4N6V0

Partial rotational order disorder structure of human stefin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
ATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Cystatin-B
publication title Partial rotational lattice order-disorder in stefin B crystals
doi rcsb
source organism Homo sapiens
total genus 22
structure length 91
sequence length 91
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6v000
3KSED 1WNHA 2OCTA 1R4CA 1CYVA 1EQKA 5EQLA 1NB5I 5LC6A 5LC7A 4CCVA 1YVBI 1MNLA 1N5PA 1IV7A 1FA3A 1TIJA 1A67A 1GD4A 3PS8A 3GAXA 2BO9B 1G96A 5A0OB 4IT7A 3LH4A 2W9QA 4N6LA 3PYJA 1CEWI 1CYUA 5ELJA 1DVDA 1A90A 3UL6A 2CH9A 1ROAA 1M9GA 3UL5A 4LZIA 3Q2PA 1GD3A 1N5HA 1KWIA 1FUWA 1MOLA 1LXEA 3L0RA 4N6MA 4EYCA 4N6OB 3PXMA 1DVCA 2KXGA 3IMAB 3MWZA 1IV9A 1N9JA 1STFI 4N6UA 4TX4A 3SVAA 5ELUA 4N6V0 2W9PA 3QRDA 4ZM8A 3K9MC 4N6TA 3NX0A 4N6NB 1NB3I 2O9UX 1RN7A 1PFPA 3KFQC 3S67A
chains in the Genus database with same CATH superfamily
5IENA 1RCLA 1A2PA 3KSED 1WNHA 1ULJB 3JUPA 2GU3A 4GSPA 2XGLA 2AADA 1IVXA 2BIRA 1RNBA 2E2TA 4CJNA 5AYSC 1JN5A 1UUGB 2UGIA 3HI7A 1Q40A 4CCVA 2F86B 1VQL3 1TRQA 3B8LA 1OHOA 4HM0B 2K54A 1YVBI 3NV0A 3BNDA 2GU1A 4HOHA 3D79A 4ORLA 3SOYA 3CNMA 1UDII 2RFRA 3OWSA 5DREA 3UB1A 2W2CA 1BANA 3RGRA 1LQGC 1B2SA 4GHOA 2FGTA 1KQS2 1RMSA 4HM4B 3B4PA 1ZO2A 1BOXA 2FXTA 5CLKA 3DGYA 1UGHI 2K0MA 1YIT3 4HM1B 1MWTA 5A0OB 1GOYA 4N6LA 2CG0A 1I3IA 4HVNA 3WA3A 4EV5A 3LTBA 1BU4A 5STDA 5ELJA 3LTCA 3EE1A 2IUJA 1B3SA 1UCLA 1Q42A 4CDLA 5AEUB 4QWTA 3STDA 4HJLB 1VQ53 2ZHXB 1LQMB 3JUQA 3CC43 3NUVA 4NPBA 2PNCA 4BL2A 2CW9A 4HKVB 4R80A 3X40A 3PGBA 1SARA 2C10A 1B27A 3UL5A 1LNIA 1UUWB 1I2GA 1W4NA 3S28A 4HM2B 3EJVA 1LOWA 1WMPA 2KAAA 1VQ73 1YIJ3 3SEDA 1FGOA 5CK6A 1VQ93 1HYFA 2WGOA 3Q2PA 4MMXB 1YHQ3 1O7PB 3LT8A 3AGNA 3KSPA 3L0RA 4N6MA 1D6UA 1RSNA 4N6OB 4EYCA 3U97A 1AVLA 3BNCA 1DVCA 3WOEB 3K0ZA 1GSPA 3OV4A 2KXGA 4STDA 1FGQA 2KF6A 2P09A 1GYBA 1WMOA 2IY2A 3NXJA 4WYKB 1IVUA 1N9EA 1O7GB 3U1WA 5HOHA 5D83A 2Z7AA 2R4IA 3G16A 2R41A 2F99A 4BL3A 3A76A 1R4YA 3JUNA 2QIYA 5AYRB 4IIAA 3G0KA 1W01A 4WYKA 4EXRA 5ELUA 1UCIA 1W2ZA 3BIRA 2W56B 1D6ZA 2CIUA 2HMMB 3N9HA 4N6V0 1I0VA 1RGFA 4X2HA 8CHOA 1IVVA 2RBIA 2XH9A 4XBXA 2RGQA 3ECFA 6GSPA 5AIHA 1TFKA 2WGQA 3ZFZA 1RGLA 1JB2A 3CXC2 1TFOA 5GSPA 2QA43 1ISKA 4IPBA 2QGUA 1D6YA 4FMBA 5RNTA 5IERA 1EKMA 4H3UA 2YFLB 1RLSA 2D1WA 1B21A 2CX0A 2HOHA 2CFDA 3T8NA 4O02B 4EV2A 5IW9A 5KP3A 1AVKA 3SXXA 1T5YA 2SARA 2HMKB 1RN7A 2P05A 4XM4A 4U13A 2IYJA 1RGGA 4RZMA 3UJMA 3V99A 1UUVB 2KF3A 3EBYA 3KE7A 1I8VA 5G1KA 1T3BA 3G6E3 2V1LA 5EQLA 3CD63 1U5OA 1EQKA 1Q7HA 2C11A 3VSYA 3J7Yd 3OXAA 1OCVA 1JNQA 2W0QA 3GZRA 1RGHA 2XEPA 3KIIA 2HMNB 4HM8B 1SPUA 2KRTA 1N5PA 3FGYA 3GWRA 1UCJA 4HM3B 5CF1A 2BT3A 1OUNA 1TIJA 4AEQA 1A67A 4I4KA 4Q53A 1VQQA 1MWRA 4WFOA 3PS8A 2PZVA 2GEYA 1RRLA 3WHOA 5EEOA 1O7NB 1OHPA 1A2VA 2XSOB 2D42A 1WQLB 3T8UA 2BHMA 3CCL3 3LH4A 2W9QA 1NDOB 3PYJA 1CEWI 5JPPA 2JQ5A 1CYUA 1YVSA 2Y73A 3CCR3 1Z1SA 5I97A 4MMZB 3CME3 5CF2A 4BTWA 3JUOA 3AHSA 2H0HA 3F8HA 4HM7B 1M904 3B4OA 1ASKA 2CH9A 2CK3H 5EVHA 1ROAA 3X41A 1B2MA 1M9GA 4OVMA 3I563 1V58A 4ILFA 1YJW3 1RGAA 2OOVA 3HK4A 2UX0A 3X3ZA 4R4KA 1T2IA 2E2VA 1OPYA 3NHXA 3PCRA 4R1KA 1BSCA 3EBTA 4AKYA 1PU4A 1AV4A 2YFIB 2GBWB 4O3VA 1FYSA 1FUTA 1IQYA 1FUWA 1MOLA 3DZLA 1HZ1A 3G713 1Q864 1M1XB 3M8CA 1W2B2 1IVWA 3WDGB 1BRIA 1QAFA 2CWTA 2HMLB 3IMAB 1JV2B 2OTJ3 4R9KA 4WHAA 3MWZA 1BNIA 1AY7A 1UI8A 2CFLA 3QK9A 2ZA4A 1PY3A 1N9JA 3MYTA 2BMQB 3AMOB 4KT3B 3V98A 4JRFA 3WODG 2A15A 2XFTA 2C4BA 2LQVA 3DXOA 4J5KA 4OUQA 4BIRA 1VQ83 1B2ZA 3MG1A 3DMCA 4LSOA 1TRPA 1B20A 2L1SA 2CWVA 3QRDA 3LMLA 4ZM8A 2GSPA 3DH2A 1DYUA 4GB5A 1JZDA 1IK3A 3VF1A 3CPOA 1NNVA 1UGIA 2L4VA 6RNTA 2XFSA 1RGKA 4N6TA 3NM7A 1UW1A 5BIRA 2Z76A 1JKGB 1I3FA 1TTOA 2CX1A 3NX0A 2XGNA 4FMDA 3F7XA 3CCV3 3X42A 4DKIA 1CQSA 2IUKA 1NB3I 2B24B 2HMJB 1PFPA 3KFQC 1BSAA 5FW5A 3FCSB 2F4YA 2Z6BA 2B1XB 1RGEA 1LNHA 3DGOA 1BNJA 4XBTA 2BMOB 3FF2A 1KD14 1E3RA 1K9M4 3OW22 3S67A 4L8PA 1M1K4 1E97A 3CMA3 4O8SA 3RDEA 5IG0A 3X3YA 1HKXA 1FW7A 1IQ8A 2XRXB 3FG4A 4EW5A 1BSDA 1O7WB 1RN4A 2ZDJA 1K734 5AIFA 1BUJA 1RRHA 2YFJB 1W5ZA 1NB5I 5LC6A 1RNTA 3TDGA 1O7HB 1L5GB 5LC7A 4LGQA 4N3VA 3CCJ3 4EC6A 2W56A 1BIRA 4WWUC 5G2GA 1SQWA 2J8XB 3GZXB 5JBSA 1WTHA 2K3DA 2O3OA 3FH1A 5KP4A 1N8R4 1K8A4 5FGOA 3O8YA 1GMRA 3LT9A 3F40A 1X1WA 3CPW2 2BU4A 2CHCA 1Y4KA 3SLUA 4LYLB 4XDWA 1QVG2 1PYLA 3MG2A 3HIIA 4O2HA 3WA2X 3KN4A 3Q90A 2WOHA 2P0MA 2GXFA 1N8QA 5HGRA 2BO9B 4K90B 1G96A 3K5TA 2KF5A 2WOFA 1GOUA 3EC9A 3HOHA 1LOVA 3A5EA 1WMNA 1OF5B 4IT7A 4XB5A 1W00A 3NQZA 4HZBB 3OX9A 1VQ63 9RNTA 3LXUX 1X1UA 3JVCA 1FGMA 1GY7A 3MG3A 4J5GA 1ZS7A 2CFKA 2OOVC 1KSIA 3S5CA 1FGTA 5DRVA 1DVDA 1I0XA 1W6GA 4KFEA 3D5IA 3T0UA 1BRGA 1OF5A 4GL6A 3MSOA 1F8NA 2BNGA 3UL6A 5BU4A 3FF0A 3DY5A 1V74A 3EX9A 3S29A 1OH0A 3MPHA 1I70A 1KC84 2AAEA 1YGEA 1B2XA 4LZIA 3CCQ3 1ULIB 3URPA 2W6JH 1DE3A 5IF6A 3F9SA 4MMYB 1BNEA 1TU5A 1EEJA 1W02A 3KKGA 3ZG5A 1BVIA 1BNGA 5IG4A 1GD3A 1N5HA 1VQM3 1RN1A 1KWIA 2F5MA 2IA7A 2CKFB 3SYUA 2OWPA 1GOVA 1LVNA 3RGAA 4AKZA 1DMNA 2W03A 2Y74A 4KFDA 1VQK3 1FUSA 1MGWA 1VQO3 4CPKA 1RCKA 4HM5B 2CC3A 3SX1A 5D82A 1Q7Y4 3JUMA 1BRNL 3IPTA 4XDVA 3CU3A 4HBRA 3BNBA 3SOAA 1C7HA 2F98A 3F8XA 3NBJA 1QJGA 3V92A 3E99A 3EQQB 3CCE3 1IV9A 1RJOA 2Z77A 3AHWA 1STFI 2P38A 5IEPA 1GMQA 2MF7A 2STDA 1AR0A 1IT8A 1TJDA 4X2OA 1OHSA 2WO0A 3FLJA 1HU9A 1BAOA 3HZPA 1X1XA 4N6UA 1RHLA 1JN5B 4RNZA 5M19A 1VQN3 1Q40B 2BMRB 1SJWA 1W6YA 2HMOB 1JB5A 3NV0B 4FMAA 1SIIA 2CFWA 1BRSA 1JB4A 1ZX2A 2CFGA 3ALAA 2M7OA 3D9RA 3Q3FA 4I5QA 5TGNA 6STDA 2KCDA 4HZ9B 3F14A 2CWUA 4WP5A 1S5AA 1ZGXA 3EN8A 3MHEA 2RNTA 1FGRA 1IU7A 4MEIA 3ROBA 2P0XA 2IMJA 3ER7A 3HIGA 3LTDA 3PZWA 4J8TA 3CNXA 1K41A 3WMDA 3EF8A 1IQXA 2O9UX 3K7CA 4KVHA 3GZYB 1U8CB 3FG3A 2RSXA 1TP6A 3ZG0A 3K63A 3FSDA 1AQZA 4RBNA 3EN1B 3DGLA 4G1MB 1GMPA 5AEWB 2OCTA 1DMMA 1R4CA 1CYVA 2OTL3 3FG1A 4NHFA 1GS3A 2GBXB 2INXA 3MKIA 3AMOA 1G02A 1O7MB 3IJEB 1LRAA 4LMIA 1BNSA 2XR8B 4K1VA 7STDA 3G4S3 3BU4A 1K28A 2I9WA 3PCSA 3D4AA 3I0YA 4BU4A 1MNLA 2LYXA 1RTUA 3EHCA 1JBTA 3CCS3 1QMAA 8RNTA 1BUQA 1IV7A 1FA3A 1I2FA 1NJI4 2XF3A 4FCMA 2KF4A 1GD4A 3FZWA 4K61A 1QALA 5IG5A 1Q9EA 1MGRA 3NM2A 1W7CA 3N8BA 1FZUA 3GAXA 2MC8A 4JF8A 1OACA 1JKGA 2FNQA 1T2HA 5AI1A 1BNRA 2CG1A 5BXQA 2ML5A 4KFFA 2YX9A 4H61A 5IEOA 1EA2A 3NQYA 5KP1A 1GY5A 3F7SA 2Q07A 4L8OA 4J9AA 5G1LA 3RNTA 3LOYA 2QEX3 1VQ43 1DMQA 1I2EA 1A90A 1MWUA 4OK0A 1BGSA 3H51A 1VZZA 5IG3A 1BSBA 1W6CA 5BVBA 3DGMA 1A2KA 2GEXA 1OGXA 3WOFB 1JRQA 3D5GA 3WR2A 3GRDA 1J2BA 1Q824 2F56A 1NO3A 4HYZA 3BLZA 1TUHA 3DUKA 5AIIA 1E3VA 1EUIC 1UI7A 1SIHA 7RNTA 3B7CA 4K1UA 4PEJA 3Q1CA 4R9LA 3BB9A 3KCHA 1QVF2 2RCDA 2ML6A 3NBBA 4EBGA 4XBYA 1DETA 1LXEA 3NBRA 1STDA 2E2UA 2OQEC 3BNEA 3PXMA 3HX8A 4BTYA 3OWUA 4RNTA 1C54A 1G0TA 1YGWA 4BTXA 3LTAA 3S27A 1Q814 4FMCA 4FCJA 3KZTA 7GSPA 3H3HA 4RNYA 1IT7A 3X3XA 3DGNA 3I553 1YI23 1BRHA 1VQP3 3GSPA 3N54B 3UNLA 1JBRA 1RGCA 3D3LA 4HM6B 5M18A 1EG9B 3CC73 4FCZA 3CC23 1YNVX 4TX4A 1MWSA 3SVAA 3G8ZA 1BNFA 3CCU3 1UCKA 3OWYA 5D81A 1LOXA 1NU3A 4LEHA 2W9PA 4FR9A 1OGZA 4KZ1A 1CH0A 5CXOA 3VGNA 5JPUA 1V57A 2H0GA 5M1AA 1X1YA 2SBLA 3K9MC 4L7KA 1IDPA 1RKYA 2F5WA 2UUGC 1BRJA 3LYGA 3EB8A 1B2UA 1LOYA 3DM8A 4NREA 1QAKA 1NWWA 1IYYA 2W04A 1US1A 2ZL8A 1YJN3 2H0IA 3AGOA 1JZOA 4MJDA 4N6NB 4HAAA 1ROVA 2XSHB 3LZAA 2OQEA 1JBSA 3GZBA 1JJ22 2JDIH 3CCM3 1BSEA 3FKAA 1S723 1RDSA 5AIGA 1BRKA 1YJ93 1GY6A
chains in the Genus database with same CATH topology
5IENA 3KSED 1WNHA 1ULJB 3JUPA 2GU3A 2XGLA 1IVXA 2E2TA 5AYSC 1JN5A 3HI7A 1Q40A 4CCVA 2F86B 1VQL3 3B8LA 1OHOA 4HM0B 2K54A 1YVBI 3NV0A 3BNDA 2GU1A 4ORLA 3SOYA 3CNMA 3OWSA 2RFRA 5DREA 3UB1A 2W2CA 3RGRA 2FGTA 1KQS2 4HM4B 3B4PA 1ZO2A 2FXTA 5CLKA 1YIT3 2K0MA 4HM1B 5A0OB 4N6LA 2CG0A 3WA3A 4HVNA 4EV5A 3LTBA 5STDA 5ELJA 3LTCA 3EE1A 2IUJA 1Q42A 4CDLA 5AEUB 4QWTA 3STDA 4HJLB 1VQ53 3JUQA 3CC43 3NUVA 2PNCA 2CW9A 4HKVB 4R80A 3X40A 3PGBA 2C10A 3UL5A 1UUWB 1W4NA 3S28A 4HM2B 3EJVA 1YIJ3 1WMPA 1VQ93 1VQ73 3SEDA 1FGOA 5CK6A 2WGOA 3Q2PA 4MMXB 1YHQ3 1O7PB 3LT8A 3KSPA 3L0RA 4N6MA 1D6UA 4EYCA 4N6OB 3U97A 1AVLA 3BNCA 1DVCA 3WOEB 3K0ZA 3OV4A 2KXGA 4STDA 1FGQA 2P09A 1GYBA 1WMOA 3NXJA 4WYKB 1IVUA 1N9EA 1O7GB 3U1WA 5D83A 2Z7AA 2R4IA 3G16A 2F99A 3A76A 3JUNA 2QIYA 5AYRB 4IIAA 3G0KA 1W01A 4WYKA 4EXRA 1W2ZA 2W56B 1D6ZA 2CIUA 2HMMB 3N9HA 4N6V0 4X2HA 8CHOA 1IVVA 2XH9A 4XBXA 2RGQA 3ECFA 5AIHA 1TFKA 2WGQA 2QA43 1JB2A 3CXC2 1TFOA 1ISKA 4IPBA 2QGUA 1D6YA 4FMBA 5IERA 1EKMA 4H3UA 2YFLB 2D1WA 2CFDA 3T8NA 4O02B 4EV2A 5IW9A 5KP3A 1AVKA 3SXXA 1T5YA 2HMKB 1RN7A 2P05A 4XM4A 4U13A 4RZMA 3UJMA 3V99A 1UUVB 3EBYA 3KE7A 3G6E3 2V1LA 5EQLA 3CD63 1U5OA 1EQKA 2C11A 3VSYA 3J7Yd 3OXAA 1OCVA 1JNQA 2W0QA 3GZRA 2XEPA 3KIIA 2HMNB 4HM8B 1SPUA 2KRTA 1N5PA 3FGYA 3GWRA 4HM3B 5CF1A 2BT3A 1OUNA 1TIJA 4AEQA 1A67A 4I4KA 4Q53A 4WFOA 3PS8A 2PZVA 2GEYA 1RRLA 5EEOA 1O7NB 1OHPA 1A2VA 2XSOB 2D42A 1WQLB 3T8UA 2BHMA 3CCL3 3LH4A 2W9QA 1NDOB 3PYJA 1CEWI 5JPPA 2JQ5A 1CYUA 2Y73A 3CCR3 1Z1SA 5I97A 4MMZB 3CME3 5CF2A 4BTWA 3JUOA 3F8HA 4HM7B 1M904 3B4OA 1ASKA 2CH9A 2CK3H 5EVHA 1ROAA 3X41A 1M9GA 4OVMA 3I563 1YJW3 2OOVA 3X3ZA 3HK4A 2UX0A 4R4KA 2E2VA 1OPYA 3NHXA 3PCRA 4R1KA 3EBTA 4AKYA 1PU4A 1AV4A 2YFIB 2GBWB 4O3VA 1IQYA 1FUWA 1MOLA 3DZLA 3G713 1Q864 1M1XB 3M8CA 1W2B2 1IVWA 3WDGB 1QAFA 2CWTA 2HMLB 3IMAB 1JV2B 2OTJ3 4R9KA 4WHAA 3MWZA 1UI8A 2CFLA 3QK9A 1N9JA 3MYTA 2BMQB 3AMOB 3V98A 4JRFA 3WODG 2A15A 2XFTA 2LQVA 3DXOA 4OUQA 1VQ83 3MG1A 3DMCA 4LSOA 3QRDA 2CWVA 3LMLA 4ZM8A 1DYUA 4GB5A 1IK3A 3VF1A 3CPOA 2L4VA 2XFSA 4N6TA 3NM7A 1UW1A 2Z76A 1JKGB 3NX0A 2XGNA 4FMDA 3F7XA 3CCV3 3X42A 1CQSA 2IUKA 1NB3I 2B24B 2HMJB 1PFPA 3KFQC 5FW5A 3FCSB 2Z6BA 2B1XB 4XBTA 1LNHA 3DGOA 1KD14 2BMOB 3FF2A 1K9M4 1E3RA 3OW22 3S67A 4L8PA 1M1K4 1E97A 3CMA3 4O8SA 3RDEA 5IG0A 3X3YA 1HKXA 1IQ8A 2XRXB 3FG4A 2ZDJA 1O7WB 1K734 5AIFA 1RRHA 2YFJB 1W5ZA 1NB5I 5LC6A 3TDGA 1O7HB 1L5GB 5LC7A 4LGQA 4N3VA 3CCJ3 4EC6A 2W56A 4WWUC 5G2GA 1SQWA 3GZXB 5JBSA 1WTHA 2O3OA 3FH1A 5KP4A 1N8R4 1K8A4 5FGOA 3O8YA 3LT9A 3F40A 3CPW2 2CHCA 1Y4KA 3SLUA 4XDWA 1QVG2 3MG2A 3HIIA 4O2HA 3WA2X 3KN4A 3Q90A 2WOHA 2P0MA 2GXFA 1N8QA 5HGRA 2BO9B 4K90B 1G96A 3K5TA 2WOFA 3EC9A 1WMNA 1OF5B 4IT7A 4XB5A 1W00A 3NQZA 4HZBB 3OX9A 1VQ63 3LXUX 3JVCA 1FGMA 1GY7A 3MG3A 2CFKA 2OOVC 1KSIA 3S5CA 1FGTA 5DRVA 1DVDA 1W6GA 4KFEA 3T0UA 1OF5A 4GL6A 3MSOA 1F8NA 2BNGA 3UL6A 3FF0A 3DY5A 1V74A 3EX9A 3S29A 1OH0A 3MPHA 1KC84 1YGEA 4LZIA 3CCQ3 1ULIB 2W6JH 5IF6A 3F9SA 4MMYB 1TU5A 1W02A 3KKGA 5IG4A 1N5HA 1GD3A 1VQM3 1KWIA 2IA7A 2CKFB 2OWPA 1LVNA 3RGAA 4AKZA 1DMNA 2W03A 2Y74A 4KFDA 1VQK3 1VQO3 4HM5B 3SX1A 2CC3A 5D82A 1Q7Y4 3JUMA 3IPTA 4XDVA 3CU3A 4HBRA 3BNBA 3SOAA 1C7HA 2F98A 3F8XA 3NBJA 1QJGA 3V92A 3E99A 3EQQB 3CCE3 1IV9A 1RJOA 2Z77A 1STFI 2P38A 5IEPA 2MF7A 2STDA 1AR0A 1IT8A 4X2OA 1OHSA 2WO0A 3FLJA 1HU9A 4N6UA 3HZPA 4RNZA 1JN5B 1VQN3 1Q40B 2BMRB 1SJWA 2HMOB 1W6YA 1JB5A 3NV0B 4FMAA 1SIIA 2CFWA 1JB4A 5ELUA 1ZX2A 2CFGA 3ALAA 2M7OA 3D9RA 5TGNA 6STDA 2KCDA 4HZ9B 3F14A 2CWUA 4WP5A 1S5AA 3EN8A 3MHEA 1FGRA 1IU7A 4MEIA 3ROBA 2P0XA 2IMJA 3ER7A 3HIGA 3LTDA 3PZWA 4J8TA 3CNXA 1K41A 3WMDA 3EF8A 1IQXA 2O9UX 3K7CA 4KVHA 3GZYB 1U8CB 3FG3A 2RSXA 1TP6A 3K63A 3FSDA 4RBNA 3EN1B 3DGLA 4G1MB 5AEWB 2OCTA 1DMMA 1R4CA 1CYVA 2OTL3 3FG1A 4NHFA 1GS3A 2GBXB 2INXA 3MKIA 3AMOA 1O7MB 3IJEB 4LMIA 2XR8B 4K1VA 7STDA 3G4S3 1K28A 2I9WA 3PCSA 3I0YA 1MNLA 2LYXA 3EHCA 3CCS3 1QMAA 1BUQA 1IV7A 1FA3A 1NJI4 2XF3A 4FCMA 1GD4A 3FZWA 4K61A 1QALA 5IG5A 3NM2A 1W7CA 3N8BA 3GAXA 2MC8A 4JF8A 1OACA 1JKGA 2FNQA 5AI1A 2CG1A 5BXQA 2ML5A 4KFFA 2YX9A 4H61A 5IEOA 1EA2A 3NQYA 5KP1A 1GY5A 3F7SA 2Q07A 4L8OA 4J9AA 2QEX3 3LOYA 1VQ43 1DMQA 1A90A 4OK0A 3H51A 1VZZA 5IG3A 1W6CA 5BVBA 3DGMA 1A2KA 2GEXA 1OGXA 3WOFB 1JRQA 3GRDA 1J2BA 1Q824 4HYZA 1NO3A 3BLZA 1TUHA 3DUKA 5AIIA 1E3VA 1UI7A 1SIHA 3B7CA 4K1UA 4PEJA 3Q1CA 4R9LA 3BB9A 1QVF2 2RCDA 2ML6A 3NBBA 4EBGA 4XBYA 1LXEA 3NBRA 1STDA 2E2UA 2OQEC 3BNEA 3PXMA 3HX8A 4BTYA 3OWUA 4BTXA 3LTAA 3S27A 1Q814 4FMCA 4FCJA 3KZTA 3H3HA 4RNYA 1IT7A 3X3XA 3DGNA 3I553 1YI23 1VQP3 3N54B 3UNLA 3D3LA 4HM6B 1EG9B 3CC73 4FCZA 3CC23 4TX4A 3SVAA 3G8ZA 3CCU3 3OWYA 5D81A 1LOXA 1NU3A 4LEHA 2W9PA 4FR9A 1OGZA 4KZ1A 5CXOA 3VGNA 5JPUA 4L7KA 2SBLA 3K9MC 1IDPA 1RKYA 3LYGA 3EB8A 3DM8A 4NREA 1QAKA 1NWWA 2W04A 1US1A 2ZL8A 1YJN3 4N6NB 4MJDA 1ROVA 2XSHB 3LZAA 2OQEA 3GZBA 1JJ22 2JDIH 3CCM3 3FKAA 1S723 5AIGA 1YJ93 1GY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSE D;  1WNH A;  2OCT A;  1R4C A;  1CYV A;  1EQK A;  5EQL A;  1NB5 I;  5LC6 A;  5LC7 A;  4CCV A;  1YVB I;  1MNL A;  1N5P A;  1IV7 A;  1FA3 A;  1TIJ A;  1A67 A;  1GD4 A;  3PS8 A;  3GAX A;  2BO9 B;  1G96 A;  5A0O B;  4IT7 A;  3LH4 A;  2W9Q A;  4N6L A;  3PYJ A;  1CEW I;  1CYU A;  5ELJ A;  1DVD A;  1A90 A;  3UL6 A;  2CH9 A;  1ROA A;  1M9G A;  3UL5 A;  4LZI A;  3Q2P A;  1GD3 A;  1N5H A;  1KWI A;  1FUW A;  1MOL A;  1LXE A;  3L0R A;  4N6M A;  4EYC A;  4N6O B;  3PXM A;  1DVC A;  2KXG A;  3IMA B;  3MWZ A;  1IV9 A;  1N9J A;  1STF I;  4N6U A;  4TX4 A;  3SVA A;  5ELU A;  4N6V 0;  2W9P A;  3QRD A;  4ZM8 A;  3K9M C;  4N6T A;  3NX0 A;  4N6N B;  1NB3 I;  2O9U X;  1RN7 A;  1PFP A;  3KFQ C;  3S67 A; 
#chains in the Genus database with same CATH topology
 5IEN A;  1RCL A;  1A2P A;  3KSE D;  1WNH A;  1ULJ B;  3JUP A;  2GU3 A;  4GSP A;  2XGL A;  2AAD A;  1IVX A;  2BIR A;  1RNB A;  2E2T A;  4CJN A;  5AYS C;  1JN5 A;  1UUG B;  2UGI A;  3HI7 A;  1Q40 A;  4CCV A;  2F86 B;  1VQL 3;  1TRQ A;  3B8L A;  1OHO A;  4HM0 B;  2K54 A;  1YVB I;  3NV0 A;  3BND A;  2GU1 A;  4HOH A;  3D79 A;  4ORL A;  3SOY A;  3CNM A;  1UDI I;  2RFR A;  3OWS A;  5DRE A;  3UB1 A;  2W2C A;  1BAN A;  3RGR A;  1LQG C;  1B2S A;  4GHO A;  2FGT A;  1KQS 2;  1RMS A;  4HM4 B;  3B4P A;  1ZO2 A;  1BOX A;  2FXT A;  5CLK A;  3DGY A;  1UGH I;  2K0M A;  1YIT 3;  4HM1 B;  1MWT A;  5A0O B;  1GOY A;  4N6L A;  2CG0 A;  1I3I A;  4HVN A;  3WA3 A;  4EV5 A;  3LTB A;  1BU4 A;  5STD A;  5ELJ A;  3LTC A;  3EE1 A;  2IUJ A;  1B3S A;  1UCL A;  1Q42 A;  4CDL A;  5AEU B;  4QWT A;  3STD A;  4HJL B;  1VQ5 3;  2ZHX B;  1LQM B;  3JUQ A;  3CC4 3;  3NUV A;  4NPB A;  2PNC A;  4BL2 A;  2CW9 A;  4HKV B;  4R80 A;  3X40 A;  3PGB A;  1SAR A;  2C10 A;  1B27 A;  3UL5 A;  1LNI A;  1UUW B;  1I2G A;  1W4N A;  3S28 A;  4HM2 B;  3EJV A;  1LOW A;  1WMP A;  2KAA A;  1VQ7 3;  1YIJ 3;  3SED A;  1FGO A;  5CK6 A;  1VQ9 3;  1HYF A;  2WGO A;  3Q2P A;  4MMX B;  1YHQ 3;  1O7P B;  3LT8 A;  3AGN A;  3KSP A;  3L0R A;  4N6M A;  1D6U A;  1RSN A;  4N6O B;  4EYC A;  3U97 A;  1AVL A;  3BNC A;  1DVC A;  3WOE B;  3K0Z A;  1GSP A;  3OV4 A;  2KXG A;  4STD A;  1FGQ A;  2KF6 A;  2P09 A;  1GYB A;  1WMO A;  2IY2 A;  3NXJ A;  4WYK B;  1IVU A;  1N9E A;  1O7G B;  3U1W A;  5HOH A;  5D83 A;  2Z7A A;  2R4I A;  3G16 A;  2R41 A;  2F99 A;  4BL3 A;  3A76 A;  1R4Y A;  3JUN A;  2QIY A;  5AYR B;  4IIA A;  3G0K A;  1W01 A;  4WYK A;  4EXR A;  5ELU A;  1UCI A;  1W2Z A;  3BIR A;  2W56 B;  1D6Z A;  2CIU A;  2HMM B;  3N9H A;  4N6V 0;  1I0V A;  1RGF A;  4X2H A;  8CHO A;  1IVV A;  2RBI A;  2XH9 A;  4XBX A;  2RGQ A;  3ECF A;  6GSP A;  5AIH A;  1TFK A;  2WGQ A;  3ZFZ A;  1RGL A;  1JB2 A;  3CXC 2;  1TFO A;  5GSP A;  2QA4 3;  1ISK A;  4IPB A;  2QGU A;  1D6Y A;  4FMB A;  5RNT A;  5IER A;  1EKM A;  4H3U A;  2YFL B;  1RLS A;  2D1W A;  1B21 A;  2CX0 A;  2HOH A;  2CFD A;  3T8N A;  4O02 B;  4EV2 A;  5IW9 A;  5KP3 A;  1AVK A;  3SXX A;  1T5Y A;  2SAR A;  2HMK B;  1RN7 A;  2P05 A;  4XM4 A;  4U13 A;  2IYJ A;  1RGG A;  4RZM A;  3UJM A;  3V99 A;  1UUV B;  2KF3 A;  3EBY A;  3KE7 A;  1I8V A;  5G1K A;  1T3B A;  3G6E 3;  2V1L A;  5EQL A;  3CD6 3;  1U5O A;  1EQK A;  1Q7H A;  2C11 A;  3VSY A;  3J7Y d;  3OXA A;  1OCV A;  1JNQ A;  2W0Q A;  3GZR A;  1RGH A;  2XEP A;  3KII A;  2HMN B;  4HM8 B;  1SPU A;  2KRT A;  1N5P A;  3FGY A;  3GWR A;  1UCJ A;  4HM3 B;  5CF1 A;  2BT3 A;  1OUN A;  1TIJ A;  4AEQ A;  1A67 A;  4I4K A;  4Q53 A;  1VQQ A;  1MWR A;  4WFO A;  3PS8 A;  2PZV A;  2GEY A;  1RRL A;  3WHO A;  5EEO A;  1O7N B;  1OHP A;  1A2V A;  2XSO B;  2D42 A;  1WQL B;  3T8U A;  2BHM A;  3CCL 3;  3LH4 A;  2W9Q A;  1NDO B;  3PYJ A;  1CEW I;  5JPP A;  2JQ5 A;  1CYU A;  1YVS A;  2Y73 A;  3CCR 3;  1Z1S A;  5I97 A;  4MMZ B;  3CME 3;  5CF2 A;  4BTW A;  3JUO A;  3AHS A;  2H0H A;  3F8H A;  4HM7 B;  1M90 4;  3B4O A;  1ASK A;  2CH9 A;  2CK3 H;  5EVH A;  1ROA A;  3X41 A;  1B2M A;  1M9G A;  4OVM A;  3I56 3;  1V58 A;  4ILF A;  1YJW 3;  1RGA A;  2OOV A;  3HK4 A;  2UX0 A;  3X3Z A;  4R4K A;  1T2I A;  2E2V A;  1OPY A;  3NHX A;  3PCR A;  4R1K A;  1BSC A;  3EBT A;  4AKY A;  1PU4 A;  1AV4 A;  2YFI B;  2GBW B;  4O3V A;  1FYS A;  1FUT A;  1IQY A;  1FUW A;  1MOL A;  3DZL A;  1HZ1 A;  3G71 3;  1Q86 4;  1M1X B;  3M8C A;  1W2B 2;  1IVW A;  3WDG B;  1BRI A;  1QAF A;  2CWT A;  2HML B;  3IMA B;  1JV2 B;  2OTJ 3;  4R9K A;  4WHA A;  3MWZ A;  1BNI A;  1AY7 A;  1UI8 A;  2CFL A;  3QK9 A;  2ZA4 A;  1PY3 A;  1N9J A;  3MYT A;  2BMQ B;  3AMO B;  4KT3 B;  3V98 A;  4JRF A;  3WOD G;  2A15 A;  2XFT A;  2C4B A;  2LQV A;  3DXO A;  4J5K A;  4OUQ A;  4BIR A;  1VQ8 3;  1B2Z A;  3MG1 A;  3DMC A;  4LSO A;  1TRP A;  1B20 A;  2L1S A;  2CWV A;  3QRD A;  3LML A;  4ZM8 A;  2GSP A;  3DH2 A;  1DYU A;  4GB5 A;  1JZD A;  1IK3 A;  3VF1 A;  3CPO A;  1NNV A;  1UGI A;  2L4V A;  6RNT A;  2XFS A;  1RGK A;  4N6T A;  3NM7 A;  1UW1 A;  5BIR A;  2Z76 A;  1JKG B;  1I3F A;  1TTO A;  2CX1 A;  3NX0 A;  2XGN A;  4FMD A;  3F7X A;  3CCV 3;  3X42 A;  4DKI A;  1CQS A;  2IUK A;  1NB3 I;  2B24 B;  2HMJ B;  1PFP A;  3KFQ C;  1BSA A;  5FW5 A;  3FCS B;  2F4Y A;  2Z6B A;  2B1X B;  1RGE A;  1LNH A;  3DGO A;  1BNJ A;  4XBT A;  2BMO B;  3FF2 A;  1KD1 4;  1E3R A;  1K9M 4;  3OW2 2;  3S67 A;  4L8P A;  1M1K 4;  1E97 A;  3CMA 3;  4O8S A;  3RDE A;  5IG0 A;  3X3Y A;  1HKX A;  1FW7 A;  1IQ8 A;  2XRX B;  3FG4 A;  4EW5 A;  1BSD A;  1O7W B;  1RN4 A;  2ZDJ A;  1K73 4;  5AIF A;  1BUJ A;  1RRH A;  2YFJ B;  1W5Z A;  1NB5 I;  5LC6 A;  1RNT A;  3TDG A;  1O7H B;  1L5G B;  5LC7 A;  4LGQ A;  4N3V A;  3CCJ 3;  4EC6 A;  2W56 A;  1BIR A;  4WWU C;  5G2G A;  1SQW A;  2J8X B;  3GZX B;  5JBS A;  1WTH A;  2K3D A;  2O3O A;  3FH1 A;  5KP4 A;  1N8R 4;  1K8A 4;  5FGO A;  3O8Y A;  1GMR A;  3LT9 A;  3F40 A;  1X1W A;  3CPW 2;  2BU4 A;  2CHC A;  1Y4K A;  3SLU A;  4LYL B;  4XDW A;  1QVG 2;  1PYL A;  3MG2 A;  3HII A;  4O2H A;  3WA2 X;  3KN4 A;  3Q90 A;  2WOH A;  2P0M A;  2GXF A;  1N8Q A;  5HGR A;  2BO9 B;  4K90 B;  1G96 A;  3K5T A;  2KF5 A;  2WOF A;  1GOU A;  3EC9 A;  3HOH A;  1LOV A;  3A5E A;  1WMN A;  1OF5 B;  4IT7 A;  4XB5 A;  1W00 A;  3NQZ A;  4HZB B;  3OX9 A;  1VQ6 3;  9RNT A;  3LXU X;  1X1U A;  3JVC A;  1FGM A;  1GY7 A;  3MG3 A;  4J5G A;  1ZS7 A;  2CFK A;  2OOV C;  1KSI A;  3S5C A;  1FGT A;  5DRV A;  1DVD A;  1I0X A;  1W6G A;  4KFE A;  3D5I A;  3T0U A;  1BRG A;  1OF5 A;  4GL6 A;  3MSO A;  1F8N A;  2BNG A;  3UL6 A;  5BU4 A;  3FF0 A;  3DY5 A;  1V74 A;  3EX9 A;  3S29 A;  1OH0 A;  3MPH A;  1I70 A;  1KC8 4;  2AAE A;  1YGE A;  1B2X A;  4LZI A;  3CCQ 3;  1ULI B;  3URP A;  2W6J H;  1DE3 A;  5IF6 A;  3F9S A;  4MMY B;  1BNE A;  1TU5 A;  1EEJ A;  1W02 A;  3KKG A;  3ZG5 A;  1BVI A;  1BNG A;  5IG4 A;  1GD3 A;  1N5H A;  1VQM 3;  1RN1 A;  1KWI A;  2F5M A;  2IA7 A;  2CKF B;  3SYU A;  2OWP A;  1GOV A;  1LVN A;  3RGA A;  4AKZ A;  1DMN A;  2W03 A;  2Y74 A;  4KFD A;  1VQK 3;  1FUS A;  1MGW A;  1VQO 3;  4CPK A;  1RCK A;  4HM5 B;  2CC3 A;  3SX1 A;  5D82 A;  1Q7Y 4;  3JUM A;  1BRN L;  3IPT A;  4XDV A;  3CU3 A;  4HBR A;  3BNB A;  3SOA A;  1C7H A;  2F98 A;  3F8X A;  3NBJ A;  1QJG A;  3V92 A;  3E99 A;  3EQQ B;  3CCE 3;  1IV9 A;  1RJO A;  2Z77 A;  3AHW A;  1STF I;  2P38 A;  5IEP A;  1GMQ A;  2MF7 A;  2STD A;  1AR0 A;  1IT8 A;  1TJD A;  4X2O A;  1OHS A;  2WO0 A;  3FLJ A;  1HU9 A;  1BAO A;  3HZP A;  1X1X A;  4N6U A;  1RHL A;  1JN5 B;  4RNZ A;  5M19 A;  1VQN 3;  1Q40 B;  2BMR B;  1SJW A;  1W6Y A;  2HMO B;  1JB5 A;  3NV0 B;  4FMA A;  1SII A;  2CFW A;  1BRS A;  1JB4 A;  1ZX2 A;  2CFG A;  3ALA A;  2M7O A;  3D9R A;  3Q3F A;  4I5Q A;  5TGN A;  6STD A;  2KCD A;  4HZ9 B;  3F14 A;  2CWU A;  4WP5 A;  1S5A A;  1ZGX A;  3EN8 A;  3MHE A;  2RNT A;  1FGR A;  1IU7 A;  4MEI A;  3ROB A;  2P0X A;  2IMJ A;  3ER7 A;  3HIG A;  3LTD A;  3PZW A;  4J8T A;  3CNX A;  1K41 A;  3WMD A;  3EF8 A;  1IQX A;  2O9U X;  3K7C A;  4KVH A;  3GZY B;  1U8C B;  3FG3 A;  2RSX A;  1TP6 A;  3ZG0 A;  3K63 A;  3FSD A;  1AQZ A;  4RBN A;  3EN1 B;  3DGL A;  4G1M B;  1GMP A;  5AEW B;  2OCT A;  1DMM A;  1R4C A;  1CYV A;  2OTL 3;  3FG1 A;  4NHF A;  1GS3 A;  2GBX B;  2INX A;  3MKI A;  3AMO A;  1G02 A;  1O7M B;  3IJE B;  1LRA A;  4LMI A;  1BNS A;  2XR8 B;  4K1V A;  7STD A;  3G4S 3;  3BU4 A;  1K28 A;  2I9W A;  3PCS A;  3D4A A;  3I0Y A;  4BU4 A;  1MNL A;  2LYX A;  1RTU A;  3EHC A;  1JBT A;  3CCS 3;  1QMA A;  8RNT A;  1BUQ A;  1IV7 A;  1FA3 A;  1I2F A;  1NJI 4;  2XF3 A;  4FCM A;  2KF4 A;  1GD4 A;  3FZW A;  4K61 A;  1QAL A;  5IG5 A;  1Q9E A;  1MGR A;  3NM2 A;  1W7C A;  3N8B A;  1FZU A;  3GAX A;  2MC8 A;  4JF8 A;  1OAC A;  1JKG A;  2FNQ A;  1T2H A;  5AI1 A;  1BNR A;  2CG1 A;  5BXQ A;  2ML5 A;  4KFF A;  2YX9 A;  4H61 A;  5IEO A;  1EA2 A;  3NQY A;  5KP1 A;  1GY5 A;  3F7S A;  2Q07 A;  4L8O A;  4J9A A;  5G1L A;  3RNT A;  3LOY A;  2QEX 3;  1VQ4 3;  1DMQ A;  1I2E A;  1A90 A;  1MWU A;  4OK0 A;  1BGS A;  3H51 A;  1VZZ A;  5IG3 A;  1BSB A;  1W6C A;  5BVB A;  3DGM A;  1A2K A;  2GEX A;  1OGX A;  3WOF B;  1JRQ A;  3D5G A;  3WR2 A;  3GRD A;  1J2B A;  1Q82 4;  2F56 A;  1NO3 A;  4HYZ A;  3BLZ A;  1TUH A;  3DUK A;  5AII A;  1E3V A;  1EUI C;  1UI7 A;  1SIH A;  7RNT A;  3B7C A;  4K1U A;  4PEJ A;  3Q1C A;  4R9L A;  3BB9 A;  3KCH A;  1QVF 2;  2RCD A;  2ML6 A;  3NBB A;  4EBG A;  4XBY A;  1DET A;  1LXE A;  3NBR A;  1STD A;  2E2U A;  2OQE C;  3BNE A;  3PXM A;  3HX8 A;  4BTY A;  3OWU A;  4RNT A;  1C54 A;  1G0T A;  1YGW A;  4BTX A;  3LTA A;  3S27 A;  1Q81 4;  4FMC A;  4FCJ A;  3KZT A;  7GSP A;  3H3H A;  4RNY A;  1IT7 A;  3X3X A;  3DGN A;  3I55 3;  1YI2 3;  1BRH A;  1VQP 3;  3GSP A;  3N54 B;  3UNL A;  1JBR A;  1RGC A;  3D3L A;  4HM6 B;  5M18 A;  1EG9 B;  3CC7 3;  4FCZ A;  3CC2 3;  1YNV X;  4TX4 A;  1MWS A;  3SVA A;  3G8Z A;  1BNF A;  3CCU 3;  1UCK A;  3OWY A;  5D81 A;  1LOX A;  1NU3 A;  4LEH A;  2W9P A;  4FR9 A;  1OGZ A;  4KZ1 A;  1CH0 A;  5CXO A;  3VGN A;  5JPU A;  1V57 A;  2H0G A;  5M1A A;  1X1Y A;  2SBL A;  3K9M C;  4L7K A;  1IDP A;  1RKY A;  2F5W A;  2UUG C;  1BRJ A;  3LYG A;  3EB8 A;  1B2U A;  1LOY A;  3DM8 A;  4NRE A;  1QAK A;  1NWW A;  1IYY A;  2W04 A;  1US1 A;  2ZL8 A;  1YJN 3;  2H0I A;  3AGO A;  1JZO A;  4MJD A;  4N6N B;  4HAA A;  1ROV A;  2XSH B;  3LZA A;  2OQE A;  1JBS A;  3GZB A;  1JJ2 2;  2JDI H;  3CCM 3;  1BSE A;  3FKA A;  1S72 3;  1RDS A;  5AIG A;  1BRK A;  1YJ9 3;  1GY6 A; 
#chains in the Genus database with same CATH homology
 5IEN A;  3KSE D;  1WNH A;  1ULJ B;  3JUP A;  2GU3 A;  2XGL A;  1IVX A;  2E2T A;  5AYS C;  1JN5 A;  3HI7 A;  1Q40 A;  4CCV A;  2F86 B;  1VQL 3;  3B8L A;  1OHO A;  4HM0 B;  2K54 A;  1YVB I;  3NV0 A;  3BND A;  2GU1 A;  4ORL A;  3SOY A;  3CNM A;  3OWS A;  2RFR A;  5DRE A;  3UB1 A;  2W2C A;  3RGR A;  2FGT A;  1KQS 2;  4HM4 B;  3B4P A;  1ZO2 A;  2FXT A;  5CLK A;  1YIT 3;  2K0M A;  4HM1 B;  5A0O B;  4N6L A;  2CG0 A;  3WA3 A;  4HVN A;  4EV5 A;  3LTB A;  5STD A;  5ELJ A;  3LTC A;  3EE1 A;  2IUJ A;  1Q42 A;  4CDL A;  5AEU B;  4QWT A;  3STD A;  4HJL B;  1VQ5 3;  3JUQ A;  3CC4 3;  3NUV A;  2PNC A;  2CW9 A;  4HKV B;  4R80 A;  3X40 A;  3PGB A;  2C10 A;  3UL5 A;  1UUW B;  1W4N A;  3S28 A;  4HM2 B;  3EJV A;  1YIJ 3;  1WMP A;  1VQ9 3;  1VQ7 3;  3SED A;  1FGO A;  5CK6 A;  2WGO A;  3Q2P A;  4MMX B;  1YHQ 3;  1O7P B;  3LT8 A;  3KSP A;  3L0R A;  4N6M A;  1D6U A;  4EYC A;  4N6O B;  3U97 A;  1AVL A;  3BNC A;  1DVC A;  3WOE B;  3K0Z A;  3OV4 A;  2KXG A;  4STD A;  1FGQ A;  2P09 A;  1GYB A;  1WMO A;  3NXJ A;  4WYK B;  1IVU A;  1N9E A;  1O7G B;  3U1W A;  5D83 A;  2Z7A A;  2R4I A;  3G16 A;  2F99 A;  3A76 A;  3JUN A;  2QIY A;  5AYR B;  4IIA A;  3G0K A;  1W01 A;  4WYK A;  4EXR A;  1W2Z A;  2W56 B;  1D6Z A;  2CIU A;  2HMM B;  3N9H A;  4N6V 0;  4X2H A;  8CHO A;  1IVV A;  2XH9 A;  4XBX A;  2RGQ A;  3ECF A;  5AIH A;  1TFK A;  2WGQ A;  2QA4 3;  1JB2 A;  3CXC 2;  1TFO A;  1ISK A;  4IPB A;  2QGU A;  1D6Y A;  4FMB A;  5IER A;  1EKM A;  4H3U A;  2YFL B;  2D1W A;  2CFD A;  3T8N A;  4O02 B;  4EV2 A;  5IW9 A;  5KP3 A;  1AVK A;  3SXX A;  1T5Y A;  2HMK B;  1RN7 A;  2P05 A;  4XM4 A;  4U13 A;  4RZM A;  3UJM A;  3V99 A;  1UUV B;  3EBY A;  3KE7 A;  3G6E 3;  2V1L A;  5EQL A;  3CD6 3;  1U5O A;  1EQK A;  2C11 A;  3VSY A;  3J7Y d;  3OXA A;  1OCV A;  1JNQ A;  2W0Q A;  3GZR A;  2XEP A;  3KII A;  2HMN B;  4HM8 B;  1SPU A;  2KRT A;  1N5P A;  3FGY A;  3GWR A;  4HM3 B;  5CF1 A;  2BT3 A;  1OUN A;  1TIJ A;  4AEQ A;  1A67 A;  4I4K A;  4Q53 A;  4WFO A;  3PS8 A;  2PZV A;  2GEY A;  1RRL A;  5EEO A;  1O7N B;  1OHP A;  1A2V A;  2XSO B;  2D42 A;  1WQL B;  3T8U A;  2BHM A;  3CCL 3;  3LH4 A;  2W9Q A;  1NDO B;  3PYJ A;  1CEW I;  5JPP A;  2JQ5 A;  1CYU A;  2Y73 A;  3CCR 3;  1Z1S A;  5I97 A;  4MMZ B;  3CME 3;  5CF2 A;  4BTW A;  3JUO A;  3F8H A;  4HM7 B;  1M90 4;  3B4O A;  1ASK A;  2CH9 A;  2CK3 H;  5EVH A;  1ROA A;  3X41 A;  1M9G A;  4OVM A;  3I56 3;  1YJW 3;  2OOV A;  3X3Z A;  3HK4 A;  2UX0 A;  4R4K A;  2E2V A;  1OPY A;  3NHX A;  3PCR A;  4R1K A;  3EBT A;  4AKY A;  1PU4 A;  1AV4 A;  2YFI B;  2GBW B;  4O3V A;  1IQY A;  1FUW A;  1MOL A;  3DZL A;  3G71 3;  1Q86 4;  1M1X B;  3M8C A;  1W2B 2;  1IVW A;  3WDG B;  1QAF A;  2CWT A;  2HML B;  3IMA B;  1JV2 B;  2OTJ 3;  4R9K A;  4WHA A;  3MWZ A;  1UI8 A;  2CFL A;  3QK9 A;  1N9J A;  3MYT A;  2BMQ B;  3AMO B;  3V98 A;  4JRF A;  3WOD G;  2A15 A;  2XFT A;  2LQV A;  3DXO A;  4OUQ A;  1VQ8 3;  3MG1 A;  3DMC A;  4LSO A;  3QRD A;  2CWV A;  3LML A;  4ZM8 A;  1DYU A;  4GB5 A;  1IK3 A;  3VF1 A;  3CPO A;  2L4V A;  2XFS A;  4N6T A;  3NM7 A;  1UW1 A;  2Z76 A;  1JKG B;  3NX0 A;  2XGN A;  4FMD A;  3F7X A;  3CCV 3;  3X42 A;  1CQS A;  2IUK A;  1NB3 I;  2B24 B;  2HMJ B;  1PFP A;  3KFQ C;  5FW5 A;  3FCS B;  2Z6B A;  2B1X B;  4XBT A;  1LNH A;  3DGO A;  1KD1 4;  2BMO B;  3FF2 A;  1K9M 4;  1E3R A;  3OW2 2;  3S67 A;  4L8P A;  1M1K 4;  1E97 A;  3CMA 3;  4O8S A;  3RDE A;  5IG0 A;  3X3Y A;  1HKX A;  1IQ8 A;  2XRX B;  3FG4 A;  2ZDJ A;  1O7W B;  1K73 4;  5AIF A;  1RRH A;  2YFJ B;  1W5Z A;  1NB5 I;  5LC6 A;  3TDG A;  1O7H B;  1L5G B;  5LC7 A;  4LGQ A;  4N3V A;  3CCJ 3;  4EC6 A;  2W56 A;  4WWU C;  5G2G A;  1SQW A;  3GZX B;  5JBS A;  1WTH A;  2O3O A;  3FH1 A;  5KP4 A;  1N8R 4;  1K8A 4;  5FGO A;  3O8Y A;  3LT9 A;  3F40 A;  3CPW 2;  2CHC A;  1Y4K A;  3SLU A;  4XDW A;  1QVG 2;  3MG2 A;  3HII A;  4O2H A;  3WA2 X;  3KN4 A;  3Q90 A;  2WOH A;  2P0M A;  2GXF A;  1N8Q A;  5HGR A;  2BO9 B;  4K90 B;  1G96 A;  3K5T A;  2WOF A;  3EC9 A;  1WMN A;  1OF5 B;  4IT7 A;  4XB5 A;  1W00 A;  3NQZ A;  4HZB B;  3OX9 A;  1VQ6 3;  3LXU X;  3JVC A;  1FGM A;  1GY7 A;  3MG3 A;  2CFK A;  2OOV C;  1KSI A;  3S5C A;  1FGT A;  5DRV A;  1DVD A;  1W6G A;  4KFE A;  3T0U A;  1OF5 A;  4GL6 A;  3MSO A;  1F8N A;  2BNG A;  3UL6 A;  3FF0 A;  3DY5 A;  1V74 A;  3EX9 A;  3S29 A;  1OH0 A;  3MPH A;  1KC8 4;  1YGE A;  4LZI A;  3CCQ 3;  1ULI B;  2W6J H;  5IF6 A;  3F9S A;  4MMY B;  1TU5 A;  1W02 A;  3KKG A;  5IG4 A;  1N5H A;  1GD3 A;  1VQM 3;  1KWI A;  2IA7 A;  2CKF B;  2OWP A;  1LVN A;  3RGA A;  4AKZ A;  1DMN A;  2W03 A;  2Y74 A;  4KFD A;  1VQK 3;  1VQO 3;  4HM5 B;  3SX1 A;  2CC3 A;  5D82 A;  1Q7Y 4;  3JUM A;  3IPT A;  4XDV A;  3CU3 A;  4HBR A;  3BNB A;  3SOA A;  1C7H A;  2F98 A;  3F8X A;  3NBJ A;  1QJG A;  3V92 A;  3E99 A;  3EQQ B;  3CCE 3;  1IV9 A;  1RJO A;  2Z77 A;  1STF I;  2P38 A;  5IEP A;  2MF7 A;  2STD A;  1AR0 A;  1IT8 A;  4X2O A;  1OHS A;  2WO0 A;  3FLJ A;  1HU9 A;  4N6U A;  3HZP A;  4RNZ A;  1JN5 B;  1VQN 3;  1Q40 B;  2BMR B;  1SJW A;  2HMO B;  1W6Y A;  1JB5 A;  3NV0 B;  4FMA A;  1SII A;  2CFW A;  1JB4 A;  5ELU A;  1ZX2 A;  2CFG A;  3ALA A;  2M7O A;  3D9R A;  5TGN A;  6STD A;  2KCD A;  4HZ9 B;  3F14 A;  2CWU A;  4WP5 A;  1S5A A;  3EN8 A;  3MHE A;  1FGR A;  1IU7 A;  4MEI A;  3ROB A;  2P0X A;  2IMJ A;  3ER7 A;  3HIG A;  3LTD A;  3PZW A;  4J8T A;  3CNX A;  1K41 A;  3WMD A;  3EF8 A;  1IQX A;  2O9U X;  3K7C A;  4KVH A;  3GZY B;  1U8C B;  3FG3 A;  2RSX A;  1TP6 A;  3K63 A;  3FSD A;  4RBN A;  3EN1 B;  3DGL A;  4G1M B;  5AEW B;  2OCT A;  1DMM A;  1R4C A;  1CYV A;  2OTL 3;  3FG1 A;  4NHF A;  1GS3 A;  2GBX B;  2INX A;  3MKI A;  3AMO A;  1O7M B;  3IJE B;  4LMI A;  2XR8 B;  4K1V A;  7STD A;  3G4S 3;  1K28 A;  2I9W A;  3PCS A;  3I0Y A;  1MNL A;  2LYX A;  3EHC A;  3CCS 3;  1QMA A;  1BUQ A;  1IV7 A;  1FA3 A;  1NJI 4;  2XF3 A;  4FCM A;  1GD4 A;  3FZW A;  4K61 A;  1QAL A;  5IG5 A;  3NM2 A;  1W7C A;  3N8B A;  3GAX A;  2MC8 A;  4JF8 A;  1OAC A;  1JKG A;  2FNQ A;  5AI1 A;  2CG1 A;  5BXQ A;  2ML5 A;  4KFF A;  2YX9 A;  4H61 A;  5IEO A;  1EA2 A;  3NQY A;  5KP1 A;  1GY5 A;  3F7S A;  2Q07 A;  4L8O A;  4J9A A;  2QEX 3;  3LOY A;  1VQ4 3;  1DMQ A;  1A90 A;  4OK0 A;  3H51 A;  1VZZ A;  5IG3 A;  1W6C A;  5BVB A;  3DGM A;  1A2K A;  2GEX A;  1OGX A;  3WOF B;  1JRQ A;  3GRD A;  1J2B A;  1Q82 4;  4HYZ A;  1NO3 A;  3BLZ A;  1TUH A;  3DUK A;  5AII A;  1E3V A;  1UI7 A;  1SIH A;  3B7C A;  4K1U A;  4PEJ A;  3Q1C A;  4R9L A;  3BB9 A;  1QVF 2;  2RCD A;  2ML6 A;  3NBB A;  4EBG A;  4XBY A;  1LXE A;  3NBR A;  1STD A;  2E2U A;  2OQE C;  3BNE A;  3PXM A;  3HX8 A;  4BTY A;  3OWU A;  4BTX A;  3LTA A;  3S27 A;  1Q81 4;  4FMC A;  4FCJ A;  3KZT A;  3H3H A;  4RNY A;  1IT7 A;  3X3X A;  3DGN A;  3I55 3;  1YI2 3;  1VQP 3;  3N54 B;  3UNL A;  3D3L A;  4HM6 B;  1EG9 B;  3CC7 3;  4FCZ A;  3CC2 3;  4TX4 A;  3SVA A;  3G8Z A;  3CCU 3;  3OWY A;  5D81 A;  1LOX A;  1NU3 A;  4LEH A;  2W9P A;  4FR9 A;  1OGZ A;  4KZ1 A;  5CXO A;  3VGN A;  5JPU A;  4L7K A;  2SBL A;  3K9M C;  1IDP A;  1RKY A;  3LYG A;  3EB8 A;  3DM8 A;  4NRE A;  1QAK A;  1NWW A;  2W04 A;  1US1 A;  2ZL8 A;  1YJN 3;  4N6N B;  4MJD A;  1ROV A;  2XSH B;  3LZA A;  2OQE A;  3GZB A;  1JJ2 2;  2JDI H;  3CCM 3;  3FKA A;  1S72 3;  5AIG A;  1YJ9 3;  1GY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...