4N6V0

Partial rotational order disorder structure of human stefin b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
91
Chain Sequence
ATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cystatin-B
publication title Partial rotational lattice order-disorder in stefin B crystals
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor
total genus 22
structure length 91
sequence length 91
chains with identical sequence 1, 2, 3, 4, 5, 6, 7, 8, 9
ec nomenclature
pdb deposition date 2013-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4n6v000
1STFI 1FUWA 3LH4A 3PYJA 1DVCA 4N6V0 1G96A 3IMAB 1ROAA 2O9UX 1EQKA 1IV7A 3KFQC 2W9PA 3UL5A 4N6UA 2W9QA 4N6LA 1TIJA 1MNLA 5LC7A 1A90A 5A0OB 1NB3I 1A67A 3GAXA 5ELUA 3L0RA 1N5PA 4N6MA 3SVAA 2OCTA 2KXGA 4EYCA 3S67A 1NB5I 5ELJA 1KWIA 1IV9A 3UL6A 1LXEA 1CYUA 5EQLA 4IT7A 4N6OB 4TX4A 4N6NB 4N6TA 1PFPA 1N5HA 1R4CA 1GD4A 1N9JA 5LC6A 3PXMA 3QRDA 4CCVA 3K9MC 3KSED 4ZM8A 1CEWI 1CYVA 3Q2PA 1WNHA 1GD3A 1RN7A 1FA3A 1YVBI 1MOLA 3NX0A 2CH9A 2BO9B 3PS8A 1DVDA 3MWZA 1M9GA 4LZIA
chains in the Genus database with same CATH superfamily
1STFI 2OQEC 2CX0A 1OF5A 1K9M4 3MG2A 1U5OA 2OOVC 1MGRA 6RNTA 1UCKA 1VQK3 2Y74A 2GEYA 3PYJA 2ZHXB 4HM8B 3DM8A 3B8LA 1IVWA 3IMAB 3NQZA 4FCMA 2HOHA 5IG0A 2O9UX 5AEWB 3F9SA 3BNDA 1N8QA 5M18A 1IQXA 1SIIA 5D82A 1RLSA 1BSDA 4MMXB 2W9PA 3EB8A 3VF1A 2MC8A 1UUGB 2BHMA 3MPHA 4O2HA 2KCDA 1BRJA 2HMJB 3NUVA 1PU4A 3LT8A 2RBIA 1RN1A 2F4YA 4N6LA 4WWUC 3EE1A 4H61A 1NNVA 3Q90A 1W2B2 1A90A 3OXAA 2RNTA 1JBTA 1TUHA 4HM4B 2CKFB 2H0GA 5IENA 3CPW2 5DREA 1DMQA 3BIRA 3BLZA 3L0RA 3LZAA 3N8BA 1UW1A 2CFDA 3NV0A 1RCKA 3G8ZA 3X42A 4R9KA 3OWSA 2QA43 1O7MB 5KP1A 4WP5A 3V92A 1A2KA 4LMIA 1E3RA 1AQZA 1UI7A 1I2FA 2ZL8A 2IYJA 2KXGA 3AGNA 3G0KA 3U97A 1RRHA 1LQMB 1GMQA 3RDEA 1V74A 5ELJA 1OUNA 3BNBA 1FGMA 2B24B 4L7KA 2BMRB 2V1LA 1LXEA 1WMNA 3WA2X 4BL3A 2P09A 3JUOA 3M8CA 1C54A 1TRQA 2HMKB 3QK9A 1OHOA 5D83A 1KQS2 1UDII 2CIUA 3HK4A 3AMOB 1VQO3 3CD63 2C11A 4TX4A 1B20A 1UGHI 3S5CA 1KD14 4K90B 1ISKA 3SXXA 1I3FA 1BSCA 2O3OA 1SIHA 3IPTA 2A15A 3GZXB 1OHSA 3BB9A 4XB5A 1VQN3 1K41A 7RNTA 1IK3A 3CCE3 2GU1A 1BIRA 5CF2A 1RMSA 2CX1A 2RCDA 2XSOB 1R4CA 1GD4A 1Q40B 3X41A 1QJGA 1TP6A 5IF6A 1RGEA 3SOYA 1B2XA 3HZPA 1HKXA 1OACA 3PXMA 4CCVA 1ROVA 1DMNA 1M1K4 4FCZA 3EHCA 2R41A 2E2TA 1UUVB 3CCV3 1JRQA 1I70A 3PGBA 5CF1A 1ZO2A 1MWUA 1ZX2A 1FGOA 1G0TA 1GSPA 3DMCA 3G4S3 2W03A 2F5WA 3FGYA 5IEPA 1SPUA 3HIIA 1M904 4FCJA 3N54B 2E2VA 3EBTA 2CG1A 3CCM3 4NHFA 1MOLA 1W4NA 5IEOA 3K7CA 3RGAA 2IMJA 1B2SA 1ULIB 2CWVA 1M9GA 2K54A 6STDA 2LYXA 1NU3A 2UGIA 1RGKA 3AHSA 3LOYA 3F40A 3UJMA 1K28A 2OWPA 1FGTA 5IW9A 1B27A 2YX9A 4HM2B 1SARA 1UUWB 3HX8A 1Q814 4EV2A 3AMOA 4BIRA 1ASKA 4N6V0 3MG3A 3UB1A 4OK0A 3WOEB 3I553 3LT9A 1ROAA 2OQEA 3A5EA 1EQKA 1DYUA 1IV7A 1RGLA 4AKZA 1UCJA 3ZG0A 1DMMA 4WYKA 1CH0A 1OGXA 3SLUA 4HKVB 3OWUA 1RKYA 1K734 4X2HA 1BNSA 1BU4A 5M19A 1RNBA 4FMAA 1JZDA 1RDSA 2CG0A 4XBXA 4XDVA 2W9QA 1Q9EA 1Q824 1NWWA 3D3LA 2R4IA 1LRAA 5A0OB 4BU4A 3PZWA 1LVNA 3CU3A 1W6CA 5JPPA 1GOUA 3MYTA 3OX9A 2IUJA 1BSBA 1OCVA 4N3VA 2KRTA 4HM5B 1AVLA 5D81A 5BXQA 3WHOA 4KT3B 2I9WA 3SVAA 1BSAA 3U1WA 4X2OA 2OCTA 1B2UA 4EXRA 1QVF2 1DE3A 2RSXA 3DGYA 3NBJA 3K5TA 3LTDA 3X3XA 1YJ93 1RCLA 2BIRA 4EYCA 5IG3A 3DGOA 3S67A 3LMLA 1OPYA 1RGCA 2F98A 1NB5I 2K0MA 3X3ZA 1U8CB 2JDIH 4HM6B 4EW5A 3CCJ3 3WMDA 1GMRA 1CYUA 1V57A 2Y73A 1N9EA 1W7CA 1T5YA 2W56A 1VQ73 1K8A4 2XRXB 1N8R4 1B2MA 4ORLA 3EC9A 1BUQA 2BT3A 1BRKA 2XH9A 2W2CA 3G6E3 1RGHA 3AHWA 3WODG 1YI23 1BGSA 1IT8A 1E3VA 1VQ43 4HZ9B 1NJI4 2YFJB 3EF8A 2YFIB 2KF6A 4QWTA 3DGLA 4J5KA 1PFPA 1BUJA 1TTOA 2ML5A 2HMMB 4ILFA 3DXOA 3SEDA 4I4KA 1J2BA 4EV5A 5BU4A 1BNFA 4HYZA 4IIAA 4GSPA 3GSPA 2FXTA 4HM0B 4HAAA 1IVVA 1ULJB 3CNXA 3N9HA 1JKGA 1M1XB 2ZDJA 4MJDA 4Q53A 4HM7B 4R80A 3FSDA 2ZA4A 4J8TA 1AVKA 2AADA 1WMOA 2CC3A 1WMPA 5M1AA 2QEX3 4K1VA 1JZOA 3DGNA 3STDA 5AIFA 1A2VA 3I563 1FGRA 1TFOA 3KIIA 4FMDA 1O7WB 4ZM8A 2HMNB 1CEWI 1LOVA 3Q2PA 3D4AA 3LTCA 1RN7A 3WOFB 3BU4A 1W5ZA 5EEOA 1FA3A 7STDA 1EEJA 1VQQA 2XGNA 3RNTA 2BO9B 1DVDA 1VQL3 2WO0A 3B7CA 2C4BA 3V99A 1JN5B 4LZIA 5G2GA 3PCSA 1L5GB 3MHEA 1G02A 3SYUA 5AIIA 5EVHA 1BRIA 1GS3A 1YGEA 2F56A 2XSHB 3BNEA 1RRLA 4XBTA 3CCU3 4XM4A 1IU7A 4I5QA 8RNTA 1R4YA 1T2HA 2GU3A 2CW9A 1RGGA 3AGOA 5AIGA 1DVCA 2OTJ3 1W01A 5IG5A 1QVG2 1RNTA 3MSOA 4HVNA 5AYSC 3KFQC 1BANA 2GSPA 1UGIA 1GY6A 3JUQA 2INXA 4R1KA 4RNZA 3X3YA 1CQSA 4RNYA 3UL5A 4N6UA 3NXJA 2OTL3 1JB5A 5STDA 3E99A 2CWTA 1LNIA 3OV4A 1BNEA 4XDWA 1FUSA 2IY2A 2WGOA 5CXOA 2GXFA 3D5GA 4HJLB 3JUNA 1TIJA 1MNLA 1OF5B 2BNGA 3D79A 5GSPA 1LOYA 3FF0A 1D6ZA 1RJOA 4HOHA 4KFFA 5LC7A 1IVUA 2BMOB 3GZBA 1YIT3 3Q3FA 1NB3I 1A67A 3HOHA 1Z1SA 3GAXA 5ELUA 2FNQA 4RNTA 2XGLA 3NM7A 4GB5A 2K3DA 1N5PA 3ZFZA 1IQYA 2D1WA 2FGTA 5AI1A 3CC23 4N6MA 3F7XA 1DETA 2YFLB 3DZLA 1KSIA 2W6JH 1UCLA 3NBBA 4FR9A 3URPA 1FUTA 1BNGA 2IA7A 1D6UA 3VGNA 2BMQB 4BTWA 3GWRA 1MWRA 3DGMA 3GRDA 4FMBA 2XR8B 3H3HA 3KSPA 5IERA 1EA2A 2SBLA 2C10A 3NBRA 2Z6BA 4K61A 1HU9A 4RZMA 1KWIA 3ALAA 4XBYA 1AR0A 4OUQA 1BOXA 4O8SA 5KP4A 1JBSA 3UL6A 3EX9A 1Q40A 2XFTA 7GSPA 2L1SA 1TJDA 5EQLA 1I0VA 1LOXA 2F5MA 4IT7A 1RTUA 4H3UA 4N6OB 5JBSA 1OH0A 1US1A 1W6GA 2IUKA 1UI8A 3NV0B 4BTYA 1BRHA 1FZUA 1VQ83 1MWSA 3FKAA 1GOVA 4N6TA 4JF8A 3CCR3 4MEIA 1OGZA 4O02B 3KZTA 4KZ1A 1NDOB 3NQYA 3VSYA 1VQ93 1E97A 1O7NB 1JJ22 4R9LA 1T2IA 1VZZA 1YNVX 4K1UA 3DY5A 1JNQA 3HI7A 4L8PA 3X40A 5CLKA 1ZGXA 5LC6A 3RGRA 4MMZB 4U13A 3CCQ3 3GZRA 3JUMA 3QRDA 1YGWA 3CCS3 2UUGC 1LNHA 3CPOA 3T8NA 1X1UA 1BNJA 3JVCA 2Q07A 4HM1B 4CJNA 3K9MC 3EN1B 2KAAA 3WR2A 2P38A 2Z7AA 1QALA 5CK6A 4G1MB 3CME3 2XFSA 3CC43 2CFKA 1CYVA 1IT7A 2H0HA 1WNHA 2J8XB 4RBNA 1W02A 3ZG5A 1RHLA 1YVSA 1LOWA 1IVXA 1NO3A 3B4PA 3EN8A 3S29A 3LTAA 1YVBI 3NM2A 3G713 4KFEA 1BRNL 1LQGC 1I2EA 3SX1A 1BNRA 3S27A 2KF3A 3PS8A 1IYYA 3F14A 4O3VA 3O8YA 4FMCA 1B2ZA 5BVBA 2E2UA 3T0UA 2P0MA 1BRGA 2RFRA 1W2ZA 3FG3A 1B3SA 3KCHA 4WHAA 1JB4A 3EBYA 5HGRA 1FUWA 5BIRA 1QAKA 3DH2A 1AV4A 1Q7Y4 3FG4A 1GYBA 1F8NA 1JBRA 2WOFA 3LH4A 1UCIA 1T3BA 2ML6A 1VQ53 3WA3A 3J7Yd 3F8HA 1G96A 1VQP3 5FW5A 3TDGA 1RGAA 3UNLA 8CHOA 3GZYB 2KF5A 4NPBA 1X1YA 3FLJA 2XF3A 1FYSA 1Q7HA 3SOAA 1ZS7A 5AEUB 3LTBA 1TU5A 1W00A 1YJW3 5AIHA 2CFGA 3FCSB 3KE7A 5IG4A 1VQM3 1O7PB 1X1XA 2CFLA 3ROBA 5JPUA 5RNTA 3F7SA 3G16A 3CMA3 1BRSA 1RSNA 2CFWA 4AKYA 1STDA 2W0QA 3ECFA 2CK3H 4KVHA 3OW22 3EJVA 4OVMA 2F86B 5HOHA 1A2PA 2CHCA 1YJN3 1BAOA 1WTHA 2PZVA 1SJWA 1X1WA 5G1KA 2QIYA 2UX0A 1FGQA 3MG1A 1MWTA 2MF7A 4WYKB 3PCRA 3LYGA 1RGFA 3K0ZA 3K63A 2LQVA 1RN4A 2WOHA 2F99A 1GMPA 3DUKA 2XEPA 4LEHA 5FGOA 5G1LA 1WQLB 2STDA 3FZWA 3CNMA 2Z76A 4IPBA 1I8VA 4DKIA 3WDGB 1I3IA 1IDPA 2GBXB 1IV9A 3KKGA 4HZBB 5I97A 2B1XB 3D9RA 9RNTA 1QMAA 1BNIA 4WFOA 4CDLA 4GL6A 1Y4KA 3CXC2 4KFDA 3CCL3 4L8OA 4PEJA 2WGQA 2D42A 4HBRA 1AY7A 2PNCA 1O7GB 2W04A 3NHXA 3V98A 4N6NB 3FF2A 1S723 1JV2B 4NREA 4GHOA 4R4KA 2HMOB 2P0XA 2KF4A 1JB2A 1TFKA 3LXUX 1PY3A 3T8UA 4EC6A 1YIJ3 1MGWA 5AYRB 4CPKA 1SQWA 3JUPA 1EUIC 1Q42A 3EQQB 2L4VA 3F8XA 3MKIA 1HYFA 3S28A 1QAFA 1N5HA 2M7OA 1GY7A 3B4OA 1BVIA 2JQ5A 1N9JA 5KP3A 1BSEA 2W56B 1VQ63 1IQ8A 1JN5A 1GOYA 3ER7A 3I0YA 1HZ1A 4BL2A 2RGQA 2SARA 1Q864 3FG1A 6GSPA 5DRVA 1EKMA 3FH1A 5TGNA 3H51A 4STDA 2GEXA 1V58A 3KSED 3CC73 2CWUA 1TRPA 1YHQ3 3D5IA 4LGQA 1W6YA 4HM3B 2BU4A 4J9AA 3IJEB 1C7HA 2QGUA 1GD3A 1B21A 1OHPA 2OOVA 4LYLB 4LSOA 4EBGA 2HMLB 3Q1CA 4J5GA 4BTXA 1KC84 4JRFA 2Z77A 2GBWB 1GY5A 1FW7A 3NX0A 3A76A 2P05A 1EG9B 2CH9A 1O7HB 1D6YA 3HIGA 3MWZA 3OWYA 1PYLA 3KN4A 1I0XA 1JKGB 1S5AA 2AAEA 2H0IA 4MMYB 1I2GA 3BNCA 4AEQA
chains in the Genus database with same CATH topology
1STFI 2OQEC 1OF5A 3MG2A 1U5OA 2OOVC 1VQK3 2Y74A 2GEYA 3PYJA 4HM8B 3DM8A 3B8LA 1IVWA 3IMAB 3NQZA 4FCMA 5IG0A 5AEWB 2O9UX 3F9SA 3BNDA 1N8QA 1IQXA 1SIIA 5D82A 4MMXB 2W9PA 3EB8A 3VF1A 2MC8A 2BHMA 3MPHA 4O2HA 2KCDA 2HMJB 3NUVA 1PU4A 3LT8A 4N6LA 4WWUC 3EE1A 4H61A 3Q90A 1W2B2 1A90A 3OXAA 1TUHA 4HM4B 2CKFB 5IENA 3CPW2 5DREA 1DMQA 3BLZA 3L0RA 3LZAA 3N8BA 1UW1A 2CFDA 3NV0A 3G8ZA 3X42A 4R9KA 3OWSA 2QA43 1O7MB 5KP1A 4WP5A 3V92A 1A2KA 4LMIA 1E3RA 1UI7A 2ZL8A 2KXGA 3G0KA 3U97A 1RRHA 3RDEA 1V74A 5ELJA 1OUNA 3BNBA 1FGMA 2B24B 4L7KA 2BMRB 2V1LA 1LXEA 1WMNA 3WA2X 2P09A 3JUOA 3M8CA 2HMKB 3QK9A 1OHOA 5D83A 1KQS2 2CIUA 3HK4A 3AMOB 1VQO3 3CD63 2C11A 4TX4A 3S5CA 1KD14 4K90B 1ISKA 3SXXA 3IPTA 2O3OA 1SIHA 2A15A 3GZXB 1OHSA 3BB9A 4XB5A 1VQN3 1K41A 1IK3A 3CCE3 2GU1A 5CF2A 2RCDA 2XSOB 1R4CA 1GD4A 1Q40B 3X41A 1QJGA 1TP6A 5IF6A 3SOYA 3HZPA 1HKXA 1OACA 3PXMA 4CCVA 1ROVA 1DMNA 1M1K4 4FCZA 3EHCA 2E2TA 1UUVB 3CCV3 1JRQA 3PGBA 5CF1A 1ZO2A 1ZX2A 1FGOA 3DMCA 3G4S3 2W03A 3FGYA 5IEPA 1SPUA 3HIIA 1M904 4FCJA 3N54B 2E2VA 3EBTA 2CG1A 3CCM3 4NHFA 1MOLA 1W4NA 5IEOA 3K7CA 3RGAA 2IMJA 1ULIB 2CWVA 1M9GA 2K54A 6STDA 2LYXA 1NU3A 3LOYA 3F40A 3UJMA 1K28A 2OWPA 1FGTA 5IW9A 2YX9A 4HM2B 1UUWB 3HX8A 1Q814 4EV2A 3AMOA 1ASKA 4N6V0 3MG3A 3UB1A 4OK0A 3WOEB 3I553 3LT9A 1ROAA 2OQEA 1EQKA 1DYUA 1IV7A 4AKZA 1DMMA 4WYKA 1OGXA 3SLUA 4HKVB 3OWUA 1RKYA 1K734 4X2HA 4FMAA 2CG0A 4XDVA 4XBXA 2W9QA 1Q824 1NWWA 3D3LA 2R4IA 5A0OB 3PZWA 1LVNA 3CU3A 1W6CA 5JPPA 3MYTA 3OX9A 2IUJA 1OCVA 4N3VA 2KRTA 4HM5B 1AVLA 5D81A 5BXQA 2I9WA 3SVAA 3U1WA 4X2OA 2OCTA 4EXRA 1QVF2 2RSXA 3NBJA 3K5TA 3LTDA 3X3XA 1YJ93 4EYCA 5IG3A 3DGOA 3S67A 3LMLA 1OPYA 2F98A 1NB5I 2K0MA 3X3ZA 1U8CB 2JDIH 4HM6B 3CCJ3 3WMDA 1CYUA 2Y73A 1N9EA 1W7CA 1T5YA 2W56A 1VQ73 1K8A4 2XRXB 1N8R4 4ORLA 3EC9A 1BUQA 2BT3A 2XH9A 2W2CA 3G6E3 1YI23 3WODG 1IT8A 1E3VA 1VQ43 4HZ9B 1NJI4 2YFJB 3EF8A 2YFIB 4QWTA 3DGLA 1PFPA 2ML5A 2HMMB 1J2BA 3DXOA 3SEDA 4I4KA 4EV5A 4HYZA 4IIAA 2FXTA 4HM0B 1IVVA 1ULJB 3CNXA 3N9HA 1JKGA 1M1XB 2ZDJA 4MJDA 4Q53A 4HM7B 4R80A 3FSDA 4J8TA 1AVKA 1WMOA 2CC3A 1WMPA 2QEX3 4K1VA 3DGNA 3STDA 5AIFA 1A2VA 3I563 1FGRA 1TFOA 3KIIA 4FMDA 1O7WB 4ZM8A 2HMNB 1CEWI 3Q2PA 3LTCA 1RN7A 3WOFB 1W5ZA 5EEOA 1FA3A 7STDA 2XGNA 2BO9B 1DVDA 1VQL3 2WO0A 3B7CA 3V99A 1JN5B 4LZIA 5G2GA 3PCSA 1L5GB 3MHEA 5AIIA 5EVHA 1YGEA 1GS3A 2XSHB 3BNEA 1RRLA 4XBTA 3CCU3 4XM4A 1IU7A 2GU3A 2CW9A 5AIGA 1DVCA 2OTJ3 1W01A 5IG5A 1QVG2 3MSOA 4HVNA 5AYSC 3KFQC 3JUQA 1GY6A 4RNZA 2INXA 4R1KA 3X3YA 2OTL3 1CQSA 4RNYA 3UL5A 4N6UA 3NXJA 1JB5A 5STDA 3E99A 2CWTA 5CXOA 3OV4A 4XDWA 2WGOA 2GXFA 4HJLB 3JUNA 1TIJA 1MNLA 1OF5B 2BNGA 3CC73 4KFFA 3FF0A 1D6ZA 1RJOA 5LC7A 1YIT3 1K9M4 1IVUA 2BMOB 3GZBA 1NB3I 1A67A 1Z1SA 3GAXA 5ELUA 2FNQA 2XGLA 3NM7A 4GB5A 1N5PA 1IQYA 2D1WA 2FGTA 5AI1A 3CC23 4N6MA 3F7XA 2YFLB 3DZLA 1KSIA 2W6JH 3NBBA 4FR9A 2IA7A 1D6UA 3VGNA 2BMQB 4BTWA 3GWRA 3GRDA 3DGMA 4FMBA 2XR8B 3H3HA 3KSPA 5IERA 1EA2A 2SBLA 2C10A 3NBRA 2Z6BA 4K61A 1HU9A 4RZMA 1KWIA 3ALAA 4XBYA 1AR0A 4OUQA 4O8SA 5KP4A 3UL6A 3EX9A 1Q40A 2XFTA 5EQLA 1LOXA 4IT7A 4H3UA 4N6OB 5JBSA 1OH0A 1US1A 1W6GA 2IUKA 1UI8A 3NV0B 4BTYA 1VQ83 3FKAA 4N6TA 4JF8A 3CCR3 4MEIA 1OGZA 4O02B 3KZTA 4KZ1A 1NDOB 3NQYA 3VSYA 1VQ93 1E97A 1O7NB 1JJ22 4R9LA 1VZZA 4K1UA 3DY5A 1JNQA 3HI7A 4L8PA 3X40A 5CLKA 5LC6A 3RGRA 4MMZB 4U13A 3CCQ3 3GZRA 3JUMA 3QRDA 3CCS3 1LNHA 3CPOA 3T8NA 3JVCA 2Q07A 4HM1B 3K9MC 3EN1B 2P38A 2Z7AA 1QALA 5CK6A 4G1MB 3CME3 2XFSA 3CC43 2CFKA 1CYVA 1IT7A 1WNHA 4RBNA 1W02A 1NO3A 1IVXA 3B4PA 3EN8A 3S29A 3G713 3LTAA 1YVBI 3NM2A 4KFEA 3SX1A 3S27A 3PS8A 3F14A 4O3VA 3O8YA 4FMCA 5BVBA 2E2UA 3T0UA 2P0MA 2RFRA 1W2ZA 3FG3A 4WHAA 1JB4A 3EBYA 5HGRA 1FUWA 1QAKA 1AV4A 1Q7Y4 3FG4A 1GYBA 1F8NA 2WOFA 3LH4A 2ML6A 1VQ53 3WA3A 3J7Yd 3F8HA 1G96A 1VQP3 5FW5A 3TDGA 3UNLA 8CHOA 3GZYB 3FLJA 2XF3A 3SOAA 1TU5A 5AEUB 3LTBA 1W00A 1YJW3 5AIHA 2CFGA 3FCSB 3KE7A 5IG4A 1VQM3 1O7PB 2CFLA 3ROBA 5JPUA 3CMA3 3F7SA 3G16A 2CFWA 4AKYA 1STDA 2W0QA 3ECFA 2CK3H 4KVHA 3OW22 3EJVA 4OVMA 2F86B 2CHCA 1YJN3 1WTHA 2PZVA 1SJWA 2QIYA 2UX0A 1FGQA 3MG1A 2MF7A 4WYKB 3PCRA 3LYGA 3K0ZA 3K63A 2LQVA 2WOHA 2F99A 3DUKA 2XEPA 4LEHA 5FGOA 1WQLB 2STDA 3FZWA 3CNMA 2Z76A 4IPBA 3WDGB 1IDPA 2GBXB 1IV9A 3KKGA 4HZBB 5I97A 2B1XB 3D9RA 1QMAA 4WFOA 4CDLA 4GL6A 1Y4KA 3CXC2 4KFDA 3CCL3 4L8OA 4PEJA 2WGQA 2D42A 4HBRA 2PNCA 1O7GB 2W04A 3NHXA 3V98A 4N6NB 3FF2A 1S723 1JV2B 4NREA 4R4KA 2HMOB 2P0XA 1JB2A 1TFKA 3LXUX 3T8UA 4EC6A 1YIJ3 5AYRB 1SQWA 3JUPA 3EQQB 1Q42A 2L4VA 3F8XA 3MKIA 3S28A 1QAFA 1N5HA 2M7OA 1GY7A 3B4OA 2JQ5A 1N9JA 5KP3A 2W56B 1VQ63 1JN5A 1IQ8A 3ER7A 3I0YA 2RGQA 1Q864 3FG1A 5DRVA 1EKMA 3FH1A 5TGNA 3H51A 4STDA 2GEXA 3KSED 2CWUA 1YHQ3 4LGQA 1W6YA 4HM3B 4J9AA 3IJEB 1C7HA 2QGUA 1GD3A 1OHPA 2OOVA 4LSOA 4EBGA 2HMLB 3Q1CA 1KC84 4BTXA 4JRFA 2Z77A 2GBWB 1GY5A 3NX0A 3A76A 2P05A 1EG9B 2CH9A 1O7HB 1D6YA 3HIGA 3MWZA 3OWYA 3KN4A 1JKGB 1S5AA 4MMYB 3BNCA 4AEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STF I;  1FUW A;  3LH4 A;  3PYJ A;  1DVC A;  4N6V 0;  1G96 A;  3IMA B;  1ROA A;  2O9U X;  1EQK A;  1IV7 A;  3KFQ C;  2W9P A;  3UL5 A;  4N6U A;  2W9Q A;  4N6L A;  1TIJ A;  1MNL A;  5LC7 A;  1A90 A;  5A0O B;  1NB3 I;  1A67 A;  3GAX A;  5ELU A;  3L0R A;  1N5P A;  4N6M A;  3SVA A;  2OCT A;  2KXG A;  4EYC A;  3S67 A;  1NB5 I;  5ELJ A;  1KWI A;  1IV9 A;  3UL6 A;  1LXE A;  1CYU A;  5EQL A;  4IT7 A;  4N6O B;  4TX4 A;  4N6N B;  4N6T A;  1PFP A;  1N5H A;  1R4C A;  1GD4 A;  1N9J A;  5LC6 A;  3PXM A;  3QRD A;  4CCV A;  3K9M C;  3KSE D;  4ZM8 A;  1CEW I;  1CYV A;  3Q2P A;  1WNH A;  1GD3 A;  1RN7 A;  1FA3 A;  1YVB I;  1MOL A;  3NX0 A;  2CH9 A;  2BO9 B;  3PS8 A;  1DVD A;  3MWZ A;  1M9G A;  4LZI A; 
#chains in the Genus database with same CATH topology
 1STF I;  2OQE C;  2CX0 A;  1OF5 A;  1K9M 4;  3MG2 A;  1U5O A;  2OOV C;  1MGR A;  6RNT A;  1UCK A;  1VQK 3;  2Y74 A;  2GEY A;  3PYJ A;  2ZHX B;  4HM8 B;  3DM8 A;  3B8L A;  1IVW A;  3IMA B;  3NQZ A;  4FCM A;  2HOH A;  5IG0 A;  2O9U X;  5AEW B;  3F9S A;  3BND A;  1N8Q A;  5M18 A;  1IQX A;  1SII A;  5D82 A;  1RLS A;  1BSD A;  4MMX B;  2W9P A;  3EB8 A;  3VF1 A;  2MC8 A;  1UUG B;  2BHM A;  3MPH A;  4O2H A;  2KCD A;  1BRJ A;  2HMJ B;  3NUV A;  1PU4 A;  3LT8 A;  2RBI A;  1RN1 A;  2F4Y A;  4N6L A;  4WWU C;  3EE1 A;  4H61 A;  1NNV A;  3Q90 A;  1W2B 2;  1A90 A;  3OXA A;  2RNT A;  1JBT A;  1TUH A;  4HM4 B;  2CKF B;  2H0G A;  5IEN A;  3CPW 2;  5DRE A;  1DMQ A;  3BIR A;  3BLZ A;  3L0R A;  3LZA A;  3N8B A;  1UW1 A;  2CFD A;  3NV0 A;  1RCK A;  3G8Z A;  3X42 A;  4R9K A;  3OWS A;  2QA4 3;  1O7M B;  5KP1 A;  4WP5 A;  3V92 A;  1A2K A;  4LMI A;  1E3R A;  1AQZ A;  1UI7 A;  1I2F A;  2ZL8 A;  2IYJ A;  2KXG A;  3AGN A;  3G0K A;  3U97 A;  1RRH A;  1LQM B;  1GMQ A;  3RDE A;  1V74 A;  5ELJ A;  1OUN A;  3BNB A;  1FGM A;  2B24 B;  4L7K A;  2BMR B;  2V1L A;  1LXE A;  1WMN A;  3WA2 X;  4BL3 A;  2P09 A;  3JUO A;  3M8C A;  1C54 A;  1TRQ A;  2HMK B;  3QK9 A;  1OHO A;  5D83 A;  1KQS 2;  1UDI I;  2CIU A;  3HK4 A;  3AMO B;  1VQO 3;  3CD6 3;  2C11 A;  4TX4 A;  1B20 A;  1UGH I;  3S5C A;  1KD1 4;  4K90 B;  1ISK A;  3SXX A;  1I3F A;  1BSC A;  2O3O A;  1SIH A;  3IPT A;  2A15 A;  3GZX B;  1OHS A;  3BB9 A;  4XB5 A;  1VQN 3;  1K41 A;  7RNT A;  1IK3 A;  3CCE 3;  2GU1 A;  1BIR A;  5CF2 A;  1RMS A;  2CX1 A;  2RCD A;  2XSO B;  1R4C A;  1GD4 A;  1Q40 B;  3X41 A;  1QJG A;  1TP6 A;  5IF6 A;  1RGE A;  3SOY A;  1B2X A;  3HZP A;  1HKX A;  1OAC A;  3PXM A;  4CCV A;  1ROV A;  1DMN A;  1M1K 4;  4FCZ A;  3EHC A;  2R41 A;  2E2T A;  1UUV B;  3CCV 3;  1JRQ A;  1I70 A;  3PGB A;  5CF1 A;  1ZO2 A;  1MWU A;  1ZX2 A;  1FGO A;  1G0T A;  1GSP A;  3DMC A;  3G4S 3;  2W03 A;  2F5W A;  3FGY A;  5IEP A;  1SPU A;  3HII A;  1M90 4;  4FCJ A;  3N54 B;  2E2V A;  3EBT A;  2CG1 A;  3CCM 3;  4NHF A;  1MOL A;  1W4N A;  5IEO A;  3K7C A;  3RGA A;  2IMJ A;  1B2S A;  1ULI B;  2CWV A;  1M9G A;  2K54 A;  6STD A;  2LYX A;  1NU3 A;  2UGI A;  1RGK A;  3AHS A;  3LOY A;  3F40 A;  3UJM A;  1K28 A;  2OWP A;  1FGT A;  5IW9 A;  1B27 A;  2YX9 A;  4HM2 B;  1SAR A;  1UUW B;  3HX8 A;  1Q81 4;  4EV2 A;  3AMO A;  4BIR A;  1ASK A;  4N6V 0;  3MG3 A;  3UB1 A;  4OK0 A;  3WOE B;  3I55 3;  3LT9 A;  1ROA A;  2OQE A;  3A5E A;  1EQK A;  1DYU A;  1IV7 A;  1RGL A;  4AKZ A;  1UCJ A;  3ZG0 A;  1DMM A;  4WYK A;  1CH0 A;  1OGX A;  3SLU A;  4HKV B;  3OWU A;  1RKY A;  1K73 4;  4X2H A;  1BNS A;  1BU4 A;  5M19 A;  1RNB A;  4FMA A;  1JZD A;  1RDS A;  2CG0 A;  4XBX A;  4XDV A;  2W9Q A;  1Q9E A;  1Q82 4;  1NWW A;  3D3L A;  2R4I A;  1LRA A;  5A0O B;  4BU4 A;  3PZW A;  1LVN A;  3CU3 A;  1W6C A;  5JPP A;  1GOU A;  3MYT A;  3OX9 A;  2IUJ A;  1BSB A;  1OCV A;  4N3V A;  2KRT A;  4HM5 B;  1AVL A;  5D81 A;  5BXQ A;  3WHO A;  4KT3 B;  2I9W A;  3SVA A;  1BSA A;  3U1W A;  4X2O A;  2OCT A;  1B2U A;  4EXR A;  1QVF 2;  1DE3 A;  2RSX A;  3DGY A;  3NBJ A;  3K5T A;  3LTD A;  3X3X A;  1YJ9 3;  1RCL A;  2BIR A;  4EYC A;  5IG3 A;  3DGO A;  3S67 A;  3LML A;  1OPY A;  1RGC A;  2F98 A;  1NB5 I;  2K0M A;  3X3Z A;  1U8C B;  2JDI H;  4HM6 B;  4EW5 A;  3CCJ 3;  3WMD A;  1GMR A;  1CYU A;  1V57 A;  2Y73 A;  1N9E A;  1W7C A;  1T5Y A;  2W56 A;  1VQ7 3;  1K8A 4;  2XRX B;  1N8R 4;  1B2M A;  4ORL A;  3EC9 A;  1BUQ A;  2BT3 A;  1BRK A;  2XH9 A;  2W2C A;  3G6E 3;  1RGH A;  3AHW A;  3WOD G;  1YI2 3;  1BGS A;  1IT8 A;  1E3V A;  1VQ4 3;  4HZ9 B;  1NJI 4;  2YFJ B;  3EF8 A;  2YFI B;  2KF6 A;  4QWT A;  3DGL A;  4J5K A;  1PFP A;  1BUJ A;  1TTO A;  2ML5 A;  2HMM B;  4ILF A;  3DXO A;  3SED A;  4I4K A;  1J2B A;  4EV5 A;  5BU4 A;  1BNF A;  4HYZ A;  4IIA A;  4GSP A;  3GSP A;  2FXT A;  4HM0 B;  4HAA A;  1IVV A;  1ULJ B;  3CNX A;  3N9H A;  1JKG A;  1M1X B;  2ZDJ A;  4MJD A;  4Q53 A;  4HM7 B;  4R80 A;  3FSD A;  2ZA4 A;  4J8T A;  1AVK A;  2AAD A;  1WMO A;  2CC3 A;  1WMP A;  5M1A A;  2QEX 3;  4K1V A;  1JZO A;  3DGN A;  3STD A;  5AIF A;  1A2V A;  3I56 3;  1FGR A;  1TFO A;  3KII A;  4FMD A;  1O7W B;  4ZM8 A;  2HMN B;  1CEW I;  1LOV A;  3Q2P A;  3D4A A;  3LTC A;  1RN7 A;  3WOF B;  3BU4 A;  1W5Z A;  5EEO A;  1FA3 A;  7STD A;  1EEJ A;  1VQQ A;  2XGN A;  3RNT A;  2BO9 B;  1DVD A;  1VQL 3;  2WO0 A;  3B7C A;  2C4B A;  3V99 A;  1JN5 B;  4LZI A;  5G2G A;  3PCS A;  1L5G B;  3MHE A;  1G02 A;  3SYU A;  5AII A;  5EVH A;  1BRI A;  1GS3 A;  1YGE A;  2F56 A;  2XSH B;  3BNE A;  1RRL A;  4XBT A;  3CCU 3;  4XM4 A;  1IU7 A;  4I5Q A;  8RNT A;  1R4Y A;  1T2H A;  2GU3 A;  2CW9 A;  1RGG A;  3AGO A;  5AIG A;  1DVC A;  2OTJ 3;  1W01 A;  5IG5 A;  1QVG 2;  1RNT A;  3MSO A;  4HVN A;  5AYS C;  3KFQ C;  1BAN A;  2GSP A;  1UGI A;  1GY6 A;  3JUQ A;  2INX A;  4R1K A;  4RNZ A;  3X3Y A;  1CQS A;  4RNY A;  3UL5 A;  4N6U A;  3NXJ A;  2OTL 3;  1JB5 A;  5STD A;  3E99 A;  2CWT A;  1LNI A;  3OV4 A;  1BNE A;  4XDW A;  1FUS A;  2IY2 A;  2WGO A;  5CXO A;  2GXF A;  3D5G A;  4HJL B;  3JUN A;  1TIJ A;  1MNL A;  1OF5 B;  2BNG A;  3D79 A;  5GSP A;  1LOY A;  3FF0 A;  1D6Z A;  1RJO A;  4HOH A;  4KFF A;  5LC7 A;  1IVU A;  2BMO B;  3GZB A;  1YIT 3;  3Q3F A;  1NB3 I;  1A67 A;  3HOH A;  1Z1S A;  3GAX A;  5ELU A;  2FNQ A;  4RNT A;  2XGL A;  3NM7 A;  4GB5 A;  2K3D A;  1N5P A;  3ZFZ A;  1IQY A;  2D1W A;  2FGT A;  5AI1 A;  3CC2 3;  4N6M A;  3F7X A;  1DET A;  2YFL B;  3DZL A;  1KSI A;  2W6J H;  1UCL A;  3NBB A;  4FR9 A;  3URP A;  1FUT A;  1BNG A;  2IA7 A;  1D6U A;  3VGN A;  2BMQ B;  4BTW A;  3GWR A;  1MWR A;  3DGM A;  3GRD A;  4FMB A;  2XR8 B;  3H3H A;  3KSP A;  5IER A;  1EA2 A;  2SBL A;  2C10 A;  3NBR A;  2Z6B A;  4K61 A;  1HU9 A;  4RZM A;  1KWI A;  3ALA A;  4XBY A;  1AR0 A;  4OUQ A;  1BOX A;  4O8S A;  5KP4 A;  1JBS A;  3UL6 A;  3EX9 A;  1Q40 A;  2XFT A;  7GSP A;  2L1S A;  1TJD A;  5EQL A;  1I0V A;  1LOX A;  2F5M A;  4IT7 A;  1RTU A;  4H3U A;  4N6O B;  5JBS A;  1OH0 A;  1US1 A;  1W6G A;  2IUK A;  1UI8 A;  3NV0 B;  4BTY A;  1BRH A;  1FZU A;  1VQ8 3;  1MWS A;  3FKA A;  1GOV A;  4N6T A;  4JF8 A;  3CCR 3;  4MEI A;  1OGZ A;  4O02 B;  3KZT A;  4KZ1 A;  1NDO B;  3NQY A;  3VSY A;  1VQ9 3;  1E97 A;  1O7N B;  1JJ2 2;  4R9L A;  1T2I A;  1VZZ A;  1YNV X;  4K1U A;  3DY5 A;  1JNQ A;  3HI7 A;  4L8P A;  3X40 A;  5CLK A;  1ZGX A;  5LC6 A;  3RGR A;  4MMZ B;  4U13 A;  3CCQ 3;  3GZR A;  3JUM A;  3QRD A;  1YGW A;  3CCS 3;  2UUG C;  1LNH A;  3CPO A;  3T8N A;  1X1U A;  1BNJ A;  3JVC A;  2Q07 A;  4HM1 B;  4CJN A;  3K9M C;  3EN1 B;  2KAA A;  3WR2 A;  2P38 A;  2Z7A A;  1QAL A;  5CK6 A;  4G1M B;  3CME 3;  2XFS A;  3CC4 3;  2CFK A;  1CYV A;  1IT7 A;  2H0H A;  1WNH A;  2J8X B;  4RBN A;  1W02 A;  3ZG5 A;  1RHL A;  1YVS A;  1LOW A;  1IVX A;  1NO3 A;  3B4P A;  3EN8 A;  3S29 A;  3LTA A;  1YVB I;  3NM2 A;  3G71 3;  4KFE A;  1BRN L;  1LQG C;  1I2E A;  3SX1 A;  1BNR A;  3S27 A;  2KF3 A;  3PS8 A;  1IYY A;  3F14 A;  4O3V A;  3O8Y A;  4FMC A;  1B2Z A;  5BVB A;  2E2U A;  3T0U A;  2P0M A;  1BRG A;  2RFR A;  1W2Z A;  3FG3 A;  1B3S A;  3KCH A;  4WHA A;  1JB4 A;  3EBY A;  5HGR A;  1FUW A;  5BIR A;  1QAK A;  3DH2 A;  1AV4 A;  1Q7Y 4;  3FG4 A;  1GYB A;  1F8N A;  1JBR A;  2WOF A;  3LH4 A;  1UCI A;  1T3B A;  2ML6 A;  1VQ5 3;  3WA3 A;  3J7Y d;  3F8H A;  1G96 A;  1VQP 3;  5FW5 A;  3TDG A;  1RGA A;  3UNL A;  8CHO A;  3GZY B;  2KF5 A;  4NPB A;  1X1Y A;  3FLJ A;  2XF3 A;  1FYS A;  1Q7H A;  3SOA A;  1ZS7 A;  5AEU B;  3LTB A;  1TU5 A;  1W00 A;  1YJW 3;  5AIH A;  2CFG A;  3FCS B;  3KE7 A;  5IG4 A;  1VQM 3;  1O7P B;  1X1X A;  2CFL A;  3ROB A;  5JPU A;  5RNT A;  3F7S A;  3G16 A;  3CMA 3;  1BRS A;  1RSN A;  2CFW A;  4AKY A;  1STD A;  2W0Q A;  3ECF A;  2CK3 H;  4KVH A;  3OW2 2;  3EJV A;  4OVM A;  2F86 B;  5HOH A;  1A2P A;  2CHC A;  1YJN 3;  1BAO A;  1WTH A;  2PZV A;  1SJW A;  1X1W A;  5G1K A;  2QIY A;  2UX0 A;  1FGQ A;  3MG1 A;  1MWT A;  2MF7 A;  4WYK B;  3PCR A;  3LYG A;  1RGF A;  3K0Z A;  3K63 A;  2LQV A;  1RN4 A;  2WOH A;  2F99 A;  1GMP A;  3DUK A;  2XEP A;  4LEH A;  5FGO A;  5G1L A;  1WQL B;  2STD A;  3FZW A;  3CNM A;  2Z76 A;  4IPB A;  1I8V A;  4DKI A;  3WDG B;  1I3I A;  1IDP A;  2GBX B;  1IV9 A;  3KKG A;  4HZB B;  5I97 A;  2B1X B;  3D9R A;  9RNT A;  1QMA A;  1BNI A;  4WFO A;  4CDL A;  4GL6 A;  1Y4K A;  3CXC 2;  4KFD A;  3CCL 3;  4L8O A;  4PEJ A;  2WGQ A;  2D42 A;  4HBR A;  1AY7 A;  2PNC A;  1O7G B;  2W04 A;  3NHX A;  3V98 A;  4N6N B;  3FF2 A;  1S72 3;  1JV2 B;  4NRE A;  4GHO A;  4R4K A;  2HMO B;  2P0X A;  2KF4 A;  1JB2 A;  1TFK A;  3LXU X;  1PY3 A;  3T8U A;  4EC6 A;  1YIJ 3;  1MGW A;  5AYR B;  4CPK A;  1SQW A;  3JUP A;  1EUI C;  1Q42 A;  3EQQ B;  2L4V A;  3F8X A;  3MKI A;  1HYF A;  3S28 A;  1QAF A;  1N5H A;  2M7O A;  1GY7 A;  3B4O A;  1BVI A;  2JQ5 A;  1N9J A;  5KP3 A;  1BSE A;  2W56 B;  1VQ6 3;  1IQ8 A;  1JN5 A;  1GOY A;  3ER7 A;  3I0Y A;  1HZ1 A;  4BL2 A;  2RGQ A;  2SAR A;  1Q86 4;  3FG1 A;  6GSP A;  5DRV A;  1EKM A;  3FH1 A;  5TGN A;  3H51 A;  4STD A;  2GEX A;  1V58 A;  3KSE D;  3CC7 3;  2CWU A;  1TRP A;  1YHQ 3;  3D5I A;  4LGQ A;  1W6Y A;  4HM3 B;  2BU4 A;  4J9A A;  3IJE B;  1C7H A;  2QGU A;  1GD3 A;  1B21 A;  1OHP A;  2OOV A;  4LYL B;  4LSO A;  4EBG A;  2HML B;  3Q1C A;  4J5G A;  4BTX A;  1KC8 4;  4JRF A;  2Z77 A;  2GBW B;  1GY5 A;  1FW7 A;  3NX0 A;  3A76 A;  2P05 A;  1EG9 B;  2CH9 A;  1O7H B;  1D6Y A;  3HIG A;  3MWZ A;  3OWY A;  1PYL A;  3KN4 A;  1I0X A;  1JKG B;  1S5A A;  2AAE A;  2H0I A;  4MMY B;  1I2G A;  3BNC A;  4AEQ A; 
#chains in the Genus database with same CATH homology
 1STF I;  2OQE C;  1OF5 A;  3MG2 A;  1U5O A;  2OOV C;  1VQK 3;  2Y74 A;  2GEY A;  3PYJ A;  4HM8 B;  3DM8 A;  3B8L A;  1IVW A;  3IMA B;  3NQZ A;  4FCM A;  5IG0 A;  5AEW B;  2O9U X;  3F9S A;  3BND A;  1N8Q A;  1IQX A;  1SII A;  5D82 A;  4MMX B;  2W9P A;  3EB8 A;  3VF1 A;  2MC8 A;  2BHM A;  3MPH A;  4O2H A;  2KCD A;  2HMJ B;  3NUV A;  1PU4 A;  3LT8 A;  4N6L A;  4WWU C;  3EE1 A;  4H61 A;  3Q90 A;  1W2B 2;  1A90 A;  3OXA A;  1TUH A;  4HM4 B;  2CKF B;  5IEN A;  3CPW 2;  5DRE A;  1DMQ A;  3BLZ A;  3L0R A;  3LZA A;  3N8B A;  1UW1 A;  2CFD A;  3NV0 A;  3G8Z A;  3X42 A;  4R9K A;  3OWS A;  2QA4 3;  1O7M B;  5KP1 A;  4WP5 A;  3V92 A;  1A2K A;  4LMI A;  1E3R A;  1UI7 A;  2ZL8 A;  2KXG A;  3G0K A;  3U97 A;  1RRH A;  3RDE A;  1V74 A;  5ELJ A;  1OUN A;  3BNB A;  1FGM A;  2B24 B;  4L7K A;  2BMR B;  2V1L A;  1LXE A;  1WMN A;  3WA2 X;  2P09 A;  3JUO A;  3M8C A;  2HMK B;  3QK9 A;  1OHO A;  5D83 A;  1KQS 2;  2CIU A;  3HK4 A;  3AMO B;  1VQO 3;  3CD6 3;  2C11 A;  4TX4 A;  3S5C A;  1KD1 4;  4K90 B;  1ISK A;  3SXX A;  3IPT A;  2O3O A;  1SIH A;  2A15 A;  3GZX B;  1OHS A;  3BB9 A;  4XB5 A;  1VQN 3;  1K41 A;  1IK3 A;  3CCE 3;  2GU1 A;  5CF2 A;  2RCD A;  2XSO B;  1R4C A;  1GD4 A;  1Q40 B;  3X41 A;  1QJG A;  1TP6 A;  5IF6 A;  3SOY A;  3HZP A;  1HKX A;  1OAC A;  3PXM A;  4CCV A;  1ROV A;  1DMN A;  1M1K 4;  4FCZ A;  3EHC A;  2E2T A;  1UUV B;  3CCV 3;  1JRQ A;  3PGB A;  5CF1 A;  1ZO2 A;  1ZX2 A;  1FGO A;  3DMC A;  3G4S 3;  2W03 A;  3FGY A;  5IEP A;  1SPU A;  3HII A;  1M90 4;  4FCJ A;  3N54 B;  2E2V A;  3EBT A;  2CG1 A;  3CCM 3;  4NHF A;  1MOL A;  1W4N A;  5IEO A;  3K7C A;  3RGA A;  2IMJ A;  1ULI B;  2CWV A;  1M9G A;  2K54 A;  6STD A;  2LYX A;  1NU3 A;  3LOY A;  3F40 A;  3UJM A;  1K28 A;  2OWP A;  1FGT A;  5IW9 A;  2YX9 A;  4HM2 B;  1UUW B;  3HX8 A;  1Q81 4;  4EV2 A;  3AMO A;  1ASK A;  4N6V 0;  3MG3 A;  3UB1 A;  4OK0 A;  3WOE B;  3I55 3;  3LT9 A;  1ROA A;  2OQE A;  1EQK A;  1DYU A;  1IV7 A;  4AKZ A;  1DMM A;  4WYK A;  1OGX A;  3SLU A;  4HKV B;  3OWU A;  1RKY A;  1K73 4;  4X2H A;  4FMA A;  2CG0 A;  4XDV A;  4XBX A;  2W9Q A;  1Q82 4;  1NWW A;  3D3L A;  2R4I A;  5A0O B;  3PZW A;  1LVN A;  3CU3 A;  1W6C A;  5JPP A;  3MYT A;  3OX9 A;  2IUJ A;  1OCV A;  4N3V A;  2KRT A;  4HM5 B;  1AVL A;  5D81 A;  5BXQ A;  2I9W A;  3SVA A;  3U1W A;  4X2O A;  2OCT A;  4EXR A;  1QVF 2;  2RSX A;  3NBJ A;  3K5T A;  3LTD A;  3X3X A;  1YJ9 3;  4EYC A;  5IG3 A;  3DGO A;  3S67 A;  3LML A;  1OPY A;  2F98 A;  1NB5 I;  2K0M A;  3X3Z A;  1U8C B;  2JDI H;  4HM6 B;  3CCJ 3;  3WMD A;  1CYU A;  2Y73 A;  1N9E A;  1W7C A;  1T5Y A;  2W56 A;  1VQ7 3;  1K8A 4;  2XRX B;  1N8R 4;  4ORL A;  3EC9 A;  1BUQ A;  2BT3 A;  2XH9 A;  2W2C A;  3G6E 3;  1YI2 3;  3WOD G;  1IT8 A;  1E3V A;  1VQ4 3;  4HZ9 B;  1NJI 4;  2YFJ B;  3EF8 A;  2YFI B;  4QWT A;  3DGL A;  1PFP A;  2ML5 A;  2HMM B;  1J2B A;  3DXO A;  3SED A;  4I4K A;  4EV5 A;  4HYZ A;  4IIA A;  2FXT A;  4HM0 B;  1IVV A;  1ULJ B;  3CNX A;  3N9H A;  1JKG A;  1M1X B;  2ZDJ A;  4MJD A;  4Q53 A;  4HM7 B;  4R80 A;  3FSD A;  4J8T A;  1AVK A;  1WMO A;  2CC3 A;  1WMP A;  2QEX 3;  4K1V A;  3DGN A;  3STD A;  5AIF A;  1A2V A;  3I56 3;  1FGR A;  1TFO A;  3KII A;  4FMD A;  1O7W B;  4ZM8 A;  2HMN B;  1CEW I;  3Q2P A;  3LTC A;  1RN7 A;  3WOF B;  1W5Z A;  5EEO A;  1FA3 A;  7STD A;  2XGN A;  2BO9 B;  1DVD A;  1VQL 3;  2WO0 A;  3B7C A;  3V99 A;  1JN5 B;  4LZI A;  5G2G A;  3PCS A;  1L5G B;  3MHE A;  5AII A;  5EVH A;  1YGE A;  1GS3 A;  2XSH B;  3BNE A;  1RRL A;  4XBT A;  3CCU 3;  4XM4 A;  1IU7 A;  2GU3 A;  2CW9 A;  5AIG A;  1DVC A;  2OTJ 3;  1W01 A;  5IG5 A;  1QVG 2;  3MSO A;  4HVN A;  5AYS C;  3KFQ C;  3JUQ A;  1GY6 A;  4RNZ A;  2INX A;  4R1K A;  3X3Y A;  2OTL 3;  1CQS A;  4RNY A;  3UL5 A;  4N6U A;  3NXJ A;  1JB5 A;  5STD A;  3E99 A;  2CWT A;  5CXO A;  3OV4 A;  4XDW A;  2WGO A;  2GXF A;  4HJL B;  3JUN A;  1TIJ A;  1MNL A;  1OF5 B;  2BNG A;  3CC7 3;  4KFF A;  3FF0 A;  1D6Z A;  1RJO A;  5LC7 A;  1YIT 3;  1K9M 4;  1IVU A;  2BMO B;  3GZB A;  1NB3 I;  1A67 A;  1Z1S A;  3GAX A;  5ELU A;  2FNQ A;  2XGL A;  3NM7 A;  4GB5 A;  1N5P A;  1IQY A;  2D1W A;  2FGT A;  5AI1 A;  3CC2 3;  4N6M A;  3F7X A;  2YFL B;  3DZL A;  1KSI A;  2W6J H;  3NBB A;  4FR9 A;  2IA7 A;  1D6U A;  3VGN A;  2BMQ B;  4BTW A;  3GWR A;  3GRD A;  3DGM A;  4FMB A;  2XR8 B;  3H3H A;  3KSP A;  5IER A;  1EA2 A;  2SBL A;  2C10 A;  3NBR A;  2Z6B A;  4K61 A;  1HU9 A;  4RZM A;  1KWI A;  3ALA A;  4XBY A;  1AR0 A;  4OUQ A;  4O8S A;  5KP4 A;  3UL6 A;  3EX9 A;  1Q40 A;  2XFT A;  5EQL A;  1LOX A;  4IT7 A;  4H3U A;  4N6O B;  5JBS A;  1OH0 A;  1US1 A;  1W6G A;  2IUK A;  1UI8 A;  3NV0 B;  4BTY A;  1VQ8 3;  3FKA A;  4N6T A;  4JF8 A;  3CCR 3;  4MEI A;  1OGZ A;  4O02 B;  3KZT A;  4KZ1 A;  1NDO B;  3NQY A;  3VSY A;  1VQ9 3;  1E97 A;  1O7N B;  1JJ2 2;  4R9L A;  1VZZ A;  4K1U A;  3DY5 A;  1JNQ A;  3HI7 A;  4L8P A;  3X40 A;  5CLK A;  5LC6 A;  3RGR A;  4MMZ B;  4U13 A;  3CCQ 3;  3GZR A;  3JUM A;  3QRD A;  3CCS 3;  1LNH A;  3CPO A;  3T8N A;  3JVC A;  2Q07 A;  4HM1 B;  3K9M C;  3EN1 B;  2P38 A;  2Z7A A;  1QAL A;  5CK6 A;  4G1M B;  3CME 3;  2XFS A;  3CC4 3;  2CFK A;  1CYV A;  1IT7 A;  1WNH A;  4RBN A;  1W02 A;  1NO3 A;  1IVX A;  3B4P A;  3EN8 A;  3S29 A;  3G71 3;  3LTA A;  1YVB I;  3NM2 A;  4KFE A;  3SX1 A;  3S27 A;  3PS8 A;  3F14 A;  4O3V A;  3O8Y A;  4FMC A;  5BVB A;  2E2U A;  3T0U A;  2P0M A;  2RFR A;  1W2Z A;  3FG3 A;  4WHA A;  1JB4 A;  3EBY A;  5HGR A;  1FUW A;  1QAK A;  1AV4 A;  1Q7Y 4;  3FG4 A;  1GYB A;  1F8N A;  2WOF A;  3LH4 A;  2ML6 A;  1VQ5 3;  3WA3 A;  3J7Y d;  3F8H A;  1G96 A;  1VQP 3;  5FW5 A;  3TDG A;  3UNL A;  8CHO A;  3GZY B;  3FLJ A;  2XF3 A;  3SOA A;  1TU5 A;  5AEU B;  3LTB A;  1W00 A;  1YJW 3;  5AIH A;  2CFG A;  3FCS B;  3KE7 A;  5IG4 A;  1VQM 3;  1O7P B;  2CFL A;  3ROB A;  5JPU A;  3CMA 3;  3F7S A;  3G16 A;  2CFW A;  4AKY A;  1STD A;  2W0Q A;  3ECF A;  2CK3 H;  4KVH A;  3OW2 2;  3EJV A;  4OVM A;  2F86 B;  2CHC A;  1YJN 3;  1WTH A;  2PZV A;  1SJW A;  2QIY A;  2UX0 A;  1FGQ A;  3MG1 A;  2MF7 A;  4WYK B;  3PCR A;  3LYG A;  3K0Z A;  3K63 A;  2LQV A;  2WOH A;  2F99 A;  3DUK A;  2XEP A;  4LEH A;  5FGO A;  1WQL B;  2STD A;  3FZW A;  3CNM A;  2Z76 A;  4IPB A;  3WDG B;  1IDP A;  2GBX B;  1IV9 A;  3KKG A;  4HZB B;  5I97 A;  2B1X B;  3D9R A;  1QMA A;  4WFO A;  4CDL A;  4GL6 A;  1Y4K A;  3CXC 2;  4KFD A;  3CCL 3;  4L8O A;  4PEJ A;  2WGQ A;  2D42 A;  4HBR A;  2PNC A;  1O7G B;  2W04 A;  3NHX A;  3V98 A;  4N6N B;  3FF2 A;  1S72 3;  1JV2 B;  4NRE A;  4R4K A;  2HMO B;  2P0X A;  1JB2 A;  1TFK A;  3LXU X;  3T8U A;  4EC6 A;  1YIJ 3;  5AYR B;  1SQW A;  3JUP A;  3EQQ B;  1Q42 A;  2L4V A;  3F8X A;  3MKI A;  3S28 A;  1QAF A;  1N5H A;  2M7O A;  1GY7 A;  3B4O A;  2JQ5 A;  1N9J A;  5KP3 A;  2W56 B;  1VQ6 3;  1JN5 A;  1IQ8 A;  3ER7 A;  3I0Y A;  2RGQ A;  1Q86 4;  3FG1 A;  5DRV A;  1EKM A;  3FH1 A;  5TGN A;  3H51 A;  4STD A;  2GEX A;  3KSE D;  2CWU A;  1YHQ 3;  4LGQ A;  1W6Y A;  4HM3 B;  4J9A A;  3IJE B;  1C7H A;  2QGU A;  1GD3 A;  1OHP A;  2OOV A;  4LSO A;  4EBG A;  2HML B;  3Q1C A;  1KC8 4;  4BTX A;  4JRF A;  2Z77 A;  2GBW B;  1GY5 A;  3NX0 A;  3A76 A;  2P05 A;  1EG9 B;  2CH9 A;  1O7H B;  1D6Y A;  3HIG A;  3MWZ A;  3OWY A;  3KN4 A;  1JKG B;  1S5A A;  4MMY B;  3BNC A;  4AEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...