA 3PS8A 2CG1A 2GEXA 4N6MA 3MKIA 3CPOA 3HX8A 2OOVC 2CFLA 2RGQA 3BNEA 1U8CB 4HYZA 1JB2A 1LOXA 4HJLB 3GZRA 3IJEB 1OH0A 1JB5A 4HKVB 1DVCA 3PCSA 3S27A 1Q824 2HMNB 1E3RA 1U5OA 2OQEA 1SIIA 4I4KA 1LNHA 2GEYA 5IF6A 2C10A 4CDLA 3EX9A 1CYVA 3K63A 1Q40B 3STDA 2CHCA 2FGTA 4MMZB 3SX1A 3TDGA 1JKGB 3F8XA 1AVLA 1QVF2 4HZBB 2CFDA 1M904 1QAFA 3BNDA 3DUKA 2C11A 3B8LA 1KQS2 1FGOA 3CCQ3 5AEWB 1OGZA 1W01A 3FZWA 3V98A 1WNHA 2BMOB 2WGQA 3CCE3 2Y73A 1TFOA 5ELJA 1VQM3 4ZM8A 1WQLB 1Q814 1IQ8A 3I563 1JRQA 3FF2A 2W9QA 5G2GA 3WA3A 1QVG2 1NU3A 3WDGB 3NQYA 3RGAA 2GU1A 3JVCA 5ELUA 3T8UA 3X3ZA 3MYTA 3S28A 2XFSA 5IW9A 4FR9A 4G1MB 3B4PA 3FGYA 1ROAA 3PGBA 4EV5A 3HIIA 4GB5A 1JB4A 2CC3A 1PU4A 1EKMA 4N6NB 1Q7Y4 5AIFA 1JN5A 1N8R4 1CQSA 3DMCA 3DZLA 4HM0B 1IVUA 2R4IA 3GRDA 4CCVA 1A2KA 1NB5I 1ZO2A 3ALAA 3OWSA 3G8ZA 1VQL3 5IERA 4N6LA 2M7OA 1STDA 1N9EA 2XSHB 3EF8A 3NBBA 3VGNA 3GWRA 3H3HA 1O7MB 3U97A 3BNCA 1KD14 3SEDA 1K28A 3EHCA 1O7NB 1FGQA 4RNZA 2K54A 2HMMB 2W6JH 3AMOB 1IK3A 2RFRA 1PFPA 2W04A 1GD4A 2GU3A 3LMLA 2WOHA 1ULIB 3DGMA 3OV4A 2XEPA 2P05A 3F7SA 5DRVA 2HMKB 2YFJB 1OF5A 1ASKA 2BMQB 2PNCA 5HGRA 1W00A 5EVHA 5D83A 4FMCA 1SJWA 2BHMA 4N6UA 4MEIA 1OACA 3FKAA 2BMRB 4FMDA 1QJGA 4XBTA 3Q2PA 1GY6A 1T5YA 3JUMA 2D42A 1W4NA 6STDA 4RZMA 5EEOA 5IG5A 1IT8A 2CW9A 2XH9A 5IG0A 4O8SA 5AEUB 3VSYA 1TFKA 3DM8A 3EBTA 3LTBA 3PXMA 1GY7A 2IA7A 3FSDA 3UL5A 1CEWI 3DY5A 2XSOB 3LT8A 4K1VA 4OK0A 1W02A 5AIHA 1DVDA 3PCRA 1W6CA 3OWUA 3V99A 4TX4A 2JDIH 4K90B 3FCSB 4AEQA 2GBXB 4O3VA 1JN5B 4WWUC 4HVNA 3M8CA 2E2TA 2CFGA 3LXUX 1HKXA 1VQP3 3QRDA 3G6E3 5BVBA 1VQN3 1AR0A 1JV2B 4N3VA 4J9AA 1FUWA 3MWZA 3WMDA 3CD63 1JJ22 4L8PA 4PEJA 3T8NA 3F40A 3NBJA 1NO3A 3AMOA 1IT7A 3N8BA 4HM8B 1KC84 5I97A 1OGXA 1OHPA 1Y4KA 2YFLB 3CCU3 3EN1B 4X2OA 3JUOA 5AYSC 4FCZA 1Q42A 4KFFA 7STDA 1QALA 1TP6A 5STDA 2F98A 3CU3A 3CC73 3GZYB 1D6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLK A;  1EA2 A;  1OF5 B;  1OCV A;  3EN8 A;  1O7G B;  1ZX2 A;  3F7X A;  3E99 A;  3LZA A;  3HK4 A;  4LEH A;  3KKG A;  1GY5 A;  3GZX B;  3JUN A;  2HMO B;  5CF2 A;  4Q53 A;  4HM3 B;  4LMI A;  3OXA A;  5IG4 A;  3OX9 A;  3Q90 A;  5DRE A;  4XM4 A;  2I9W A;  5D81 A;  5IEP A;  1TUH A;  4XDV A;  3MG1 A;  5IG3 A;  4IIA A;  4FCM A;  5KP4 A;  3FF0 A;  4R9L A;  1IDP A;  1VZZ A;  1S5A A;  4HM5 B;  2QGU A;  3H51 A;  3B7C A;  3CNX A;  3IPT A;  3F8H A;  4OUQ A;  4U13 A;  4KVH A;  4XBX A;  3SOA A;  1OHO A;  4R1K A;  2BNG A;  2HML B;  3UJM A;  1K41 A;  3BLZ A;  4HM4 B;  3G0K A;  2GXF A;  3MG2 A;  4WP5 A;  1E3V A;  5KP1 A;  3A76 A;  3ER7 A;  4J8T A;  4OVM A;  3EC9 A;  2W2C A;  5CF1 A;  3D9R A;  2A15 A;  3NXJ A;  3MHE A;  3F14 A;  1Z1S A;  1E97 A;  3EBY A;  3GZB A;  2STD A;  4WYK A;  3MG3 A;  1GYB A;  5TGN A;  4LGQ A;  1UUV B;  3BB9 A;  3HZP A;  3NM2 A;  2YFI B;  3F9S A;  3B4O A;  3G16 A;  4H3U A;  8CHO A;  1BUQ A;  1DMQ A;  3NBR A;  3EQQ B;  4K1U A;  3UNL A;  4FCJ A;  4XB5 A;  3KSP A;  3RGR A;  3K0Z A;  1OUN A;  3S5C A;  5BXQ A;  1W6Y A;  3NV0 A;  1O7P B;  3JUQ A;  2INX A;  5JPP A;  1DMN A;  2B1X B;  3MSO A;  3DXO A;  3NUV A;  4L7K A;  2Z77 A;  4HM2 B;  3SOY A;  2F86 B;  2CKF B;  1O7H B;  2RCD A;  1ULJ B;  3K7C A;  1O7W B;  4WYK B;  2UX0 A;  5AI1 A;  1ISK A;  2IMJ A;  2GBW B;  3LYG A;  5AII A;  2XR8 B;  4XDW A;  1NDO B;  1DMM A;  4MJD A;  4R9K A;  4HM1 B;  5KP3 A;  3ECF A;  1UUW B;  2B24 B;  4HZ9 B;  3ROB A;  4HM6 B;  3FLJ A;  3OWY A;  1Q40 A;  5IEN A;  1QMA A;  1JKG A;  3CNM A;  2PZV A;  1NWW A;  1OPY A;  3NV0 B;  5JPU A;  1GS3 A;  5AIG A;  4HM7 B;  3KE7 A;  2OWP A;  3NHX A;  2JQ5 A;  5IEO A;  3FH1 A;  1OHS A;  5CXO A;  3EJV A;  2Z76 A;  5CK6 A;  1C7H A;  4STD A;  3KZT A;  4ORL A;  2F99 A;  2QIY A;  4XBY A;  3CU3 A;  3JUP A;  3I0Y A;  2Z7A A;  5D82 A;  2HMJ B;  5FW5 A;  1EG9 B;  2XRX B;  4L8O A;  2GEX A;  3MKI A;  3CPO A;  3HX8 A;  2RGQ A;  1JB2 A;  4HJL B;  3GZR A;  1OH0 A;  1JB5 A;  4HKV B;  2HMN B;  1E3R A;  1U5O A;  4I4K A;  2GEY A;  5IF6 A;  4CDL A;  3EX9 A;  1Q40 B;  3STD A;  2CHC A;  1JKG B;  3F8X A;  4HZB B;  3DUK A;  3B8L A;  5AEW B;  1OGZ A;  1W01 A;  3FZW A;  2BMO B;  1WQL B;  3FF2 A;  5G2G A;  1NU3 A;  3RGA A;  3T8U A;  3MYT A;  3B4P A;  3FGY A;  4GB5 A;  1JB4 A;  5AIF A;  1JN5 A;  1CQS A;  3DMC A;  3DZL A;  4HM0 B;  2R4I A;  3GRD A;  1A2K A;  1ZO2 A;  3OWS A;  3G8Z A;  5IER A;  1STD A;  2XSH B;  3VGN A;  3EF8 A;  3GWR A;  3H3H A;  1O7M B;  3SED A;  3EHC A;  1O7N B;  2K54 A;  2HMM B;  2RFR A;  1ULI B;  3OV4 A;  3F7S A;  5DRV A;  2HMK B;  2YFJ B;  1OF5 A;  1ASK A;  2BMQ B;  5HGR A;  1W00 A;  5EVH A;  5D83 A;  1SJW A;  3FKA A;  2BMR B;  4XBT A;  1QJG A;  1GY6 A;  3JUM A;  6STD A;  4RZM A;  5IG5 A;  5IG0 A;  5AEU B;  3VSY A;  3DM8 A;  3EBT A;  1GY7 A;  3FSD A;  2XSO B;  4K1V A;  1W02 A;  5AIH A;  3OWU A;  2GBX B;  1JN5 B;  4WWU C;  4HVN A;  3M8C A;  1HKX A;  5BVB A;  1AR0 A;  4N3V A;  4J9A A;  3WMD A;  4L8P A;  4PEJ A;  3T8N A;  3F40 A;  4HM8 B;  1OGX A;  1OHP A;  2YFL B;  3EN1 B;  4X2O A;  3JUO A;  7STD A;  1Q42 A;  1TP6 A;  5STD A;  2F98 A;  4X2H A;  3GZY B; 
#chains in the Genus database with same CATH topology
 4K61 A;  5CLK A;  1N5P A;  3T0U A;  1EA2 A;  1OF5 B;  2MC8 A;  1B21 A;  1OCV A;  3NM7 A;  3QK9 A;  4BL2 A;  2WGO A;  3EN8 A;  4GSP A;  1LOV A;  1A2V A;  1O7G B;  1WMN A;  1ZX2 A;  1B2U A;  3F7X A;  4HBR A;  2OOV A;  1Q9E A;  4LZI A;  1SPU A;  2LQV A;  3E99 A;  1US1 A;  3LZA A;  3CC4 3;  3D3L A;  1BUJ A;  1STF I;  2YX9 A;  1TJD A;  3HK4 A;  2H0H A;  1I3F A;  1UGI A;  2WOF A;  5G1L A;  3EE1 A;  1JNQ A;  3MPH A;  1IQY A;  2ML5 A;  1UDI I;  4LEH A;  1M1K 4;  4R80 A;  2OTJ 3;  2FXT A;  3KKG A;  1YGW A;  3DGN A;  2KF5 A;  1GY5 A;  3CCL 3;  9RNT A;  1YVB I;  4KFE A;  2XFT A;  1GMP A;  1ZGX A;  1T2I A;  1BOX A;  3KSE D;  1SQW A;  3GZX B;  4BTY A;  2ZL8 A;  2D1W A;  2KCD A;  1I2F A;  1DE3 A;  1X1Y A;  3JUN A;  3NX0 A;  1M9G A;  1K9M 4;  2HMO B;  1ROV A;  3CMA 3;  3KFQ C;  1MGR A;  1RRL A;  3CXC 2;  2Z6B A;  4N6O B;  7RNT A;  1B2M A;  5LC7 A;  1RGH A;  1A67 A;  1LOY A;  2LYX A;  1PYL A;  2Y74 A;  4O02 B;  1RGL A;  5CF2 A;  4Q53 A;  1V57 A;  2ML6 A;  3WOE B;  1VQ8 3;  4HM3 B;  1HZ1 A;  2E2V A;  1VQ7 3;  1BRN L;  4LMI A;  5BU4 A;  3CCV 3;  3OXA A;  5IG4 A;  4R4K A;  1YNV X;  1VQO 3;  3OX9 A;  3Q90 A;  5DRE A;  1JBR A;  3RDE A;  4XM4 A;  1EUI C;  2I9W A;  5JBS A;  2ZDJ A;  1FYS A;  1IQX A;  1YGE A;  2KRT A;  1LQM B;  1YVS A;  3VGN A;  5D81 A;  1HYF A;  4RBN A;  5IEP A;  1TUH A;  1WMO A;  1FGT A;  3MG1 A;  4I5Q A;  4XDV A;  1RN7 A;  5IG3 A;  4IIA A;  1BRH A;  4H61 A;  1TU5 A;  1BAN A;  4FCM A;  3WA2 X;  5KP4 A;  3FF0 A;  3AGN A;  4R9L A;  1IDP A;  1JZO A;  1VZZ A;  1S5A A;  1Q7H A;  4HM5 B;  1A2P A;  2QGU A;  3H51 A;  4GL6 A;  3B7C A;  1SAR A;  4X2H A;  3CNX A;  3IPT A;  3F8H A;  4KFD A;  4OUQ A;  4U13 A;  2P09 A;  4KVH A;  4XBX A;  1IVW A;  3SOA A;  3DGL A;  1GD3 A;  2CFW A;  4RNY A;  1OHO A;  1RGE A;  4IT7 A;  4R1K A;  1GOU A;  2BNG A;  1MGW A;  2CWT A;  2O9U X;  3VF1 A;  1FGR A;  4AKZ A;  4BU4 A;  2E2U A;  1RGA A;  2HML B;  1UCL A;  3UJM A;  3CCJ 3;  2IUJ A;  1M1X B;  1BRJ A;  1K41 A;  1RDS A;  3BLZ A;  3KN4 A;  2P0X A;  4HM4 B;  3G0K A;  2V1L A;  1VQ6 3;  2GXF A;  5M18 A;  1NJI 4;  2XGL A;  1VQ5 3;  1RRH A;  3MG2 A;  1DET A;  3IMA B;  2L4V A;  1BAO A;  1E3V A;  2KXG A;  2W03 A;  4WP5 A;  1IV7 A;  3FG4 A;  3Q1C A;  1VQ4 3;  1X1X A;  2WO0 A;  1LOW A;  5KP1 A;  1MOL A;  1BIR A;  4RNT A;  3CC2 3;  3A76 A;  3ER7 A;  2P0M A;  4J8T A;  4QWT A;  4OVM A;  1WMP A;  3LOY A;  3EC9 A;  2W2C A;  1W6G A;  5CF1 A;  1KWI A;  3D9R A;  2H0I A;  4GHO A;  4ILF A;  2A15 A;  1R4Y A;  3NXJ A;  3MHE A;  1IV9 A;  4WFO A;  1W2B 2;  3V92 A;  2KAA A;  3F14 A;  3WOF B;  1N9J A;  1Z1S A;  1FGM A;  1V74 A;  3ZG5 A;  1E97 A;  1G96 A;  3PYJ A;  2W0Q A;  3X42 A;  3EBY A;  1SIH A;  3CCS 3;  3GZB A;  1VQ9 3;  3J7Y d;  3HI7 A;  4EXR A;  1YIT 3;  1RHL A;  2BO9 B;  2STD A;  1DYU A;  4WYK A;  3CCR 3;  1UCK A;  7GSP A;  1VQQ A;  1W7C A;  1LNI A;  1R4C A;  1N5H A;  1BRS A;  3FG1 A;  2W56 A;  3MG3 A;  1GYB A;  5TGN A;  6RNT A;  1RKY A;  1I3I A;  4LGQ A;  1BSC A;  1UUV B;  3BB9 A;  3HZP A;  1L5G B;  2OQE C;  1FW7 A;  3NM2 A;  2YFI B;  1BNF A;  3F9S A;  4BTX A;  3B4O A;  3ZG0 A;  2O3O A;  1QAK A;  1RCL A;  3X40 A;  3G16 A;  1D6Z A;  1BSA A;  4EYC A;  4H3U A;  1YJN 3;  1RN1 A;  8CHO A;  1JZD A;  2OTL 3;  3BIR A;  1AQZ A;  1RN4 A;  1LXE A;  4MMY B;  4HAA A;  1BUQ A;  2SBL A;  1DMQ A;  2CH9 A;  2GSP A;  2MF7 A;  3O8Y A;  3NBR A;  3EQQ B;  3SLU A;  4EW5 A;  3CME 3;  2FNQ A;  4K1U A;  3UNL A;  4FCJ A;  1BGS A;  2P38 A;  3WOD G;  4XB5 A;  3KSP A;  3RGR A;  3K0Z A;  1RMS A;  4FMB A;  1AV4 A;  1OUN A;  3GAX A;  1ZS7 A;  3S5C A;  2BT3 A;  1YHQ 3;  1VQK 3;  1B27 A;  2AAD A;  4J5G A;  5BXQ A;  2XF3 A;  4JF8 A;  3X3X A;  1UGH I;  1LVN A;  3X41 A;  1W6Y A;  3NV0 A;  2AAE A;  4BL3 A;  1YJW 3;  1YI2 3;  3S29 A;  1GMR A;  1O7P B;  1RLS A;  2CK3 H;  2INX A;  2IY2 A;  3JUQ A;  5JPP A;  4O2H A;  2OCT A;  3HIG A;  3K5T A;  1DMN A;  1N8Q A;  2B1X B;  5M1A A;  3MSO A;  1GMQ A;  2HOH A;  3U1W A;  1NB3 I;  2CWV A;  3X3Y A;  6GSP A;  3SVA A;  1BNJ A;  4N6T A;  3DXO A;  3EB8 A;  3NUV A;  4AKY A;  1EQK A;  1WTH A;  4KT3 B;  1UI8 A;  4L7K A;  2Z77 A;  4HM2 B;  3SOY A;  1D6Y A;  1B2Z A;  2CKF B;  2F86 B;  3PZW A;  1O7H B;  1F8N A;  3Q3F A;  2RCD A;  4MMX B;  3CPW 2;  1UCJ A;  1ULJ B;  1AVK A;  3K7C A;  3BNB A;  3WHO A;  1MWU A;  1UI7 A;  1O7W B;  2CG0 A;  2RSX A;  2F5M A;  2W9P A;  4NRE A;  4WYK B;  3I55 3;  4CJN A;  2CFK A;  4HOH A;  5FGO A;  1RGC A;  2W56 B;  2UX0 A;  5AI1 A;  1ISK A;  3AHW A;  2IMJ A;  1TIJ A;  2GBW B;  3LYG A;  5AII A;  2QA4 3;  3A5E A;  3DGY A;  3OW2 2;  1YJ9 3;  1TRP A;  1FA3 A;  2XR8 B;  1RJO A;  4XDW A;  1EEJ A;  3NQZ A;  4IPB A;  5LC6 A;  1NDO B;  1DMM A;  4MJD A;  2L1S A;  4R9K A;  1IVV A;  3UB1 A;  5A0O B;  2IUK A;  3BU4 A;  2QEX 3;  4HM1 B;  5KP3 A;  3CCM 3;  3ECF A;  3LH4 A;  1UUW B;  3N9H A;  2B24 B;  2IYJ A;  1S72 3;  4N6V 0;  3LTA A;  3LTC A;  4HZ9 B;  5GSP A;  3KII A;  1GSP A;  3D79 A;  3KCH A;  1YIJ 3;  1W2Z A;  1I0X A;  3ROB A;  1IU7 A;  2J8X B;  3K9M C;  4HM6 B;  4KZ1 A;  3FLJ A;  3FG3 A;  1Q40 A;  2RBI A;  1RNT A;  1I8V A;  3OWY A;  5IEN A;  1QMA A;  4NHF A;  1JKG A;  5AYR B;  3CNM A;  2PZV A;  2F4Y A;  3UL6 A;  4FMA A;  1NWW A;  1OPY A;  5EQL A;  1LQG C;  1B2X A;  3NV0 B;  5JPU A;  1J2B A;  1HU9 A;  1BRG A;  1FUS A;  2CWU A;  1GS3 A;  3G71 3;  3LTD A;  5AIG A;  5G1K A;  4HM7 B;  1MWR A;  2H0G A;  1MWS A;  1KSI A;  1MWT A;  3KE7 A;  1A90 A;  2OWP A;  1K73 4;  3SXX A;  1T3B A;  1Q86 4;  3L0R A;  4LSO A;  3DGO A;  3NHX A;  2JQ5 A;  1BRI A;  3S67 A;  1I2G A;  4EV2 A;  2Q07 A;  5HOH A;  5IEO A;  3FH1 A;  4EBG A;  3AGO A;  1OHS A;  2XGN A;  5CXO A;  2SAR A;  3D4A A;  3EJV A;  8RNT A;  1MNL A;  3LT9 A;  4BTW A;  2Z76 A;  4WHA A;  5CK6 A;  1W5Z A;  1C7H A;  1IYY A;  3GSP A;  2BIR A;  3KZT A;  3D5G A;  4ORL A;  2F99 A;  2CIU A;  2QIY A;  4STD A;  4XBY A;  2K0M A;  3JUP A;  3RNT A;  1K8A 4;  3I0Y A;  1IVX A;  2KF4 A;  1FUT A;  1BSB A;  4JRF A;  1B20 A;  2Z7A A;  1UW1 A;  4J5K A;  5D82 A;  2HMJ B;  1RTU A;  3G4S 3;  5FW5 A;  4EC6 A;  3N54 B;  1C54 A;  1CYU A;  1EG9 B;  2XRX B;  4L8O A;  3PS8 A;  2CG1 A;  2GEX A;  1PY3 A;  2K3D A;  4N6M A;  3MKI A;  3CPO A;  3HX8 A;  1BSE A;  2OOV C;  2CFL A;  2RGQ A;  3BNE A;  1U8C B;  1B2S A;  4HYZ A;  1JB2 A;  1LOX A;  4HJL B;  3GZR A;  3IJE B;  1CH0 A;  1OH0 A;  1BNG A;  1JB5 A;  4HKV B;  3ZFZ A;  1DVC A;  3PCS A;  3S27 A;  1NNV A;  1Q82 4;  2HMN B;  1E3R A;  1LRA A;  1U5O A;  2OQE A;  1SII A;  4I4K A;  1LNH A;  1BSD A;  2GEY A;  5IF6 A;  2C10 A;  2CX1 A;  3EX9 A;  1CYV A;  3K63 A;  1Q40 B;  3STD A;  2CHC A;  2FGT A;  4MMZ B;  3SX1 A;  3TDG A;  3WR2 A;  1JKG B;  3F8X A;  1AVL A;  1QVF 2;  4HZB B;  1UCI A;  2CFD A;  1M90 4;  1QAF A;  1BRK A;  3BND A;  3DUK A;  2C11 A;  3B8L A;  1KQS 2;  1FGO A;  2RNT A;  3CCQ 3;  2UUG C;  5AEW B;  1OGZ A;  1W01 A;  3FZW A;  3V98 A;  1I70 A;  1WNH A;  2BMO B;  2WGQ A;  3CCE 3;  2Y73 A;  1TFO A;  5ELJ A;  1VQM 3;  4ZM8 A;  1WQL B;  1Q81 4;  1BNR A;  1IQ8 A;  2F5W A;  1JRQ A;  3FF2 A;  3I56 3;  2W9Q A;  5G2G A;  3WA3 A;  1QVG 2;  1NU3 A;  3WDG B;  3NQY A;  3RGA A;  2GU1 A;  1RGK A;  2C4B A;  3JVC A;  5ELU A;  3T8U A;  2BU4 A;  3X3Z A;  3MYT A;  3S28 A;  2R41 A;  2XFS A;  4FR9 A;  4G1M B;  5IW9 A;  3B4P A;  3FGY A;  1ROA A;  3PGB A;  1RCK A;  4EV5 A;  3HII A;  4GB5 A;  1JB4 A;  2CC3 A;  1PU4 A;  1EKM A;  4N6N B;  3SYU A;  1Q7Y 4;  5AIF A;  1JN5 A;  1N8R 4;  1BNS A;  1CQS A;  3DMC A;  3DZL A;  4HM0 B;  1IVU A;  2R4I A;  3GRD A;  4CCV A;  1A2K A;  1NB5 I;  1ZO2 A;  3ALA A;  3OWS A;  3G8Z A;  1VQL 3;  1JBT A;  5IER A;  4N6L A;  2M7O A;  1STD A;  1N9E A;  1I2E A;  2XSH B;  3EF8 A;  3NBB A;  3GWR A;  3H3H A;  1O7M B;  3U97 A;  5RNT A;  3BNC A;  1RGG A;  1KD1 4;  3SED A;  1K28 A;  3EHC A;  1G0T A;  1RGF A;  1O7N B;  4LYL B;  5BIR A;  1FGQ A;  2ZA4 A;  4RNZ A;  2K54 A;  2HMM B;  2W6J H;  3AMO B;  1IK3 A;  1AY7 A;  2RFR A;  2KF6 A;  1PFP A;  2W04 A;  1GD4 A;  2GU3 A;  1RNB A;  3LML A;  2WOH A;  1ULI B;  3DGM A;  3OV4 A;  2XEP A;  2P05 A;  3F7S A;  5DRV A;  2HMK B;  2YFJ B;  1OF5 A;  1ASK A;  1BNI A;  2BMQ B;  2PNC A;  5HGR A;  1RSN A;  1W00 A;  3HOH A;  5EVH A;  5D83 A;  4FMC A;  1X1U A;  4DKI A;  4CDL A;  1SJW A;  2BHM A;  4N6U A;  4MEI A;  1TRQ A;  1OAC A;  3FKA A;  2BMR B;  4FMD A;  1G02 A;  1QJG A;  4XBT A;  3Q2P A;  1GY6 A;  1T5Y A;  3JUM A;  2D42 A;  1W4N A;  6STD A;  4RZM A;  5EEO A;  5IG5 A;  1IT8 A;  1BVI A;  2CW9 A;  2XH9 A;  5IG0 A;  4CPK A;  4O8S A;  5AEU B;  3VSY A;  1TFK A;  1TTO A;  3DM8 A;  3EBT A;  3LTB A;  1GOY A;  3PXM A;  1GY7 A;  2IA7 A;  3FSD A;  3UL5 A;  4NPB A;  1CEW I;  3DY5 A;  1FZU A;  2XSO B;  2F56 A;  3LT8 A;  1B3S A;  4K1V A;  4OK0 A;  1W02 A;  5AIH A;  1DVD A;  2ZHX B;  3PCR A;  1W6C A;  3OWU A;  3V99 A;  4TX4 A;  2JDI H;  4K90 B;  4BIR A;  3FCS B;  3D5I A;  4AEQ A;  2GBX B;  4O3V A;  1BNE A;  1JN5 B;  3URP A;  4WWU C;  5M19 A;  4HVN A;  2CX0 A;  3M8C A;  2E2T A;  1GOV A;  3AHS A;  2CFG A;  3LXU X;  1JBS A;  1HKX A;  1VQP 3;  3QRD A;  3G6E 3;  5BVB A;  1UUG B;  1VQN 3;  1AR0 A;  1JV2 B;  4N3V A;  4J9A A;  1FUW A;  3MWZ A;  3WMD A;  3CD6 3;  1JJ2 2;  4L8P A;  4PEJ A;  3T8N A;  3F40 A;  1T2H A;  1V58 A;  3NBJ A;  1NO3 A;  3AMO A;  1IT7 A;  3N8B A;  2KF3 A;  4HM8 B;  1KC8 4;  5I97 A;  1OGX A;  1OHP A;  1Y4K A;  2YFL B;  1BU4 A;  3CCU 3;  3EN1 B;  4X2O A;  3DH2 A;  3JUO A;  5AYS C;  4FCZ A;  1Q42 A;  4KFF A;  7STD A;  1I0V A;  1QAL A;  1TP6 A;  5STD A;  1X1W A;  2F98 A;  2UGI A;  3CU3 A;  3CC7 3;  3GZY B;  1D6U A; 
#chains in the Genus database with same CATH homology
 4K61 A;  5CLK A;  1N5P A;  3T0U A;  1EA2 A;  1OF5 B;  2MC8 A;  1OCV A;  3NM7 A;  3QK9 A;  2WGO A;  3EN8 A;  1A2V A;  1O7G B;  1WMN A;  1ZX2 A;  3F7X A;  4HBR A;  2OOV A;  4LZI A;  1SPU A;  2LQV A;  3E99 A;  1US1 A;  3LZA A;  3CC4 3;  3D3L A;  1STF I;  2YX9 A;  3HK4 A;  2WOF A;  3EE1 A;  1JNQ A;  3MPH A;  1IQY A;  2ML5 A;  4LEH A;  1M1K 4;  4R80 A;  2OTJ 3;  2FXT A;  3KKG A;  3DGN A;  1GY5 A;  3CCL 3;  1YVB I;  4KFE A;  2XFT A;  3KSE D;  1SQW A;  3GZX B;  4BTY A;  2ZL8 A;  2D1W A;  2KCD A;  3JUN A;  3NX0 A;  1K9M 4;  1M9G A;  2HMO B;  1ROV A;  3CMA 3;  3KFQ C;  1RRL A;  3CXC 2;  2Z6B A;  4N6O B;  5LC7 A;  1A67 A;  2LYX A;  2Y74 A;  4O02 B;  5CF2 A;  4Q53 A;  2ML6 A;  3WOE B;  1VQ8 3;  4HM3 B;  2E2V A;  1VQ7 3;  4LMI A;  3CCV 3;  3OXA A;  5IG4 A;  4R4K A;  1VQO 3;  3OX9 A;  3Q90 A;  5DRE A;  3RDE A;  4XM4 A;  2I9W A;  5JBS A;  2ZDJ A;  1IQX A;  1YGE A;  2KRT A;  5D81 A;  4RBN A;  5IEP A;  1TUH A;  1WMO A;  1FGT A;  3MG1 A;  4XDV A;  1RN7 A;  5IG3 A;  4IIA A;  4H61 A;  1TU5 A;  4FCM A;  3WA2 X;  5KP4 A;  3FF0 A;  4R9L A;  1IDP A;  1VZZ A;  1S5A A;  4HM5 B;  2QGU A;  3H51 A;  4GL6 A;  3B7C A;  4X2H A;  3CNX A;  3IPT A;  3F8H A;  4KFD A;  4OUQ A;  4U13 A;  2P09 A;  4KVH A;  4XBX A;  1IVW A;  3SOA A;  3DGL A;  1GD3 A;  2CFW A;  4RNY A;  1OHO A;  4IT7 A;  4R1K A;  3VF1 A;  2BNG A;  2CWT A;  2O9U X;  1FGR A;  4AKZ A;  2E2U A;  2HML B;  3UJM A;  3CCJ 3;  2IUJ A;  1M1X B;  1K41 A;  3BLZ A;  3KN4 A;  2P0X A;  4HM4 B;  3G0K A;  2V1L A;  1VQ6 3;  2GXF A;  1NJI 4;  2XGL A;  1VQ5 3;  1RRH A;  3MG2 A;  3IMA B;  4WP5 A;  2L4V A;  1E3V A;  2W03 A;  2KXG A;  1IV7 A;  3FG4 A;  3Q1C A;  1VQ4 3;  2WO0 A;  5KP1 A;  1MOL A;  3CC2 3;  3A76 A;  3ER7 A;  2P0M A;  4J8T A;  4QWT A;  4OVM A;  1WMP A;  3LOY A;  3EC9 A;  2W2C A;  1W6G A;  5CF1 A;  1KWI A;  3D9R A;  2A15 A;  3NXJ A;  3MHE A;  1IV9 A;  4WFO A;  1W2B 2;  3V92 A;  3F14 A;  3WOF B;  1N9J A;  1Z1S A;  1FGM A;  1V74 A;  1E97 A;  1G96 A;  3PYJ A;  2W0Q A;  3X42 A;  3EBY A;  1SIH A;  3CCS 3;  3GZB A;  1VQ9 3;  3J7Y d;  3HI7 A;  4EXR A;  1YIT 3;  2STD A;  2BO9 B;  4WYK A;  1DYU A;  3CCR 3;  1W7C A;  1R4C A;  1N5H A;  3FG1 A;  3MG3 A;  2W56 A;  1RKY A;  1GYB A;  5TGN A;  4LGQ A;  1UUV B;  3BB9 A;  3HZP A;  1L5G B;  2OQE C;  3NM2 A;  2YFI B;  3F9S A;  4BTX A;  3B4O A;  2O3O A;  1QAK A;  3X40 A;  3G16 A;  1D6Z A;  4EYC A;  4H3U A;  1YJN 3;  8CHO A;  2OTL 3;  1LXE A;  4MMY B;  1BUQ A;  2SBL A;  1DMQ A;  2CH9 A;  2MF7 A;  3O8Y A;  3CME 3;  3NBR A;  3EQQ B;  3SLU A;  2FNQ A;  4K1U A;  3UNL A;  4FCJ A;  2P38 A;  3WOD G;  4XB5 A;  3KSP A;  3RGR A;  3K0Z A;  4FMB A;  1AV4 A;  1OUN A;  3GAX A;  3S5C A;  2BT3 A;  1YHQ 3;  1VQK 3;  5BXQ A;  2XF3 A;  4JF8 A;  3X3X A;  3X41 A;  1LVN A;  1W6Y A;  3NV0 A;  1YJW 3;  1YI2 3;  3S29 A;  1O7P B;  3JUQ A;  2CK3 H;  2INX A;  5JPP A;  4O2H A;  2OCT A;  3HIG A;  3K5T A;  1DMN A;  1N8Q A;  2B1X B;  3MSO A;  3U1W A;  1NB3 I;  2CWV A;  3X3Y A;  3SVA A;  4N6T A;  3DXO A;  3EB8 A;  3NUV A;  4AKY A;  1EQK A;  1WTH A;  1UI8 A;  4L7K A;  2Z77 A;  4HM2 B;  3SOY A;  1D6Y A;  2F86 B;  2CKF B;  3PZW A;  1O7H B;  1F8N A;  2RCD A;  4MMX B;  3CPW 2;  1ULJ B;  1AVK A;  3K7C A;  3BNB A;  2W9P A;  1UI7 A;  1O7W B;  2CG0 A;  2RSX A;  4WYK B;  4NRE A;  3I55 3;  2CFK A;  5FGO A;  2W56 B;  2UX0 A;  5AI1 A;  1ISK A;  2IMJ A;  1TIJ A;  2GBW B;  3LYG A;  5AII A;  2QA4 3;  3OW2 2;  1YJ9 3;  1FA3 A;  2XR8 B;  1RJO A;  4XDW A;  3NQZ A;  4IPB A;  5LC6 A;  1NDO B;  1DMM A;  4MJD A;  4R9K A;  1IVV A;  3UB1 A;  5A0O B;  2IUK A;  2QEX 3;  4HM1 B;  5KP3 A;  3CCM 3;  3ECF A;  3LH4 A;  1UUW B;  3N9H A;  2B24 B;  1S72 3;  4N6V 0;  3LTA A;  3LTC A;  4HZ9 B;  3KII A;  1YIJ 3;  1W2Z A;  3ROB A;  1IU7 A;  3K9M C;  4HM6 B;  4KZ1 A;  3FLJ A;  3FG3 A;  1Q40 A;  3OWY A;  5IEN A;  1QMA A;  4NHF A;  1JKG A;  5AYR B;  3CNM A;  2PZV A;  3UL6 A;  4FMA A;  1NWW A;  1OPY A;  5EQL A;  1J2B A;  3NV0 B;  5JPU A;  1HU9 A;  2CWU A;  1GS3 A;  3G71 3;  3LTD A;  5AIG A;  4HM7 B;  1KSI A;  3KE7 A;  1A90 A;  2OWP A;  1K73 4;  3SXX A;  1Q86 4;  3L0R A;  4LSO A;  3DGO A;  3NHX A;  2JQ5 A;  3S67 A;  4EV2 A;  2Q07 A;  5IEO A;  3FH1 A;  4EBG A;  1OHS A;  2XGN A;  5CXO A;  3EJV A;  1MNL A;  3LT9 A;  4BTW A;  2Z76 A;  4WHA A;  5CK6 A;  1W5Z A;  1C7H A;  4STD A;  3KZT A;  4ORL A;  2F99 A;  2CIU A;  2QIY A;  4XBY A;  1K8A 4;  2K0M A;  3JUP A;  3I0Y A;  1IVX A;  4JRF A;  2Z7A A;  1UW1 A;  5D82 A;  2HMJ B;  3G4S 3;  5FW5 A;  4EC6 A;  3N54 B;  1CYU A;  1EG9 B;  2XRX B;  4L8O A;  3PS8 A;  2CG1 A;  2GEX A;  4N6M A;  3MKI A;  3CPO A;  3HX8 A;  2OOV C;  2CFL A;  2RGQ A;  3BNE A;  1U8C B;  4HYZ A;  1JB2 A;  1LOX A;  4HJL B;  3GZR A;  3IJE B;  1OH0 A;  1JB5 A;  4HKV B;  1DVC A;  3PCS A;  3S27 A;  1Q82 4;  2HMN B;  1E3R A;  1U5O A;  2OQE A;  1SII A;  4I4K A;  1LNH A;  2GEY A;  5IF6 A;  2C10 A;  4CDL A;  3EX9 A;  1CYV A;  3K63 A;  1Q40 B;  3STD A;  2CHC A;  2FGT A;  4MMZ B;  3SX1 A;  3TDG A;  1JKG B;  3F8X A;  1AVL A;  1QVF 2;  4HZB B;  2CFD A;  1M90 4;  1QAF A;  3BND A;  3DUK A;  2C11 A;  3B8L A;  1KQS 2;  1FGO A;  3CCQ 3;  5AEW B;  1OGZ A;  1W01 A;  3FZW A;  3V98 A;  1WNH A;  2BMO B;  2WGQ A;  3CCE 3;  2Y73 A;  1TFO A;  5ELJ A;  1VQM 3;  4ZM8 A;  1WQL B;  1Q81 4;  1IQ8 A;  3I56 3;  1JRQ A;  3FF2 A;  2W9Q A;  5G2G A;  3WA3 A;  1QVG 2;  1NU3 A;  3WDG B;  3NQY A;  3RGA A;  2GU1 A;  3JVC A;  5ELU A;  3T8U A;  3X3Z A;  3MYT A;  3S28 A;  2XFS A;  5IW9 A;  4FR9 A;  4G1M B;  3B4P A;  3FGY A;  1ROA A;  3PGB A;  4EV5 A;  3HII A;  4GB5 A;  1JB4 A;  2CC3 A;  1PU4 A;  1EKM A;  4N6N B;  1Q7Y 4;  5AIF A;  1JN5 A;  1N8R 4;  1CQS A;  3DMC A;  3DZL A;  4HM0 B;  1IVU A;  2R4I A;  3GRD A;  4CCV A;  1A2K A;  1NB5 I;  1ZO2 A;  3ALA A;  3OWS A;  3G8Z A;  1VQL 3;  5IER A;  4N6L A;  2M7O A;  1STD A;  1N9E A;  2XSH B;  3EF8 A;  3NBB A;  3VGN A;  3GWR A;  3H3H A;  1O7M B;  3U97 A;  3BNC A;  1KD1 4;  3SED A;  1K28 A;  3EHC A;  1O7N B;  1FGQ A;  4RNZ A;  2K54 A;  2HMM B;  2W6J H;  3AMO B;  1IK3 A;  2RFR A;  1PFP A;  2W04 A;  1GD4 A;  2GU3 A;  3LML A;  2WOH A;  1ULI B;  3DGM A;  3OV4 A;  2XEP A;  2P05 A;  3F7S A;  5DRV A;  2HMK B;  2YFJ B;  1OF5 A;  1ASK A;  2BMQ B;  2PNC A;  5HGR A;  1W00 A;  5EVH A;  5D83 A;  4FMC A;  1SJW A;  2BHM A;  4N6U A;  4MEI A;  1OAC A;  3FKA A;  2BMR B;  4FMD A;  1QJG A;  4XBT A;  3Q2P A;  1GY6 A;  1T5Y A;  3JUM A;  2D42 A;  1W4N A;  6STD A;  4RZM A;  5EEO A;  5IG5 A;  1IT8 A;  2CW9 A;  2XH9 A;  5IG0 A;  4O8S A;  5AEU B;  3VSY A;  1TFK A;  3DM8 A;  3EBT A;  3LTB A;  3PXM A;  1GY7 A;  2IA7 A;  3FSD A;  3UL5 A;  1CEW I;  3DY5 A;  2XSO B;  3LT8 A;  4K1V A;  4OK0 A;  1W02 A;  5AIH A;  1DVD A;  3PCR A;  1W6C A;  3OWU A;  3V99 A;  4TX4 A;  2JDI H;  4K90 B;  3FCS B;  4AEQ A;  2GBX B;  4O3V A;  1JN5 B;  4WWU C;  4HVN A;  3M8C A;  2E2T A;  2CFG A;  3LXU X;  1HKX A;  1VQP 3;  3QRD A;  3G6E 3;  5BVB A;  1VQN 3;  1AR0 A;  1JV2 B;  4N3V A;  4J9A A;  1FUW A;  3MWZ A;  3WMD A;  3CD6 3;  1JJ2 2;  4L8P A;  4PEJ A;  3T8N A;  3F40 A;  3NBJ A;  1NO3 A;  3AMO A;  1IT7 A;  3N8B A;  4HM8 B;  1KC8 4;  5I97 A;  1OGX A;  1OHP A;  1Y4K A;  2YFL B;  3CCU 3;  3EN1 B;  4X2O A;  3JUO A;  5AYS C;  4FCZ A;  1Q42 A;  4KFF A;  7STD A;  1QAL A;  1TP6 A;  5STD A;  2F98 A;  3CU3 A;  3CC7 3;  3GZY B;  1D6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...