3KKGA

Crystal structure of putative snoal-like polyketide cyclase (yp_509242.1) from jannaschia sp. ccs1 at 1.40 a resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
144
structure length
143
Chain Sequence
GQDRSPIEQNVETVLRLFDEGWGAQDGWRDVWRETMTPGFRSIFHSNQAVEGIEQAIAFNAVLFEGFPRLEVVVENVTVEGDNVVVQARLTGAQDGPFLGVPPSGQMVDVPDVTLFTLADGQVIEMRYFTDLLAVMTAISAPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative SnoaL-like polyketide cyclase
publication title Crystal structure of Putative SnoaL-like polyketide cyclase (YP_509242.1) from Jannaschia Sp. CCS1 at 1.40 A resolution
rcsb
source organism Jannaschia sp.
total genus 39
structure length 143
sequence length 144
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3kkgA00
5KP3A 3HK4A 3HZPA 4ORLA 3S5CA 5AEUB 2F99A 1JKGB 3OWSA 1JKGA 3IPTA 3ECFA 3M8CA 1ZO2A 3GRDA 5BVBA 2HMKB 3I0YA 1A2KA 1UUVB 4CDLA 1E97A 1JB2A 2INXA 3FH1A 3NM2A 3LYGA 3MSOA 3SOYA 2GBXB 4L8OA 3F7XA 3K7CA 4R9LA 1O7MB 2XR8B 1JB5A 3F40A 1O7PB 4R1KA 3FLJA 5AIFA 2RCDA 4XDWA 5DREA 1E3RA 5G2GA 4HM3B 3BLZA 2Z7AA 5IEOA 1WQLB 1DMNA 2B24B 3MG2A 6STDA 4HM0B 1Z1SA 5FW5A 3OX9A 2CKFB 3MKIA 3JUQA 4HM2B 1OGXA 4H3UA 3VSYA 1GY7A 4LEHA 3HX8A 3JUMA 1ULJB 5CF1A 4HM5B 1S5AA 3EHCA 4X2HA 3Q90A 4HVNA 4HZBB 4K1VA 1W00A 3F7SA 2XRXB 5IG4A 3NHXA 4XB5A 3NBRA 1GY6A 4XDVA 1JN5B 1O7HB 1IDPA 3FZWA 1UUWB 1JN5A 4X2OA 4XM4A 2HMNB 1NU3A 1C7HA 3KSPA 1JB4A 5TGNA 5CLKA 3OV4A 2R4IA 1AR0A 5STDA 5IENA 3JUNA 3MG1A 2GXFA 1NDOB 4XBXA 3H51A 3ROBA 4L7KA 3F14A 3VGNA 1ISKA 1HKXA 1W01A 1DMMA 5DRVA 2K54A 2CHCA 2XSOB 3SOAA 5IG0A 3CPOA 3STDA 4GB5A 2BMRB 2QGUA 2GEYA 3UJMA 1O7WB 3FGYA 1GYBA 5IG3A 4OVMA 1O7GB 1DMQA 4K1UA 3ER7A 4Q53A 3T8NA 3G8ZA 3D9RA 5AI1A 3CNXA 3GZYB 3E99A 4HKVB 2BMOB 5HGRA 3B4OA 3WMDA 1QJGA 3NUVA 1TUHA 2HMOB 4LGQA 4HZ9B 1SJWA 4N3VA 1OHPA 3B4PA 2UX0A 1OH0A 1ZX2A 3EN1B 2PZVA 5CK6A 2XSHB 2HMMB 2Z77A 4RZMA 5D82A 3CU3A 2IMJA 3EF8A 4HM8B 1OHOA 1OHSA 5AIGA 3JUOA 1GY5A 4HM1B 4HM6B 5CF2A 3CNMA 5IF6A 4WWUC 1BUQA 4LMIA 4WYKB 1U5OA 2RGQA 4WYKA 3FF0A 2QIYA 2I9WA 3EBYA 1E3VA 4HJLB 3MYTA 4I4KA 7STDA 3FSDA 1OUNA 3EBTA 3G16A 4OUQA 3NXJA 2GEXA 2B1XB 5D81A 2GBWB 3G0KA 2W2CA 1OF5B 5EVHA 1O7NB 1OF5A 3JUPA 4J9AA 3DZLA 1STDA 3F8XA 1EG9B 3F9SA 1NWWA 5IG5A 3B7CA 3EC9A 5AIIA 1ASKA 3GZXB 3FKAA 2YFJB 3DXOA 2Z76A 4J8TA 3LZAA 3DM8A 1W6YA 2BNGA 3OWUA 4XBTA 4FCJA 5IEPA 5AIHA 1Q40B 3DMCA 3H3HA 1Q40A 3GZBA 3DUKA 3RGRA 5IERA 3FF2A 3MHEA 4FCMA 4L8PA 2HMJB 3A76A 3GZRA 3RGAA 4XBYA 3BB9A 3OXAA 5AEWB 3EJVA 3GWRA 3KZTA 2JQ5A 4R9KA 4MJDA 3B8LA 3SEDA 3T8UA 1K41A 3NV0B 4U13A 3KE7A 3NV0A 2BMQB 5BXQA 5JPPA 1VZZA 5KP1A 4PEJA 2F86B 3F8HA 1CQSA 3OWYA 1GS3A 4HM7B 2F98A 3K0ZA 3KKGA 5D83A 3UNLA 1ULIB 4WP5A 2YFIB 1Q42A 2YFLB 5JPUA 2STDA 3EN8A 5CXOA 3MG3A 1EA2A 1OCVA 4HM4B 4IIAA 4STDA 1TP6A 1QMAA 2RFRA 1W02A 8CHOA 4KVHA 2OWPA 2A15A 1OGZA 5KP4A 3EQQB 3EX9A 2HMLB 1OPYA
chains in the Genus database with same CATH superfamily
5KP3A 3HK4A 1KQS2 3BNDA 3HZPA 4ORLA 3S5CA 8RNTA 5AEUB 2F99A 4QWTA 1MWRA 1V57A 3O8YA 1SPUA 1UUGB 3D4AA 3DGNA 1JKGB 4RNTA 1YVSA 2KF4A 3OWSA 1BUJA 1JKGA 1SARA 4GHOA 3IPTA 3ECFA 4R80A 1BANA 2F56A 2BT3A 3M8CA 1ZO2A 1YNVX 1HYFA 3GRDA 1DVDA 2F5MA 5BVBA 2HMKB 3SVAA 5M1AA 3AGOA 3I0YA 3ZFZA 1X1YA 1G96A 1IT7A 1A2KA 3MPHA 2CFKA 1UUVB 2WOFA 4N6MA 7RNTA 4CDLA 1VQK3 2OTL3 1LXEA 1UW1A 3CMA3 2OOVC 1E97A 1YGEA 3EB8A 4GSPA 1JB2A 2INXA 1N8QA 1I2GA 3FH1A 2UGIA 4RBNA 1QVG2 1BAOA 1GMPA 4N6OB 1W2ZA 1NJI4 1D6UA 3X3XA 1RGAA 1VQM3 3NM2A 3N9HA 3X40A 2QA43 2OTJ3 3LYGA 1GOUA 4O2HA 1FGQA 3MSOA 1MOLA 3SOYA 2GBXB 3LXUX 1TTOA 4MMZB 1SIHA 4L8OA 3J7Yd 3CD63 1M1XB 3F7XA 1YGWA 3K7CA 1JV2B 4FMCA 4CCVA 1QAFA 4R9LA 1O7MB 2XR8B 3KSED 2ZL8A 1JB5A 1VQ83 1FUSA 4MMXB 3F40A 1I2FA 2MF7A 1O7PB 1LNIA 5AYSC 4R1KA 1CYVA 3FLJA 5AIFA 4IT7A 3D79A 1T3BA 2RCDA 1CH0A 4XDWA 1BNFA 2OOVA 3PYJA 5DREA 2CX1A 1E3RA 2GU1A 3BNEA 3FG4A 1SQWA 2BO9B 5G2GA 1LVNA 1BSEA 1US1A 4HM3B 3BLZA 4NPBA 2CG1A 2ZHXB 2Z7AA 5IEOA 4H61A 1WQLB 3K63A 1YJN3 1GD3A 1DMNA 2B24B 3MG2A 6STDA 4HM0B 1UGHI 1C54A 2OCTA 1Z1SA 2ZA4A 5FW5A 3NBJA 2IYJA 2V1LA 1ROAA 3OX9A 2CKFB 1BU4A 1W6GA 2LQVA 1JJ22 2C11A 4J5GA 3MKIA 3JUQA 4HM2B 1OGXA 4H3UA 3VSYA 1GY7A 3GSPA 1MWUA 4LEHA 3CCE3 5M18A 4JRFA 1JBSA 3N54B 1UCKA 1V58A 3HI7A 3WOFB 3HX8A 3JUMA 1X1WA 1ULJB 3AHWA 4HM5B 5CF1A 1T2IA 1RLSA 5RNTA 1S5AA 2WOHA 1VQ43 1B2UA 4N6LA 1B27A 3EHCA 1BRJA 2CH9A 2P05A 4X2HA 3Q90A 3CCR3 4HVNA 1AV4A 3WDGB 1SIIA 4HZBB 3CCJ3 1CEWI 3I553 4K1VA 3BU4A 1W00A 3F7SA 1IQYA 2XRXB 2J8XB 5IG4A 3NHXA 5BU4A 3KCHA 1EUIC 1FGRA 2YX9A 3NQZA 4XB5A 1T5YA 3NBRA 1GY6A 1JN5B 2K3DA 2WO0A 1O7HB 4XDVA 3CC23 1IDPA 3FZWA 3S27A 1UUWB 1GD4A 1JN5A 1BRIA 4BL3A 3SLUA 3FG3A 3I563 1JZDA 2RSXA 2O3OA 2FGTA 4X2OA 1DVCA 2IA7A 2Q07A 4XM4A 3LH4A 2MC8A 3QRDA 3CC43 2HMNB 3QK9A 3CME3 1NU3A 4EV2A 3X3YA 2H0HA 1TRQA 1MWTA 1BOXA 2F5WA 1C7HA 3JVCA 1BRGA 3KSPA 1W4NA 1JB4A 1UCLA 5TGNA 1IYYA 1M9GA 1BGSA 5CLKA 3PZWA 3NBBA 3D5IA 3OV4A 2R4IA 4WHAA 1AR0A 1LOWA 5STDA 5IENA 1BNIA 1BSAA 1RTUA 2P38A 1BVIA 3BNBA 3JUNA 1R4YA 3MG1A 2GXFA 1EQKA 1NDOB 3GAXA 1N5HA 3Q2PA 4XBXA 3H51A 1YJ93 1RKYA 1YIJ3 1RRHA 4N6V0 1GOYA 3ROBA 1KSIA 1RCKA 4L7KA 3F14A 4N6NB 4N6TA 1GSPA 2CWUA 1N9EA 3VGNA 1ISKA 1HKXA 2FNQA 3WR2A 1ROVA 1W01A 2WGQA 4O8SA 1DMMA 3U1WA 3CPW2 5DRVA 2K54A 2CHCA 2XSOB 5ELJA 3SOAA 1A90A 4I5QA 3X3ZA 4BIRA 1NB5I 5IG0A 3CPOA 1B3SA 2W56B 3PXMA 1TFOA 3CCM3 4TX4A 1LOYA 4WFOA 4ILFA 2W56A 1GMRA 2K0MA 3STDA 1AVLA 3UB1A 3V99A 4GB5A 2BMRB 2QGUA 2WGOA 1BNRA 1J2BA 2GEYA 3UJMA 3DGLA 1JNQA 3OW22 1O7WB 3PCRA 1BNGA 5GSPA 3FGYA 5BIRA 1TJDA 2CX0A 4CPKA 2XH9A 1FA3A 2H0IA 1GYBA 1LOXA 5IG3A 1IV9A 4O3VA 4OVMA 6GSPA 1O7GB 1UI7A 1DMQA 1D6YA 4K1UA 1VQP3 1RGFA 3ER7A 4Q53A 3T8NA 3S28A 1W7CA 3G8ZA 1B21A 3DGYA 4O02B 1LNHA 2RBIA 3D9RA 2KF5A 1UCJA 3CNXA 1BSDA 5AI1A 3RDEA 3GZYB 1B20A 1HU9A 3E99A 1YI23 2P09A 1JRQA 2C4BA 2CC3A 1G02A 1WMPA 4CJNA 1MWSA 2XGLA 4HKVB 2KXGA 2BMOB 1DE3A 2FXTA 1B2SA 1UCIA 2AADA 3B4OA 5HGRA 3WMDA 1QJGA 1HZ1A 3RNTA 1T2HA 3NM7A 4J5KA 2E2VA 3U97A 3NUVA 3ZG0A 1IVVA 1TUHA 2HMOB 4LGQA 1MGRA 1I3IA 4EV5A 4HZ9B 1SJWA 1F8NA 4AKYA 1NO3A 4G1MB 4N3VA 1L5GB 3LMLA 1YHQ3 4IPBA 3V92A 3X41A 5LC6A 1FGTA 1OHPA 3DH2A 2E2UA 3B4PA 1JBRA 2UX0A 3LTCA 4BTYA 1OH0A 3ZG5A 3CXC2 2C10A 1LOVA 3ALAA 1ZX2A 1QAKA 1TU5A 5ELUA 1B2MA 3EN1B 2AAEA 2PZVA 5CK6A 2XSHB 2HMMB 2CFWA 4OK0A 2RNTA 5G1LA 3AGNA 2Z77A 4RZMA 4KZ1A 3WODG 4HOHA 4FMAA 5D82A 4EYCA 1U8CB 3CU3A 2W04A 4FCZA 3URPA 3DY5A 9RNTA 1KC84 2CG0A 2IMJA 3AHSA 3EF8A 5M19A 2SARA 1V74A 1WMOA 2W9QA 1OHOA 1OHSA 4HM8B 2IUKA 5AIGA 4ZM8A 3CCU3 3JUOA 1GY5A 3PCSA 3SX1A 1A2PA 1WTHA 2GSPA 3DGOA 4HM1B 1WNHA 3PGBA 1I2EA 4HM6B 1B2XA 1IT8A 1RCLA 2IY2A 3V98A 2W9PA 4RNZA 5CF2A 4EBGA 3CNMA 1OACA 6RNTA 2H0GA 1TRPA 3IJEB 5IF6A 3G6E3 3VF1A 4WWUC 1EEJA 2GU3A 1BUQA 4FR9A 4LMIA 1NNVA 1IVWA 1Q7Y4 4WYKB 3D5GA 1RN1A 4BTXA 1RGEA 1U5OA 5LC7A 1W5ZA 2KRTA 2RGQA 4WYKA 3FF0A 2M7OA 1RGKA 2QIYA 4KFDA 1VQL3 1BSBA 1IU7A 2I9WA 3EBYA 1D6ZA 3CC73 1E3VA 3AMOB 1VQ63 4HJLB 1BRNL 3MYTA 3AMOA 4FMBA 1MGWA 1VQQA 4I4KA 1FYSA 1A67A 7STDA 5JBSA 2BHMA 3FSDA 1OUNA 3EBTA 3G16A 4OUQA 1EKMA 4BTWA 1NB3I 2CFLA 1K734 1FGMA 3NXJA 2GEXA 4EC6A 2B1XB 4AKZA 5D81A 3WHOA 2GBWB 3CCS3 1AVKA 3G0KA 1N5PA 1VQO3 2CFDA 2W2CA 1OF5B 5EVHA 1I70A 2IUJA 3Q3FA 2R41A 2W6JH 1O7NB 3SXXA 1OF5A 3KFQC 2W0QA 1AQZA 3BNCA 1VQ93 2CW9A 4LZIA 4DKIA 4HAAA 2KCDA 4KFEA 3WA3A 1LQMB 3JUPA 2O9UX 4HBRA 3S29A 3TDGA 3CCL3 1UDII 4NREA 4J9AA 3DZLA 1STDA 3F8XA 4BU4A 3S67A 1MNLA 4HYZA 1IV7A 1EG9B 3F9SA 1N8R4 2PNCA 2D42A 1NWWA 3DGMA 5IG5A 1RGGA 3SYUA 3WOEB 4LSOA 2JDIH 1RHLA 2XF3A 1YVBI 3B7CA 3EC9A 1VQ73 1STFI 3D3LA 1BNEA 1BIRA 5HOHA 5AIIA 3CCV3 1ASKA 1QALA 4KFFA 1ZGXA 3K5TA 3GZXB 1X1XA 3FKAA 5A0OB 2CK3H 2YFJB 4R4KA 3DXOA 1BNSA 2Z76A 4J8TA 3L0RA 3LZAA 1K9M4 1FUTA 3DM8A 1PU4A 1BSCA 1WMNA 4BL2A 1W6YA 1ZS7A 2E2TA 1VQN3 2ML6A 4EW5A 2OQEC 1BRHA 4LYLB 5FGOA 2QEX3 3EE1A 2ZDJA 2BNGA 1RDSA 1I0XA 2F4YA 3OWUA 2CFGA 2XGNA 4XBTA 4FCJA 5IEPA 5AIHA 1A2VA 3IMAB 3X42A 1Q40B 3DMCA 3H3HA 3LTBA 1W6CA 5AYRB 1Q40A 3GZBA 1RJOA 1PFPA 3DUKA 3RGRA 1M904 5IERA 1IVXA 3FF2A 3MHEA 4FCMA 4L8PA 2HMJB 3A76A 2Y73A 1Y4KA 4JF8A 2KF3A 2UUGC 1RGHA 3A5EA 3GZRA 1RNBA 3RGAA 2ML5A 4XBYA 1IK3A 3BB9A 1LRAA 3OXAA 1UI8A 5AEWB 3HOHA 1K28A 3EJVA 1GMQA 1RRLA 1S723 7GSPA 3GWRA 2CWVA 2OQEA 3KZTA 2HOHA 2JQ5A 4MEIA 1TFKA 4R9KA 1K8A4 4MJDA 1Q864 3B8LA 3LT8A 3SEDA 3T8UA 5IW9A 3NX0A 1YIT3 1K41A 1VQ53 3NV0B 4U13A 3KE7A 3NV0A 1FZUA 2BMQB 2Z6BA 3KIIA 3NQYA 3CCQ3 2Y74A 2BU4A 5BXQA 3LOYA 1GOVA 5JPPA 2W03A 3K9MC 1VZZA 3UL6A 5KP1A 4PEJA 3WA2X 1W2B2 1B2ZA 1JZOA 2F86B 3LTDA 1Q9EA 3F8HA 4RNYA 2CIUA 1CQSA 1I3FA 1YJW3 3OWYA 2CWTA 2XEPA 3G4S3 1RNTA 4NHFA 1M1K4 1RGCA 1RMSA 1RSNA 1IQXA 1GS3A 4HM7B 2F98A 3K0ZA 3KKGA 5D83A 1IQ8A 3UNLA 1PY3A 1ULIB 3LT9A 4MMYB 4K61A 4WP5A 2YFIB 1BRKA 1Q42A 3FCSB 2KAAA 5G1KA 1N9JA 2YFLB 2L1SA 5I97A 5JPUA 2XFSA 2STDA 3LTAA 3EN8A 3MWZA 1RN7A 1RGLA 2BIRA 3HIGA 3T0UA 1BNJA 1KD14 1DYUA 3HIIA 3Q1CA 4K90B 1I0VA 1R4CA 5CXOA 1FGOA 1IVUA 3MG3A 2P0MA 2LYXA 1EA2A 1Q824 1OCVA 1TIJA 4HM4B 3UL5A 4IIAA 5EQLA 4STDA 4FMDA 1FW7A 3G713 1FUWA 1BRSA 1Q7HA 1TP6A 1QMAA 2KF6A 1Q814 1AY7A 1QVF2 2RFRA 4AEQA 4EXRA 3FG1A 2SBLA 1DETA 4N6UA 1CYUA 1KWIA 1W02A 5EEOA 8CHOA 1JBTA 4KVHA 2OWPA 3BIRA 3N8BA 3KN4A 1I8VA 1UGIA 2A15A 1OGZA 2L4VA 1PYLA 2P0XA 5KP4A 4GL6A 4KT3B 1X1UA 3EQQB 1G0TA 2D1WA 1RN4A 3PS8A 3EX9A 2XFTA 2HMLB 1LQGC 1OPYA
chains in the Genus database with same CATH topology
5KP3A 3HK4A 1KQS2 3BNDA 3HZPA 4ORLA 3S5CA 5AEUB 2F99A 4QWTA 3O8YA 1SPUA 3DGNA 1JKGB 3OWSA 1JKGA 3IPTA 3ECFA 4R80A 2BT3A 3M8CA 1ZO2A 3GRDA 1DVDA 5BVBA 2HMKB 3SVAA 3I0YA 1G96A 1IT7A 1A2KA 3MPHA 2CFKA 1UUVB 2WOFA 4N6MA 4CDLA 1VQK3 2OTL3 1LXEA 1UW1A 3CMA3 2OOVC 1E97A 1YGEA 3EB8A 1JB2A 2INXA 1N8QA 3FH1A 4RBNA 1QVG2 4N6OB 1W2ZA 1NJI4 1D6UA 3X3XA 1VQM3 3NM2A 3N9HA 3X40A 2QA43 2OTJ3 3LYGA 4O2HA 1FGQA 3MSOA 1MOLA 3SOYA 2GBXB 3LXUX 4MMZB 1SIHA 4L8OA 3J7Yd 3CD63 1M1XB 3F7XA 3K7CA 1JV2B 4FMCA 4CCVA 1QAFA 4R9LA 1O7MB 2XR8B 3KSED 2ZL8A 1JB5A 1VQ83 4MMXB 3F40A 2MF7A 1O7PB 5AYSC 4R1KA 1CYVA 3FLJA 5AIFA 4IT7A 2RCDA 4XDWA 2OOVA 3PYJA 5DREA 2GU1A 1E3RA 3BNEA 3FG4A 1SQWA 2BO9B 5G2GA 1LVNA 1US1A 4HM3B 3BLZA 2CG1A 2Z7AA 5IEOA 4H61A 1WQLB 3K63A 1YJN3 1GD3A 1DMNA 2B24B 3MG2A 6STDA 4HM0B 2OCTA 1Z1SA 5FW5A 3NBJA 2V1LA 1ROAA 3OX9A 2CKFB 1W6GA 1JJ22 2LQVA 2C11A 3MKIA 3JUQA 4HM2B 1OGXA 4H3UA 3VSYA 1GY7A 4LEHA 3CCE3 4JRFA 3N54B 3HI7A 3WOFB 3HX8A 3JUMA 1ULJB 5CF1A 4HM5B 1S5AA 2WOHA 1VQ43 4N6LA 3EHCA 2CH9A 2P05A 4X2HA 3Q90A 3CCR3 4HVNA 1AV4A 3WDGB 1SIIA 4HZBB 3CCJ3 1CEWI 3I553 4K1VA 1W00A 3F7SA 1IQYA 2XRXB 5IG4A 3NHXA 1FGRA 2YX9A 3NQZA 4XB5A 1T5YA 3NBRA 1GY6A 1JN5B 4XDVA 2WO0A 1O7HB 3CC23 1IDPA 3FZWA 3S27A 1UUWB 1GD4A 1JN5A 3SLUA 3FG3A 3I563 2RSXA 2O3OA 2FGTA 4X2OA 1DVCA 2IA7A 2Q07A 4XM4A 3LH4A 2MC8A 3QRDA 3CC43 2HMNB 3QK9A 3CME3 1NU3A 4EV2A 3X3YA 3JVCA 1C7HA 3KSPA 1W4NA 1JB4A 5TGNA 1M9GA 5CLKA 3PZWA 3NBBA 3OV4A 2R4IA 4WHAA 1AR0A 5STDA 5IENA 3JUNA 2P38A 3BNBA 3MG1A 2GXFA 1EQKA 1NDOB 3GAXA 1N5HA 3Q2PA 4XBXA 3H51A 1YJ93 1RKYA 1YIJ3 1RRHA 4N6V0 3ROBA 1KSIA 4L7KA 3F14A 4N6NB 4N6TA 2CWUA 1N9EA 3VGNA 1ISKA 1HKXA 2FNQA 1ROVA 1W01A 2WGQA 4O8SA 1DMMA 3U1WA 3CPW2 5DRVA 2K54A 2CHCA 2XSOB 5ELJA 3SOAA 1A90A 1NB5I 3X3ZA 5IG0A 3CPOA 2W56B 3PXMA 1TFOA 3CCM3 4TX4A 4WFOA 2W56A 2K0MA 3STDA 1AVLA 3UB1A 3V99A 4GB5A 2BMRB 2QGUA 2WGOA 1J2BA 2GEYA 3UJMA 3DGLA 1JNQA 3OW22 1O7WB 3PCRA 3FGYA 2XH9A 1FA3A 1GYBA 1LOXA 5IG3A 1IV9A 4O3VA 4OVMA 1O7GB 1UI7A 1DMQA 1D6YA 4K1UA 1VQP3 3ER7A 4Q53A 3T8NA 3S28A 1W7CA 3G8ZA 4O02B 1LNHA 3D9RA 5AI1A 3CNXA 3RDEA 3GZYB 1HU9A 3E99A 1YI23 2P09A 1JRQA 2CC3A 1WMPA 2XGLA 4HKVB 2KXGA 2BMOB 2FXTA 5HGRA 3B4OA 3WMDA 1QJGA 3NM7A 2E2VA 3U97A 3NUVA 1IVVA 1TUHA 2HMOB 4LGQA 4EV5A 4HZ9B 1SJWA 1F8NA 4AKYA 1NO3A 4G1MB 4N3VA 1L5GB 3LMLA 1YHQ3 4IPBA 3V92A 3X41A 5LC6A 1FGTA 1OHPA 2E2UA 3B4PA 2UX0A 3LTCA 4BTYA 1OH0A 3CXC2 2C10A 3ALAA 1ZX2A 1QAKA 1TU5A 5ELUA 3EN1B 2PZVA 5CK6A 2XSHB 2HMMB 2CFWA 4OK0A 2Z77A 4RZMA 4KZ1A 3WODG 4FMAA 5D82A 4EYCA 1U8CB 3CU3A 2W04A 4FCZA 1KC84 3DY5A 2CG0A 2IMJA 3EF8A 1V74A 1WMOA 2W9QA 1OHOA 1OHSA 4HM8B 2IUKA 5AIGA 4ZM8A 3CCU3 3JUOA 1GY5A 3PCSA 3SX1A 3DGOA 1WTHA 4HM1B 4HM6B 3V98A 1WNHA 3PGBA 3CCS3 1IT8A 2W9PA 4RNZA 5CF2A 4EBGA 3CNMA 1OACA 3IJEB 5IF6A 3G6E3 3VF1A 4WWUC 2GU3A 1BUQA 4FR9A 4LMIA 1IVWA 1Q7Y4 4WYKB 4BTXA 1U5OA 5LC7A 1W5ZA 2KRTA 2RGQA 4WYKA 3FF0A 2M7OA 2QIYA 4KFDA 1VQL3 1IU7A 2I9WA 3EBYA 1D6ZA 3CC73 1E3VA 3AMOB 1VQ63 4HJLB 3MYTA 3AMOA 4FMBA 4I4KA 1A67A 7STDA 5JBSA 2BHMA 3FSDA 1OUNA 3EBTA 3G16A 4OUQA 1EKMA 4BTWA 1NB3I 2CFLA 1K734 1FGMA 3NXJA 2GEXA 4EC6A 2B1XB 4AKZA 5D81A 2GBWB 1AVKA 3G0KA 1N5PA 1VQO3 2CFDA 2W2CA 1OF5B 5EVHA 2IUJA 2W6JH 1O7NB 3SXXA 1OF5A 3KFQC 2W0QA 3BNCA 1VQ93 2CW9A 4LZIA 2KCDA 4KFEA 3WA3A 4HBRA 3JUPA 2O9UX 3S29A 3TDGA 4NREA 4J9AA 3DZLA 1STDA 3F8XA 3S67A 1MNLA 4HYZA 1IV7A 1EG9B 3F9SA 1N8R4 2PNCA 2D42A 1NWWA 3DGMA 5IG5A 3WOEB 4LSOA 2JDIH 3B7CA 2XF3A 1YVBI 3EC9A 1VQ73 1STFI 3D3LA 5AIIA 3CCV3 1ASKA 1QALA 4KFFA 3K5TA 3GZXB 3FKAA 5A0OB 2CK3H 2YFJB 4R4KA 3DXOA 2Z76A 4J8TA 3L0RA 3LZAA 1K9M4 3DM8A 1PU4A 1WMNA 1W6YA 2E2TA 1VQN3 2ML6A 2OQEC 5FGOA 2QEX3 3EE1A 2ZDJA 2BNGA 3CCL3 3OWUA 4XBTA 2CFGA 2XGNA 4FCJA 5IEPA 5AIHA 1A2VA 3IMAB 3X42A 1Q40B 3DMCA 3H3HA 3LTBA 1W6CA 5AYRB 1Q40A 3GZBA 1RJOA 1PFPA 3DUKA 3RGRA 1M904 5IERA 1IVXA 3FF2A 3MHEA 4FCMA 4L8PA 2HMJB 3A76A 2Y73A 1Y4KA 4JF8A 3GZRA 3RGAA 2ML5A 4XBYA 1IK3A 3BB9A 3OXAA 1UI8A 5AEWB 1K28A 3EJVA 1RRLA 1S723 3GWRA 2CWVA 2OQEA 3KZTA 2JQ5A 4MEIA 1TFKA 4R9KA 1K8A4 4MJDA 1Q864 3B8LA 3LT8A 3SEDA 3T8UA 5IW9A 3NX0A 1YIT3 1K41A 1VQ53 3NV0B 4U13A 3KE7A 3NV0A 2BMQB 2Z6BA 3KIIA 3NQYA 3CCQ3 2Y74A 5BXQA 3LOYA 5JPPA 2W03A 3K9MC 1VZZA 3UL6A 5KP1A 4PEJA 3WA2X 1W2B2 2F86B 3LTDA 3F8HA 4RNYA 2CIUA 1CQSA 1YJW3 3OWYA 2CWTA 2XEPA 3G4S3 4NHFA 1M1K4 1IQXA 1GS3A 4HM7B 2F98A 3K0ZA 3KKGA 5D83A 1IQ8A 3UNLA 1ULIB 3LT9A 4MMYB 4K61A 4WP5A 2YFIB 1Q42A 3FCSB 1N9JA 2YFLB 5I97A 5JPUA 2XFSA 2STDA 3LTAA 3EN8A 3MWZA 1RN7A 3HIGA 3T0UA 1KD14 1DYUA 3HIIA 3Q1CA 4K90B 1R4CA 5CXOA 1FGOA 1IVUA 3MG3A 2P0MA 2LYXA 1EA2A 1Q824 1OCVA 1TIJA 4HM4B 3UL5A 4IIAA 5EQLA 4STDA 4FMDA 3G713 1FUWA 1TP6A 1QMAA 1Q814 1QVF2 2RFRA 4AEQA 4EXRA 3FG1A 2SBLA 4N6UA 1CYUA 1KWIA 1W02A 5EEOA 8CHOA 4KVHA 2OWPA 3N8BA 3KN4A 2A15A 1OGZA 2L4VA 2P0XA 5KP4A 4GL6A 3EQQB 2D1WA 3PS8A 3EX9A 2XFTA 2HMLB 1OPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KP3 A;  3HK4 A;  3HZP A;  4ORL A;  3S5C A;  5AEU B;  2F99 A;  1JKG B;  3OWS A;  1JKG A;  3IPT A;  3ECF A;  3M8C A;  1ZO2 A;  3GRD A;  5BVB A;  2HMK B;  3I0Y A;  1A2K A;  1UUV B;  4CDL A;  1E97 A;  1JB2 A;  2INX A;  3FH1 A;  3NM2 A;  3LYG A;  3MSO A;  3SOY A;  2GBX B;  4L8O A;  3F7X A;  3K7C A;  4R9L A;  1O7M B;  2XR8 B;  1JB5 A;  3F40 A;  1O7P B;  4R1K A;  3FLJ A;  5AIF A;  2RCD A;  4XDW A;  5DRE A;  1E3R A;  5G2G A;  4HM3 B;  3BLZ A;  2Z7A A;  5IEO A;  1WQL B;  1DMN A;  2B24 B;  3MG2 A;  6STD A;  4HM0 B;  1Z1S A;  5FW5 A;  3OX9 A;  2CKF B;  3MKI A;  3JUQ A;  4HM2 B;  1OGX A;  4H3U A;  3VSY A;  1GY7 A;  4LEH A;  3HX8 A;  3JUM A;  1ULJ B;  5CF1 A;  4HM5 B;  1S5A A;  3EHC A;  4X2H A;  3Q90 A;  4HVN A;  4HZB B;  4K1V A;  1W00 A;  3F7S A;  2XRX B;  5IG4 A;  3NHX A;  4XB5 A;  3NBR A;  1GY6 A;  4XDV A;  1JN5 B;  1O7H B;  1IDP A;  3FZW A;  1UUW B;  1JN5 A;  4X2O A;  4XM4 A;  2HMN B;  1NU3 A;  1C7H A;  3KSP A;  1JB4 A;  5TGN A;  5CLK A;  3OV4 A;  2R4I A;  1AR0 A;  5STD A;  5IEN A;  3JUN A;  3MG1 A;  2GXF A;  1NDO B;  4XBX A;  3H51 A;  3ROB A;  4L7K A;  3F14 A;  3VGN A;  1ISK A;  1HKX A;  1W01 A;  1DMM A;  5DRV A;  2K54 A;  2CHC A;  2XSO B;  3SOA A;  5IG0 A;  3CPO A;  3STD A;  4GB5 A;  2BMR B;  2QGU A;  2GEY A;  3UJM A;  1O7W B;  3FGY A;  1GYB A;  5IG3 A;  4OVM A;  1O7G B;  1DMQ A;  4K1U A;  3ER7 A;  4Q53 A;  3T8N A;  3G8Z A;  3D9R A;  5AI1 A;  3CNX A;  3GZY B;  3E99 A;  4HKV B;  2BMO B;  5HGR A;  3B4O A;  3WMD A;  1QJG A;  3NUV A;  1TUH A;  2HMO B;  4LGQ A;  4HZ9 B;  1SJW A;  4N3V A;  1OHP A;  3B4P A;  2UX0 A;  1OH0 A;  1ZX2 A;  3EN1 B;  2PZV A;  5CK6 A;  2XSH B;  2HMM B;  2Z77 A;  4RZM A;  5D82 A;  3CU3 A;  2IMJ A;  3EF8 A;  4HM8 B;  1OHO A;  1OHS A;  5AIG A;  3JUO A;  1GY5 A;  4HM1 B;  4HM6 B;  5CF2 A;  3CNM A;  5IF6 A;  4WWU C;  1BUQ A;  4LMI A;  4WYK B;  1U5O A;  2RGQ A;  4WYK A;  3FF0 A;  2QIY A;  2I9W A;  3EBY A;  1E3V A;  4HJL B;  3MYT A;  4I4K A;  7STD A;  3FSD A;  1OUN A;  3EBT A;  3G16 A;  4OUQ A;  3NXJ A;  2GEX A;  2B1X B;  5D81 A;  2GBW B;  3G0K A;  2W2C A;  1OF5 B;  5EVH A;  1O7N B;  1OF5 A;  3JUP A;  4J9A A;  3DZL A;  1STD A;  3F8X A;  1EG9 B;  3F9S A;  1NWW A;  5IG5 A;  3B7C A;  3EC9 A;  5AII A;  1ASK A;  3GZX B;  3FKA A;  2YFJ B;  3DXO A;  2Z76 A;  4J8T A;  3LZA A;  3DM8 A;  1W6Y A;  2BNG A;  3OWU A;  4XBT A;  4FCJ A;  5IEP A;  5AIH A;  1Q40 B;  3DMC A;  3H3H A;  1Q40 A;  3GZB A;  3DUK A;  3RGR A;  5IER A;  3FF2 A;  3MHE A;  4FCM A;  4L8P A;  2HMJ B;  3A76 A;  3GZR A;  3RGA A;  4XBY A;  3BB9 A;  3OXA A;  5AEW B;  3EJV A;  3GWR A;  3KZT A;  2JQ5 A;  4R9K A;  4MJD A;  3B8L A;  3SED A;  3T8U A;  1K41 A;  3NV0 B;  4U13 A;  3KE7 A;  3NV0 A;  2BMQ B;  5BXQ A;  5JPP A;  1VZZ A;  5KP1 A;  4PEJ A;  2F86 B;  3F8H A;  1CQS A;  3OWY A;  1GS3 A;  4HM7 B;  2F98 A;  3K0Z A;  3KKG A;  5D83 A;  3UNL A;  1ULI B;  4WP5 A;  2YFI B;  1Q42 A;  2YFL B;  5JPU A;  2STD A;  3EN8 A;  5CXO A;  3MG3 A;  1EA2 A;  1OCV A;  4HM4 B;  4IIA A;  4STD A;  1TP6 A;  1QMA A;  2RFR A;  1W02 A;  8CHO A;  4KVH A;  2OWP A;  2A15 A;  1OGZ A;  5KP4 A;  3EQQ B;  3EX9 A;  2HML B;  1OPY A; 
#chains in the Genus database with same CATH topology
 5KP3 A;  3HK4 A;  1KQS 2;  3BND A;  3HZP A;  4ORL A;  3S5C A;  8RNT A;  5AEU B;  2F99 A;  4QWT A;  1MWR A;  1V57 A;  3O8Y A;  1SPU A;  1UUG B;  3D4A A;  3DGN A;  1JKG B;  4RNT A;  1YVS A;  2KF4 A;  3OWS A;  1BUJ A;  1JKG A;  1SAR A;  4GHO A;  3IPT A;  3ECF A;  4R80 A;  1BAN A;  2F56 A;  2BT3 A;  3M8C A;  1ZO2 A;  1YNV X;  1HYF A;  3GRD A;  1DVD A;  2F5M A;  5BVB A;  2HMK B;  3SVA A;  5M1A A;  3AGO A;  3I0Y A;  3ZFZ A;  1X1Y A;  1G96 A;  1IT7 A;  1A2K A;  3MPH A;  2CFK A;  1UUV B;  2WOF A;  4N6M A;  7RNT A;  4CDL A;  1VQK 3;  2OTL 3;  1LXE A;  1UW1 A;  3CMA 3;  2OOV C;  1E97 A;  1YGE A;  3EB8 A;  4GSP A;  1JB2 A;  2INX A;  1N8Q A;  1I2G A;  3FH1 A;  2UGI A;  4RBN A;  1QVG 2;  1BAO A;  1GMP A;  4N6O B;  1W2Z A;  1NJI 4;  1D6U A;  3X3X A;  1RGA A;  1VQM 3;  3NM2 A;  3N9H A;  3X40 A;  2QA4 3;  2OTJ 3;  3LYG A;  1GOU A;  4O2H A;  1FGQ A;  3MSO A;  1MOL A;  3SOY A;  2GBX B;  3LXU X;  1TTO A;  4MMZ B;  1SIH A;  4L8O A;  3J7Y d;  3CD6 3;  1M1X B;  3F7X A;  1YGW A;  3K7C A;  1JV2 B;  4FMC A;  4CCV A;  1QAF A;  4R9L A;  1O7M B;  2XR8 B;  3KSE D;  2ZL8 A;  1JB5 A;  1VQ8 3;  1FUS A;  4MMX B;  3F40 A;  1I2F A;  2MF7 A;  1O7P B;  1LNI A;  5AYS C;  4R1K A;  1CYV A;  3FLJ A;  5AIF A;  4IT7 A;  3D79 A;  1T3B A;  2RCD A;  1CH0 A;  4XDW A;  1BNF A;  2OOV A;  3PYJ A;  5DRE A;  2CX1 A;  1E3R A;  2GU1 A;  3BNE A;  3FG4 A;  1SQW A;  2BO9 B;  5G2G A;  1LVN A;  1BSE A;  1US1 A;  4HM3 B;  3BLZ A;  4NPB A;  2CG1 A;  2ZHX B;  2Z7A A;  5IEO A;  4H61 A;  1WQL B;  3K63 A;  1YJN 3;  1GD3 A;  1DMN A;  2B24 B;  3MG2 A;  6STD A;  4HM0 B;  1UGH I;  1C54 A;  2OCT A;  1Z1S A;  2ZA4 A;  5FW5 A;  3NBJ A;  2IYJ A;  2V1L A;  1ROA A;  3OX9 A;  2CKF B;  1BU4 A;  1W6G A;  2LQV A;  1JJ2 2;  2C11 A;  4J5G A;  3MKI A;  3JUQ A;  4HM2 B;  1OGX A;  4H3U A;  3VSY A;  1GY7 A;  3GSP A;  1MWU A;  4LEH A;  3CCE 3;  5M18 A;  4JRF A;  1JBS A;  3N54 B;  1UCK A;  1V58 A;  3HI7 A;  3WOF B;  3HX8 A;  3JUM A;  1X1W A;  1ULJ B;  3AHW A;  4HM5 B;  5CF1 A;  1T2I A;  1RLS A;  5RNT A;  1S5A A;  2WOH A;  1VQ4 3;  1B2U A;  4N6L A;  1B27 A;  3EHC A;  1BRJ A;  2CH9 A;  2P05 A;  4X2H A;  3Q90 A;  3CCR 3;  4HVN A;  1AV4 A;  3WDG B;  1SII A;  4HZB B;  3CCJ 3;  1CEW I;  3I55 3;  4K1V A;  3BU4 A;  1W00 A;  3F7S A;  1IQY A;  2XRX B;  2J8X B;  5IG4 A;  3NHX A;  5BU4 A;  3KCH A;  1EUI C;  1FGR A;  2YX9 A;  3NQZ A;  4XB5 A;  1T5Y A;  3NBR A;  1GY6 A;  1JN5 B;  2K3D A;  2WO0 A;  1O7H B;  4XDV A;  3CC2 3;  1IDP A;  3FZW A;  3S27 A;  1UUW B;  1GD4 A;  1JN5 A;  1BRI A;  4BL3 A;  3SLU A;  3FG3 A;  3I56 3;  1JZD A;  2RSX A;  2O3O A;  2FGT A;  4X2O A;  1DVC A;  2IA7 A;  2Q07 A;  4XM4 A;  3LH4 A;  2MC8 A;  3QRD A;  3CC4 3;  2HMN B;  3QK9 A;  3CME 3;  1NU3 A;  4EV2 A;  3X3Y A;  2H0H A;  1TRQ A;  1MWT A;  1BOX A;  2F5W A;  1C7H A;  3JVC A;  1BRG A;  3KSP A;  1W4N A;  1JB4 A;  1UCL A;  5TGN A;  1IYY A;  1M9G A;  1BGS A;  5CLK A;  3PZW A;  3NBB A;  3D5I A;  3OV4 A;  2R4I A;  4WHA A;  1AR0 A;  1LOW A;  5STD A;  5IEN A;  1BNI A;  1BSA A;  1RTU A;  2P38 A;  1BVI A;  3BNB A;  3JUN A;  1R4Y A;  3MG1 A;  2GXF A;  1EQK A;  1NDO B;  3GAX A;  1N5H A;  3Q2P A;  4XBX A;  3H51 A;  1YJ9 3;  1RKY A;  1YIJ 3;  1RRH A;  4N6V 0;  1GOY A;  3ROB A;  1KSI A;  1RCK A;  4L7K A;  3F14 A;  4N6N B;  4N6T A;  1GSP A;  2CWU A;  1N9E A;  3VGN A;  1ISK A;  1HKX A;  2FNQ A;  3WR2 A;  1ROV A;  1W01 A;  2WGQ A;  4O8S A;  1DMM A;  3U1W A;  3CPW 2;  5DRV A;  2K54 A;  2CHC A;  2XSO B;  5ELJ A;  3SOA A;  1A90 A;  4I5Q A;  3X3Z A;  4BIR A;  1NB5 I;  5IG0 A;  3CPO A;  1B3S A;  2W56 B;  3PXM A;  1TFO A;  3CCM 3;  4TX4 A;  1LOY A;  4WFO A;  4ILF A;  2W56 A;  1GMR A;  2K0M A;  3STD A;  1AVL A;  3UB1 A;  3V99 A;  4GB5 A;  2BMR B;  2QGU A;  2WGO A;  1BNR A;  1J2B A;  2GEY A;  3UJM A;  3DGL A;  1JNQ A;  3OW2 2;  1O7W B;  3PCR A;  1BNG A;  5GSP A;  3FGY A;  5BIR A;  1TJD A;  2CX0 A;  4CPK A;  2XH9 A;  1FA3 A;  2H0I A;  1GYB A;  1LOX A;  5IG3 A;  1IV9 A;  4O3V A;  4OVM A;  6GSP A;  1O7G B;  1UI7 A;  1DMQ A;  1D6Y A;  4K1U A;  1VQP 3;  1RGF A;  3ER7 A;  4Q53 A;  3T8N A;  3S28 A;  1W7C A;  3G8Z A;  1B21 A;  3DGY A;  4O02 B;  1LNH A;  2RBI A;  3D9R A;  2KF5 A;  1UCJ A;  3CNX A;  1BSD A;  5AI1 A;  3RDE A;  3GZY B;  1B20 A;  1HU9 A;  3E99 A;  1YI2 3;  2P09 A;  1JRQ A;  2C4B A;  2CC3 A;  1G02 A;  1WMP A;  4CJN A;  1MWS A;  2XGL A;  4HKV B;  2KXG A;  2BMO B;  1DE3 A;  2FXT A;  1B2S A;  1UCI A;  2AAD A;  3B4O A;  5HGR A;  3WMD A;  1QJG A;  1HZ1 A;  3RNT A;  1T2H A;  3NM7 A;  4J5K A;  2E2V A;  3U97 A;  3NUV A;  3ZG0 A;  1IVV A;  1TUH A;  2HMO B;  4LGQ A;  1MGR A;  1I3I A;  4EV5 A;  4HZ9 B;  1SJW A;  1F8N A;  4AKY A;  1NO3 A;  4G1M B;  4N3V A;  1L5G B;  3LML A;  1YHQ 3;  4IPB A;  3V92 A;  3X41 A;  5LC6 A;  1FGT A;  1OHP A;  3DH2 A;  2E2U A;  3B4P A;  1JBR A;  2UX0 A;  3LTC A;  4BTY A;  1OH0 A;  3ZG5 A;  3CXC 2;  2C10 A;  1LOV A;  3ALA A;  1ZX2 A;  1QAK A;  1TU5 A;  5ELU A;  1B2M A;  3EN1 B;  2AAE A;  2PZV A;  5CK6 A;  2XSH B;  2HMM B;  2CFW A;  4OK0 A;  2RNT A;  5G1L A;  3AGN A;  2Z77 A;  4RZM A;  4KZ1 A;  3WOD G;  4HOH A;  4FMA A;  5D82 A;  4EYC A;  1U8C B;  3CU3 A;  2W04 A;  4FCZ A;  3URP A;  3DY5 A;  9RNT A;  1KC8 4;  2CG0 A;  2IMJ A;  3AHS A;  3EF8 A;  5M19 A;  2SAR A;  1V74 A;  1WMO A;  2W9Q A;  1OHO A;  1OHS A;  4HM8 B;  2IUK A;  5AIG A;  4ZM8 A;  3CCU 3;  3JUO A;  1GY5 A;  3PCS A;  3SX1 A;  1A2P A;  1WTH A;  2GSP A;  3DGO A;  4HM1 B;  1WNH A;  3PGB A;  1I2E A;  4HM6 B;  1B2X A;  1IT8 A;  1RCL A;  2IY2 A;  3V98 A;  2W9P A;  4RNZ A;  5CF2 A;  4EBG A;  3CNM A;  1OAC A;  6RNT A;  2H0G A;  1TRP A;  3IJE B;  5IF6 A;  3G6E 3;  3VF1 A;  4WWU C;  1EEJ A;  2GU3 A;  1BUQ A;  4FR9 A;  4LMI A;  1NNV A;  1IVW A;  1Q7Y 4;  4WYK B;  3D5G A;  1RN1 A;  4BTX A;  1RGE A;  1U5O A;  5LC7 A;  1W5Z A;  2KRT A;  2RGQ A;  4WYK A;  3FF0 A;  2M7O A;  1RGK A;  2QIY A;  4KFD A;  1VQL 3;  1BSB A;  1IU7 A;  2I9W A;  3EBY A;  1D6Z A;  3CC7 3;  1E3V A;  3AMO B;  1VQ6 3;  4HJL B;  1BRN L;  3MYT A;  3AMO A;  4FMB A;  1MGW A;  1VQQ A;  4I4K A;  1FYS A;  1A67 A;  7STD A;  5JBS A;  2BHM A;  3FSD A;  1OUN A;  3EBT A;  3G16 A;  4OUQ A;  1EKM A;  4BTW A;  1NB3 I;  2CFL A;  1K73 4;  1FGM A;  3NXJ A;  2GEX A;  4EC6 A;  2B1X B;  4AKZ A;  5D81 A;  3WHO A;  2GBW B;  3CCS 3;  1AVK A;  3G0K A;  1N5P A;  1VQO 3;  2CFD A;  2W2C A;  1OF5 B;  5EVH A;  1I70 A;  2IUJ A;  3Q3F A;  2R41 A;  2W6J H;  1O7N B;  3SXX A;  1OF5 A;  3KFQ C;  2W0Q A;  1AQZ A;  3BNC A;  1VQ9 3;  2CW9 A;  4LZI A;  4DKI A;  4HAA A;  2KCD A;  4KFE A;  3WA3 A;  1LQM B;  3JUP A;  2O9U X;  4HBR A;  3S29 A;  3TDG A;  3CCL 3;  1UDI I;  4NRE A;  4J9A A;  3DZL A;  1STD A;  3F8X A;  4BU4 A;  3S67 A;  1MNL A;  4HYZ A;  1IV7 A;  1EG9 B;  3F9S A;  1N8R 4;  2PNC A;  2D42 A;  1NWW A;  3DGM A;  5IG5 A;  1RGG A;  3SYU A;  3WOE B;  4LSO A;  2JDI H;  1RHL A;  2XF3 A;  1YVB I;  3B7C A;  3EC9 A;  1VQ7 3;  1STF I;  3D3L A;  1BNE A;  1BIR A;  5HOH A;  5AII A;  3CCV 3;  1ASK A;  1QAL A;  4KFF A;  1ZGX A;  3K5T A;  3GZX B;  1X1X A;  3FKA A;  5A0O B;  2CK3 H;  2YFJ B;  4R4K A;  3DXO A;  1BNS A;  2Z76 A;  4J8T A;  3L0R A;  3LZA A;  1K9M 4;  1FUT A;  3DM8 A;  1PU4 A;  1BSC A;  1WMN A;  4BL2 A;  1W6Y A;  1ZS7 A;  2E2T A;  1VQN 3;  2ML6 A;  4EW5 A;  2OQE C;  1BRH A;  4LYL B;  5FGO A;  2QEX 3;  3EE1 A;  2ZDJ A;  2BNG A;  1RDS A;  1I0X A;  2F4Y A;  3OWU A;  2CFG A;  2XGN A;  4XBT A;  4FCJ A;  5IEP A;  5AIH A;  1A2V A;  3IMA B;  3X42 A;  1Q40 B;  3DMC A;  3H3H A;  3LTB A;  1W6C A;  5AYR B;  1Q40 A;  3GZB A;  1RJO A;  1PFP A;  3DUK A;  3RGR A;  1M90 4;  5IER A;  1IVX A;  3FF2 A;  3MHE A;  4FCM A;  4L8P A;  2HMJ B;  3A76 A;  2Y73 A;  1Y4K A;  4JF8 A;  2KF3 A;  2UUG C;  1RGH A;  3A5E A;  3GZR A;  1RNB A;  3RGA A;  2ML5 A;  4XBY A;  1IK3 A;  3BB9 A;  1LRA A;  3OXA A;  1UI8 A;  5AEW B;  3HOH A;  1K28 A;  3EJV A;  1GMQ A;  1RRL A;  1S72 3;  7GSP A;  3GWR A;  2CWV A;  2OQE A;  3KZT A;  2HOH A;  2JQ5 A;  4MEI A;  1TFK A;  4R9K A;  1K8A 4;  4MJD A;  1Q86 4;  3B8L A;  3LT8 A;  3SED A;  3T8U A;  5IW9 A;  3NX0 A;  1YIT 3;  1K41 A;  1VQ5 3;  3NV0 B;  4U13 A;  3KE7 A;  3NV0 A;  1FZU A;  2BMQ B;  2Z6B A;  3KII A;  3NQY A;  3CCQ 3;  2Y74 A;  2BU4 A;  5BXQ A;  3LOY A;  1GOV A;  5JPP A;  2W03 A;  3K9M C;  1VZZ A;  3UL6 A;  5KP1 A;  4PEJ A;  3WA2 X;  1W2B 2;  1B2Z A;  1JZO A;  2F86 B;  3LTD A;  1Q9E A;  3F8H A;  4RNY A;  2CIU A;  1CQS A;  1I3F A;  1YJW 3;  3OWY A;  2CWT A;  2XEP A;  3G4S 3;  1RNT A;  4NHF A;  1M1K 4;  1RGC A;  1RMS A;  1RSN A;  1IQX A;  1GS3 A;  4HM7 B;  2F98 A;  3K0Z A;  3KKG A;  5D83 A;  1IQ8 A;  3UNL A;  1PY3 A;  1ULI B;  3LT9 A;  4MMY B;  4K61 A;  4WP5 A;  2YFI B;  1BRK A;  1Q42 A;  3FCS B;  2KAA A;  5G1K A;  1N9J A;  2YFL B;  2L1S A;  5I97 A;  5JPU A;  2XFS A;  2STD A;  3LTA A;  3EN8 A;  3MWZ A;  1RN7 A;  1RGL A;  2BIR A;  3HIG A;  3T0U A;  1BNJ A;  1KD1 4;  1DYU A;  3HII A;  3Q1C A;  4K90 B;  1I0V A;  1R4C A;  5CXO A;  1FGO A;  1IVU A;  3MG3 A;  2P0M A;  2LYX A;  1EA2 A;  1Q82 4;  1OCV A;  1TIJ A;  4HM4 B;  3UL5 A;  4IIA A;  5EQL A;  4STD A;  4FMD A;  1FW7 A;  3G71 3;  1FUW A;  1BRS A;  1Q7H A;  1TP6 A;  1QMA A;  2KF6 A;  1Q81 4;  1AY7 A;  1QVF 2;  2RFR A;  4AEQ A;  4EXR A;  3FG1 A;  2SBL A;  1DET A;  4N6U A;  1CYU A;  1KWI A;  1W02 A;  5EEO A;  8CHO A;  1JBT A;  4KVH A;  2OWP A;  3BIR A;  3N8B A;  3KN4 A;  1I8V A;  1UGI A;  2A15 A;  1OGZ A;  2L4V A;  1PYL A;  2P0X A;  5KP4 A;  4GL6 A;  4KT3 B;  1X1U A;  3EQQ B;  1G0T A;  2D1W A;  1RN4 A;  3PS8 A;  3EX9 A;  2XFT A;  2HML B;  1LQG C;  1OPY A; 
#chains in the Genus database with same CATH homology
 5KP3 A;  3HK4 A;  1KQS 2;  3BND A;  3HZP A;  4ORL A;  3S5C A;  5AEU B;  2F99 A;  4QWT A;  3O8Y A;  1SPU A;  3DGN A;  1JKG B;  3OWS A;  1JKG A;  3IPT A;  3ECF A;  4R80 A;  2BT3 A;  3M8C A;  1ZO2 A;  3GRD A;  1DVD A;  5BVB A;  2HMK B;  3SVA A;  3I0Y A;  1G96 A;  1IT7 A;  1A2K A;  3MPH A;  2CFK A;  1UUV B;  2WOF A;  4N6M A;  4CDL A;  1VQK 3;  2OTL 3;  1LXE A;  1UW1 A;  3CMA 3;  2OOV C;  1E97 A;  1YGE A;  3EB8 A;  1JB2 A;  2INX A;  1N8Q A;  3FH1 A;  4RBN A;  1QVG 2;  4N6O B;  1W2Z A;  1NJI 4;  1D6U A;  3X3X A;  1VQM 3;  3NM2 A;  3N9H A;  3X40 A;  2QA4 3;  2OTJ 3;  3LYG A;  4O2H A;  1FGQ A;  3MSO A;  1MOL A;  3SOY A;  2GBX B;  3LXU X;  4MMZ B;  1SIH A;  4L8O A;  3J7Y d;  3CD6 3;  1M1X B;  3F7X A;  3K7C A;  1JV2 B;  4FMC A;  4CCV A;  1QAF A;  4R9L A;  1O7M B;  2XR8 B;  3KSE D;  2ZL8 A;  1JB5 A;  1VQ8 3;  4MMX B;  3F40 A;  2MF7 A;  1O7P B;  5AYS C;  4R1K A;  1CYV A;  3FLJ A;  5AIF A;  4IT7 A;  2RCD A;  4XDW A;  2OOV A;  3PYJ A;  5DRE A;  2GU1 A;  1E3R A;  3BNE A;  3FG4 A;  1SQW A;  2BO9 B;  5G2G A;  1LVN A;  1US1 A;  4HM3 B;  3BLZ A;  2CG1 A;  2Z7A A;  5IEO A;  4H61 A;  1WQL B;  3K63 A;  1YJN 3;  1GD3 A;  1DMN A;  2B24 B;  3MG2 A;  6STD A;  4HM0 B;  2OCT A;  1Z1S A;  5FW5 A;  3NBJ A;  2V1L A;  1ROA A;  3OX9 A;  2CKF B;  1W6G A;  1JJ2 2;  2LQV A;  2C11 A;  3MKI A;  3JUQ A;  4HM2 B;  1OGX A;  4H3U A;  3VSY A;  1GY7 A;  4LEH A;  3CCE 3;  4JRF A;  3N54 B;  3HI7 A;  3WOF B;  3HX8 A;  3JUM A;  1ULJ B;  5CF1 A;  4HM5 B;  1S5A A;  2WOH A;  1VQ4 3;  4N6L A;  3EHC A;  2CH9 A;  2P05 A;  4X2H A;  3Q90 A;  3CCR 3;  4HVN A;  1AV4 A;  3WDG B;  1SII A;  4HZB B;  3CCJ 3;  1CEW I;  3I55 3;  4K1V A;  1W00 A;  3F7S A;  1IQY A;  2XRX B;  5IG4 A;  3NHX A;  1FGR A;  2YX9 A;  3NQZ A;  4XB5 A;  1T5Y A;  3NBR A;  1GY6 A;  1JN5 B;  4XDV A;  2WO0 A;  1O7H B;  3CC2 3;  1IDP A;  3FZW A;  3S27 A;  1UUW B;  1GD4 A;  1JN5 A;  3SLU A;  3FG3 A;  3I56 3;  2RSX A;  2O3O A;  2FGT A;  4X2O A;  1DVC A;  2IA7 A;  2Q07 A;  4XM4 A;  3LH4 A;  2MC8 A;  3QRD A;  3CC4 3;  2HMN B;  3QK9 A;  3CME 3;  1NU3 A;  4EV2 A;  3X3Y A;  3JVC A;  1C7H A;  3KSP A;  1W4N A;  1JB4 A;  5TGN A;  1M9G A;  5CLK A;  3PZW A;  3NBB A;  3OV4 A;  2R4I A;  4WHA A;  1AR0 A;  5STD A;  5IEN A;  3JUN A;  2P38 A;  3BNB A;  3MG1 A;  2GXF A;  1EQK A;  1NDO B;  3GAX A;  1N5H A;  3Q2P A;  4XBX A;  3H51 A;  1YJ9 3;  1RKY A;  1YIJ 3;  1RRH A;  4N6V 0;  3ROB A;  1KSI A;  4L7K A;  3F14 A;  4N6N B;  4N6T A;  2CWU A;  1N9E A;  3VGN A;  1ISK A;  1HKX A;  2FNQ A;  1ROV A;  1W01 A;  2WGQ A;  4O8S A;  1DMM A;  3U1W A;  3CPW 2;  5DRV A;  2K54 A;  2CHC A;  2XSO B;  5ELJ A;  3SOA A;  1A90 A;  1NB5 I;  3X3Z A;  5IG0 A;  3CPO A;  2W56 B;  3PXM A;  1TFO A;  3CCM 3;  4TX4 A;  4WFO A;  2W56 A;  2K0M A;  3STD A;  1AVL A;  3UB1 A;  3V99 A;  4GB5 A;  2BMR B;  2QGU A;  2WGO A;  1J2B A;  2GEY A;  3UJM A;  3DGL A;  1JNQ A;  3OW2 2;  1O7W B;  3PCR A;  3FGY A;  2XH9 A;  1FA3 A;  1GYB A;  1LOX A;  5IG3 A;  1IV9 A;  4O3V A;  4OVM A;  1O7G B;  1UI7 A;  1DMQ A;  1D6Y A;  4K1U A;  1VQP 3;  3ER7 A;  4Q53 A;  3T8N A;  3S28 A;  1W7C A;  3G8Z A;  4O02 B;  1LNH A;  3D9R A;  5AI1 A;  3CNX A;  3RDE A;  3GZY B;  1HU9 A;  3E99 A;  1YI2 3;  2P09 A;  1JRQ A;  2CC3 A;  1WMP A;  2XGL A;  4HKV B;  2KXG A;  2BMO B;  2FXT A;  5HGR A;  3B4O A;  3WMD A;  1QJG A;  3NM7 A;  2E2V A;  3U97 A;  3NUV A;  1IVV A;  1TUH A;  2HMO B;  4LGQ A;  4EV5 A;  4HZ9 B;  1SJW A;  1F8N A;  4AKY A;  1NO3 A;  4G1M B;  4N3V A;  1L5G B;  3LML A;  1YHQ 3;  4IPB A;  3V92 A;  3X41 A;  5LC6 A;  1FGT A;  1OHP A;  2E2U A;  3B4P A;  2UX0 A;  3LTC A;  4BTY A;  1OH0 A;  3CXC 2;  2C10 A;  3ALA A;  1ZX2 A;  1QAK A;  1TU5 A;  5ELU A;  3EN1 B;  2PZV A;  5CK6 A;  2XSH B;  2HMM B;  2CFW A;  4OK0 A;  2Z77 A;  4RZM A;  4KZ1 A;  3WOD G;  4FMA A;  5D82 A;  4EYC A;  1U8C B;  3CU3 A;  2W04 A;  4FCZ A;  1KC8 4;  3DY5 A;  2CG0 A;  2IMJ A;  3EF8 A;  1V74 A;  1WMO A;  2W9Q A;  1OHO A;  1OHS A;  4HM8 B;  2IUK A;  5AIG A;  4ZM8 A;  3CCU 3;  3JUO A;  1GY5 A;  3PCS A;  3SX1 A;  3DGO A;  1WTH A;  4HM1 B;  4HM6 B;  3V98 A;  1WNH A;  3PGB A;  3CCS 3;  1IT8 A;  2W9P A;  4RNZ A;  5CF2 A;  4EBG A;  3CNM A;  1OAC A;  3IJE B;  5IF6 A;  3G6E 3;  3VF1 A;  4WWU C;  2GU3 A;  1BUQ A;  4FR9 A;  4LMI A;  1IVW A;  1Q7Y 4;  4WYK B;  4BTX A;  1U5O A;  5LC7 A;  1W5Z A;  2KRT A;  2RGQ A;  4WYK A;  3FF0 A;  2M7O A;  2QIY A;  4KFD A;  1VQL 3;  1IU7 A;  2I9W A;  3EBY A;  1D6Z A;  3CC7 3;  1E3V A;  3AMO B;  1VQ6 3;  4HJL B;  3MYT A;  3AMO A;  4FMB A;  4I4K A;  1A67 A;  7STD A;  5JBS A;  2BHM A;  3FSD A;  1OUN A;  3EBT A;  3G16 A;  4OUQ A;  1EKM A;  4BTW A;  1NB3 I;  2CFL A;  1K73 4;  1FGM A;  3NXJ A;  2GEX A;  4EC6 A;  2B1X B;  4AKZ A;  5D81 A;  2GBW B;  1AVK A;  3G0K A;  1N5P A;  1VQO 3;  2CFD A;  2W2C A;  1OF5 B;  5EVH A;  2IUJ A;  2W6J H;  1O7N B;  3SXX A;  1OF5 A;  3KFQ C;  2W0Q A;  3BNC A;  1VQ9 3;  2CW9 A;  4LZI A;  2KCD A;  4KFE A;  3WA3 A;  4HBR A;  3JUP A;  2O9U X;  3S29 A;  3TDG A;  4NRE A;  4J9A A;  3DZL A;  1STD A;  3F8X A;  3S67 A;  1MNL A;  4HYZ A;  1IV7 A;  1EG9 B;  3F9S A;  1N8R 4;  2PNC A;  2D42 A;  1NWW A;  3DGM A;  5IG5 A;  3WOE B;  4LSO A;  2JDI H;  3B7C A;  2XF3 A;  1YVB I;  3EC9 A;  1VQ7 3;  1STF I;  3D3L A;  5AII A;  3CCV 3;  1ASK A;  1QAL A;  4KFF A;  3K5T A;  3GZX B;  3FKA A;  5A0O B;  2CK3 H;  2YFJ B;  4R4K A;  3DXO A;  2Z76 A;  4J8T A;  3L0R A;  3LZA A;  1K9M 4;  3DM8 A;  1PU4 A;  1WMN A;  1W6Y A;  2E2T A;  1VQN 3;  2ML6 A;  2OQE C;  5FGO A;  2QEX 3;  3EE1 A;  2ZDJ A;  2BNG A;  3CCL 3;  3OWU A;  4XBT A;  2CFG A;  2XGN A;  4FCJ A;  5IEP A;  5AIH A;  1A2V A;  3IMA B;  3X42 A;  1Q40 B;  3DMC A;  3H3H A;  3LTB A;  1W6C A;  5AYR B;  1Q40 A;  3GZB A;  1RJO A;  1PFP A;  3DUK A;  3RGR A;  1M90 4;  5IER A;  1IVX A;  3FF2 A;  3MHE A;  4FCM A;  4L8P A;  2HMJ B;  3A76 A;  2Y73 A;  1Y4K A;  4JF8 A;  3GZR A;  3RGA A;  2ML5 A;  4XBY A;  1IK3 A;  3BB9 A;  3OXA A;  1UI8 A;  5AEW B;  1K28 A;  3EJV A;  1RRL A;  1S72 3;  3GWR A;  2CWV A;  2OQE A;  3KZT A;  2JQ5 A;  4MEI A;  1TFK A;  4R9K A;  1K8A 4;  4MJD A;  1Q86 4;  3B8L A;  3LT8 A;  3SED A;  3T8U A;  5IW9 A;  3NX0 A;  1YIT 3;  1K41 A;  1VQ5 3;  3NV0 B;  4U13 A;  3KE7 A;  3NV0 A;  2BMQ B;  2Z6B A;  3KII A;  3NQY A;  3CCQ 3;  2Y74 A;  5BXQ A;  3LOY A;  5JPP A;  2W03 A;  3K9M C;  1VZZ A;  3UL6 A;  5KP1 A;  4PEJ A;  3WA2 X;  1W2B 2;  2F86 B;  3LTD A;  3F8H A;  4RNY A;  2CIU A;  1CQS A;  1YJW 3;  3OWY A;  2CWT A;  2XEP A;  3G4S 3;  4NHF A;  1M1K 4;  1IQX A;  1GS3 A;  4HM7 B;  2F98 A;  3K0Z A;  3KKG A;  5D83 A;  1IQ8 A;  3UNL A;  1ULI B;  3LT9 A;  4MMY B;  4K61 A;  4WP5 A;  2YFI B;  1Q42 A;  3FCS B;  1N9J A;  2YFL B;  5I97 A;  5JPU A;  2XFS A;  2STD A;  3LTA A;  3EN8 A;  3MWZ A;  1RN7 A;  3HIG A;  3T0U A;  1KD1 4;  1DYU A;  3HII A;  3Q1C A;  4K90 B;  1R4C A;  5CXO A;  1FGO A;  1IVU A;  3MG3 A;  2P0M A;  2LYX A;  1EA2 A;  1Q82 4;  1OCV A;  1TIJ A;  4HM4 B;  3UL5 A;  4IIA A;  5EQL A;  4STD A;  4FMD A;  3G71 3;  1FUW A;  1TP6 A;  1QMA A;  1Q81 4;  1QVF 2;  2RFR A;  4AEQ A;  4EXR A;  3FG1 A;  2SBL A;  4N6U A;  1CYU A;  1KWI A;  1W02 A;  5EEO A;  8CHO A;  4KVH A;  2OWP A;  3N8B A;  3KN4 A;  2A15 A;  1OGZ A;  2L4V A;  2P0X A;  5KP4 A;  4GL6 A;  3EQQ B;  2D1W A;  3PS8 A;  3EX9 A;  2XFT A;  2HML B;  1OPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...