1Q42A

Crystal structure analysis of the candida albicans mtr2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
159
Chain Sequence
b'QDPTQQLEPFLKRFLASLDLLYTQPTSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESARPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 46
structure length 159
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q42A00
2I9WA 3GRDA 4J8TA 1O7MB 4XM4A 1NWWA 3CNMA 2UX0A 3NUVA 2B24B 4XBYA 5IEOA 1UUVB 4K1VA 3ER7A 3F14A 4PEJA 3OX9A 1ULJB 5EVHA 3EJVA 1E3RA 4L8OA 3G16A 3NV0B 1ASKA 4HJLB 1OHSA 4XDVA 3F8XA 1OHOA 4HVNA 2CHCA 4X2OA 3JUQA 3B8LA 3B7CA 3SEDA 3FKAA 4FCMA 1GS3A 3G8ZA 1W02A 2R4IA 3FZWA 5DRVA 3F7SA 3F9SA 2RFRA 1JB4A 2BMOB 2K54A 1W6YA 3OWYA 2XRXB 3D9RA 1DMNA 1DMQA 4L8PA 3OWSA 3BB9A 3FF0A 3NV0A 3FGYA 4OVMA 3MG1A 2HMJB 3OWUA 4OUQA 4HM0B 2BMRB 5D82A 4WWUC 1AR0A 3I0YA 3MG3A 4HM8B 3T8UA 3KSPA 4L7KA 2RCDA 3UJMA 1OF5B 2F99A 2QGUA 4GB5A 3CNXA 4HKVB 3GZBA 2XSOB 4I4KA 2IMJA 3KKGA 5IEPA 3EHCA 5G2GA 3UNLA 2XSHB 1OH0A 4WP5A 3EF8A 4LGQA 4R1KA 3SOAA 3FH1A 4RZMA 5AIIA 2HMKB 1JN5A 5D83A 2W2CA 1O7NB 3VGNA 5IERA 4STDA 3EQQB 2GEXA 1GY6A 8CHOA 1ZO2A 1EA2A 5DREA 1OCVA 1QMAA 2Z77A 5STDA 6STDA 3KE7A 4XBXA 3K7CA 2HMOB 4N3VA 5AIHA 2JQ5A 5KP1A 3EBTA 1OUNA 3ROBA 1OF5A 3CU3A 3BLZA 3GWRA 5CXOA 5KP3A 1NDOB 1BUQA 1Q40B 4R9LA 4LMIA 4ORLA 3HX8A 5JPUA 1UUWB 3FSDA 4XDWA 5AIFA 3HZPA 1C7HA 3B4PA 1E97A 3IPTA 3DXOA 3S5CA 2YFIB 1W00A 3T8NA 4HM2B 5HGRA 4XB5A 1ISKA 2HMLB 1TUHA 1JKGB 1VZZA 3CPOA 1E3VA 2YFJB 5IG0A 3DMCA 5IG4A 3KZTA 2F86B 2YFLB 2A15A 5CLKA 1K41A 1Q40A 3M8CA 3STDA 4XBTA 3F8HA 2BNGA 4FCJA 4HZBB 2STDA 3HK4A 4LEHA 1Z1SA 3OXAA 1W01A 4Q53A 3VSYA 2F98A 1GYBA 1GY7A 1TP6A 5CK6A 3MG2A 1JKGA 1ZX2A 2HMMB 2PZVA 1U5OA 5BVBA 3EX9A 1OGXA 1S5AA 4HM5B 3B4OA 2HMNB 4K1UA 3F40A 4X2HA 2XR8B 3GZYB 3SOYA 1GY5A 4WYKB 1ULIB 1O7PB 3RGAA 4MJDA 5KP4A 3Q90A 3G0KA 2B1XB 3MYTA 4HM4B 3NHXA 4HM1B 3EN1B 3MHEA 5IG3A 3FLJA 2Z76A 3EBYA 4HM3B 3NBRA 4CDLA 2QIYA 4U13A 1DMMA 3GZRA 1OHPA 4IIAA 5AI1A 1SJWA 2GBWB 1O7GB 2GXFA 3DZLA 3OV4A 1NU3A 4J9AA 1WQLB 3NM2A 1OGZA 3H3HA 5CF1A 1JB2A 1O7HB 4HM7B 3ECFA 1HKXA 1EG9B 3JUMA 5IF6A 1JB5A 5TGNA 3EC9A 3DUKA 5CF2A 4WYKA 3GZXB 3E99A 1CQSA 4HZ9B 1JN5B 5AEUB 4R9KA 2OWPA 3WMDA 1O7WB 3EN8A 2GBXB 3RGRA 3FF2A 3LYGA 3JUNA 1STDA 3MSOA 2BMQB 5IENA 3A76A 3DM8A 3NXJA 2RGQA 5JPPA 2GEYA 5AEWB 3K0ZA 1OPYA 5AIGA 1QJGA 3MKIA 5FW5A 1IDPA 5IG5A 3JUPA 2INXA 7STDA 1A2KA 5BXQA 2Z7AA 3LZAA 4KVHA 5D81A 1Q42A 3H51A 4HM6B 3F7XA 4H3UA 3JUOA 2CKFB
chains in the Genus database with same CATH superfamily
2PNCA 2I9WA 1HYFA 3GRDA 1RGFA 2CFLA 1GD4A 1I70A 4J8TA 3NQYA 2CC3A 1O7MB 4XM4A 1NWWA 3CNMA 2UX0A 1LQMB 3NUVA 2B24B 3D3LA 2CK3H 4XBYA 1FUTA 2CX1A 2OQEC 1RKYA 5IEOA 1UUVB 4EBGA 4K1VA 3ER7A 3CCU3 3F14A 1GD3A 4PEJA 3OX9A 1RSNA 2W56B 3AGOA 2OOVC 5G1LA 1ULJB 5EVHA 3EJVA 2QEX3 1KWIA 3SYUA 1E3RA 4L8OA 3ALAA 1LQGC 4WHAA 1T2HA 4EC6A 2FNQA 3G16A 1M9GA 3NV0B 1LXEA 1BIRA 3X42A 1VQ83 1VQQA 1ASKA 3AHWA 4HJLB 3CD63 1OHSA 2KF5A 3JVCA 4XDVA 1AY7A 3F8XA 1VQP3 1OHOA 1BNRA 3NQZA 4HVNA 1IQXA 1U8CB 2CHCA 1JBTA 3N9HA 3LMLA 1RJOA 1EEJA 3B8LA 3B7CA 1BNJA 1BSEA 1FYSA 2O3OA 3JUQA 3SEDA 2SARA 3FKAA 4R4KA 4K90B 1IU7A 1YGWA 4O02B 1RDSA 1STFI 4FCMA 1GS3A 2F5WA 3G8ZA 1W02A 2R4IA 3CCV3 2W9QA 1RGKA 3FZWA 2GU1A 2RNTA 5DRVA 1B2UA 3VF1A 3WODG 1FZUA 3F7SA 2ZDJA 1FGRA 3F9SA 2IYJA 2RFRA 1BNGA 3WOFB 1B21A 2Z6BA 3OW22 1RMSA 2H0HA 1RGHA 5LC6A 1JB4A 2BT3A 2BMOB 1YIJ3 1NB5I 1M904 2K54A 1GMQA 1RTUA 1BNEA 2W56A 1LNHA 1WTHA 2W9PA 1IV7A 3LH4A 3CPW2 1W6YA 3OWYA 1BRHA 2GSPA 1NNVA 1G0TA 4KFEA 1MOLA 2XRXB 1BNSA 3D9RA 1DMNA 1DMQA 1ZS7A 3DGNA 3WHOA 2ZL8A 4L8PA 1VQ93 1TFOA 1MWUA 3OWSA 3BB9A 3DGOA 4LYLB 2J8XB 1W2ZA 3FF0A 3S29A 1BNFA 3NV0A 3FGYA 3RNTA 1BUJA 4OVMA 3V98A 3CCL3 1T3BA 1V57A 3MG1A 1NJI4 2KCDA 2HMJB 3BNEA 1B2SA 3OWUA 4OUQA 2D1WA 1B2ZA 1A2VA 2BO9B 4HM0B 2BMRB 5D82A 4WWUC 4N6MA 1AR0A 3I0YA 3MG3A 4HM8B 1W5ZA 3S28A 7RNTA 3U97A 2CKFB 3T8UA 4NREA 1J2BA 1AVLA 4HOHA 1CEWI 1WNHA 1TU5A 3KSPA 1BSCA 4N6NB 4L7KA 2RCDA 3UJMA 2OQEA 1HU9A 1OF5B 2C11A 4OK0A 2F99A 2QGUA 4GB5A 2CG0A 2W6JH 2IA7A 3AMOA 3CNXA 3GZBA 4HKVB 1V58A 2XSOB 4I4KA 4J5KA 4DKIA 1RNBA 4J5GA 1YGEA 1UCKA 4KT3B 1AV4A 4BIRA 2OOVA 2IMJA 3KKGA 1IT7A 3LTBA 4O3VA 5IEPA 1MWRA 3EHCA 3SX1A 4BTYA 3CC73 4CCVA 5G2GA 3X41A 3CCJ3 3UNLA 1UCJA 1CH0A 2KAAA 1I0VA 1LOXA 1AVKA 1BRJA 1I3IA 2LYXA 2P38A 2XSHB 1OH0A 2CWVA 3EF8A 4N6TA 2CW9A 4WP5A 1SARA 1BRKA 4LGQA 2KF6A 4R1KA 3SOAA 3FH1A 4RZMA 5AIIA 2HMKB 1JN5A 5D83A 1RCLA 2W2CA 1O7NB 1LVNA 3UL6A 3VGNA 5IERA 1BNIA 4STDA 1A90A 4FMBA 5AYSC 3CCQ3 3F7XA 3EQQB 2GEXA 1GY6A 3LT8A 1W6GA 2HOHA 1YHQ3 8CHOA 1IV9A 3WA3A 4AKYA 1EKMA 1TJDA 1UGHI 1ZO2A 1EA2A 3BNDA 5DREA 5G1KA 4EV2A 1IK3A 1PU4A 1OCVA 2D42A 1QMAA 3DY5A 1BGSA 2H0GA 2Z77A 1UGIA 5STDA 2MC8A 1X1WA 2IUJA 4FMAA 3LTAA 4EW5A 6STDA 2W03A 3KE7A 4G1MB 3LXUX 4XBXA 3K7CA 2HMOB 3KN4A 3NM7A 1N9JA 3DGYA 4N3VA 1GSPA 5AIHA 1CYUA 3CCR3 2JQ5A 2KF3A 3FCSB 1MGWA 5KP1A 1I0XA 3GAXA 2CWTA 3EBTA 1OUNA 3WR2A 1UCIA 3ROBA 2CFKA 4ILFA 3BU4A 1OF5A 1BRNL 4O8SA 1C54A 3CU3A 4HYZA 6RNTA 2KXGA 1JJ22 1JV2B 1A2PA 1LRAA 3BLZA 3GWRA 1A67A 5CXOA 3LTDA 3X3YA 1JNQA 1HZ1A 1PY3A 5KP3A 1NDOB 1BUQA 1Q40B 4R9LA 2E2TA 5EEOA 2IY2A 4EV5A 1DVCA 3UB1A 1Q864 1VQK3 1KSIA 1V74A 2R41A 4LMIA 4RBNA 4ORLA 1TTOA 3HX8A 2XFSA 3QRDA 3L0RA 3LT9A 3A5EA 4RNTA 1VQO3 1YJ93 1N8QA 2RBIA 5JPUA 1UUWB 1VQ43 3CC43 3FSDA 4KZ1A 5M18A 4XDWA 4AKZA 5AIFA 3K63A 3MWZA 3CCS3 2BIRA 3HZPA 2QA43 1C7HA 2RSXA 1LOYA 3B4PA 1DETA 3AHSA 2FGTA 3WDGB 1KC84 2ML5A 3HI7A 1E97A 3IPTA 3AGNA 1WMOA 4GHOA 4RNZA 4EXRA 3DXOA 3S5CA 1VQ63 3K9MC 2WO0A 2YFIB 1D6YA 1W00A 3J7Yd 3T8NA 4HM2B 4XB5A 5HGRA 1RN7A 1YI23 1RHLA 4JRFA 1F8NA 2HMLB 1ISKA 3CMA3 1D6ZA 1YNVX 2XF3A 1TUHA 3CC23 1JKGB 3RDEA 1VZZA 3CPOA 3PGBA 5EQLA 3N54B 1E3VA 2YFJB 2XH9A 3GSPA 4EYCA 4MEIA 5IG0A 3DMCA 1M1K4 5FGOA 2P0XA 3Q2PA 4NHFA 5IG4A 1VQM3 9RNTA 1I2EA 2L4VA 1VQN3 3U1WA 2XGNA 1VQ73 2CFDA 3KZTA 1Y4KA 2F86B 2YFLB 1DYUA 2A15A 1G96A 1IT8A 1LOWA 1W4NA 2K0MA 5CLKA 2H0IA 1K41A 1Q40A 3G4S3 3M8CA 2JDIH 1Q824 3STDA 4XBTA 1RRHA 3F8HA 4RNYA 1YIT3 1YJW3 2BNGA 2Y73A 4HAAA 2Q07A 4FCJA 3T0UA 1RN4A 5JBSA 3KIIA 4X2OA 1RLSA 1JRQA 3Q1CA 2LQVA 1EQKA 4HBRA 2OTJ3 1GOVA 1JBRA 1BRIA 1G02A 1K9M4 4HZBB 2CG1A 2W0QA 1OACA 1US1A 1FGOA 4R80A 1I2GA 2STDA 3EE1A 3HK4A 4FR9A 3CCE3 1N8R4 3PCSA 1TFKA 1B27A 1PYLA 3BIRA 2CH9A 5ELUA 3FG4A 3FG3A 2CFGA 3UL5A 1FGQA 4LEHA 1Z1SA 3OXAA 1IVXA 4N6LA 3D4AA 4FCZA 1W01A 3ZG0A 6GSPA 4Q53A 3VSYA 3WOEB 4TX4A 2F98A 1K8A4 1GYBA 1MGRA 1GY7A 1B2MA 3V92A 1TP6A 1GOYA 3EB8A 5CK6A 4I5QA 1ROAA 4AEQA 1GOUA 3MG2A 2F5MA 1JKGA 1ZX2A 1Q9EA 3KFQC 1TRPA 2HMMB 3X40A 1VQL3 4FMCA 1UW1A 4BTWA 3DGMA 1X1UA 4FMDA 2AAEA 1RCKA 3K5TA 5RNTA 1ZGXA 2PZVA 2M7OA 3S67A 1U5OA 5BVBA 7GSPA 3EX9A 2Y74A 1Q814 3O8YA 1UI8A 3D5GA 3URPA 1OGXA 3ZFZA 1S5AA 4HM5B 3B4OA 2HMNB 3HIIA 4K1UA 5I97A 3SVAA 2C4BA 3F40A 1FUWA 3TDGA 4IT7A 4X2HA 1ROVA 5BU4A 1MWSA 1WMPA 2XR8B 3GZYB 1B2XA 1S723 3SOYA 1TRQA 1W2B2 1KQS2 1TIJA 1GY5A 1IVVA 1IVWA 1ULIB 1BSBA 1O7PB 2E2UA 4WYKB 3RGAA 1VQ53 1QVF2 4MJDA 5KP4A 3Q90A 1IQYA 1DVDA 3WA2X 3G0KA 4BL2A 1K734 2B1XB 2WGQA 3MYTA 1NB3I 4BTXA 1UUGB 2XGLA 4HM4B 3Q3FA 2IUKA 3NHXA 3LTCA 4HM1B 1RRLA 1RNTA 2BU4A 3EN1B 4WFOA 4KFFA 1N9EA 3MHEA 1RGCA 3FLJA 5IG3A 1MWTA 2Z76A 1QALA 3EBYA 1RGAA 4HM3B 4KFDA 3NBRA 2FXTA 2C10A 3D79A 4MMXB 5AYRB 4CDLA 3I563 2QIYA 3NBJA 4U13A 1DMMA 3SXXA 2BHMA 1IQ8A 3GZRA 3KCHA 1PFPA 1OHPA 1T2IA 5GSPA 1BRGA 4IIAA 5AI1A 2CX0A 1SIIA 2L1SA 1SJWA 1N5HA 1RGEA 2GBWB 1M1XB 1D6UA 1O7GB 1Q7HA 2GXFA 3PXMA 4CPKA 4MMZB 1DE3A 5ELJA 3DZLA 4GL6A 1JZOA 1JBSA 3OV4A 1NU3A 4J9AA 1KD14 1R4YA 4IPBA 1WQLB 2KF4A 4H61A 1RGLA 2CFWA 4N6OB 1UCLA 5A0OB 1YJN3 3NM2A 1OGZA 3H3HA 1LOVA 1FA3A 1R4CA 3PCRA 1JB2A 1O7HB 2E2VA 2K3DA 4HM7B 5CF1A 4LZIA 3ECFA 3AMOB 4NPBA 3N8BA 3G6E3 1HKXA 4BU4A 1YVSA 1EG9B 3G713 3JUMA 5IF6A 1JB5A 3DGLA 5TGNA 1FGMA 1BAOA 1BVIA 3CCM3 3EC9A 5IW9A 3DUKA 1WMNA 3PZWA 1IYYA 2CWUA 1LNIA 1L5GB 2AADA 1K28A 5CF2A 4WYKA 2OTL3 2O9UX 2WOFA 3GZXB 3MPHA 2ZHXB 3CXC2 3E99A 2UUGC 1NO3A 1RN1A 2SBLA 3LOYA 1CQSA 4HZ9B 2XEPA 1B3SA 1SIHA 3D5IA 1JN5B 2XFTA 4QWTA 4R9KA 2YX9A 5AEUB 1I8VA 2KRTA 3V99A 1FW7A 1SQWA 1W7CA 2OWPA 2WGOA 3HIGA 3WMDA 4CJNA 1Q7Y4 2UGIA 2F4YA 1X1XA 4MMYB 1QAKA 3QK9A 3BNCA 2F56A 3ZG5A 1BSDA 1O7WB 3EN8A 1QVG2 2GBXB 1FGTA 3RGRA 4N6UA 1GMPA 1YVBI 3FF2A 3LYGA 5LC7A 5HOHA 3JUNA 1BRSA 1STDA 3NX0A 3MSOA 1W6CA 2BMQB 5IENA 4O2HA 4JF8A 3A76A 3DM8A 1CYVA 2OCTA 3NXJA 4LSOA 1UDII 2RGQA 3SLUA 5JPPA 2CIUA 1UI7A 2ML6A 3PYJA 3HOHA 2GEYA 5AEWB 3CME3 5M1AA 3IMAB 4ZM8A 3K0ZA 3X3ZA 1OPYA 5AIGA 1QJGA 3PS8A 1X1YA 3MKIA 5FW5A 3KSED 8RNTA 1FUSA 1SPUA 1N5PA 5BIRA 2P09A 2P0MA 2W04A 4GSPA 1GMRA 1BU4A 2WOHA 3S27A 1IDPA 1IVUA 1JZDA 1I3FA 3X3XA 3I553 1BSAA 3DH2A 1QAFA 5IG5A 3JUPA 1MNLA 1B20A 1BOXA 1I2FA 2INXA 3IJEB 3NBBA 4N6V0 7STDA 1A2KA 5BXQA 2P05A 3BNBA 2Z7AA 2ZA4A 1RGGA 2V1LA 3FG1A 3LZAA 4KVHA 5D81A 5M19A 1Q42A 3H51A 4HM6B 1BANA 2MF7A 4BL3A 1T5YA 2GU3A 4K61A 1AQZA 4H3UA 3JUOA 1EUIC
chains in the Genus database with same CATH topology
2PNCA 2I9WA 3GRDA 2CFLA 1GD4A 4J8TA 3NQYA 2CC3A 1O7MB 4XM4A 1NWWA 3CNMA 2UX0A 3NUVA 2B24B 3D3LA 2CK3H 4XBYA 2OQEC 1RKYA 5IEOA 1UUVB 4EBGA 4K1VA 3ER7A 3CCU3 3F14A 1GD3A 4PEJA 3OX9A 2W56B 2OOVC 1ULJB 5EVHA 3EJVA 2QEX3 1KWIA 1E3RA 4L8OA 3ALAA 4WHAA 4EC6A 2FNQA 3G16A 1M9GA 3NV0B 1LXEA 3X42A 1VQ83 1ASKA 4HJLB 3CD63 1OHSA 3JVCA 4XDVA 3F8XA 1VQP3 1OHOA 3NQZA 4HVNA 1IQXA 1U8CB 2CHCA 3N9HA 3LMLA 1RJOA 3B8LA 3JUQA 3B7CA 4X2OA 2O3OA 3SEDA 3FKAA 4R4KA 4K90B 1IU7A 4O02B 1STFI 4FCMA 1GS3A 3G8ZA 1W02A 2R4IA 3CCV3 2W9QA 3FZWA 2GU1A 5DRVA 3VF1A 3WODG 3F7SA 2ZDJA 1FGRA 3F9SA 2RFRA 3WOFB 2Z6BA 3OW22 5LC6A 1JB4A 2BT3A 2BMOB 1YIJ3 1NB5I 1M904 2K54A 2W56A 3LH4A 1LNHA 1WTHA 2W9PA 1IV7A 3CPW2 1W6YA 3OWYA 4KFEA 1MOLA 2XRXB 3D9RA 1DMNA 1DMQA 1VQ93 3DGNA 2ZL8A 4L8PA 1TFOA 3OWSA 3BB9A 3DGOA 1W2ZA 3FF0A 3S29A 3NV0A 3FGYA 4OVMA 3V98A 3CCL3 3MG1A 1NJI4 2KCDA 2HMJB 3BNEA 3OWUA 4OUQA 2D1WA 1A2VA 2BO9B 4HM0B 2BMRB 5D82A 4WWUC 4N6MA 1AR0A 3I0YA 3MG3A 4HM8B 1W5ZA 3S28A 3U97A 3T8UA 4NREA 1J2BA 1AVLA 1CEWI 1WNHA 1TU5A 3KSPA 4N6NB 4L7KA 2RCDA 3UJMA 2OQEA 1HU9A 1OF5B 2C11A 4OK0A 2F99A 2QGUA 4GB5A 2CG0A 2W6JH 2IA7A 3AMOA 3CNXA 3GZBA 4HKVB 2XSOB 4I4KA 1YGEA 1AV4A 2OOVA 2IMJA 3KKGA 1IT7A 3LTBA 4O3VA 5IEPA 3EHCA 3SX1A 4BTYA 3CC73 4CCVA 5G2GA 3X41A 3CCJ3 3UNLA 1LOXA 1AVKA 2LYXA 2P38A 2XSHB 1OH0A 2CWVA 3EF8A 4N6TA 2CW9A 4WP5A 4LGQA 1KD14 4R1KA 3SOAA 3FH1A 4RZMA 5AIIA 2HMKB 1JN5A 5D83A 2W2CA 1O7NB 1LVNA 3UL6A 3VGNA 5IERA 4STDA 1A90A 4FMBA 5AYSC 3CCQ3 3F7XA 3EQQB 2GEXA 1GY6A 3LT8A 1W6GA 1YHQ3 8CHOA 1IV9A 3WA3A 4AKYA 1EKMA 3BNDA 1ZO2A 4EV2A 1EA2A 5DREA 1IK3A 1PU4A 1OCVA 2D42A 1QMAA 3DY5A 2Z77A 5STDA 2MC8A 2IUJA 4FMAA 3LTAA 6STDA 2W03A 3KE7A 4G1MB 3LXUX 4XBXA 3K7CA 2HMOB 3KN4A 3NM7A 1N9JA 4N3VA 5AIHA 1CYUA 3CCR3 2JQ5A 3FCSB 5KP1A 3GAXA 2CWTA 3EBTA 1OUNA 3ROBA 2CFKA 1OF5A 4O8SA 3CU3A 4HYZA 2KXGA 1JJ22 1JV2B 3BLZA 3GWRA 1A67A 5CXOA 3LTDA 3X3YA 1JNQA 5KP3A 1NDOB 1BUQA 1Q40B 4R9LA 2E2TA 5EEOA 4EV5A 1DVCA 3UB1A 1Q864 1VQK3 1KSIA 1V74A 4LMIA 4RBNA 4ORLA 3HX8A 2XFSA 3QRDA 3L0RA 3LT9A 1YJ93 1VQO3 1N8QA 5JPUA 1UUWB 1VQ43 3CC43 3FSDA 4KZ1A 4XDWA 4AKZA 5AIFA 3K63A 3MWZA 3CCS3 3HZPA 2QA43 1C7HA 2RSXA 3B4PA 3WDGB 1KC84 2FGTA 2ML5A 3HI7A 1E97A 3IPTA 4RNZA 1WMOA 4EXRA 3DXOA 3S5CA 1VQ63 3K9MC 2WO0A 2YFIB 1D6YA 1W00A 3J7Yd 3T8NA 4HM2B 4XB5A 5HGRA 1RN7A 1YI23 4JRFA 1F8NA 2HMLB 1ISKA 3CMA3 1D6ZA 2XF3A 3CC23 1TUHA 1JKGB 3RDEA 1VZZA 3CPOA 3PGBA 5EQLA 3N54B 1E3VA 2YFJB 2XH9A 4EYCA 4MEIA 5IG0A 3DMCA 1M1K4 5FGOA 2P0XA 3Q2PA 4NHFA 5IG4A 1VQM3 2L4VA 1VQN3 3U1WA 2XGNA 1VQ73 2CFDA 3KZTA 1Y4KA 2F86B 2YFLB 1DYUA 2A15A 1G96A 1IT8A 1W4NA 2K0MA 5CLKA 1K41A 1Q40A 3G4S3 3M8CA 2JDIH 1Q824 3STDA 4XBTA 1RRHA 3F8HA 4RNYA 1YIT3 1YJW3 2BNGA 2Y73A 2Q07A 4FCJA 3T0UA 5JBSA 3KIIA 1JRQA 3Q1CA 2LQVA 1EQKA 4HBRA 2OTJ3 1K9M4 4HZBB 2CG1A 2W0QA 1OACA 1US1A 1FGOA 4R80A 2STDA 3HK4A 3EE1A 4FR9A 3CCE3 1N8R4 3PCSA 1TFKA 2CH9A 5ELUA 3FG4A 3FG3A 2CFGA 3UL5A 1FGQA 4LEHA 1Z1SA 3OXAA 1IVXA 4N6LA 4FCZA 1W01A 4Q53A 3VSYA 3WOEB 4TX4A 2F98A 1K8A4 1GYBA 1GY7A 3V92A 1TP6A 3EB8A 5CK6A 1ROAA 4AEQA 3MG2A 1JKGA 1ZX2A 3X40A 3KFQC 2HMMB 1VQL3 4FMCA 1UW1A 4BTWA 3DGMA 4FMDA 3K5TA 2PZVA 2M7OA 3S67A 1U5OA 5BVBA 3EX9A 2Y74A 1Q814 3O8YA 1UI8A 1OGXA 1S5AA 4HM5B 3B4OA 2HMNB 3HIIA 4K1UA 5I97A 3SVAA 3F40A 1FUWA 3TDGA 4IT7A 4X2HA 1ROVA 1WMPA 3GZYB 1S723 3SOYA 1W2B2 1KQS2 1TIJA 1GY5A 1IVVA 1IVWA 1ULIB 2E2UA 1O7PB 4WYKB 3RGAA 1VQ53 1QVF2 4MJDA 5KP4A 3Q90A 1IQYA 1DVDA 3WA2X 3G0KA 1K734 2B1XB 2WGQA 3MYTA 1NB3I 4BTXA 2XGLA 4HM4B 2IUKA 3NHXA 3LTCA 4HM1B 1RRLA 3EN1B 4WFOA 4KFFA 1N9EA 3MHEA 5IG3A 3FLJA 2Z76A 1QALA 3EBYA 4HM3B 4KFDA 3NBRA 2FXTA 2C10A 4MMXB 5AYRB 4CDLA 3I563 2QIYA 3NBJA 4U13A 1DMMA 3SXXA 2BHMA 1IQ8A 3GZRA 1PFPA 1OHPA 4IIAA 5AI1A 1SIIA 1SJWA 1N5HA 2GBWB 1M1XB 1D6UA 1O7GB 2GXFA 3PXMA 4MMZB 5ELJA 3DZLA 4GL6A 3OV4A 1NU3A 4J9AA 4IPBA 1WQLB 4H61A 2CFWA 1YJN3 4N6OB 5A0OB 3NM2A 1OGZA 3H3HA 1FA3A 1R4CA 3PCRA 1JB2A 1O7HB 2E2VA 4HM7B 5CF1A 4LZIA 3ECFA 3AMOB 3N8BA 3G6E3 1HKXA 1EG9B 3G713 3JUMA 5IF6A 1JB5A 3DGLA 5TGNA 1FGMA 3CCM3 3EC9A 5IW9A 3DUKA 1WMNA 3PZWA 2CWUA 1L5GB 1K28A 5CF2A 4WYKA 2OTL3 2O9UX 2WOFA 3GZXB 3MPHA 3CXC2 3E99A 1NO3A 2SBLA 3LOYA 1CQSA 4HZ9B 2XEPA 1SIHA 1JN5B 2XFTA 4QWTA 4R9KA 2YX9A 5AEUB 3V99A 2KRTA 1SQWA 1W7CA 2OWPA 2WGOA 3HIGA 3WMDA 1Q7Y4 4MMYB 1QAKA 3QK9A 3BNCA 1QVG2 1O7WB 3EN8A 2GBXB 1FGTA 3RGRA 4N6UA 3FF2A 1YVBI 3LYGA 5LC7A 3JUNA 1STDA 3NX0A 3MSOA 1W6CA 2BMQB 5IENA 4O2HA 4JF8A 3A76A 3DM8A 1CYVA 2OCTA 3NXJA 4LSOA 2RGQA 3SLUA 5JPPA 2CIUA 1UI7A 2ML6A 3PYJA 2GEYA 5AEWB 3CME3 3IMAB 4ZM8A 3K0ZA 3X3ZA 1OPYA 5AIGA 1QJGA 3PS8A 3MKIA 5FW5A 3KSED 1SPUA 1N5PA 2P09A 2P0MA 2W04A 2WOHA 3S27A 1IDPA 1IVUA 3X3XA 3I553 5IG5A 1QAFA 3JUPA 1MNLA 3IJEB 2INXA 3NBBA 4N6V0 7STDA 1A2KA 5BXQA 2P05A 3BNBA 2Z7AA 3FG1A 3LZAA 2V1LA 4KVHA 5D81A 1Q42A 3H51A 4HM6B 2MF7A 1T5YA 2GU3A 4K61A 2XR8B 4H3UA 3JUOA 2CKFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9W A;  3GRD A;  4J8T A;  1O7M B;  4XM4 A;  1NWW A;  3CNM A;  2UX0 A;  3NUV A;  2B24 B;  4XBY A;  5IEO A;  1UUV B;  4K1V A;  3ER7 A;  3F14 A;  4PEJ A;  3OX9 A;  1ULJ B;  5EVH A;  3EJV A;  1E3R A;  4L8O A;  3G16 A;  3NV0 B;  1ASK A;  4HJL B;  1OHS A;  4XDV A;  3F8X A;  1OHO A;  4HVN A;  2CHC A;  4X2O A;  3JUQ A;  3B8L A;  3B7C A;  3SED A;  3FKA A;  4FCM A;  1GS3 A;  3G8Z A;  1W02 A;  2R4I A;  3FZW A;  5DRV A;  3F7S A;  3F9S A;  2RFR A;  1JB4 A;  2BMO B;  2K54 A;  1W6Y A;  3OWY A;  2XRX B;  3D9R A;  1DMN A;  1DMQ A;  4L8P A;  3OWS A;  3BB9 A;  3FF0 A;  3NV0 A;  3FGY A;  4OVM A;  3MG1 A;  2HMJ B;  3OWU A;  4OUQ A;  4HM0 B;  2BMR B;  5D82 A;  4WWU C;  1AR0 A;  3I0Y A;  3MG3 A;  4HM8 B;  3T8U A;  3KSP A;  4L7K A;  2RCD A;  3UJM A;  1OF5 B;  2F99 A;  2QGU A;  4GB5 A;  3CNX A;  4HKV B;  3GZB A;  2XSO B;  4I4K A;  2IMJ A;  3KKG A;  5IEP A;  3EHC A;  5G2G A;  3UNL A;  2XSH B;  1OH0 A;  4WP5 A;  3EF8 A;  4LGQ A;  4R1K A;  3SOA A;  3FH1 A;  4RZM A;  5AII A;  2HMK B;  1JN5 A;  5D83 A;  2W2C A;  1O7N B;  3VGN A;  5IER A;  4STD A;  3EQQ B;  2GEX A;  1GY6 A;  8CHO A;  1ZO2 A;  1EA2 A;  5DRE A;  1OCV A;  1QMA A;  2Z77 A;  5STD A;  6STD A;  3KE7 A;  4XBX A;  3K7C A;  2HMO B;  4N3V A;  5AIH A;  2JQ5 A;  5KP1 A;  3EBT A;  1OUN A;  3ROB A;  1OF5 A;  3CU3 A;  3BLZ A;  3GWR A;  5CXO A;  5KP3 A;  1NDO B;  1BUQ A;  1Q40 B;  4R9L A;  4LMI A;  4ORL A;  3HX8 A;  5JPU A;  1UUW B;  3FSD A;  4XDW A;  5AIF A;  3HZP A;  1C7H A;  3B4P A;  1E97 A;  3IPT A;  3DXO A;  3S5C A;  2YFI B;  1W00 A;  3T8N A;  4HM2 B;  5HGR A;  4XB5 A;  1ISK A;  2HML B;  1TUH A;  1JKG B;  1VZZ A;  3CPO A;  1E3V A;  2YFJ B;  5IG0 A;  3DMC A;  5IG4 A;  3KZT A;  2F86 B;  2YFL B;  2A15 A;  5CLK A;  1K41 A;  1Q40 A;  3M8C A;  3STD A;  4XBT A;  3F8H A;  2BNG A;  4FCJ A;  4HZB B;  2STD A;  3HK4 A;  4LEH A;  1Z1S A;  3OXA A;  1W01 A;  4Q53 A;  3VSY A;  2F98 A;  1GYB A;  1GY7 A;  1TP6 A;  5CK6 A;  3MG2 A;  1JKG A;  1ZX2 A;  2HMM B;  2PZV A;  1U5O A;  5BVB A;  3EX9 A;  1OGX A;  1S5A A;  4HM5 B;  3B4O A;  2HMN B;  4K1U A;  3F40 A;  4X2H A;  2XR8 B;  3GZY B;  3SOY A;  1GY5 A;  4WYK B;  1ULI B;  1O7P B;  3RGA A;  4MJD A;  5KP4 A;  3Q90 A;  3G0K A;  2B1X B;  3MYT A;  4HM4 B;  3NHX A;  4HM1 B;  3EN1 B;  3MHE A;  5IG3 A;  3FLJ A;  2Z76 A;  3EBY A;  4HM3 B;  3NBR A;  4CDL A;  2QIY A;  4U13 A;  1DMM A;  3GZR A;  1OHP A;  4IIA A;  5AI1 A;  1SJW A;  2GBW B;  1O7G B;  2GXF A;  3DZL A;  3OV4 A;  1NU3 A;  4J9A A;  1WQL B;  3NM2 A;  1OGZ A;  3H3H A;  5CF1 A;  1JB2 A;  1O7H B;  4HM7 B;  3ECF A;  1HKX A;  1EG9 B;  3JUM A;  5IF6 A;  1JB5 A;  5TGN A;  3EC9 A;  3DUK A;  5CF2 A;  4WYK A;  3GZX B;  3E99 A;  1CQS A;  4HZ9 B;  1JN5 B;  5AEU B;  4R9K A;  2OWP A;  3WMD A;  1O7W B;  3EN8 A;  2GBX B;  3RGR A;  3FF2 A;  3LYG A;  3JUN A;  1STD A;  3MSO A;  2BMQ B;  5IEN A;  3A76 A;  3DM8 A;  3NXJ A;  2RGQ A;  5JPP A;  2GEY A;  5AEW B;  3K0Z A;  1OPY A;  5AIG A;  1QJG A;  3MKI A;  5FW5 A;  1IDP A;  5IG5 A;  3JUP A;  2INX A;  7STD A;  1A2K A;  5BXQ A;  2Z7A A;  3LZA A;  4KVH A;  5D81 A;  1Q42 A;  3H51 A;  4HM6 B;  3F7X A;  4H3U A;  3JUO A;  2CKF B; 
#chains in the Genus database with same CATH topology
 2PNC A;  2I9W A;  1HYF A;  3GRD A;  1RGF A;  2CFL A;  1GD4 A;  1I70 A;  4J8T A;  3NQY A;  2CC3 A;  1O7M B;  4XM4 A;  1NWW A;  3CNM A;  2UX0 A;  1LQM B;  3NUV A;  2B24 B;  3D3L A;  2CK3 H;  4XBY A;  1FUT A;  2CX1 A;  2OQE C;  1RKY A;  5IEO A;  1UUV B;  4EBG A;  4K1V A;  3ER7 A;  3CCU 3;  3F14 A;  1GD3 A;  4PEJ A;  3OX9 A;  1RSN A;  2W56 B;  3AGO A;  2OOV C;  5G1L A;  1ULJ B;  5EVH A;  3EJV A;  2QEX 3;  1KWI A;  3SYU A;  1E3R A;  4L8O A;  3ALA A;  1LQG C;  4WHA A;  1T2H A;  4EC6 A;  2FNQ A;  3G16 A;  1M9G A;  3NV0 B;  1LXE A;  1BIR A;  3X42 A;  1VQ8 3;  1VQQ A;  1ASK A;  3AHW A;  4HJL B;  3CD6 3;  1OHS A;  2KF5 A;  3JVC A;  4XDV A;  1AY7 A;  3F8X A;  1VQP 3;  1OHO A;  1BNR A;  3NQZ A;  4HVN A;  1IQX A;  1U8C B;  2CHC A;  1JBT A;  3N9H A;  3LML A;  1RJO A;  1EEJ A;  3B8L A;  3B7C A;  1BNJ A;  1BSE A;  1FYS A;  2O3O A;  3JUQ A;  3SED A;  2SAR A;  3FKA A;  4R4K A;  4K90 B;  1IU7 A;  1YGW A;  4O02 B;  1RDS A;  1STF I;  4FCM A;  1GS3 A;  2F5W A;  3G8Z A;  1W02 A;  2R4I A;  3CCV 3;  2W9Q A;  1RGK A;  3FZW A;  2GU1 A;  2RNT A;  5DRV A;  1B2U A;  3VF1 A;  3WOD G;  1FZU A;  3F7S A;  2ZDJ A;  1FGR A;  3F9S A;  2IYJ A;  2RFR A;  1BNG A;  3WOF B;  1B21 A;  2Z6B A;  3OW2 2;  1RMS A;  2H0H A;  1RGH A;  5LC6 A;  1JB4 A;  2BT3 A;  2BMO B;  1YIJ 3;  1NB5 I;  1M90 4;  2K54 A;  1GMQ A;  1RTU A;  1BNE A;  2W56 A;  1LNH A;  1WTH A;  2W9P A;  1IV7 A;  3LH4 A;  3CPW 2;  1W6Y A;  3OWY A;  1BRH A;  2GSP A;  1NNV A;  1G0T A;  4KFE A;  1MOL A;  2XRX B;  1BNS A;  3D9R A;  1DMN A;  1DMQ A;  1ZS7 A;  3DGN A;  3WHO A;  2ZL8 A;  4L8P A;  1VQ9 3;  1TFO A;  1MWU A;  3OWS A;  3BB9 A;  3DGO A;  4LYL B;  2J8X B;  1W2Z A;  3FF0 A;  3S29 A;  1BNF A;  3NV0 A;  3FGY A;  3RNT A;  1BUJ A;  4OVM A;  3V98 A;  3CCL 3;  1T3B A;  1V57 A;  3MG1 A;  1NJI 4;  2KCD A;  2HMJ B;  3BNE A;  1B2S A;  3OWU A;  4OUQ A;  2D1W A;  1B2Z A;  1A2V A;  2BO9 B;  4HM0 B;  2BMR B;  5D82 A;  4WWU C;  4N6M A;  1AR0 A;  3I0Y A;  3MG3 A;  4HM8 B;  1W5Z A;  3S28 A;  7RNT A;  3U97 A;  2CKF B;  3T8U A;  4NRE A;  1J2B A;  1AVL A;  4HOH A;  1CEW I;  1WNH A;  1TU5 A;  3KSP A;  1BSC A;  4N6N B;  4L7K A;  2RCD A;  3UJM A;  2OQE A;  1HU9 A;  1OF5 B;  2C11 A;  4OK0 A;  2F99 A;  2QGU A;  4GB5 A;  2CG0 A;  2W6J H;  2IA7 A;  3AMO A;  3CNX A;  3GZB A;  4HKV B;  1V58 A;  2XSO B;  4I4K A;  4J5K A;  4DKI A;  1RNB A;  4J5G A;  1YGE A;  1UCK A;  4KT3 B;  1AV4 A;  4BIR A;  2OOV A;  2IMJ A;  3KKG A;  1IT7 A;  3LTB A;  4O3V A;  5IEP A;  1MWR A;  3EHC A;  3SX1 A;  4BTY A;  3CC7 3;  4CCV A;  5G2G A;  3X41 A;  3CCJ 3;  3UNL A;  1UCJ A;  1CH0 A;  2KAA A;  1I0V A;  1LOX A;  1AVK A;  1BRJ A;  1I3I A;  2LYX A;  2P38 A;  2XSH B;  1OH0 A;  2CWV A;  3EF8 A;  4N6T A;  2CW9 A;  4WP5 A;  1SAR A;  1BRK A;  4LGQ A;  2KF6 A;  4R1K A;  3SOA A;  3FH1 A;  4RZM A;  5AII A;  2HMK B;  1JN5 A;  5D83 A;  1RCL A;  2W2C A;  1O7N B;  1LVN A;  3UL6 A;  3VGN A;  5IER A;  1BNI A;  4STD A;  1A90 A;  4FMB A;  5AYS C;  3CCQ 3;  3F7X A;  3EQQ B;  2GEX A;  1GY6 A;  3LT8 A;  1W6G A;  2HOH A;  1YHQ 3;  8CHO A;  1IV9 A;  3WA3 A;  4AKY A;  1EKM A;  1TJD A;  1UGH I;  1ZO2 A;  1EA2 A;  3BND A;  5DRE A;  5G1K A;  4EV2 A;  1IK3 A;  1PU4 A;  1OCV A;  2D42 A;  1QMA A;  3DY5 A;  1BGS A;  2H0G A;  2Z77 A;  1UGI A;  5STD A;  2MC8 A;  1X1W A;  2IUJ A;  4FMA A;  3LTA A;  4EW5 A;  6STD A;  2W03 A;  3KE7 A;  4G1M B;  3LXU X;  4XBX A;  3K7C A;  2HMO B;  3KN4 A;  3NM7 A;  1N9J A;  3DGY A;  4N3V A;  1GSP A;  5AIH A;  1CYU A;  3CCR 3;  2JQ5 A;  2KF3 A;  3FCS B;  1MGW A;  5KP1 A;  1I0X A;  3GAX A;  2CWT A;  3EBT A;  1OUN A;  3WR2 A;  1UCI A;  3ROB A;  2CFK A;  4ILF A;  3BU4 A;  1OF5 A;  1BRN L;  4O8S A;  1C54 A;  3CU3 A;  4HYZ A;  6RNT A;  2KXG A;  1JJ2 2;  1JV2 B;  1A2P A;  1LRA A;  3BLZ A;  3GWR A;  1A67 A;  5CXO A;  3LTD A;  3X3Y A;  1JNQ A;  1HZ1 A;  1PY3 A;  5KP3 A;  1NDO B;  1BUQ A;  1Q40 B;  4R9L A;  2E2T A;  5EEO A;  2IY2 A;  4EV5 A;  1DVC A;  3UB1 A;  1Q86 4;  1VQK 3;  1KSI A;  1V74 A;  2R41 A;  4LMI A;  4RBN A;  4ORL A;  1TTO A;  3HX8 A;  2XFS A;  3QRD A;  3L0R A;  3LT9 A;  3A5E A;  4RNT A;  1VQO 3;  1YJ9 3;  1N8Q A;  2RBI A;  5JPU A;  1UUW B;  1VQ4 3;  3CC4 3;  3FSD A;  4KZ1 A;  5M18 A;  4XDW A;  4AKZ A;  5AIF A;  3K63 A;  3MWZ A;  3CCS 3;  2BIR A;  3HZP A;  2QA4 3;  1C7H A;  2RSX A;  1LOY A;  3B4P A;  1DET A;  3AHS A;  2FGT A;  3WDG B;  1KC8 4;  2ML5 A;  3HI7 A;  1E97 A;  3IPT A;  3AGN A;  1WMO A;  4GHO A;  4RNZ A;  4EXR A;  3DXO A;  3S5C A;  1VQ6 3;  3K9M C;  2WO0 A;  2YFI B;  1D6Y A;  1W00 A;  3J7Y d;  3T8N A;  4HM2 B;  4XB5 A;  5HGR A;  1RN7 A;  1YI2 3;  1RHL A;  4JRF A;  1F8N A;  2HML B;  1ISK A;  3CMA 3;  1D6Z A;  1YNV X;  2XF3 A;  1TUH A;  3CC2 3;  1JKG B;  3RDE A;  1VZZ A;  3CPO A;  3PGB A;  5EQL A;  3N54 B;  1E3V A;  2YFJ B;  2XH9 A;  3GSP A;  4EYC A;  4MEI A;  5IG0 A;  3DMC A;  1M1K 4;  5FGO A;  2P0X A;  3Q2P A;  4NHF A;  5IG4 A;  1VQM 3;  9RNT A;  1I2E A;  2L4V A;  1VQN 3;  3U1W A;  2XGN A;  1VQ7 3;  2CFD A;  3KZT A;  1Y4K A;  2F86 B;  2YFL B;  1DYU A;  2A15 A;  1G96 A;  1IT8 A;  1LOW A;  1W4N A;  2K0M A;  5CLK A;  2H0I A;  1K41 A;  1Q40 A;  3G4S 3;  3M8C A;  2JDI H;  1Q82 4;  3STD A;  4XBT A;  1RRH A;  3F8H A;  4RNY A;  1YIT 3;  1YJW 3;  2BNG A;  2Y73 A;  4HAA A;  2Q07 A;  4FCJ A;  3T0U A;  1RN4 A;  5JBS A;  3KII A;  4X2O A;  1RLS A;  1JRQ A;  3Q1C A;  2LQV A;  1EQK A;  4HBR A;  2OTJ 3;  1GOV A;  1JBR A;  1BRI A;  1G02 A;  1K9M 4;  4HZB B;  2CG1 A;  2W0Q A;  1OAC A;  1US1 A;  1FGO A;  4R80 A;  1I2G A;  2STD A;  3EE1 A;  3HK4 A;  4FR9 A;  3CCE 3;  1N8R 4;  3PCS A;  1TFK A;  1B27 A;  1PYL A;  3BIR A;  2CH9 A;  5ELU A;  3FG4 A;  3FG3 A;  2CFG A;  3UL5 A;  1FGQ A;  4LEH A;  1Z1S A;  3OXA A;  1IVX A;  4N6L A;  3D4A A;  4FCZ A;  1W01 A;  3ZG0 A;  6GSP A;  4Q53 A;  3VSY A;  3WOE B;  4TX4 A;  2F98 A;  1K8A 4;  1GYB A;  1MGR A;  1GY7 A;  1B2M A;  3V92 A;  1TP6 A;  1GOY A;  3EB8 A;  5CK6 A;  4I5Q A;  1ROA A;  4AEQ A;  1GOU A;  3MG2 A;  2F5M A;  1JKG A;  1ZX2 A;  1Q9E A;  3KFQ C;  1TRP A;  2HMM B;  3X40 A;  1VQL 3;  4FMC A;  1UW1 A;  4BTW A;  3DGM A;  1X1U A;  4FMD A;  2AAE A;  1RCK A;  3K5T A;  5RNT A;  1ZGX A;  2PZV A;  2M7O A;  3S67 A;  1U5O A;  5BVB A;  7GSP A;  3EX9 A;  2Y74 A;  1Q81 4;  3O8Y A;  1UI8 A;  3D5G A;  3URP A;  1OGX A;  3ZFZ A;  1S5A A;  4HM5 B;  3B4O A;  2HMN B;  3HII A;  4K1U A;  5I97 A;  3SVA A;  2C4B A;  3F40 A;  1FUW A;  3TDG A;  4IT7 A;  4X2H A;  1ROV A;  5BU4 A;  1MWS A;  1WMP A;  2XR8 B;  3GZY B;  1B2X A;  1S72 3;  3SOY A;  1TRQ A;  1W2B 2;  1KQS 2;  1TIJ A;  1GY5 A;  1IVV A;  1IVW A;  1ULI B;  1BSB A;  1O7P B;  2E2U A;  4WYK B;  3RGA A;  1VQ5 3;  1QVF 2;  4MJD A;  5KP4 A;  3Q90 A;  1IQY A;  1DVD A;  3WA2 X;  3G0K A;  4BL2 A;  1K73 4;  2B1X B;  2WGQ A;  3MYT A;  1NB3 I;  4BTX A;  1UUG B;  2XGL A;  4HM4 B;  3Q3F A;  2IUK A;  3NHX A;  3LTC A;  4HM1 B;  1RRL A;  1RNT A;  2BU4 A;  3EN1 B;  4WFO A;  4KFF A;  1N9E A;  3MHE A;  1RGC A;  3FLJ A;  5IG3 A;  1MWT A;  2Z76 A;  1QAL A;  3EBY A;  1RGA A;  4HM3 B;  4KFD A;  3NBR A;  2FXT A;  2C10 A;  3D79 A;  4MMX B;  5AYR B;  4CDL A;  3I56 3;  2QIY A;  3NBJ A;  4U13 A;  1DMM A;  3SXX A;  2BHM A;  1IQ8 A;  3GZR A;  3KCH A;  1PFP A;  1OHP A;  1T2I A;  5GSP A;  1BRG A;  4IIA A;  5AI1 A;  2CX0 A;  1SII A;  2L1S A;  1SJW A;  1N5H A;  1RGE A;  2GBW B;  1M1X B;  1D6U A;  1O7G B;  1Q7H A;  2GXF A;  3PXM A;  4CPK A;  4MMZ B;  1DE3 A;  5ELJ A;  3DZL A;  4GL6 A;  1JZO A;  1JBS A;  3OV4 A;  1NU3 A;  4J9A A;  1KD1 4;  1R4Y A;  4IPB A;  1WQL B;  2KF4 A;  4H61 A;  1RGL A;  2CFW A;  4N6O B;  1UCL A;  5A0O B;  1YJN 3;  3NM2 A;  1OGZ A;  3H3H A;  1LOV A;  1FA3 A;  1R4C A;  3PCR A;  1JB2 A;  1O7H B;  2E2V A;  2K3D A;  4HM7 B;  5CF1 A;  4LZI A;  3ECF A;  3AMO B;  4NPB A;  3N8B A;  3G6E 3;  1HKX A;  4BU4 A;  1YVS A;  1EG9 B;  3G71 3;  3JUM A;  5IF6 A;  1JB5 A;  3DGL A;  5TGN A;  1FGM A;  1BAO A;  1BVI A;  3CCM 3;  3EC9 A;  5IW9 A;  3DUK A;  1WMN A;  3PZW A;  1IYY A;  2CWU A;  1LNI A;  1L5G B;  2AAD A;  1K28 A;  5CF2 A;  4WYK A;  2OTL 3;  2O9U X;  2WOF A;  3GZX B;  3MPH A;  2ZHX B;  3CXC 2;  3E99 A;  2UUG C;  1NO3 A;  1RN1 A;  2SBL A;  3LOY A;  1CQS A;  4HZ9 B;  2XEP A;  1B3S A;  1SIH A;  3D5I A;  1JN5 B;  2XFT A;  4QWT A;  4R9K A;  2YX9 A;  5AEU B;  1I8V A;  2KRT A;  3V99 A;  1FW7 A;  1SQW A;  1W7C A;  2OWP A;  2WGO A;  3HIG A;  3WMD A;  4CJN A;  1Q7Y 4;  2UGI A;  2F4Y A;  1X1X A;  4MMY B;  1QAK A;  3QK9 A;  3BNC A;  2F56 A;  3ZG5 A;  1BSD A;  1O7W B;  3EN8 A;  1QVG 2;  2GBX B;  1FGT A;  3RGR A;  4N6U A;  1GMP A;  1YVB I;  3FF2 A;  3LYG A;  5LC7 A;  5HOH A;  3JUN A;  1BRS A;  1STD A;  3NX0 A;  3MSO A;  1W6C A;  2BMQ B;  5IEN A;  4O2H A;  4JF8 A;  3A76 A;  3DM8 A;  1CYV A;  2OCT A;  3NXJ A;  4LSO A;  1UDI I;  2RGQ A;  3SLU A;  5JPP A;  2CIU A;  1UI7 A;  2ML6 A;  3PYJ A;  3HOH A;  2GEY A;  5AEW B;  3CME 3;  5M1A A;  3IMA B;  4ZM8 A;  3K0Z A;  3X3Z A;  1OPY A;  5AIG A;  1QJG A;  3PS8 A;  1X1Y A;  3MKI A;  5FW5 A;  3KSE D;  8RNT A;  1FUS A;  1SPU A;  1N5P A;  5BIR A;  2P09 A;  2P0M A;  2W04 A;  4GSP A;  1GMR A;  1BU4 A;  2WOH A;  3S27 A;  1IDP A;  1IVU A;  1JZD A;  1I3F A;  3X3X A;  3I55 3;  1BSA A;  3DH2 A;  1QAF A;  5IG5 A;  3JUP A;  1MNL A;  1B20 A;  1BOX A;  1I2F A;  2INX A;  3IJE B;  3NBB A;  4N6V 0;  7STD A;  1A2K A;  5BXQ A;  2P05 A;  3BNB A;  2Z7A A;  2ZA4 A;  1RGG A;  2V1L A;  3FG1 A;  3LZA A;  4KVH A;  5D81 A;  5M19 A;  1Q42 A;  3H51 A;  4HM6 B;  1BAN A;  2MF7 A;  4BL3 A;  1T5Y A;  2GU3 A;  4K61 A;  1AQZ A;  4H3U A;  3JUO A;  1EUI C; 
#chains in the Genus database with same CATH homology
 2PNC A;  2I9W A;  3GRD A;  2CFL A;  1GD4 A;  4J8T A;  3NQY A;  2CC3 A;  1O7M B;  4XM4 A;  1NWW A;  3CNM A;  2UX0 A;  3NUV A;  2B24 B;  3D3L A;  2CK3 H;  4XBY A;  2OQE C;  1RKY A;  5IEO A;  1UUV B;  4EBG A;  4K1V A;  3ER7 A;  3CCU 3;  3F14 A;  1GD3 A;  4PEJ A;  3OX9 A;  2W56 B;  2OOV C;  1ULJ B;  5EVH A;  3EJV A;  2QEX 3;  1KWI A;  1E3R A;  4L8O A;  3ALA A;  4WHA A;  4EC6 A;  2FNQ A;  3G16 A;  1M9G A;  3NV0 B;  1LXE A;  3X42 A;  1VQ8 3;  1ASK A;  4HJL B;  3CD6 3;  1OHS A;  3JVC A;  4XDV A;  3F8X A;  1VQP 3;  1OHO A;  3NQZ A;  4HVN A;  1IQX A;  1U8C B;  2CHC A;  3N9H A;  3LML A;  1RJO A;  3B8L A;  3JUQ A;  3B7C A;  4X2O A;  2O3O A;  3SED A;  3FKA A;  4R4K A;  4K90 B;  1IU7 A;  4O02 B;  1STF I;  4FCM A;  1GS3 A;  3G8Z A;  1W02 A;  2R4I A;  3CCV 3;  2W9Q A;  3FZW A;  2GU1 A;  5DRV A;  3VF1 A;  3WOD G;  3F7S A;  2ZDJ A;  1FGR A;  3F9S A;  2RFR A;  3WOF B;  2Z6B A;  3OW2 2;  5LC6 A;  1JB4 A;  2BT3 A;  2BMO B;  1YIJ 3;  1NB5 I;  1M90 4;  2K54 A;  2W56 A;  3LH4 A;  1LNH A;  1WTH A;  2W9P A;  1IV7 A;  3CPW 2;  1W6Y A;  3OWY A;  4KFE A;  1MOL A;  2XRX B;  3D9R A;  1DMN A;  1DMQ A;  1VQ9 3;  3DGN A;  2ZL8 A;  4L8P A;  1TFO A;  3OWS A;  3BB9 A;  3DGO A;  1W2Z A;  3FF0 A;  3S29 A;  3NV0 A;  3FGY A;  4OVM A;  3V98 A;  3CCL 3;  3MG1 A;  1NJI 4;  2KCD A;  2HMJ B;  3BNE A;  3OWU A;  4OUQ A;  2D1W A;  1A2V A;  2BO9 B;  4HM0 B;  2BMR B;  5D82 A;  4WWU C;  4N6M A;  1AR0 A;  3I0Y A;  3MG3 A;  4HM8 B;  1W5Z A;  3S28 A;  3U97 A;  3T8U A;  4NRE A;  1J2B A;  1AVL A;  1CEW I;  1WNH A;  1TU5 A;  3KSP A;  4N6N B;  4L7K A;  2RCD A;  3UJM A;  2OQE A;  1HU9 A;  1OF5 B;  2C11 A;  4OK0 A;  2F99 A;  2QGU A;  4GB5 A;  2CG0 A;  2W6J H;  2IA7 A;  3AMO A;  3CNX A;  3GZB A;  4HKV B;  2XSO B;  4I4K A;  1YGE A;  1AV4 A;  2OOV A;  2IMJ A;  3KKG A;  1IT7 A;  3LTB A;  4O3V A;  5IEP A;  3EHC A;  3SX1 A;  4BTY A;  3CC7 3;  4CCV A;  5G2G A;  3X41 A;  3CCJ 3;  3UNL A;  1LOX A;  1AVK A;  2LYX A;  2P38 A;  2XSH B;  1OH0 A;  2CWV A;  3EF8 A;  4N6T A;  2CW9 A;  4WP5 A;  4LGQ A;  1KD1 4;  4R1K A;  3SOA A;  3FH1 A;  4RZM A;  5AII A;  2HMK B;  1JN5 A;  5D83 A;  2W2C A;  1O7N B;  1LVN A;  3UL6 A;  3VGN A;  5IER A;  4STD A;  1A90 A;  4FMB A;  5AYS C;  3CCQ 3;  3F7X A;  3EQQ B;  2GEX A;  1GY6 A;  3LT8 A;  1W6G A;  1YHQ 3;  8CHO A;  1IV9 A;  3WA3 A;  4AKY A;  1EKM A;  3BND A;  1ZO2 A;  4EV2 A;  1EA2 A;  5DRE A;  1IK3 A;  1PU4 A;  1OCV A;  2D42 A;  1QMA A;  3DY5 A;  2Z77 A;  5STD A;  2MC8 A;  2IUJ A;  4FMA A;  3LTA A;  6STD A;  2W03 A;  3KE7 A;  4G1M B;  3LXU X;  4XBX A;  3K7C A;  2HMO B;  3KN4 A;  3NM7 A;  1N9J A;  4N3V A;  5AIH A;  1CYU A;  3CCR 3;  2JQ5 A;  3FCS B;  5KP1 A;  3GAX A;  2CWT A;  3EBT A;  1OUN A;  3ROB A;  2CFK A;  1OF5 A;  4O8S A;  3CU3 A;  4HYZ A;  2KXG A;  1JJ2 2;  1JV2 B;  3BLZ A;  3GWR A;  1A67 A;  5CXO A;  3LTD A;  3X3Y A;  1JNQ A;  5KP3 A;  1NDO B;  1BUQ A;  1Q40 B;  4R9L A;  2E2T A;  5EEO A;  4EV5 A;  1DVC A;  3UB1 A;  1Q86 4;  1VQK 3;  1KSI A;  1V74 A;  4LMI A;  4RBN A;  4ORL A;  3HX8 A;  2XFS A;  3QRD A;  3L0R A;  3LT9 A;  1YJ9 3;  1VQO 3;  1N8Q A;  5JPU A;  1UUW B;  1VQ4 3;  3CC4 3;  3FSD A;  4KZ1 A;  4XDW A;  4AKZ A;  5AIF A;  3K63 A;  3MWZ A;  3CCS 3;  3HZP A;  2QA4 3;  1C7H A;  2RSX A;  3B4P A;  3WDG B;  1KC8 4;  2FGT A;  2ML5 A;  3HI7 A;  1E97 A;  3IPT A;  4RNZ A;  1WMO A;  4EXR A;  3DXO A;  3S5C A;  1VQ6 3;  3K9M C;  2WO0 A;  2YFI B;  1D6Y A;  1W00 A;  3J7Y d;  3T8N A;  4HM2 B;  4XB5 A;  5HGR A;  1RN7 A;  1YI2 3;  4JRF A;  1F8N A;  2HML B;  1ISK A;  3CMA 3;  1D6Z A;  2XF3 A;  3CC2 3;  1TUH A;  1JKG B;  3RDE A;  1VZZ A;  3CPO A;  3PGB A;  5EQL A;  3N54 B;  1E3V A;  2YFJ B;  2XH9 A;  4EYC A;  4MEI A;  5IG0 A;  3DMC A;  1M1K 4;  5FGO A;  2P0X A;  3Q2P A;  4NHF A;  5IG4 A;  1VQM 3;  2L4V A;  1VQN 3;  3U1W A;  2XGN A;  1VQ7 3;  2CFD A;  3KZT A;  1Y4K A;  2F86 B;  2YFL B;  1DYU A;  2A15 A;  1G96 A;  1IT8 A;  1W4N A;  2K0M A;  5CLK A;  1K41 A;  1Q40 A;  3G4S 3;  3M8C A;  2JDI H;  1Q82 4;  3STD A;  4XBT A;  1RRH A;  3F8H A;  4RNY A;  1YIT 3;  1YJW 3;  2BNG A;  2Y73 A;  2Q07 A;  4FCJ A;  3T0U A;  5JBS A;  3KII A;  1JRQ A;  3Q1C A;  2LQV A;  1EQK A;  4HBR A;  2OTJ 3;  1K9M 4;  4HZB B;  2CG1 A;  2W0Q A;  1OAC A;  1US1 A;  1FGO A;  4R80 A;  2STD A;  3HK4 A;  3EE1 A;  4FR9 A;  3CCE 3;  1N8R 4;  3PCS A;  1TFK A;  2CH9 A;  5ELU A;  3FG4 A;  3FG3 A;  2CFG A;  3UL5 A;  1FGQ A;  4LEH A;  1Z1S A;  3OXA A;  1IVX A;  4N6L A;  4FCZ A;  1W01 A;  4Q53 A;  3VSY A;  3WOE B;  4TX4 A;  2F98 A;  1K8A 4;  1GYB A;  1GY7 A;  3V92 A;  1TP6 A;  3EB8 A;  5CK6 A;  1ROA A;  4AEQ A;  3MG2 A;  1JKG A;  1ZX2 A;  3X40 A;  3KFQ C;  2HMM B;  1VQL 3;  4FMC A;  1UW1 A;  4BTW A;  3DGM A;  4FMD A;  3K5T A;  2PZV A;  2M7O A;  3S67 A;  1U5O A;  5BVB A;  3EX9 A;  2Y74 A;  1Q81 4;  3O8Y A;  1UI8 A;  1OGX A;  1S5A A;  4HM5 B;  3B4O A;  2HMN B;  3HII A;  4K1U A;  5I97 A;  3SVA A;  3F40 A;  1FUW A;  3TDG A;  4IT7 A;  4X2H A;  1ROV A;  1WMP A;  3GZY B;  1S72 3;  3SOY A;  1W2B 2;  1KQS 2;  1TIJ A;  1GY5 A;  1IVV A;  1IVW A;  1ULI B;  2E2U A;  1O7P B;  4WYK B;  3RGA A;  1VQ5 3;  1QVF 2;  4MJD A;  5KP4 A;  3Q90 A;  1IQY A;  1DVD A;  3WA2 X;  3G0K A;  1K73 4;  2B1X B;  2WGQ A;  3MYT A;  1NB3 I;  4BTX A;  2XGL A;  4HM4 B;  2IUK A;  3NHX A;  3LTC A;  4HM1 B;  1RRL A;  3EN1 B;  4WFO A;  4KFF A;  1N9E A;  3MHE A;  5IG3 A;  3FLJ A;  2Z76 A;  1QAL A;  3EBY A;  4HM3 B;  4KFD A;  3NBR A;  2FXT A;  2C10 A;  4MMX B;  5AYR B;  4CDL A;  3I56 3;  2QIY A;  3NBJ A;  4U13 A;  1DMM A;  3SXX A;  2BHM A;  1IQ8 A;  3GZR A;  1PFP A;  1OHP A;  4IIA A;  5AI1 A;  1SII A;  1SJW A;  1N5H A;  2GBW B;  1M1X B;  1D6U A;  1O7G B;  2GXF A;  3PXM A;  4MMZ B;  5ELJ A;  3DZL A;  4GL6 A;  3OV4 A;  1NU3 A;  4J9A A;  4IPB A;  1WQL B;  4H61 A;  2CFW A;  1YJN 3;  4N6O B;  5A0O B;  3NM2 A;  1OGZ A;  3H3H A;  1FA3 A;  1R4C A;  3PCR A;  1JB2 A;  1O7H B;  2E2V A;  4HM7 B;  5CF1 A;  4LZI A;  3ECF A;  3AMO B;  3N8B A;  3G6E 3;  1HKX A;  1EG9 B;  3G71 3;  3JUM A;  5IF6 A;  1JB5 A;  3DGL A;  5TGN A;  1FGM A;  3CCM 3;  3EC9 A;  5IW9 A;  3DUK A;  1WMN A;  3PZW A;  2CWU A;  1L5G B;  1K28 A;  5CF2 A;  4WYK A;  2OTL 3;  2O9U X;  2WOF A;  3GZX B;  3MPH A;  3CXC 2;  3E99 A;  1NO3 A;  2SBL A;  3LOY A;  1CQS A;  4HZ9 B;  2XEP A;  1SIH A;  1JN5 B;  2XFT A;  4QWT A;  4R9K A;  2YX9 A;  5AEU B;  3V99 A;  2KRT A;  1SQW A;  1W7C A;  2OWP A;  2WGO A;  3HIG A;  3WMD A;  1Q7Y 4;  4MMY B;  1QAK A;  3QK9 A;  3BNC A;  1QVG 2;  1O7W B;  3EN8 A;  2GBX B;  1FGT A;  3RGR A;  4N6U A;  3FF2 A;  1YVB I;  3LYG A;  5LC7 A;  3JUN A;  1STD A;  3NX0 A;  3MSO A;  1W6C A;  2BMQ B;  5IEN A;  4O2H A;  4JF8 A;  3A76 A;  3DM8 A;  1CYV A;  2OCT A;  3NXJ A;  4LSO A;  2RGQ A;  3SLU A;  5JPP A;  2CIU A;  1UI7 A;  2ML6 A;  3PYJ A;  2GEY A;  5AEW B;  3CME 3;  3IMA B;  4ZM8 A;  3K0Z A;  3X3Z A;  1OPY A;  5AIG A;  1QJG A;  3PS8 A;  3MKI A;  5FW5 A;  3KSE D;  1SPU A;  1N5P A;  2P09 A;  2P0M A;  2W04 A;  2WOH A;  3S27 A;  1IDP A;  1IVU A;  3X3X A;  3I55 3;  5IG5 A;  1QAF A;  3JUP A;  1MNL A;  3IJE B;  2INX A;  3NBB A;  4N6V 0;  7STD A;  1A2K A;  5BXQ A;  2P05 A;  3BNB A;  2Z7A A;  3FG1 A;  3LZA A;  2V1L A;  4KVH A;  5D81 A;  1Q42 A;  3H51 A;  4HM6 B;  2MF7 A;  1T5Y A;  2GU3 A;  4K61 A;  2XR8 B;  4H3U A;  3JUO A;  2CKF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...