1Q42A

Crystal structure analysis of the candida albicans mtr2
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
159
Chain Sequence
QDPTQQLEPFLKRFLASLDLLYTQPTSQPFPNVESYATQLGSNLKRSSAIIVNGQPIIPSPQEDCKLQFQKKWLQTPLSSHQLTSYDGHLIPGTGTFVVHFSAKVRFDQSGRNRLGESARPIWGSWFGVDVNLVVDENVMQDGEIINSMDYRFTYVPND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRNA TRANSPORT REGULATOR Mtr2
publication title The mtr2-mex67 ntf2-like domain complex: Structural insights into a dual role of MTR2 for yeast nuclear export
pubmed doi rcsb
source organism Candida albicans
molecule tags Translation
total genus 46
structure length 159
sequence length 174
ec nomenclature
pdb deposition date 2003-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10429 Mtr2 Nuclear pore RNA shuttling protein Mtr2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1q42A00
4MJDA 3B8LA 5IF6A 3G16A 3NV0A 3OV4A 3NV0B 3GZYB 1OHOA 3EC9A 3MKIA 2BMQB 5STDA 3UNLA 1OUNA 1DMQA 3DXOA 2W2CA 1ASKA 1W6YA 3EQQB 4N3VA 4WYKA 4WYKB 2BMOB 1GY6A 3CPOA 3EHCA 1GY7A 4HKVB 5AIGA 5CLKA 5IG4A 5IEPA 5IG0A 1BUQA 1HKXA 3ECFA 4XDVA 1K41A 5D81A 1JKGA 3G0KA 1JKGB 4HM7B 3EN8A 2F86B 3IPTA 3CNXA 3EJVA 1JB2A 2YFIB 4FCMA 3OXAA 5IG3A 1C7HA 5CF2A 3GWRA 3EBYA 3OWUA 3JUQA 1OH0A 1UUWB 2YFLB 4LMIA 2JQ5A 3GRDA 1E3RA 5BXQA 5CXOA 3CNMA 3FF2A 1GY5A 3FKAA 2GBWB 3B4OA 3SOYA 2B24B 3DUKA 3VSYA 4HM5B 4OUQA 3H51A 3OWSA 4Q53A 2Z76A 3NBRA 1O7PB 4KVHA 3LZAA 4J8TA 2RCDA 5AI1A 1OCVA 2QGUA 1E3VA 6STDA 3NM2A 3FSDA 3MSOA 2HMOB 5JPPA 3KKGA 1QJGA 1DMMA 3S5CA 1U5OA 4OVMA 3WMDA 3BB9A 1STDA 5D83A 4PEJA 1OPYA 2XR8B 3FLJA 4HM1B 4HM4B 1NDOB 5DREA 1Q40A 1Q40B 3A76A 3KSPA 1ULIB 1NWWA 5D82A 3EBTA 3GZXB 4R9KA 4XBXA 3M8CA 3MG1A 4XM4A 2XSHB 1TP6A 3MG2A 1ZX2A 3FZWA 1NU3A 4ORLA 2RFRA 3ROBA 3ER7A 5BVBA 1EG9B 4WP5A 4R9LA 4RZMA 1W00A 5KP3A 1JB4A 2F99A 1OF5A 1VZZA 3B7CA 1OF5B 4HZBB 5CK6A 7STDA 3D9RA 2HMJB 2GEXA 1AR0A 2GXFA 3F7XA 3FGYA 1UUVB 1DMNA 4LGQA 1JN5A 1JN5B 1WQLB 2GBXB 1O7WB 4L7KA 4HZ9B 4XBYA 3MYTA 2BMRB 2OWPA 4XBTA 4CDLA 2UX0A 3F8HA 2HMKB 3HK4A 3GZRA 5JPUA 3GZBA 3G8ZA 1O7GB 3B4PA 2CKFB 5AIIA 2XRXB 5AIFA 3FH1A 4WWUC 2A15A 3DZLA 8CHOA 5IG5A 4HM6B 5DRVA 3T8NA 2Z77A 5G2GA 5FW5A 3K0ZA 4HJLB 4L8PA 3Q90A 4STDA 3JUNA 2IMJA 2STDA 5TGNA 2GEYA 2BNGA 3EX9A 3K7CA 3E99A 3JUOA 1ISKA 1S5AA 3F14A 1GYBA 3LYGA 1OHSA 1W01A 2R4IA 2HMMB 4GB5A 1OHPA 1ULJB 3EF8A 3F9SA 4FCJA 5AEUB 4R1KA 3RGRA 5AEWB 3JUMA 4HM2B 3NXJA 3CU3A 3HZPA 1Q42A 3SOAA 1O7MB 4K1UA 2INXA 5IENA 1JB5A 2Z7AA 4HM3B 4LEHA 2PZVA 5IERA 2HMLB 1ZO2A 3KE7A 1EA2A 1A2KA 4HM8B 3RGAA 1IDPA 4HVNA 4L8OA 4I4KA 2CHCA 5EVHA 3F8XA 3VGNA 2XSOB 2K54A 3UJMA 5AIHA 1O7NB 3EN1B 1W02A 4IIAA 4K1VA 1QMAA 1CQSA 3SEDA 2QIYA 3OX9A 4X2HA 3NUVA 3DM8A 3KZTA 4J9AA 3MHEA 3H3HA 1TUHA 3STDA 5KP4A 5IEOA 4XDWA 1O7HB 3T8UA 4H3UA 2RGQA 1OGXA 3MG3A 3F40A 2B1XB 1E97A 4HM0B 4XB5A 1Z1SA 3HX8A 1SJWA 4U13A 3JUPA 1OGZA 3I0YA 5CF1A 1GS3A 2F98A 4X2OA 3NHXA 3FF0A 2I9WA 3OWYA 2YFJB 3F7SA 5HGRA 5KP1A 2HMNB 3BLZA 3DMCA
chains in the Genus database with same CATH superfamily
4MJDA 1B2UA 2GU1A 4HAAA 3B8LA 1W2B2 1Y4KA 3PS8A 1IT8A 1WMOA 2KXGA 1SIHA 1VQP3 3SYUA 1IVWA 2AAEA 5IF6A 1SIIA 1D6ZA 1CEWI 1W6GA 1ZS7A 3G16A 1FA3A 3NV0A 2WGOA 3OV4A 3NV0B 3LTAA 1KD14 1IU7A 3GZYB 2CWUA 1UW1A 1BRNL 1OHOA 3EC9A 1LOWA 3MKIA 3CMA3 1FGRA 1IV9A 1T3BA 3WOEB 1RGFA 3S29A 1N9JA 2BMQB 3NBBA 5STDA 2CWVA 3UNLA 3NQYA 1IQ8A 1GD3A 4MMZB 5LC6A 1OUNA 1SARA 1DMQA 1W2ZA 4LSOA 3DXOA 1VQM3 1RSNA 1YVBI 3FG1A 2IUJA 1LOXA 1ASKA 1WNHA 2BO9B 2W2CA 1TU5A 4QWTA 4CCVA 2W6JH 1YGEA 4ZM8A 3S67A 1FUWA 1HU9A 1W6YA 3FG4A 3EQQB 4N3VA 3RNTA 4BTWA 2OQEC 1AVLA 4OK0A 1BOXA 2OQEA 1BNSA 1RNTA 3D5IA 1V58A 4TX4A 4WYKA 4WYKB 2BMOB 1GY6A 2WOHA 3CPOA 3EHCA 1NJI4 5G1LA 1GY7A 4HKVB 2W56A 5AIGA 1VQ63 1BSEA 5CLKA 1JBRA 2K0MA 4AKYA 3NBJA 5IG4A 1US1A 2W9QA 1EKMA 4MMYB 1G96A 2R41A 3N9HA 5IG0A 5IEPA 1HKXA 1HYFA 1BUQA 2O3OA 3ECFA 4XDVA 1K41A 5D81A 6GSPA 1JKGA 3G0KA 1JKGB 4HM7B 1RGHA 7RNTA 1FW7A 1W5ZA 1RHLA 1B27A 3EN8A 4EW5A 2F86B 1BNEA 1LQMB 1I0XA 2J8XB 3AGOA 3FCSB 3IPTA 4AKZA 3CPW2 3CNXA 1BNJA 3EJVA 1OACA 1VQK3 1W7CA 1JB2A 1Q7Y4 1BSBA 1N8QA 2YFIB 3X3XA 3TDGA 4FCMA 3OXAA 4N6V0 3UB1A 5IG3A 1C7HA 1LNHA 4EC6A 5CF2A 3G4S3 1K734 3LH4A 2CWTA 1N5PA 1MWRA 1Q824 3GWRA 1BANA 3GAXA 3EBYA 2ML5A 1B2XA 2CIUA 3OWUA 1UGHI 4BTYA 3JUQA 3O8YA 1OH0A 1UUWB 2YFLB 2BU4A 4LMIA 3FG3A 2JDIH 2JQ5A 2UGIA 1FGTA 1NNVA 1B2SA 2XGNA 1STFI 3GRDA 5EQLA 5BU4A 3NM7A 1E3RA 4KT3B 2CG1A 3BNCA 3DY5A 5BXQA 3X42A 3BU4A 5CXOA 3CNMA 4LZIA 3FF2A 1GY5A 3FKAA 2GBWB 3B4OA 3SOYA 2B24B 4K90B 3IMAB 3LTCA 2FNQA 3WHOA 1RN7A 2SBLA 2H0HA 2YX9A 3G6E3 4BU4A 1M1K4 3QK9A 3DUKA 3ALAA 3VSYA 1B21A 4HM5B 4OUQA 2Z6BA 3H51A 2CX0A 3OWSA 1FUTA 5RNTA 2Z76A 4Q53A 3NBRA 4FMDA 1O7PB 1V57A 1CYVA 1FGQA 4KVHA 1QVG2 2L1SA 3LZAA 1GOVA 3KSED 4J8TA 1MGRA 1CYUA 3SVAA 2RCDA 1BIRA 2KCDA 3DGOA 5AI1A 1OCVA 3X3ZA 2QGUA 1FUSA 1EEJA 1T2IA 2MF7A 1E3VA 2P38A 1VQQA 4NREA 1I0VA 4IPBA 3NM2A 6STDA 1YIT3 3FSDA 2RSXA 3MSOA 2KF4A 3KIIA 1AQZA 2HMOB 3WODG 1M1XB 1RLSA 6RNTA 2CFDA 1MWSA 4KZ1A 1JBTA 4RNZA 3U97A 3X40A 2C10A 3HIGA 3KN4A 5JPPA 3KKGA 1QJGA 3AHWA 1DMMA 1RGEA 3S5CA 1U5OA 4OVMA 3WA3A 3WMDA 3BB9A 2KRTA 2OCTA 2CFWA 3CD63 3URPA 2BHMA 1STDA 5D83A 4PEJA 1OPYA 2C11A 4R80A 2XR8B 3FLJA 4HM1B 4HM4B 1NDOB 4I5QA 3ZG5A 3ZFZA 1VQ43 1M9GA 5DREA 1RN1A 1IQYA 1Q40A 3PCRA 1Q40B 3A76A 4ILFA 4DKIA 1DVDA 4EV2A 1BRIA 2E2UA 3LMLA 3KSPA 2CW9A 3LOYA 1R4CA 1ULIB 1NWWA 2BIRA 2F56A 5D82A 3EBTA 3GZXB 3CC73 4CJNA 1UUGB 1EQKA 1RKYA 4R9KA 1MWTA 4K61A 4XBXA 1B2MA 1RGLA 1SQWA 3M8CA 3MG1A 1GSPA 1LXEA 2XSHB 1TP6A 3MG2A 1ZX2A 4GHOA 4XM4A 3FZWA 4R4KA 1NU3A 1X1UA 3D4AA 4ORLA 2RFRA 3CCS3 1M904 1PFPA 3BIRA 4LYLB 3ROBA 4FMCA 3N54B 3ER7A 2MC8A 1QAKA 5BVBA 1EG9B 3V99A 4WP5A 2V1LA 1BU4A 4EBGA 4R9LA 3MWZA 1SPUA 3K9MC 4N6UA 2W56B 2W03A 4EYCA 5I97A 3CCM3 5ELJA 1MOLA 3WR2A 1VQO3 2P0XA 4RZMA 2P05A 1W00A 3D79A 1YGWA 1B2ZA 4RBNA 5KP3A 1JB4A 1KWIA 2F99A 3Q3FA 3CCL3 1OF5A 1VZZA 3B7CA 1OF5B 2ZHXB 4HZBB 5CK6A 1I8VA 5EEOA 1A90A 7STDA 3D9RA 2LYXA 3WA2X 3PYJA 1VQ53 1GMRA 4RNYA 4HOHA 2E2TA 2ZA4A 1NB5I 1ROVA 1A67A 1WMPA 2GEXA 1JRQA 2HMJB 1AR0A 1G0TA 3PCSA 2GXFA 1VQ83 3F7XA 1CH0A 1MWUA 1UUVB 3FGYA 2QA43 4MEIA 1S723 1DMNA 1QALA 2C4BA 2FXTA 1JN5A 2CG0A 4GL6A 1JN5B 1WQLB 2LQVA 4LGQA 3X3YA 2GBXB 1JZDA 3BNEA 2E2VA 4AEQA 3UL6A 2XGLA 4FMBA 1AV4A 1O7WB 1IT7A 1T2HA 2F4YA 2KF6A 5M19A 4L7KA 4HZ9B 1BVIA 1LNIA 4KFFA 4XBYA 3CCV3 3MYTA 1YHQ3 2BMRB 1B3SA 1MGWA 2OWPA 4XBTA 4CDLA 1DYUA 2UX0A 1UCKA 4G1MB 3F8HA 3MPHA 1ROAA 1VQL3 4O8SA 3PZWA 2HMKB 3J7Yd 3HK4A 3HIIA 3GZRA 3KFQC 4BTXA 1RGAA 5JPUA 3GZBA 1LOVA 3G8ZA 2H0IA 1O7GB 2CC3A 2BT3A 2FGTA 3B4PA 1DE3A 2CKFB 2F5WA 5AIIA 1UI8A 2XRXB 3A5EA 4RNTA 5AIFA 3CCU3 1UCIA 3FH1A 2A15A 4WWUC 1IVVA 5ELUA 3DZLA 1VQ73 1FGMA 8CHOA 1DETA 5IG5A 4HM6B 1N9EA 1JV2B 5DRVA 1TRQA 4HYZA 3UL5A 3T8NA 2Z77A 5BIRA 5G2GA 1AVKA 2IYJA 2XEPA 1JBSA 3OW22 1J2BA 5FW5A 3K0ZA 1BSAA 4HJLB 1TTOA 1ZGXA 4O02B 3BNBA 1AY7A 3K63A 1K28A 1R4YA 5LC7A 4L8PA 4KFEA 3Q90A 3SLUA 5JBSA 1I3FA 3ZG0A 2ZDJA 1C54A 3IJEB 4STDA 3JUNA 4GSPA 1I2GA 1LQGC 4IT7A 2IMJA 1YJ93 2CK3H 2STDA 5TGNA 2CH9A 2GEYA 2BNGA 1IVUA 4FR9A 1RNBA 3PXMA 1RGGA 1RCLA 1X1YA 3EX9A 3K7CA 2D42A 3E99A 3DH2A 3SXXA 3JUOA 1ISKA 4WFOA 1S5AA 1VQ93 1TJDA 3LTDA 1KSIA 2ML6A 1DVCA 2SARA 3F14A 3S27A 1GYBA 3DGNA 3Q1CA 3VF1A 1KQS2 3GSPA 1U8CB 3CCR3 5A0OB 1I2FA 1PYLA 3LYGA 1OHSA 1W01A 2R4IA 2XF3A 3AMOA 3AMOB 4EV5A 2HMMB 4JRFA 1L5GB 1EUIC 2W04A 4N6TA 1RGKA 4CPKA 1MNLA 1BNIA 1BRHA 3NX0A 1IV7A 4GB5A 3CCQ3 1UCJA 3JVCA 5AYRB 2AADA 1WMNA 1I3IA 1OHPA 4MMXB 1ULJB 1N8R4 1RRHA 3EF8A 5GSPA 3F9SA 3DGLA 4FCJA 1BNFA 3BNDA 1NB3I 4N6MA 5AEUB 1PU4A 3AHSA 4R1KA 2IA7A 3RGRA 3CXC2 2WO0A 5AEWB 4O3VA 2W0QA 1Q864 3JUMA 2OTL3 1BRGA 3WOFB 2IUKA 3X41A 4HM2B 3NXJA 1RRLA 1N5HA 3CU3A 5G1KA 3RDEA 2KF3A 4N6NB 1NO3A 1Q42A 3HZPA 2M7OA 1IQXA 1RDSA 3SOAA 1BAOA 1O7MB 4K1UA 1Q7HA 1LVNA 1RMSA 1BRKA 2INXA 1GMQA 5IENA 3EB8A 3D3LA 1JB5A 4KFDA 2Z7AA 3G713 4HM3B 4BL3A 3LTBA 3U1WA 1TIJA 3WDGB 1UGIA 5IW9A 3DGYA 1I2EA 2PZVA 4LEHA 5IERA 1HZ1A 2HMLB 1ZO2A 2H0GA 1JZOA 1Q9EA 1YI23 3S28A 1Q814 3DGMA 2OTJ3 1YNVX 1GOUA 2PNCA 3AGNA 3KE7A 2L4VA 1EA2A 1A2KA 4HM8B 1I70A 3K5TA 3RGAA 1IDPA 1W6CA 2W9PA 1JJ22 1QVF2 1TFKA 3I563 4HVNA 4L8OA 1UCLA 1FGOA 2HOHA 2IY2A 1GD4A 4I4KA 3L0RA 2QEX3 1QAFA 1B20A 2CHCA 2XH9A 2Y74A 3LT9A 3Q2PA 5EVHA 3F8XA 3T0UA 1RJOA 2KF5A 3VGNA 2XSOB 2K54A 3UJMA 5AIHA 1BUJA 3HOHA 1O7NB 3N8BA 3EN1B 1RTUA 1W02A 4BL2A 4IIAA 4BIRA 1GOYA 3CME3 1A2VA 4NPBA 3I553 1T5YA 1X1XA 4K1VA 3QRDA 1QMAA 3CCJ3 1FZUA 1BNRA 2RBIA 1CQSA 3SEDA 1F8NA 9RNTA 2QIYA 3OX9A 1YJW3 1YJN3 2P0MA 2CFKA 1JNQA 4X2HA 3NUVA 2Q07A 1V74A 1RGCA 3DM8A 1D6UA 1W4NA 2KAAA 2UUGC 2P09A 3KZTA 1BSCA 3D5GA 4J9AA 3MHEA 3H3HA 1D6YA 1TUHA 1TRPA 3STDA 1RN4A 5IEOA 4XDWA 5KP4A 1O7HB 5M18A 3CC43 4N6OB 3T8UA 2RNTA 5HOHA 1WTHA 2F5MA 2OOVC 1LRAA 2OOVA 3CC23 4FMAA 8RNTA 3EE1A 2XFSA 4H3UA 4EXRA 1VQN3 1IYYA 3HI7A 4HBRA 1TFOA 1BGSA 2RGQA 1BSDA 2GU3A 3V98A 1OGXA 3MG3A 4FCZA 4J5GA 3V92A 4WHAA 1UDII 2WGQA 3F40A 1UI7A 2B1XB 2XFTA 4JF8A 2Y73A 4NHFA 1IK3A 1E97A 1X1WA 4HM0B 2K3DA 4N6LA 5M1AA 4XB5A 1Z1SA 1KC84 2D1WA 3HX8A 1SJWA 2CFLA 3KCHA 3PGBA 2GSPA 1YVSA 1K9M4 1LOYA 1G02A 1BNGA 3LT8A 5FGOA 4U13A 3JUPA 1OGZA 3I0YA 1FYSA 4J5KA 5AYSC 1A2PA 5CF1A 1PY3A 3NQZA 7GSPA 1GS3A 1GMPA 2F98A 3LXUX 2CFGA 1RCKA 4X2OA 3NHXA 2O9UX 2WOFA 1YIJ3 3FF0A 4H61A 2I9WA 3OWYA 2ZL8A 2YFJB 3F7SA 1BRJA 5HGRA 2CX1A 1BRSA 5KP1A 1IVXA 3CCE3 1K8A4 4O2HA 2HMNB 3BLZA 3SX1A 3DMCA
chains in the Genus database with same CATH topology
4MJDA 2GU1A 3B8LA 1W2B2 1Y4KA 3PS8A 1IT8A 1WMOA 2KXGA 1SIHA 1VQP3 1IVWA 1FA3A 5IF6A 1SIIA 1D6ZA 1CEWI 1W6GA 3G16A 3NV0A 2WGOA 3OV4A 3NV0B 3LTAA 1KD14 1IU7A 3GZYB 2CWUA 1UW1A 1OHOA 3EC9A 3CMA3 3MKIA 1FGRA 1IV9A 3WOEB 3S29A 1N9JA 2BMQB 3NBBA 5STDA 2CWVA 3UNLA 3NQYA 1IQ8A 1GD3A 4MMZB 5LC6A 1OUNA 1DMQA 1W2ZA 4LSOA 3DXOA 1VQM3 1YVBI 3FG1A 2IUJA 1LOXA 1ASKA 1WNHA 2BO9B 2W2CA 1TU5A 4QWTA 4CCVA 2W6JH 1YGEA 4ZM8A 3S67A 1FUWA 1HU9A 1W6YA 3FG4A 3EQQB 4N3VA 4BTWA 2OQEC 1AVLA 4OK0A 2OQEA 4TX4A 4WYKA 4WYKB 2BMOB 1GY6A 2WOHA 3CPOA 3EHCA 1NJI4 1GY7A 4HKVB 2W56A 5AIGA 1VQ63 5CLKA 2K0MA 4AKYA 3NBJA 5IG4A 1US1A 2W9QA 1EKMA 4MMYB 1G96A 3N9HA 5IG0A 5IEPA 1BUQA 1HKXA 2O3OA 3ECFA 4XDVA 1K41A 5D81A 1JKGA 3G0KA 1JKGB 4HM7B 1W5ZA 3EN8A 2F86B 3FCSB 3IPTA 4AKZA 3CPW2 3CNXA 3EJVA 1OACA 1VQK3 1JB2A 1W7CA 1Q7Y4 1N8QA 2YFIB 3X3XA 3TDGA 4FCMA 3OXAA 4N6V0 3UB1A 5IG3A 1C7HA 1LNHA 4EC6A 5CF2A 3G4S3 1K734 3LH4A 2CWTA 1N5PA 1Q824 3GWRA 3GAXA 3EBYA 2ML5A 2CIUA 3OWUA 4BTYA 3JUQA 3O8YA 1OH0A 1UUWB 2YFLB 4LMIA 3FG3A 2JDIH 2JQ5A 1FGTA 2XGNA 1STFI 3GRDA 5EQLA 3NM7A 1E3RA 2CG1A 3BNCA 3DY5A 5BXQA 3X42A 5CXOA 3CNMA 4LZIA 3FF2A 1GY5A 3FKAA 2GBWB 3B4OA 3SOYA 2B24B 4K90B 3IMAB 3LTCA 2FNQA 1RN7A 2SBLA 2YX9A 3G6E3 1M1K4 3QK9A 3DUKA 3ALAA 3VSYA 4HM5B 4OUQA 2Z6BA 3H51A 3OWSA 2Z76A 4Q53A 3NBRA 4FMDA 1O7PB 1CYVA 1FGQA 4KVHA 1QVG2 3LZAA 3KSED 4J8TA 1CYUA 3SVAA 2RCDA 2KCDA 3DGOA 5AI1A 1OCVA 3X3ZA 2QGUA 2MF7A 1E3VA 2P38A 4NREA 4IPBA 3NM2A 6STDA 1YIT3 3FSDA 2RSXA 3MSOA 3KIIA 2HMOB 3WODG 1M1XB 2CFDA 4KZ1A 4RNZA 3U97A 3X40A 2C10A 3HIGA 3KN4A 5JPPA 3KKGA 1QJGA 1DMMA 3S5CA 1U5OA 4OVMA 3WA3A 3WMDA 3BB9A 2KRTA 2OCTA 2CFWA 3CD63 2BHMA 1STDA 5D83A 4PEJA 1OPYA 2C11A 4R80A 2XR8B 3FLJA 4HM1B 4HM4B 1NDOB 1VQ43 1A90A 1M9GA 5DREA 1IQYA 1Q40A 3PCRA 1Q40B 3A76A 1DVDA 4EV2A 2E2UA 3LMLA 3KSPA 2CW9A 3LOYA 1R4CA 1ULIB 1NWWA 5D82A 3EBTA 3GZXB 3CC73 1EQKA 1RKYA 4R9KA 4K61A 4XBXA 1SQWA 3M8CA 3MG1A 4XM4A 1LXEA 2XSHB 1TP6A 3MG2A 1ZX2A 3FZWA 4R4KA 1NU3A 4ORLA 2RFRA 3CCS3 1M904 1PFPA 3ROBA 4FMCA 3N54B 3ER7A 2MC8A 1QAKA 5BVBA 1EG9B 3V99A 4WP5A 2V1LA 4EBGA 4R9LA 3MWZA 1SPUA 3K9MC 4N6UA 2W56B 2W03A 4EYCA 5I97A 3CCM3 5ELJA 1MOLA 1VQO3 2P0XA 4RZMA 2P05A 1W00A 4RBNA 5KP3A 1JB4A 1KWIA 2F99A 3CCL3 1OF5A 1VZZA 3B7CA 1OF5B 4HZBB 5CK6A 5EEOA 7STDA 3D9RA 2LYXA 3WA2X 3PYJA 1VQ53 4RNYA 2E2TA 1NB5I 1A67A 1ROVA 1WMPA 2GEXA 1JRQA 2HMJB 1AR0A 3PCSA 1VQ83 2GXFA 3F7XA 3FGYA 1UUVB 2QA43 1S723 4MEIA 1DMNA 1QALA 2FXTA 1JN5A 2CG0A 4GL6A 1JN5B 1WQLB 2LQVA 4LGQA 3X3YA 2GBXB 3BNEA 2E2VA 4AEQA 3UL6A 2XGLA 4FMBA 1AV4A 1O7WB 1IT7A 4L7KA 4HZ9B 4KFFA 3CCV3 4XBYA 3MYTA 1YHQ3 2BMRB 2OWPA 4XBTA 4CDLA 1DYUA 2UX0A 4G1MB 3F8HA 3MPHA 1ROAA 1VQL3 4O8SA 3PZWA 2HMKB 3J7Yd 3HK4A 3HIIA 3GZRA 3KFQC 4BTXA 5JPUA 3GZBA 3G8ZA 1O7GB 2CC3A 2BT3A 2FGTA 3B4PA 2CKFB 5AIIA 1UI8A 2XRXB 5AIFA 3CCU3 3FH1A 4WWUC 2A15A 5ELUA 1IVVA 1VQ73 3DZLA 1FGMA 8CHOA 5IG5A 4HM6B 1N9EA 1JV2B 5DRVA 3UL5A 4HYZA 3T8NA 2Z77A 5G2GA 1AVKA 2XEPA 3OW22 1J2BA 5FW5A 3K0ZA 4HJLB 4O02B 3BNBA 3K63A 1K28A 5LC7A 4L8PA 4KFEA 3Q90A 3SLUA 5JBSA 2ZDJA 3IJEB 4STDA 3JUNA 4IT7A 2IMJA 1YJ93 2CK3H 2STDA 5TGNA 2CH9A 2GEYA 2BNGA 1IVUA 4FR9A 3PXMA 3EX9A 3K7CA 2D42A 3E99A 3SXXA 3JUOA 1ISKA 4WFOA 1S5AA 1VQ93 3LTDA 1KSIA 2ML6A 1DVCA 3F14A 3S27A 1GYBA 3DGNA 3Q1CA 3VF1A 1KQS2 1U8CB 3CCR3 5A0OB 3LYGA 1OHSA 1W01A 2R4IA 2XF3A 3AMOA 3AMOB 4EV5A 2HMMB 4JRFA 1L5GB 2W04A 4N6TA 1MNLA 3NX0A 4GB5A 1IV7A 3CCQ3 3JVCA 5AYRB 1WMNA 1OHPA 4MMXB 1ULJB 1N8R4 1RRHA 3EF8A 3F9SA 3DGLA 4FCJA 3BNDA 1NB3I 4N6MA 5AEUB 1PU4A 4R1KA 2IA7A 3RGRA 3CXC2 2WO0A 5AEWB 4O3VA 2W0QA 1Q864 3JUMA 2OTL3 3WOFB 2IUKA 3X41A 4HM2B 3NXJA 1RRLA 1N5HA 3CU3A 3RDEA 4N6NB 1NO3A 1Q42A 3HZPA 2M7OA 1IQXA 3SOAA 1O7MB 4K1UA 1LVNA 2INXA 5IENA 3EB8A 3D3LA 1JB5A 4KFDA 2Z7AA 3G713 4HM3B 3LTBA 3U1WA 1TIJA 3WDGB 5IW9A 2PZVA 4LEHA 5IERA 2HMLB 1ZO2A 1YI23 1Q814 3S28A 3DGMA 2OTJ3 2PNCA 3KE7A 2L4VA 1EA2A 1A2KA 4HM8B 3K5TA 3RGAA 1IDPA 1W6CA 2W9PA 1JJ22 1QVF2 1TFKA 3I563 4HVNA 4L8OA 1FGOA 1GD4A 4I4KA 3L0RA 2QEX3 1QAFA 2CHCA 2XH9A 2Y74A 3LT9A 3Q2PA 5EVHA 3F8XA 3T0UA 1RJOA 3VGNA 2XSOB 2K54A 3UJMA 5AIHA 1O7NB 3N8BA 3EN1B 1W02A 4IIAA 3CME3 1A2VA 3I553 1T5YA 4K1VA 3QRDA 1QMAA 3CCJ3 1CQSA 3SEDA 1F8NA 2QIYA 3OX9A 1YJW3 1YJN3 2P0MA 2CFKA 1JNQA 4X2HA 3NUVA 2Q07A 1V74A 3DM8A 1D6UA 1W4NA 2P09A 3KZTA 4J9AA 3MHEA 3H3HA 1D6YA 1TUHA 3STDA 5KP4A 5IEOA 3CC43 4XDWA 1O7HB 4N6OB 3T8UA 1WTHA 2OOVC 2OOVA 3CC23 4FMAA 3EE1A 2XFSA 4H3UA 4EXRA 1VQN3 3HI7A 4HBRA 1TFOA 2RGQA 3V98A 2GU3A 1OGXA 3MG3A 4FCZA 3V92A 4WHAA 2WGQA 3F40A 1UI7A 2B1XB 2XFTA 4JF8A 2Y73A 4NHFA 1IK3A 1E97A 4HM0B 4N6LA 4XB5A 1Z1SA 1KC84 2D1WA 3HX8A 1SJWA 2CFLA 3PGBA 1K9M4 3LT8A 5FGOA 4U13A 3JUPA 1OGZA 3I0YA 5AYSC 5CF1A 3NQZA 1GS3A 3LXUX 2F98A 2CFGA 4X2OA 3NHXA 2O9UX 2WOFA 1YIJ3 3FF0A 4H61A 2I9WA 3OWYA 2ZL8A 2YFJB 3F7SA 5HGRA 5KP1A 1K8A4 1IVXA 3CCE3 4O2HA 2HMNB 3BLZA 3SX1A 3DMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJD A;  3B8L A;  5IF6 A;  3G16 A;  3NV0 A;  3OV4 A;  3NV0 B;  3GZY B;  1OHO A;  3EC9 A;  3MKI A;  2BMQ B;  5STD A;  3UNL A;  1OUN A;  1DMQ A;  3DXO A;  2W2C A;  1ASK A;  1W6Y A;  3EQQ B;  4N3V A;  4WYK A;  4WYK B;  2BMO B;  1GY6 A;  3CPO A;  3EHC A;  1GY7 A;  4HKV B;  5AIG A;  5CLK A;  5IG4 A;  5IEP A;  5IG0 A;  1BUQ A;  1HKX A;  3ECF A;  4XDV A;  1K41 A;  5D81 A;  1JKG A;  3G0K A;  1JKG B;  4HM7 B;  3EN8 A;  2F86 B;  3IPT A;  3CNX A;  3EJV A;  1JB2 A;  2YFI B;  4FCM A;  3OXA A;  5IG3 A;  1C7H A;  5CF2 A;  3GWR A;  3EBY A;  3OWU A;  3JUQ A;  1OH0 A;  1UUW B;  2YFL B;  4LMI A;  2JQ5 A;  3GRD A;  1E3R A;  5BXQ A;  5CXO A;  3CNM A;  3FF2 A;  1GY5 A;  3FKA A;  2GBW B;  3B4O A;  3SOY A;  2B24 B;  3DUK A;  3VSY A;  4HM5 B;  4OUQ A;  3H51 A;  3OWS A;  4Q53 A;  2Z76 A;  3NBR A;  1O7P B;  4KVH A;  3LZA A;  4J8T A;  2RCD A;  5AI1 A;  1OCV A;  2QGU A;  1E3V A;  6STD A;  3NM2 A;  3FSD A;  3MSO A;  2HMO B;  5JPP A;  3KKG A;  1QJG A;  1DMM A;  3S5C A;  1U5O A;  4OVM A;  3WMD A;  3BB9 A;  1STD A;  5D83 A;  4PEJ A;  1OPY A;  2XR8 B;  3FLJ A;  4HM1 B;  4HM4 B;  1NDO B;  5DRE A;  1Q40 A;  1Q40 B;  3A76 A;  3KSP A;  1ULI B;  1NWW A;  5D82 A;  3EBT A;  3GZX B;  4R9K A;  4XBX A;  3M8C A;  3MG1 A;  4XM4 A;  2XSH B;  1TP6 A;  3MG2 A;  1ZX2 A;  3FZW A;  1NU3 A;  4ORL A;  2RFR A;  3ROB A;  3ER7 A;  5BVB A;  1EG9 B;  4WP5 A;  4R9L A;  4RZM A;  1W00 A;  5KP3 A;  1JB4 A;  2F99 A;  1OF5 A;  1VZZ A;  3B7C A;  1OF5 B;  4HZB B;  5CK6 A;  7STD A;  3D9R A;  2HMJ B;  2GEX A;  1AR0 A;  2GXF A;  3F7X A;  3FGY A;  1UUV B;  1DMN A;  4LGQ A;  1JN5 A;  1JN5 B;  1WQL B;  2GBX B;  1O7W B;  4L7K A;  4HZ9 B;  4XBY A;  3MYT A;  2BMR B;  2OWP A;  4XBT A;  4CDL A;  2UX0 A;  3F8H A;  2HMK B;  3HK4 A;  3GZR A;  5JPU A;  3GZB A;  3G8Z A;  1O7G B;  3B4P A;  2CKF B;  5AII A;  2XRX B;  5AIF A;  3FH1 A;  4WWU C;  2A15 A;  3DZL A;  8CHO A;  5IG5 A;  4HM6 B;  5DRV A;  3T8N A;  2Z77 A;  5G2G A;  5FW5 A;  3K0Z A;  4HJL B;  4L8P A;  3Q90 A;  4STD A;  3JUN A;  2IMJ A;  2STD A;  5TGN A;  2GEY A;  2BNG A;  3EX9 A;  3K7C A;  3E99 A;  3JUO A;  1ISK A;  1S5A A;  3F14 A;  1GYB A;  3LYG A;  1OHS A;  1W01 A;  2R4I A;  2HMM B;  4GB5 A;  1OHP A;  1ULJ B;  3EF8 A;  3F9S A;  4FCJ A;  5AEU B;  4R1K A;  3RGR A;  5AEW B;  3JUM A;  4HM2 B;  3NXJ A;  3CU3 A;  3HZP A;  1Q42 A;  3SOA A;  1O7M B;  4K1U A;  2INX A;  5IEN A;  1JB5 A;  2Z7A A;  4HM3 B;  4LEH A;  2PZV A;  5IER A;  2HML B;  1ZO2 A;  3KE7 A;  1EA2 A;  1A2K A;  4HM8 B;  3RGA A;  1IDP A;  4HVN A;  4L8O A;  4I4K A;  2CHC A;  5EVH A;  3F8X A;  3VGN A;  2XSO B;  2K54 A;  3UJM A;  5AIH A;  1O7N B;  3EN1 B;  1W02 A;  4IIA A;  4K1V A;  1QMA A;  1CQS A;  3SED A;  2QIY A;  3OX9 A;  4X2H A;  3NUV A;  3DM8 A;  3KZT A;  4J9A A;  3MHE A;  3H3H A;  1TUH A;  3STD A;  5KP4 A;  5IEO A;  4XDW A;  1O7H B;  3T8U A;  4H3U A;  2RGQ A;  1OGX A;  3MG3 A;  3F40 A;  2B1X B;  1E97 A;  4HM0 B;  4XB5 A;  1Z1S A;  3HX8 A;  1SJW A;  4U13 A;  3JUP A;  1OGZ A;  3I0Y A;  5CF1 A;  1GS3 A;  2F98 A;  4X2O A;  3NHX A;  3FF0 A;  2I9W A;  3OWY A;  2YFJ B;  3F7S A;  5HGR A;  5KP1 A;  2HMN B;  3BLZ A;  3DMC A; 
#chains in the Genus database with same CATH topology
 4MJD A;  1B2U A;  2GU1 A;  4HAA A;  3B8L A;  1W2B 2;  1Y4K A;  3PS8 A;  1IT8 A;  1WMO A;  2KXG A;  1SIH A;  1VQP 3;  3SYU A;  1IVW A;  2AAE A;  5IF6 A;  1SII A;  1D6Z A;  1CEW I;  1W6G A;  1ZS7 A;  3G16 A;  1FA3 A;  3NV0 A;  2WGO A;  3OV4 A;  3NV0 B;  3LTA A;  1KD1 4;  1IU7 A;  3GZY B;  2CWU A;  1UW1 A;  1BRN L;  1OHO A;  3EC9 A;  1LOW A;  3MKI A;  3CMA 3;  1FGR A;  1IV9 A;  1T3B A;  3WOE B;  1RGF A;  3S29 A;  1N9J A;  2BMQ B;  3NBB A;  5STD A;  2CWV A;  3UNL A;  3NQY A;  1IQ8 A;  1GD3 A;  4MMZ B;  5LC6 A;  1OUN A;  1SAR A;  1DMQ A;  1W2Z A;  4LSO A;  3DXO A;  1VQM 3;  1RSN A;  1YVB I;  3FG1 A;  2IUJ A;  1LOX A;  1ASK A;  1WNH A;  2BO9 B;  2W2C A;  1TU5 A;  4QWT A;  4CCV A;  2W6J H;  1YGE A;  4ZM8 A;  3S67 A;  1FUW A;  1HU9 A;  1W6Y A;  3FG4 A;  3EQQ B;  4N3V A;  3RNT A;  4BTW A;  2OQE C;  1AVL A;  4OK0 A;  1BOX A;  2OQE A;  1BNS A;  1RNT A;  3D5I A;  1V58 A;  4TX4 A;  4WYK A;  4WYK B;  2BMO B;  1GY6 A;  2WOH A;  3CPO A;  3EHC A;  1NJI 4;  5G1L A;  1GY7 A;  4HKV B;  2W56 A;  5AIG A;  1VQ6 3;  1BSE A;  5CLK A;  1JBR A;  2K0M A;  4AKY A;  3NBJ A;  5IG4 A;  1US1 A;  2W9Q A;  1EKM A;  4MMY B;  1G96 A;  2R41 A;  3N9H A;  5IG0 A;  5IEP A;  1HKX A;  1HYF A;  1BUQ A;  2O3O A;  3ECF A;  4XDV A;  1K41 A;  5D81 A;  6GSP A;  1JKG A;  3G0K A;  1JKG B;  4HM7 B;  1RGH A;  7RNT A;  1FW7 A;  1W5Z A;  1RHL A;  1B27 A;  3EN8 A;  4EW5 A;  2F86 B;  1BNE A;  1LQM B;  1I0X A;  2J8X B;  3AGO A;  3FCS B;  3IPT A;  4AKZ A;  3CPW 2;  3CNX A;  1BNJ A;  3EJV A;  1OAC A;  1VQK 3;  1W7C A;  1JB2 A;  1Q7Y 4;  1BSB A;  1N8Q A;  2YFI B;  3X3X A;  3TDG A;  4FCM A;  3OXA A;  4N6V 0;  3UB1 A;  5IG3 A;  1C7H A;  1LNH A;  4EC6 A;  5CF2 A;  3G4S 3;  1K73 4;  3LH4 A;  2CWT A;  1N5P A;  1MWR A;  1Q82 4;  3GWR A;  1BAN A;  3GAX A;  3EBY A;  2ML5 A;  1B2X A;  2CIU A;  3OWU A;  1UGH I;  4BTY A;  3JUQ A;  3O8Y A;  1OH0 A;  1UUW B;  2YFL B;  2BU4 A;  4LMI A;  3FG3 A;  2JDI H;  2JQ5 A;  2UGI A;  1FGT A;  1NNV A;  1B2S A;  2XGN A;  1STF I;  3GRD A;  5EQL A;  5BU4 A;  3NM7 A;  1E3R A;  4KT3 B;  2CG1 A;  3BNC A;  3DY5 A;  5BXQ A;  3X42 A;  3BU4 A;  5CXO A;  3CNM A;  4LZI A;  3FF2 A;  1GY5 A;  3FKA A;  2GBW B;  3B4O A;  3SOY A;  2B24 B;  4K90 B;  3IMA B;  3LTC A;  2FNQ A;  3WHO A;  1RN7 A;  2SBL A;  2H0H A;  2YX9 A;  3G6E 3;  4BU4 A;  1M1K 4;  3QK9 A;  3DUK A;  3ALA A;  3VSY A;  1B21 A;  4HM5 B;  4OUQ A;  2Z6B A;  3H51 A;  2CX0 A;  3OWS A;  1FUT A;  5RNT A;  2Z76 A;  4Q53 A;  3NBR A;  4FMD A;  1O7P B;  1V57 A;  1CYV A;  1FGQ A;  4KVH A;  1QVG 2;  2L1S A;  3LZA A;  1GOV A;  3KSE D;  4J8T A;  1MGR A;  1CYU A;  3SVA A;  2RCD A;  1BIR A;  2KCD A;  3DGO A;  5AI1 A;  1OCV A;  3X3Z A;  2QGU A;  1FUS A;  1EEJ A;  1T2I A;  2MF7 A;  1E3V A;  2P38 A;  1VQQ A;  4NRE A;  1I0V A;  4IPB A;  3NM2 A;  6STD A;  1YIT 3;  3FSD A;  2RSX A;  3MSO A;  2KF4 A;  3KII A;  1AQZ A;  2HMO B;  3WOD G;  1M1X B;  1RLS A;  6RNT A;  2CFD A;  1MWS A;  4KZ1 A;  1JBT A;  4RNZ A;  3U97 A;  3X40 A;  2C10 A;  3HIG A;  3KN4 A;  5JPP A;  3KKG A;  1QJG A;  3AHW A;  1DMM A;  1RGE A;  3S5C A;  1U5O A;  4OVM A;  3WA3 A;  3WMD A;  3BB9 A;  2KRT A;  2OCT A;  2CFW A;  3CD6 3;  3URP A;  2BHM A;  1STD A;  5D83 A;  4PEJ A;  1OPY A;  2C11 A;  4R80 A;  2XR8 B;  3FLJ A;  4HM1 B;  4HM4 B;  1NDO B;  4I5Q A;  3ZG5 A;  3ZFZ A;  1VQ4 3;  1M9G A;  5DRE A;  1RN1 A;  1IQY A;  1Q40 A;  3PCR A;  1Q40 B;  3A76 A;  4ILF A;  4DKI A;  1DVD A;  4EV2 A;  1BRI A;  2E2U A;  3LML A;  3KSP A;  2CW9 A;  3LOY A;  1R4C A;  1ULI B;  1NWW A;  2BIR A;  2F56 A;  5D82 A;  3EBT A;  3GZX B;  3CC7 3;  4CJN A;  1UUG B;  1EQK A;  1RKY A;  4R9K A;  1MWT A;  4K61 A;  4XBX A;  1B2M A;  1RGL A;  1SQW A;  3M8C A;  3MG1 A;  1GSP A;  1LXE A;  2XSH B;  1TP6 A;  3MG2 A;  1ZX2 A;  4GHO A;  4XM4 A;  3FZW A;  4R4K A;  1NU3 A;  1X1U A;  3D4A A;  4ORL A;  2RFR A;  3CCS 3;  1M90 4;  1PFP A;  3BIR A;  4LYL B;  3ROB A;  4FMC A;  3N54 B;  3ER7 A;  2MC8 A;  1QAK A;  5BVB A;  1EG9 B;  3V99 A;  4WP5 A;  2V1L A;  1BU4 A;  4EBG A;  4R9L A;  3MWZ A;  1SPU A;  3K9M C;  4N6U A;  2W56 B;  2W03 A;  4EYC A;  5I97 A;  3CCM 3;  5ELJ A;  1MOL A;  3WR2 A;  1VQO 3;  2P0X A;  4RZM A;  2P05 A;  1W00 A;  3D79 A;  1YGW A;  1B2Z A;  4RBN A;  5KP3 A;  1JB4 A;  1KWI A;  2F99 A;  3Q3F A;  3CCL 3;  1OF5 A;  1VZZ A;  3B7C A;  1OF5 B;  2ZHX B;  4HZB B;  5CK6 A;  1I8V A;  5EEO A;  1A90 A;  7STD A;  3D9R A;  2LYX A;  3WA2 X;  3PYJ A;  1VQ5 3;  1GMR A;  4RNY A;  4HOH A;  2E2T A;  2ZA4 A;  1NB5 I;  1ROV A;  1A67 A;  1WMP A;  2GEX A;  1JRQ A;  2HMJ B;  1AR0 A;  1G0T A;  3PCS A;  2GXF A;  1VQ8 3;  3F7X A;  1CH0 A;  1MWU A;  1UUV B;  3FGY A;  2QA4 3;  4MEI A;  1S72 3;  1DMN A;  1QAL A;  2C4B A;  2FXT A;  1JN5 A;  2CG0 A;  4GL6 A;  1JN5 B;  1WQL B;  2LQV A;  4LGQ A;  3X3Y A;  2GBX B;  1JZD A;  3BNE A;  2E2V A;  4AEQ A;  3UL6 A;  2XGL A;  4FMB A;  1AV4 A;  1O7W B;  1IT7 A;  1T2H A;  2F4Y A;  2KF6 A;  5M19 A;  4L7K A;  4HZ9 B;  1BVI A;  1LNI A;  4KFF A;  4XBY A;  3CCV 3;  3MYT A;  1YHQ 3;  2BMR B;  1B3S A;  1MGW A;  2OWP A;  4XBT A;  4CDL A;  1DYU A;  2UX0 A;  1UCK A;  4G1M B;  3F8H A;  3MPH A;  1ROA A;  1VQL 3;  4O8S A;  3PZW A;  2HMK B;  3J7Y d;  3HK4 A;  3HII A;  3GZR A;  3KFQ C;  4BTX A;  1RGA A;  5JPU A;  3GZB A;  1LOV A;  3G8Z A;  2H0I A;  1O7G B;  2CC3 A;  2BT3 A;  2FGT A;  3B4P A;  1DE3 A;  2CKF B;  2F5W A;  5AII A;  1UI8 A;  2XRX B;  3A5E A;  4RNT A;  5AIF A;  3CCU 3;  1UCI A;  3FH1 A;  2A15 A;  4WWU C;  1IVV A;  5ELU A;  3DZL A;  1VQ7 3;  1FGM A;  8CHO A;  1DET A;  5IG5 A;  4HM6 B;  1N9E A;  1JV2 B;  5DRV A;  1TRQ A;  4HYZ A;  3UL5 A;  3T8N A;  2Z77 A;  5BIR A;  5G2G A;  1AVK A;  2IYJ A;  2XEP A;  1JBS A;  3OW2 2;  1J2B A;  5FW5 A;  3K0Z A;  1BSA A;  4HJL B;  1TTO A;  1ZGX A;  4O02 B;  3BNB A;  1AY7 A;  3K63 A;  1K28 A;  1R4Y A;  5LC7 A;  4L8P A;  4KFE A;  3Q90 A;  3SLU A;  5JBS A;  1I3F A;  3ZG0 A;  2ZDJ A;  1C54 A;  3IJE B;  4STD A;  3JUN A;  4GSP A;  1I2G A;  1LQG C;  4IT7 A;  2IMJ A;  1YJ9 3;  2CK3 H;  2STD A;  5TGN A;  2CH9 A;  2GEY A;  2BNG A;  1IVU A;  4FR9 A;  1RNB A;  3PXM A;  1RGG A;  1RCL A;  1X1Y A;  3EX9 A;  3K7C A;  2D42 A;  3E99 A;  3DH2 A;  3SXX A;  3JUO A;  1ISK A;  4WFO A;  1S5A A;  1VQ9 3;  1TJD A;  3LTD A;  1KSI A;  2ML6 A;  1DVC A;  2SAR A;  3F14 A;  3S27 A;  1GYB A;  3DGN A;  3Q1C A;  3VF1 A;  1KQS 2;  3GSP A;  1U8C B;  3CCR 3;  5A0O B;  1I2F A;  1PYL A;  3LYG A;  1OHS A;  1W01 A;  2R4I A;  2XF3 A;  3AMO A;  3AMO B;  4EV5 A;  2HMM B;  4JRF A;  1L5G B;  1EUI C;  2W04 A;  4N6T A;  1RGK A;  4CPK A;  1MNL A;  1BNI A;  1BRH A;  3NX0 A;  1IV7 A;  4GB5 A;  3CCQ 3;  1UCJ A;  3JVC A;  5AYR B;  2AAD A;  1WMN A;  1I3I A;  1OHP A;  4MMX B;  1ULJ B;  1N8R 4;  1RRH A;  3EF8 A;  5GSP A;  3F9S A;  3DGL A;  4FCJ A;  1BNF A;  3BND A;  1NB3 I;  4N6M A;  5AEU B;  1PU4 A;  3AHS A;  4R1K A;  2IA7 A;  3RGR A;  3CXC 2;  2WO0 A;  5AEW B;  4O3V A;  2W0Q A;  1Q86 4;  3JUM A;  2OTL 3;  1BRG A;  3WOF B;  2IUK A;  3X41 A;  4HM2 B;  3NXJ A;  1RRL A;  1N5H A;  3CU3 A;  5G1K A;  3RDE A;  2KF3 A;  4N6N B;  1NO3 A;  1Q42 A;  3HZP A;  2M7O A;  1IQX A;  1RDS A;  3SOA A;  1BAO A;  1O7M B;  4K1U A;  1Q7H A;  1LVN A;  1RMS A;  1BRK A;  2INX A;  1GMQ A;  5IEN A;  3EB8 A;  3D3L A;  1JB5 A;  4KFD A;  2Z7A A;  3G71 3;  4HM3 B;  4BL3 A;  3LTB A;  3U1W A;  1TIJ A;  3WDG B;  1UGI A;  5IW9 A;  3DGY A;  1I2E A;  2PZV A;  4LEH A;  5IER A;  1HZ1 A;  2HML B;  1ZO2 A;  2H0G A;  1JZO A;  1Q9E A;  1YI2 3;  3S28 A;  1Q81 4;  3DGM A;  2OTJ 3;  1YNV X;  1GOU A;  2PNC A;  3AGN A;  3KE7 A;  2L4V A;  1EA2 A;  1A2K A;  4HM8 B;  1I70 A;  3K5T A;  3RGA A;  1IDP A;  1W6C A;  2W9P A;  1JJ2 2;  1QVF 2;  1TFK A;  3I56 3;  4HVN A;  4L8O A;  1UCL A;  1FGO A;  2HOH A;  2IY2 A;  1GD4 A;  4I4K A;  3L0R A;  2QEX 3;  1QAF A;  1B20 A;  2CHC A;  2XH9 A;  2Y74 A;  3LT9 A;  3Q2P A;  5EVH A;  3F8X A;  3T0U A;  1RJO A;  2KF5 A;  3VGN A;  2XSO B;  2K54 A;  3UJM A;  5AIH A;  1BUJ A;  3HOH A;  1O7N B;  3N8B A;  3EN1 B;  1RTU A;  1W02 A;  4BL2 A;  4IIA A;  4BIR A;  1GOY A;  3CME 3;  1A2V A;  4NPB A;  3I55 3;  1T5Y A;  1X1X A;  4K1V A;  3QRD A;  1QMA A;  3CCJ 3;  1FZU A;  1BNR A;  2RBI A;  1CQS A;  3SED A;  1F8N A;  9RNT A;  2QIY A;  3OX9 A;  1YJW 3;  1YJN 3;  2P0M A;  2CFK A;  1JNQ A;  4X2H A;  3NUV A;  2Q07 A;  1V74 A;  1RGC A;  3DM8 A;  1D6U A;  1W4N A;  2KAA A;  2UUG C;  2P09 A;  3KZT A;  1BSC A;  3D5G A;  4J9A A;  3MHE A;  3H3H A;  1D6Y A;  1TUH A;  1TRP A;  3STD A;  1RN4 A;  5IEO A;  4XDW A;  5KP4 A;  1O7H B;  5M18 A;  3CC4 3;  4N6O B;  3T8U A;  2RNT A;  5HOH A;  1WTH A;  2F5M A;  2OOV C;  1LRA A;  2OOV A;  3CC2 3;  4FMA A;  8RNT A;  3EE1 A;  2XFS A;  4H3U A;  4EXR A;  1VQN 3;  1IYY A;  3HI7 A;  4HBR A;  1TFO A;  1BGS A;  2RGQ A;  1BSD A;  2GU3 A;  3V98 A;  1OGX A;  3MG3 A;  4FCZ A;  4J5G A;  3V92 A;  4WHA A;  1UDI I;  2WGQ A;  3F40 A;  1UI7 A;  2B1X B;  2XFT A;  4JF8 A;  2Y73 A;  4NHF A;  1IK3 A;  1E97 A;  1X1W A;  4HM0 B;  2K3D A;  4N6L A;  5M1A A;  4XB5 A;  1Z1S A;  1KC8 4;  2D1W A;  3HX8 A;  1SJW A;  2CFL A;  3KCH A;  3PGB A;  2GSP A;  1YVS A;  1K9M 4;  1LOY A;  1G02 A;  1BNG A;  3LT8 A;  5FGO A;  4U13 A;  3JUP A;  1OGZ A;  3I0Y A;  1FYS A;  4J5K A;  5AYS C;  1A2P A;  5CF1 A;  1PY3 A;  3NQZ A;  7GSP A;  1GS3 A;  1GMP A;  2F98 A;  3LXU X;  2CFG A;  1RCK A;  4X2O A;  3NHX A;  2O9U X;  2WOF A;  1YIJ 3;  3FF0 A;  4H61 A;  2I9W A;  3OWY A;  2ZL8 A;  2YFJ B;  3F7S A;  1BRJ A;  5HGR A;  2CX1 A;  1BRS A;  5KP1 A;  1IVX A;  3CCE 3;  1K8A 4;  4O2H A;  2HMN B;  3BLZ A;  3SX1 A;  3DMC A; 
#chains in the Genus database with same CATH homology
 4MJD A;  2GU1 A;  3B8L A;  1W2B 2;  1Y4K A;  3PS8 A;  1IT8 A;  1WMO A;  2KXG A;  1SIH A;  1VQP 3;  1IVW A;  1FA3 A;  5IF6 A;  1SII A;  1D6Z A;  1CEW I;  1W6G A;  3G16 A;  3NV0 A;  2WGO A;  3OV4 A;  3NV0 B;  3LTA A;  1KD1 4;  1IU7 A;  3GZY B;  2CWU A;  1UW1 A;  1OHO A;  3EC9 A;  3CMA 3;  3MKI A;  1FGR A;  1IV9 A;  3WOE B;  3S29 A;  1N9J A;  2BMQ B;  3NBB A;  5STD A;  2CWV A;  3UNL A;  3NQY A;  1IQ8 A;  1GD3 A;  4MMZ B;  5LC6 A;  1OUN A;  1DMQ A;  1W2Z A;  4LSO A;  3DXO A;  1VQM 3;  1YVB I;  3FG1 A;  2IUJ A;  1LOX A;  1ASK A;  1WNH A;  2BO9 B;  2W2C A;  1TU5 A;  4QWT A;  4CCV A;  2W6J H;  1YGE A;  4ZM8 A;  3S67 A;  1FUW A;  1HU9 A;  1W6Y A;  3FG4 A;  3EQQ B;  4N3V A;  4BTW A;  2OQE C;  1AVL A;  4OK0 A;  2OQE A;  4TX4 A;  4WYK A;  4WYK B;  2BMO B;  1GY6 A;  2WOH A;  3CPO A;  3EHC A;  1NJI 4;  1GY7 A;  4HKV B;  2W56 A;  5AIG A;  1VQ6 3;  5CLK A;  2K0M A;  4AKY A;  3NBJ A;  5IG4 A;  1US1 A;  2W9Q A;  1EKM A;  4MMY B;  1G96 A;  3N9H A;  5IG0 A;  5IEP A;  1BUQ A;  1HKX A;  2O3O A;  3ECF A;  4XDV A;  1K41 A;  5D81 A;  1JKG A;  3G0K A;  1JKG B;  4HM7 B;  1W5Z A;  3EN8 A;  2F86 B;  3FCS B;  3IPT A;  4AKZ A;  3CPW 2;  3CNX A;  3EJV A;  1OAC A;  1VQK 3;  1JB2 A;  1W7C A;  1Q7Y 4;  1N8Q A;  2YFI B;  3X3X A;  3TDG A;  4FCM A;  3OXA A;  4N6V 0;  3UB1 A;  5IG3 A;  1C7H A;  1LNH A;  4EC6 A;  5CF2 A;  3G4S 3;  1K73 4;  3LH4 A;  2CWT A;  1N5P A;  1Q82 4;  3GWR A;  3GAX A;  3EBY A;  2ML5 A;  2CIU A;  3OWU A;  4BTY A;  3JUQ A;  3O8Y A;  1OH0 A;  1UUW B;  2YFL B;  4LMI A;  3FG3 A;  2JDI H;  2JQ5 A;  1FGT A;  2XGN A;  1STF I;  3GRD A;  5EQL A;  3NM7 A;  1E3R A;  2CG1 A;  3BNC A;  3DY5 A;  5BXQ A;  3X42 A;  5CXO A;  3CNM A;  4LZI A;  3FF2 A;  1GY5 A;  3FKA A;  2GBW B;  3B4O A;  3SOY A;  2B24 B;  4K90 B;  3IMA B;  3LTC A;  2FNQ A;  1RN7 A;  2SBL A;  2YX9 A;  3G6E 3;  1M1K 4;  3QK9 A;  3DUK A;  3ALA A;  3VSY A;  4HM5 B;  4OUQ A;  2Z6B A;  3H51 A;  3OWS A;  2Z76 A;  4Q53 A;  3NBR A;  4FMD A;  1O7P B;  1CYV A;  1FGQ A;  4KVH A;  1QVG 2;  3LZA A;  3KSE D;  4J8T A;  1CYU A;  3SVA A;  2RCD A;  2KCD A;  3DGO A;  5AI1 A;  1OCV A;  3X3Z A;  2QGU A;  2MF7 A;  1E3V A;  2P38 A;  4NRE A;  4IPB A;  3NM2 A;  6STD A;  1YIT 3;  3FSD A;  2RSX A;  3MSO A;  3KII A;  2HMO B;  3WOD G;  1M1X B;  2CFD A;  4KZ1 A;  4RNZ A;  3U97 A;  3X40 A;  2C10 A;  3HIG A;  3KN4 A;  5JPP A;  3KKG A;  1QJG A;  1DMM A;  3S5C A;  1U5O A;  4OVM A;  3WA3 A;  3WMD A;  3BB9 A;  2KRT A;  2OCT A;  2CFW A;  3CD6 3;  2BHM A;  1STD A;  5D83 A;  4PEJ A;  1OPY A;  2C11 A;  4R80 A;  2XR8 B;  3FLJ A;  4HM1 B;  4HM4 B;  1NDO B;  1VQ4 3;  1A90 A;  1M9G A;  5DRE A;  1IQY A;  1Q40 A;  3PCR A;  1Q40 B;  3A76 A;  1DVD A;  4EV2 A;  2E2U A;  3LML A;  3KSP A;  2CW9 A;  3LOY A;  1R4C A;  1ULI B;  1NWW A;  5D82 A;  3EBT A;  3GZX B;  3CC7 3;  1EQK A;  1RKY A;  4R9K A;  4K61 A;  4XBX A;  1SQW A;  3M8C A;  3MG1 A;  4XM4 A;  1LXE A;  2XSH B;  1TP6 A;  3MG2 A;  1ZX2 A;  3FZW A;  4R4K A;  1NU3 A;  4ORL A;  2RFR A;  3CCS 3;  1M90 4;  1PFP A;  3ROB A;  4FMC A;  3N54 B;  3ER7 A;  2MC8 A;  1QAK A;  5BVB A;  1EG9 B;  3V99 A;  4WP5 A;  2V1L A;  4EBG A;  4R9L A;  3MWZ A;  1SPU A;  3K9M C;  4N6U A;  2W56 B;  2W03 A;  4EYC A;  5I97 A;  3CCM 3;  5ELJ A;  1MOL A;  1VQO 3;  2P0X A;  4RZM A;  2P05 A;  1W00 A;  4RBN A;  5KP3 A;  1JB4 A;  1KWI A;  2F99 A;  3CCL 3;  1OF5 A;  1VZZ A;  3B7C A;  1OF5 B;  4HZB B;  5CK6 A;  5EEO A;  7STD A;  3D9R A;  2LYX A;  3WA2 X;  3PYJ A;  1VQ5 3;  4RNY A;  2E2T A;  1NB5 I;  1A67 A;  1ROV A;  1WMP A;  2GEX A;  1JRQ A;  2HMJ B;  1AR0 A;  3PCS A;  1VQ8 3;  2GXF A;  3F7X A;  3FGY A;  1UUV B;  2QA4 3;  1S72 3;  4MEI A;  1DMN A;  1QAL A;  2FXT A;  1JN5 A;  2CG0 A;  4GL6 A;  1JN5 B;  1WQL B;  2LQV A;  4LGQ A;  3X3Y A;  2GBX B;  3BNE A;  2E2V A;  4AEQ A;  3UL6 A;  2XGL A;  4FMB A;  1AV4 A;  1O7W B;  1IT7 A;  4L7K A;  4HZ9 B;  4KFF A;  3CCV 3;  4XBY A;  3MYT A;  1YHQ 3;  2BMR B;  2OWP A;  4XBT A;  4CDL A;  1DYU A;  2UX0 A;  4G1M B;  3F8H A;  3MPH A;  1ROA A;  1VQL 3;  4O8S A;  3PZW A;  2HMK B;  3J7Y d;  3HK4 A;  3HII A;  3GZR A;  3KFQ C;  4BTX A;  5JPU A;  3GZB A;  3G8Z A;  1O7G B;  2CC3 A;  2BT3 A;  2FGT A;  3B4P A;  2CKF B;  5AII A;  1UI8 A;  2XRX B;  5AIF A;  3CCU 3;  3FH1 A;  4WWU C;  2A15 A;  5ELU A;  1IVV A;  1VQ7 3;  3DZL A;  1FGM A;  8CHO A;  5IG5 A;  4HM6 B;  1N9E A;  1JV2 B;  5DRV A;  3UL5 A;  4HYZ A;  3T8N A;  2Z77 A;  5G2G A;  1AVK A;  2XEP A;  3OW2 2;  1J2B A;  5FW5 A;  3K0Z A;  4HJL B;  4O02 B;  3BNB A;  3K63 A;  1K28 A;  5LC7 A;  4L8P A;  4KFE A;  3Q90 A;  3SLU A;  5JBS A;  2ZDJ A;  3IJE B;  4STD A;  3JUN A;  4IT7 A;  2IMJ A;  1YJ9 3;  2CK3 H;  2STD A;  5TGN A;  2CH9 A;  2GEY A;  2BNG A;  1IVU A;  4FR9 A;  3PXM A;  3EX9 A;  3K7C A;  2D42 A;  3E99 A;  3SXX A;  3JUO A;  1ISK A;  4WFO A;  1S5A A;  1VQ9 3;  3LTD A;  1KSI A;  2ML6 A;  1DVC A;  3F14 A;  3S27 A;  1GYB A;  3DGN A;  3Q1C A;  3VF1 A;  1KQS 2;  1U8C B;  3CCR 3;  5A0O B;  3LYG A;  1OHS A;  1W01 A;  2R4I A;  2XF3 A;  3AMO A;  3AMO B;  4EV5 A;  2HMM B;  4JRF A;  1L5G B;  2W04 A;  4N6T A;  1MNL A;  3NX0 A;  4GB5 A;  1IV7 A;  3CCQ 3;  3JVC A;  5AYR B;  1WMN A;  1OHP A;  4MMX B;  1ULJ B;  1N8R 4;  1RRH A;  3EF8 A;  3F9S A;  3DGL A;  4FCJ A;  3BND A;  1NB3 I;  4N6M A;  5AEU B;  1PU4 A;  4R1K A;  2IA7 A;  3RGR A;  3CXC 2;  2WO0 A;  5AEW B;  4O3V A;  2W0Q A;  1Q86 4;  3JUM A;  2OTL 3;  3WOF B;  2IUK A;  3X41 A;  4HM2 B;  3NXJ A;  1RRL A;  1N5H A;  3CU3 A;  3RDE A;  4N6N B;  1NO3 A;  1Q42 A;  3HZP A;  2M7O A;  1IQX A;  3SOA A;  1O7M B;  4K1U A;  1LVN A;  2INX A;  5IEN A;  3EB8 A;  3D3L A;  1JB5 A;  4KFD A;  2Z7A A;  3G71 3;  4HM3 B;  3LTB A;  3U1W A;  1TIJ A;  3WDG B;  5IW9 A;  2PZV A;  4LEH A;  5IER A;  2HML B;  1ZO2 A;  1YI2 3;  1Q81 4;  3S28 A;  3DGM A;  2OTJ 3;  2PNC A;  3KE7 A;  2L4V A;  1EA2 A;  1A2K A;  4HM8 B;  3K5T A;  3RGA A;  1IDP A;  1W6C A;  2W9P A;  1JJ2 2;  1QVF 2;  1TFK A;  3I56 3;  4HVN A;  4L8O A;  1FGO A;  1GD4 A;  4I4K A;  3L0R A;  2QEX 3;  1QAF A;  2CHC A;  2XH9 A;  2Y74 A;  3LT9 A;  3Q2P A;  5EVH A;  3F8X A;  3T0U A;  1RJO A;  3VGN A;  2XSO B;  2K54 A;  3UJM A;  5AIH A;  1O7N B;  3N8B A;  3EN1 B;  1W02 A;  4IIA A;  3CME 3;  1A2V A;  3I55 3;  1T5Y A;  4K1V A;  3QRD A;  1QMA A;  3CCJ 3;  1CQS A;  3SED A;  1F8N A;  2QIY A;  3OX9 A;  1YJW 3;  1YJN 3;  2P0M A;  2CFK A;  1JNQ A;  4X2H A;  3NUV A;  2Q07 A;  1V74 A;  3DM8 A;  1D6U A;  1W4N A;  2P09 A;  3KZT A;  4J9A A;  3MHE A;  3H3H A;  1D6Y A;  1TUH A;  3STD A;  5KP4 A;  5IEO A;  3CC4 3;  4XDW A;  1O7H B;  4N6O B;  3T8U A;  1WTH A;  2OOV C;  2OOV A;  3CC2 3;  4FMA A;  3EE1 A;  2XFS A;  4H3U A;  4EXR A;  1VQN 3;  3HI7 A;  4HBR A;  1TFO A;  2RGQ A;  3V98 A;  2GU3 A;  1OGX A;  3MG3 A;  4FCZ A;  3V92 A;  4WHA A;  2WGQ A;  3F40 A;  1UI7 A;  2B1X B;  2XFT A;  4JF8 A;  2Y73 A;  4NHF A;  1IK3 A;  1E97 A;  4HM0 B;  4N6L A;  4XB5 A;  1Z1S A;  1KC8 4;  2D1W A;  3HX8 A;  1SJW A;  2CFL A;  3PGB A;  1K9M 4;  3LT8 A;  5FGO A;  4U13 A;  3JUP A;  1OGZ A;  3I0Y A;  5AYS C;  5CF1 A;  3NQZ A;  1GS3 A;  3LXU X;  2F98 A;  2CFG A;  4X2O A;  3NHX A;  2O9U X;  2WOF A;  1YIJ 3;  3FF0 A;  4H61 A;  2I9W A;  3OWY A;  2ZL8 A;  2YFJ B;  3F7S A;  5HGR A;  5KP1 A;  1K8A 4;  1IVX A;  3CCE 3;  4O2H A;  2HMN B;  3BLZ A;  3SX1 A;  3DMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...