3LZAA

Crystal structure of putative snoal-like polyketide cyclase (yp_563807.1) from shewanella denitrificans os-217 at 1.70 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
137
structure length
137
Chain Sequence
DRPIEQQLALGYIKALTEHDYQTLSKYYNRDSVFYDKTADTKYIGTRSIIAFLQRSHEGVLEFDFNIEHMFNTGPLVVMIGNYHLRGPGEQFGKPGKIIDIAIPGVTTLKFDPNTQRLTEQVDLMDYQTMSDQLQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative SnoaL-like polyketide cyclase
publication title CRYSTAL STRUCTURE OF PUTATIVE SNOAL-LIKE POLYKETIDE CYCLASE (YP_563807.1) FROM SHEWANELLA DENITRIFICANS OS-217 AT 1.70 A RESOLUTION
rcsb
source organism Shewanella denitrificans
total genus 44
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lzaA00
3F7SA 1W02A 3JUOA 4J8TA 2YFLB 4XM4A 3Q90A 1O7HB 2I9WA 2INXA 5D82A 5AEUB 1IDPA 4K1UA 5AIHA 3K7CA 5G2GA 5KP4A 3KE7A 4HM3B 1O7MB 4R1KA 5CK6A 4RZMA 5FW5A 1O7NB 3ER7A 1JB5A 3RGRA 3HX8A 2BMOB 3EF8A 1TP6A 3HZPA 4WP5A 2UX0A 3B8LA 5KP3A 1S5AA 1VZZA 4XBTA 1NU3A 3GZYB 5CF1A 3SEDA 5D83A 3NV0A 1GY5A 4HVNA 3M8CA 5JPPA 5BVBA 2GEYA 3G0KA 3K0ZA 4MJDA 2F86B 4FCMA 4HM0B 5AIIA 3STDA 3GRDA 1E3VA 2GXFA 3MG2A 3OWSA 3FLJA 5TGNA 2F98A 1DMNA 2B1XB 3ROBA 4IIAA 3OWUA 3NV0B 5IEOA 4GB5A 1OCVA 1ISKA 5D81A 1UUWB 1ULIB 1ULJB 2XRXB 3KZTA 3VSYA 3F8XA 8CHOA 1U5OA 3F14A 5IEPA 3HK4A 2W2CA 2GBWB 4Q53A 2RFRA 4XB5A 2Z7AA 3DUKA 1BUQA 2YFIB 5EVHA 3EBYA 3EHCA 6STDA 4HM7B 4WYKA 5STDA 2QGUA 4HM2B 4N3VA 3F7XA 3H51A 1TUHA 3EC9A 4XDWA 4ORLA 5KP1A 1GY6A 2JQ5A 3FF2A 4HJLB 5IG4A 2GBXB 3DZLA 2Z77A 7STDA 2HMKB 1Z1SA 1ZX2A 1OPYA 4WYKB 1E3RA 4X2HA 1GY7A 4HM4B 2A15A 4I4KA 3SOAA 2PZVA 4R9KA 5AIFA 1K41A 3EBTA 1JKGA 4HM1B 4HM8B 3I0YA 3RGAA 2Z76A 1OHPA 3LZAA 5AIGA 1C7HA 1SJWA 1QMAA 3MKIA 1CQSA 1NWWA 1WQLB 3EN8A 3FZWA 3OXAA 3GZBA 4OUQA 1OGXA 1ASKA 3IPTA 1DMMA 3MHEA 1EG9B 1A2KA 3GZRA 4LEHA 1EA2A 1AR0A 3DXOA 3KSPA 2BMRB 3JUNA 4X2OA 1JN5B 1JKGB 1HKXA 3OX9A 3EQQB 2QIYA 3DMCA 3G16A 5IG3A 3NBRA 4K1VA 5HGRA 3BB9A 4L8PA 3JUMA 1JB4A 3WMDA 3NUVA 2BNGA 3FSDA 4L7KA 1OUNA 3CNXA 3OV4A 2F99A 4HZBB 1W6YA 2CKFB 3BLZA 3MYTA 4LGQA 4R9LA 3F9SA 4HKVB 3UNLA 3T8NA 5BXQA 1NDOB 4OVMA 5JPUA 5CLKA 3JUQA 5AI1A 4H3UA 1W00A 4CDLA 4XDVA 2HMNB 1E97A 2RCDA 3F8HA 3E99A 5IG0A 2YFJB 4KVHA 2OWPA 1O7WB 4U13A 3CNMA 4WWUC 1O7GB 1JB2A 4XBYA 2STDA 2HMLB 1O7PB 3VGNA 3GWRA 1Q40A 1QJGA 4HZ9B 5CF2A 3D9RA 2K54A 1Q42A 1JN5A 3T8UA 3S5CA 5IF6A 4L8OA 1OF5A 2XR8B 5DRVA 1ZO2A 5IERA 3CU3A 1OHOA 3F40A 3UJMA 3MG3A 3FGYA 1UUVB 3EN1B 1Q40B 4J9AA 2HMOB 3GZXB 1STDA 3NHXA 3ECFA 1W01A 2RGQA 4LMIA 3MG1A 5IG5A 3KKGA 4HM6B 1OHSA 5IENA 5AEWB 1OF5B 3FF0A 4FCJA 2XSOB 3G8ZA 3B7CA 2CHCA 2R4IA 1DMQA 1GS3A 1GYBA 3B4OA 3LYGA 3NXJA 3DM8A 3B4PA 5DREA 4PEJA 4STDA 1OGZA 3A76A 2HMMB 3FKAA 2B24B 3MSOA 3EX9A 2IMJA 3OWYA 3EJVA 5CXOA 2XSHB 1OH0A 3NM2A 4XBXA 3CPOA 2HMJB 3FH1A 2GEXA 3JUPA 4HM5B 2BMQB 3SOYA 3H3HA
chains in the Genus database with same CATH superfamily
3BNBA 3V99A 1UI8A 3F7SA 3KFQC 4DKIA 1EUIC 1W02A 1K28A 3JUOA 1N9JA 4J8TA 1X1YA 4TX4A 1UCLA 1BRKA 2YFLB 4XM4A 2E2TA 3Q90A 1BUJA 1O7HB 2I9WA 2BU4A 2INXA 3AHSA 1WTHA 5D82A 1WMOA 3HIIA 3PYJA 4O3VA 1RRHA 5AEUB 1IDPA 4K1UA 5AIHA 1X1WA 3QK9A 3X3ZA 3AMOB 1N5PA 3K7CA 3X41A 5G2GA 3FCSB 3PCRA 1RJOA 1GD3A 3LTBA 3SVAA 5KP4A 4ZM8A 1BSDA 3WDGB 1MNLA 1VQP3 1IT7A 2AAEA 2XFSA 3PGBA 3KE7A 4HM3B 1O7MB 4R1KA 5CK6A 4RZMA 1FGTA 3LMLA 4FCZA 5FW5A 1O7NB 1SARA 3ER7A 1JB5A 3RGRA 2L1SA 3HX8A 2BMOB 3CCE3 3DGMA 1ROAA 2K0MA 4H61A 5A0OB 1LOWA 1BIRA 3EF8A 1IQYA 1TP6A 1TTOA 3HZPA 3K63A 2UX0A 4WP5A 1V74A 3B8LA 5KP3A 4EC6A 1GMPA 1S5AA 1VZZA 4KFEA 1JV2B 4XBTA 3Q1CA 4WFOA 1IVVA 1NU3A 2KF3A 3WA2X 3GZYB 5CF1A 3SEDA 5D83A 3NV0A 1WMPA 1IVUA 9RNTA 1JBRA 1GY5A 1ZS7A 4HVNA 1UW1A 3M8CA 3NQZA 2CWUA 2OQEC 3EE1A 1B20A 1TFOA 4KFDA 1NO3A 5JPPA 1GOUA 1MGRA 2GEYA 5BVBA 1VQM3 4LSOA 2ZDJA 5EQLA 1R4CA 5ELUA 2W0QA 3N8BA 4GSPA 1BU4A 2C10A 1BRGA 3AGOA 3G0KA 3K0ZA 4MJDA 1NJI4 1QAFA 5G1KA 2F86B 1W2B2 3OW22 4FCMA 7RNTA 2UGIA 4BIRA 3CCL3 1IQ8A 4HM0B 5AIIA 1SIIA 3STDA 4FMBA 3GRDA 2UUGC 1E3VA 2GXFA 1YVBI 2H0HA 3MG2A 1FW7A 3OWSA 3FLJA 1JRQA 5TGNA 2F98A 3FG1A 1DMNA 3N9HA 3BNEA 1FUSA 5EEOA 1SPUA 1U8CB 2B1XB 3SYUA 3RNTA 3ROBA 3CCM3 4IIAA 3PCSA 1RN7A 4O02B 2XF3A 3OWUA 3NV0B 3CCS3 1RCKA 5IEOA 4GB5A 5IW9A 1CH0A 1OCVA 1YNVX 2OOVA 3WHOA 1A67A 2CX1A 1ISKA 5D81A 1UUWB 1ULIB 2KAAA 2CW9A 2WGOA 4BL3A 1BSEA 5AYRB 1ULJB 2XRXB 3IMAB 2ZA4A 3EB8A 1NB5I 1M904 3NM7A 3KZTA 3VSYA 3LTAA 1UDII 3F8XA 4I5QA 2LQVA 1RCLA 5AYSC 2WGQA 4N6TA 8CHOA 3CC23 1U5OA 1BNSA 1KWIA 2Z6BA 3LT8A 1AV4A 2D1WA 2CFKA 4HYZA 1LOVA 4J5KA 3F14A 1B27A 4BTYA 3D4AA 5IEPA 1BRNL 2D42A 1W6GA 2F5WA 1A2PA 4N6UA 3LH4A 3HK4A 1VQ53 5FGOA 1UCIA 2W2CA 1JBTA 2GBWB 1RGKA 4Q53A 2CWTA 1AVKA 8RNTA 2P05A 4BTXA 1I2EA 3X42A 2OTL3 2F5MA 2ML5A 5RNTA 3T0UA 2RFRA 1GOVA 4RBNA 1Q9EA 2WO0A 3X40A 1UCJA 1T3BA 1V58A 3ZG0A 4G1MB 1MWRA 4HOHA 1IQXA 1RKYA 4XB5A 1RTUA 1OACA 2KF6A 2W6JH 2Z7AA 3ALAA 3DUKA 3QRDA 1BUQA 4NPBA 2YFIB 1Q864 1GOYA 5EVHA 3TDGA 2QA43 3S28A 3EBYA 3EHCA 6STDA 4HM7B 1J2BA 1N8R4 4WYKA 1BSCA 1W4NA 5JBSA 5STDA 2QGUA 4HM2B 3ZG5A 4N3VA 3CC73 4EYCA 3F7XA 3LT9A 3DGNA 1B2UA 3H51A 2MC8A 4CCVA 1TUHA 3I553 3EC9A 1GSPA 2XGNA 3K5TA 4XDWA 4ORLA 5KP1A 3X3XA 2OCTA 1FZUA 1GY6A 2CFGA 1B2SA 1FUTA 1G02A 3L0RA 1BNJA 3S67A 3FG4A 3X3YA 4BL2A 2JQ5A 4KZ1A 1N9EA 2Y74A 3DGLA 3LTDA 3FF2A 1Q7Y4 2W04A 4HJLB 1LOXA 5LC7A 5IG4A 1B2ZA 2GBXB 3DZLA 2Z77A 1BNEA 3Q3FA 2XFTA 1BVIA 7STDA 2HMKB 3DGOA 4JRFA 1B21A 4RNYA 1Z1SA 3BIRA 3FG3A 5M18A 1ZX2A 1YIJ3 3HI7A 1G0TA 4R80A 1OPYA 1TFKA 2GU1A 4WYKB 4CPKA 1E3RA 4X2HA 1GY7A 3NQYA 3G6E3 4FMCA 2A15A 4HM4B 4I4KA 1RNTA 3GAXA 1QALA 3NBJA 1YIT3 3SOAA 1KQS2 2PZVA 4R9KA 5AIFA 1RGHA 3CCQ3 2CFDA 1PU4A 4KT3B 1R4YA 1TU5A 2SBLA 1K41A 1IV7A 2JDIH 2XGLA 3EBTA 1BANA 1FGRA 1MOLA 1UGIA 1JKGA 4HM1B 4K61A 4HM8B 3I0YA 1QVF2 1LOYA 3RGAA 1BRHA 1PYLA 3PS8A 1QAKA 1A2VA 2Z76A 1MWTA 3HOHA 1OHPA 4GHOA 3N54B 3UL5A 3LZAA 5AIGA 1C7HA 1SJWA 1QMAA 2O9UX 3D5GA 3MKIA 1CQSA 1NWWA 1PY3A 1WQLB 3S29A 6GSPA 2F56A 3EN8A 1YHQ3 3DH2A 4FMAA 3FZWA 3OXAA 1W2ZA 3GZBA 4OUQA 2QEX3 2CWVA 1OGXA 3D5IA 2BHMA 1ASKA 3IPTA 1DMMA 2P0MA 3MHEA 1JZDA 2P38A 1I0XA 1EG9B 1A2KA 3GZRA 4ILFA 1EA2A 4LEHA 1Q824 1X1UA 1AR0A 3DXOA 3DY5A 3KSPA 2BMRB 4IT7A 2OTJ3 2FGTA 3JUNA 1RGLA 3O8YA 4O8SA 1BRSA 1DVDA 4X2OA 1V57A 1GD4A 1BRJA 1ROVA 4BU4A 1N5HA 1JN5B 1JKGB 5BIRA 1HKXA 2O3OA 3OX9A 3EQQB 3S27A 4BTWA 3KCHA 2QIYA 3DMCA 2R41A 3G16A 2BT3A 5IG3A 1DE3A 3NBRA 4K1VA 2IUJA 5HGRA 4RNTA 3BB9A 1CEWI 1CYVA 1M9GA 3JUMA 4L8PA 5G1LA 1VQ93 1HYFA 1JB4A 2V1LA 3WMDA 4N6LA 2CFLA 2CG1A 2P09A 1SQWA 2IA7A 1AVLA 3NUVA 1RN4A 2BNGA 3FSDA 3IJEB 4L7KA 4NHFA 1OUNA 3CNXA 2W56A 4IPBA 3CXC2 1MGWA 3OV4A 1GMQA 4MMZB 2F99A 1HZ1A 1W6YA 2CKFB 1IVWA 3BLZA 3BNCA 3MYTA 2C4BA 4HZBB 4LGQA 4R9LA 1DVCA 1VQN3 3F9SA 4HKVB 1FYSA 1CYUA 2LYXA 3UNLA 1BSBA 3DGYA 2GSPA 1IVXA 3T8NA 3K9MC 1D6ZA 2CH9A 5BXQA 4N6MA 2H0GA 1D6UA 4EXRA 1NDOB 4OVMA 1FGQA 5JPUA 3AGNA 1TRQA 3J7Yd 1VQL3 2BIRA 1JZOA 4N6V0 1BNFA 5CLKA 3KSED 1B2XA 3JUQA 5AI1A 1M1K4 4H3UA 1W00A 4OK0A 1WMNA 4CDLA 5M19A 1YI23 1YVSA 1BOXA 2CG0A 3CC43 2H0IA 3PZWA 4XDVA 3UL6A 1W6CA 2HMNB 1MWSA 1E97A 1JJ22 4HBRA 1L5GB 3CMA3 2RCDA 1Y4KA 4FMDA 3F8HA 1YJW3 4AEQA 2W56B 4MMXB 1DYUA 1Q7HA 3WODG 3E99A 4RNZA 2IY2A 3RDEA 1IT8A 2Y73A 1N8QA 2J8XB 5IG0A 3CME3 3CPW2 2YFJB 4KVHA 1LNIA 2OWPA 1O7WB 1IV9A 4U13A 2SARA 3CNMA 4K90B 4WWUC 1WNHA 1O7GB 4O2HA 3V98A 2GU3A 2CIUA 3KIIA 1QVG2 2RSXA 1VQ83 2KF5A 2OQEA 1JB2A 1UGHI 3MPHA 1RGAA 1US1A 2FXTA 1ZGXA 2CK3H 4XBYA 3VF1A 1A90A 2STDA 2HMLB 1O7PB 3GSPA 1BAOA 1FUWA 1RNBA 3NBBA 2FNQA 2IYJA 1G96A 2XH9A 3VGNA 3BNDA 3GWRA 4JF8A 1RN1A 4QWTA 2C11A 1Q40A 4EV2A 3PXMA 1QJGA 1BSAA 4MEIA 1YGEA 4HZ9B 1JBSA 5CF2A 3D9RA 1TJDA 3URPA 2K54A 2KXGA 1Q42A 1JN5A 1Q814 2RBIA 1UCKA 3T8UA 2BO9B 1KD14 1PFPA 1YGWA 2M7OA 1RMSA 3S5CA 2ML6A 3U1WA 3U97A 5IF6A 4L8OA 4FR9A 3CCJ3 1BNIA 1OF5A 1BGSA 2XR8B 1BRIA 5DRVA 1ZO2A 1NB3I 5IERA 1VQK3 3CU3A 3JVCA 7GSPA 4AKYA 4EW5A 3CCU3 2P0XA 3D3LA 1KSIA 1OHOA 1T2IA 3F40A 3MG3A 3FGYA 3UJMA 1KC84 4LYLB 1UUVB 3WOEB 1UI7A 4LZIA 4NREA 4MMYB 2W03A 1F8NA 2WOHA 3EN1B 5LC6A 1EQKA 1Q40B 1RGFA 1RGEA 2K3DA 3HIGA 4J9AA 2HMOB 1MWUA 3GZXB 5BU4A 1IU7A 1JNQA 1STDA 3NHXA 3ECFA 1W01A 4AKZA 3LXUX 1STFI 1I2FA 2RGQA 4LMIA 3MG1A 2Q07A 1DETA 1YJ93 3SLUA 1LQMB 3KKGA 4HM6B 1RSNA 5IG5A 1AY7A 1BNGA 3LTCA 1OHSA 3V92A 2ZL8A 2YX9A 5IENA 1UUGB 1W7CA 2CFWA 3Q2PA 3WOFB 5AEWB 3NX0A 1OF5B 3FF0A 1VQ43 5HOHA 1HU9A 1K9M4 2MF7A 4FCJA 5M1AA 2XSOB 5ELJA 1EEJA 3CD63 1I0VA 3G8ZA 3B7CA 2E2UA 3A5EA 2HOHA 1K8A4 4J5GA 1SIHA 4CJNA 1S723 2CHCA 2R4IA 1DMQA 1EKMA 1GS3A 1M1XB 4GL6A 4EV5A 2KF4A 1GYBA 2RNTA 2CX0A 1I8VA 1RGCA 2W9QA 3B4OA 3BU4A 5I97A 1RHLA 6RNTA 3SXXA 3LYGA 3NXJA 2ZHXB 3WA3A 1K734 1VQO3 2L4VA 2W9PA 3CCR3 3DM8A 3B4PA 5DREA 4PEJA 2WOFA 1B2MA 1NNVA 2AADA 4EBGA 1GMRA 1FGMA 3ZFZA 1D6YA 2CC3A 3MWZA 5GSPA 1AQZA 2KCDA 4STDA 3I563 1OGZA 4WHAA 1X1XA 1LVNA 3A76A 3AHWA 4KFFA 4R4KA 2HMMB 3LOYA 3FKAA 2B24B 1TIJA 1YJN3 1W5ZA 2PNCA 3MSOA 1T2HA 1BNRA 1LRAA 3EX9A 2IMJA 2KRTA 3OWYA 1B3SA 1T5YA 1IK3A 1TRPA 1FGOA 3EJVA 1RRLA 1IYYA 1I70A 3G713 5CXOA 4N6NB 3KN4A 3WR2A 1C54A 2XSHB 1OH0A 1FA3A 3NM2A 1RDSA 3AMOA 3CPOA 4XBXA 4N6OB 1RLSA 2HMJB 3G4S3 4HAAA 1I3IA 1I2GA 3SX1A 3FH1A 2GEXA 2IUKA 3JUPA 4HM5B 2BMQB 2OOVC 1VQ63 1LQGC 1LNHA 2F4YA 3SOYA 3H3HA 3UB1A 2E2VA 3D79A 1VQ73 1RGGA 2XEPA 3CCV3 1I3FA 1LXEA 1VQQA
chains in the Genus database with same CATH topology
3BNBA 3V99A 1UI8A 3F7SA 3KFQC 1W02A 1K28A 3JUOA 1N9JA 4J8TA 4TX4A 2YFLB 4XM4A 2E2TA 3Q90A 1O7HB 2I9WA 2INXA 5D82A 1WTHA 1WMOA 3HIIA 3PYJA 4O3VA 1RRHA 5AEUB 1IDPA 4K1UA 5AIHA 3QK9A 3X3ZA 3AMOB 1N5PA 3K7CA 3X41A 5G2GA 3FCSB 3PCRA 1RJOA 1GD3A 3LTBA 3SVAA 5KP4A 4ZM8A 3WDGB 1MNLA 1VQP3 1IT7A 2XFSA 3PGBA 3KE7A 4HM3B 1O7MB 4R1KA 5CK6A 4RZMA 1FGTA 3LMLA 4FCZA 5FW5A 1O7NB 3ER7A 1JB5A 3RGRA 3HX8A 2BMOB 3CCE3 3DGMA 1ROAA 2K0MA 4H61A 5A0OB 3EF8A 1IQYA 1TP6A 3HZPA 3K63A 4WP5A 2UX0A 1V74A 3B8LA 5KP3A 4EC6A 1S5AA 1VZZA 4KFEA 1JV2B 4XBTA 3Q1CA 4WFOA 1IVVA 1NU3A 3WA2X 3GZYB 5CF1A 3SEDA 5D83A 3NV0A 1WMPA 1IVUA 1GY5A 4HVNA 1UW1A 3M8CA 3NQZA 2CWUA 2OQEC 3EE1A 1TFOA 4KFDA 1NO3A 5JPPA 5BVBA 2GEYA 1VQM3 4LSOA 2ZDJA 5EQLA 1R4CA 5ELUA 2W0QA 3N8BA 2C10A 3G0KA 3K0ZA 4MJDA 1NJI4 1QAFA 2F86B 1W2B2 3OW22 4FCMA 3CCL3 1IQ8A 4HM0B 5AIIA 1SIIA 3STDA 4FMBA 3GRDA 1E3VA 2GXFA 1YVBI 3MG2A 3OWSA 3FLJA 1JRQA 5TGNA 2F98A 3FG1A 1DMNA 3N9HA 3BNEA 5EEOA 3CCM3 1SPUA 1U8CB 2B1XB 3ROBA 4IIAA 3PCSA 1RN7A 4O02B 2XF3A 3OWUA 3NV0B 3CCS3 5IEOA 4GB5A 5IW9A 1OCVA 2OOVA 1A67A 1ISKA 5D81A 1UUWB 1ULIB 2CW9A 2WGOA 5AYRB 1ULJB 2XRXB 3IMAB 3EB8A 1NB5I 1M904 3NM7A 3KZTA 3VSYA 3LTAA 3F8XA 2LQVA 5AYSC 2WGQA 4N6TA 8CHOA 3CC23 1U5OA 1KWIA 2Z6BA 3LT8A 1AV4A 2D1WA 2CFKA 4HYZA 3F14A 4BTYA 5IEPA 2D42A 1W6GA 4N6UA 3LH4A 3HK4A 1VQ53 5FGOA 2W2CA 2GBWB 4Q53A 2CWTA 1AVKA 2P05A 4BTXA 3X42A 2OTL3 2ML5A 3T0UA 2RFRA 4RBNA 2WO0A 4G1MB 1RKYA 1IQXA 4XB5A 1OACA 2W6JH 2Z7AA 3ALAA 3DUKA 3QRDA 1BUQA 2YFIB 1Q864 5EVHA 3TDGA 2QA43 3S28A 3EBYA 3EHCA 6STDA 4HM7B 1J2BA 1N8R4 4WYKA 1W4NA 5JBSA 5STDA 2QGUA 4HM2B 4N3VA 3CC73 4EYCA 3F7XA 3LT9A 3DGNA 3H51A 2MC8A 4CCVA 1TUHA 3I553 3EC9A 2XGNA 3K5TA 4XDWA 4ORLA 5KP1A 3X3XA 2OCTA 1GY6A 2CFGA 3X3YA 3L0RA 3S67A 3FG4A 2JQ5A 4KZ1A 1N9EA 2Y74A 3DGLA 3LTDA 3FF2A 1Q7Y4 2W04A 4HJLB 1LOXA 5LC7A 5IG4A 2GBXB 3DZLA 2Z77A 2XFTA 7STDA 2HMKB 3DGOA 4JRFA 4RNYA 1Z1SA 3FG3A 1ZX2A 1YIJ3 3HI7A 4R80A 1OPYA 1TFKA 2GU1A 4WYKB 1E3RA 4X2HA 1GY7A 3NQYA 3G6E3 4FMCA 2A15A 4HM4B 4I4KA 3GAXA 1QALA 3NBJA 1YIT3 3SOAA 1KQS2 2PZVA 4R9KA 5AIFA 3CCQ3 2CFDA 1PU4A 1TU5A 2SBLA 1K41A 1IV7A 2JDIH 2XGLA 3EBTA 4K61A 1FGRA 1MOLA 3X40A 1JKGA 4HM1B 1QVF2 4HM8B 3I0YA 3RGAA 3PS8A 1QAKA 1A2VA 2Z76A 1OHPA 3N54B 3UL5A 3LZAA 5AIGA 1C7HA 1SJWA 1QMAA 2O9UX 3MKIA 1CQSA 1NWWA 1WQLB 3S29A 1YHQ3 3EN8A 4FMAA 3FZWA 3OXAA 1W2ZA 3GZBA 4OUQA 2QEX3 2CWVA 1OGXA 2BHMA 1ASKA 3IPTA 1DMMA 2P0MA 3MHEA 2P38A 1EG9B 1A2KA 3GZRA 4LEHA 1EA2A 1Q824 3DY5A 1AR0A 3DXOA 3KSPA 4IT7A 2BMRB 2OTJ3 2FGTA 3JUNA 3O8YA 4O8SA 1DVDA 4X2OA 1GD4A 1ROVA 1N5HA 1JN5B 1JKGB 1HKXA 2O3OA 3OX9A 3EQQB 3S27A 4BTWA 2QIYA 3DMCA 3G16A 2BT3A 5IG3A 3NBRA 4K1VA 2IUJA 5HGRA 3BB9A 1CEWI 1CYVA 1M9GA 3JUMA 4L8PA 1VQ93 1JB4A 2V1LA 3WMDA 4N6LA 2CFLA 2CG1A 2P09A 1SQWA 2IA7A 1AVLA 3NUVA 2BNGA 3FSDA 3IJEB 4L7KA 4NHFA 1OUNA 3CNXA 2W56A 4IPBA 3CXC2 3OV4A 4MMZB 2F99A 4HZBB 1W6YA 2CKFB 1IVWA 3BLZA 3BNCA 3MYTA 4LGQA 1VQN3 4R9LA 1DVCA 1CYUA 3F9SA 4HKVB 2LYXA 3UNLA 1IVXA 3T8NA 3K9MC 1D6ZA 2CH9A 5BXQA 4N6MA 1D6UA 4EXRA 1NDOB 4OVMA 1FGQA 5JPUA 3J7Yd 1VQL3 4N6V0 5CLKA 3KSED 3JUQA 1M1K4 5AI1A 4H3UA 1W00A 4OK0A 1WMNA 4CDLA 1YI23 2CG0A 3CC43 3PZWA 4XDVA 3UL6A 1W6CA 2HMNB 1E97A 1JJ22 4HBRA 1L5GB 3CMA3 2RCDA 1Y4KA 4FMDA 3F8HA 1YJW3 4AEQA 2W56B 4MMXB 1DYUA 3WODG 3E99A 4RNZA 3RDEA 1IT8A 2Y73A 1N8QA 5IG0A 3CME3 3CPW2 2YFJB 4KVHA 2OWPA 1O7WB 1IV9A 4U13A 3CNMA 4K90B 4WWUC 1WNHA 1O7GB 4O2HA 3V98A 2GU3A 2CIUA 3KIIA 1QVG2 2RSXA 1VQ83 2OQEA 1JB2A 3MPHA 1US1A 2FXTA 2CK3H 4XBYA 3VF1A 1A90A 2STDA 2HMLB 1O7PB 1FUWA 3NBBA 2FNQA 1G96A 2XH9A 3VGNA 3BNDA 3GWRA 4JF8A 4QWTA 2C11A 1Q40A 4EV2A 3PXMA 1QJGA 4MEIA 1YGEA 4HZ9B 5CF2A 3D9RA 2K54A 2KXGA 1Q42A 1JN5A 1Q814 3T8UA 2BO9B 1KD14 1PFPA 2M7OA 3S5CA 2ML6A 3U1WA 3U97A 5IF6A 4L8OA 4FR9A 3CCJ3 1OF5A 2XR8B 5DRVA 1ZO2A 1NB3I 5IERA 1VQK3 3CU3A 3JVCA 4AKYA 3CCU3 2P0XA 3D3LA 1KSIA 1OHOA 3F40A 3UJMA 3MG3A 3FGYA 1KC84 1UUVB 3WOEB 1UI7A 4LZIA 4NREA 4MMYB 2W03A 1F8NA 2WOHA 3EN1B 5LC6A 1EQKA 1Q40B 3HIGA 4J9AA 2HMOB 3GZXB 1IU7A 1JNQA 1STDA 3NHXA 3ECFA 1W01A 4AKZA 3LXUX 1STFI 2RGQA 4LMIA 3MG1A 2Q07A 1YJ93 3SLUA 5IG5A 3KKGA 4HM6B 3LTCA 1OHSA 3V92A 2ZL8A 2YX9A 5IENA 1W7CA 3WOFB 2CFWA 3Q2PA 5AEWB 3NX0A 1OF5B 3FF0A 1VQ43 1HU9A 1K9M4 2MF7A 4FCJA 2XSOB 5ELJA 3CD63 3G8ZA 3B7CA 2E2UA 1K8A4 1SIHA 1S723 2CHCA 2R4IA 1DMQA 1EKMA 1GS3A 1M1XB 4GL6A 4EV5A 1GYBA 2W9QA 3B4OA 5I97A 3SXXA 3LYGA 3NXJA 3WA3A 1K734 1VQO3 2L4VA 2W9PA 3CCR3 3DM8A 3B4PA 5DREA 4PEJA 2WOFA 4EBGA 1FGMA 1D6YA 2CC3A 3MWZA 2KCDA 4STDA 3I563 1OGZA 1LVNA 3A76A 4KFFA 4R4KA 2HMMB 3LOYA 3FKAA 2B24B 1TIJA 1YJN3 1W5ZA 2PNCA 3MSOA 3EX9A 2IMJA 2KRTA 3OWYA 1T5YA 1IK3A 1FGOA 3EJVA 1RRLA 3G713 5CXOA 4N6NB 3KN4A 2XSHB 1OH0A 1FA3A 3NM2A 3AMOA 3CPOA 4XBXA 4N6OB 2HMJB 3G4S3 3SX1A 3FH1A 2GEXA 2IUKA 3JUPA 4HM5B 2BMQB 2OOVC 1VQ63 1LNHA 3SOYA 3H3HA 3UB1A 2E2VA 1VQ73 2XEPA 3CCV3 4WHAA 1LXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7S A;  1W02 A;  3JUO A;  4J8T A;  2YFL B;  4XM4 A;  3Q90 A;  1O7H B;  2I9W A;  2INX A;  5D82 A;  5AEU B;  1IDP A;  4K1U A;  5AIH A;  3K7C A;  5G2G A;  5KP4 A;  3KE7 A;  4HM3 B;  1O7M B;  4R1K A;  5CK6 A;  4RZM A;  5FW5 A;  1O7N B;  3ER7 A;  1JB5 A;  3RGR A;  3HX8 A;  2BMO B;  3EF8 A;  1TP6 A;  3HZP A;  4WP5 A;  2UX0 A;  3B8L A;  5KP3 A;  1S5A A;  1VZZ A;  4XBT A;  1NU3 A;  3GZY B;  5CF1 A;  3SED A;  5D83 A;  3NV0 A;  1GY5 A;  4HVN A;  3M8C A;  5JPP A;  5BVB A;  2GEY A;  3G0K A;  3K0Z A;  4MJD A;  2F86 B;  4FCM A;  4HM0 B;  5AII A;  3STD A;  3GRD A;  1E3V A;  2GXF A;  3MG2 A;  3OWS A;  3FLJ A;  5TGN A;  2F98 A;  1DMN A;  2B1X B;  3ROB A;  4IIA A;  3OWU A;  3NV0 B;  5IEO A;  4GB5 A;  1OCV A;  1ISK A;  5D81 A;  1UUW B;  1ULI B;  1ULJ B;  2XRX B;  3KZT A;  3VSY A;  3F8X A;  8CHO A;  1U5O A;  3F14 A;  5IEP A;  3HK4 A;  2W2C A;  2GBW B;  4Q53 A;  2RFR A;  4XB5 A;  2Z7A A;  3DUK A;  1BUQ A;  2YFI B;  5EVH A;  3EBY A;  3EHC A;  6STD A;  4HM7 B;  4WYK A;  5STD A;  2QGU A;  4HM2 B;  4N3V A;  3F7X A;  3H51 A;  1TUH A;  3EC9 A;  4XDW A;  4ORL A;  5KP1 A;  1GY6 A;  2JQ5 A;  3FF2 A;  4HJL B;  5IG4 A;  2GBX B;  3DZL A;  2Z77 A;  7STD A;  2HMK B;  1Z1S A;  1ZX2 A;  1OPY A;  4WYK B;  1E3R A;  4X2H A;  1GY7 A;  4HM4 B;  2A15 A;  4I4K A;  3SOA A;  2PZV A;  4R9K A;  5AIF A;  1K41 A;  3EBT A;  1JKG A;  4HM1 B;  4HM8 B;  3I0Y A;  3RGA A;  2Z76 A;  1OHP A;  3LZA A;  5AIG A;  1C7H A;  1SJW A;  1QMA A;  3MKI A;  1CQS A;  1NWW A;  1WQL B;  3EN8 A;  3FZW A;  3OXA A;  3GZB A;  4OUQ A;  1OGX A;  1ASK A;  3IPT A;  1DMM A;  3MHE A;  1EG9 B;  1A2K A;  3GZR A;  4LEH A;  1EA2 A;  1AR0 A;  3DXO A;  3KSP A;  2BMR B;  3JUN A;  4X2O A;  1JN5 B;  1JKG B;  1HKX A;  3OX9 A;  3EQQ B;  2QIY A;  3DMC A;  3G16 A;  5IG3 A;  3NBR A;  4K1V A;  5HGR A;  3BB9 A;  4L8P A;  3JUM A;  1JB4 A;  3WMD A;  3NUV A;  2BNG A;  3FSD A;  4L7K A;  1OUN A;  3CNX A;  3OV4 A;  2F99 A;  4HZB B;  1W6Y A;  2CKF B;  3BLZ A;  3MYT A;  4LGQ A;  4R9L A;  3F9S A;  4HKV B;  3UNL A;  3T8N A;  5BXQ A;  1NDO B;  4OVM A;  5JPU A;  5CLK A;  3JUQ A;  5AI1 A;  4H3U A;  1W00 A;  4CDL A;  4XDV A;  2HMN B;  1E97 A;  2RCD A;  3F8H A;  3E99 A;  5IG0 A;  2YFJ B;  4KVH A;  2OWP A;  1O7W B;  4U13 A;  3CNM A;  4WWU C;  1O7G B;  1JB2 A;  4XBY A;  2STD A;  2HML B;  1O7P B;  3VGN A;  3GWR A;  1Q40 A;  1QJG A;  4HZ9 B;  5CF2 A;  3D9R A;  2K54 A;  1Q42 A;  1JN5 A;  3T8U A;  3S5C A;  5IF6 A;  4L8O A;  1OF5 A;  2XR8 B;  5DRV A;  1ZO2 A;  5IER A;  3CU3 A;  1OHO A;  3F40 A;  3UJM A;  3MG3 A;  3FGY A;  1UUV B;  3EN1 B;  1Q40 B;  4J9A A;  2HMO B;  3GZX B;  1STD A;  3NHX A;  3ECF A;  1W01 A;  2RGQ A;  4LMI A;  3MG1 A;  5IG5 A;  3KKG A;  4HM6 B;  1OHS A;  5IEN A;  5AEW B;  1OF5 B;  3FF0 A;  4FCJ A;  2XSO B;  3G8Z A;  3B7C A;  2CHC A;  2R4I A;  1DMQ A;  1GS3 A;  1GYB A;  3B4O A;  3LYG A;  3NXJ A;  3DM8 A;  3B4P A;  5DRE A;  4PEJ A;  4STD A;  1OGZ A;  3A76 A;  2HMM B;  3FKA A;  2B24 B;  3MSO A;  3EX9 A;  2IMJ A;  3OWY A;  3EJV A;  5CXO A;  2XSH B;  1OH0 A;  3NM2 A;  4XBX A;  3CPO A;  2HMJ B;  3FH1 A;  2GEX A;  3JUP A;  4HM5 B;  2BMQ B;  3SOY A;  3H3H A; 
#chains in the Genus database with same CATH topology
 3BNB A;  3V99 A;  1UI8 A;  3F7S A;  3KFQ C;  4DKI A;  1EUI C;  1W02 A;  1K28 A;  3JUO A;  1N9J A;  4J8T A;  1X1Y A;  4TX4 A;  1UCL A;  1BRK A;  2YFL B;  4XM4 A;  2E2T A;  3Q90 A;  1BUJ A;  1O7H B;  2I9W A;  2BU4 A;  2INX A;  3AHS A;  1WTH A;  5D82 A;  1WMO A;  3HII A;  3PYJ A;  4O3V A;  1RRH A;  5AEU B;  1IDP A;  4K1U A;  5AIH A;  1X1W A;  3QK9 A;  3X3Z A;  3AMO B;  1N5P A;  3K7C A;  3X41 A;  5G2G A;  3FCS B;  3PCR A;  1RJO A;  1GD3 A;  3LTB A;  3SVA A;  5KP4 A;  4ZM8 A;  1BSD A;  3WDG B;  1MNL A;  1VQP 3;  1IT7 A;  2AAE A;  2XFS A;  3PGB A;  3KE7 A;  4HM3 B;  1O7M B;  4R1K A;  5CK6 A;  4RZM A;  1FGT A;  3LML A;  4FCZ A;  5FW5 A;  1O7N B;  1SAR A;  3ER7 A;  1JB5 A;  3RGR A;  2L1S A;  3HX8 A;  2BMO B;  3CCE 3;  3DGM A;  1ROA A;  2K0M A;  4H61 A;  5A0O B;  1LOW A;  1BIR A;  3EF8 A;  1IQY A;  1TP6 A;  1TTO A;  3HZP A;  3K63 A;  2UX0 A;  4WP5 A;  1V74 A;  3B8L A;  5KP3 A;  4EC6 A;  1GMP A;  1S5A A;  1VZZ A;  4KFE A;  1JV2 B;  4XBT A;  3Q1C A;  4WFO A;  1IVV A;  1NU3 A;  2KF3 A;  3WA2 X;  3GZY B;  5CF1 A;  3SED A;  5D83 A;  3NV0 A;  1WMP A;  1IVU A;  9RNT A;  1JBR A;  1GY5 A;  1ZS7 A;  4HVN A;  1UW1 A;  3M8C A;  3NQZ A;  2CWU A;  2OQE C;  3EE1 A;  1B20 A;  1TFO A;  4KFD A;  1NO3 A;  5JPP A;  1GOU A;  1MGR A;  2GEY A;  5BVB A;  1VQM 3;  4LSO A;  2ZDJ A;  5EQL A;  1R4C A;  5ELU A;  2W0Q A;  3N8B A;  4GSP A;  1BU4 A;  2C10 A;  1BRG A;  3AGO A;  3G0K A;  3K0Z A;  4MJD A;  1NJI 4;  1QAF A;  5G1K A;  2F86 B;  1W2B 2;  3OW2 2;  4FCM A;  7RNT A;  2UGI A;  4BIR A;  3CCL 3;  1IQ8 A;  4HM0 B;  5AII A;  1SII A;  3STD A;  4FMB A;  3GRD A;  2UUG C;  1E3V A;  2GXF A;  1YVB I;  2H0H A;  3MG2 A;  1FW7 A;  3OWS A;  3FLJ A;  1JRQ A;  5TGN A;  2F98 A;  3FG1 A;  1DMN A;  3N9H A;  3BNE A;  1FUS A;  5EEO A;  1SPU A;  1U8C B;  2B1X B;  3SYU A;  3RNT A;  3ROB A;  3CCM 3;  4IIA A;  3PCS A;  1RN7 A;  4O02 B;  2XF3 A;  3OWU A;  3NV0 B;  3CCS 3;  1RCK A;  5IEO A;  4GB5 A;  5IW9 A;  1CH0 A;  1OCV A;  1YNV X;  2OOV A;  3WHO A;  1A67 A;  2CX1 A;  1ISK A;  5D81 A;  1UUW B;  1ULI B;  2KAA A;  2CW9 A;  2WGO A;  4BL3 A;  1BSE A;  5AYR B;  1ULJ B;  2XRX B;  3IMA B;  2ZA4 A;  3EB8 A;  1NB5 I;  1M90 4;  3NM7 A;  3KZT A;  3VSY A;  3LTA A;  1UDI I;  3F8X A;  4I5Q A;  2LQV A;  1RCL A;  5AYS C;  2WGQ A;  4N6T A;  8CHO A;  3CC2 3;  1U5O A;  1BNS A;  1KWI A;  2Z6B A;  3LT8 A;  1AV4 A;  2D1W A;  2CFK A;  4HYZ A;  1LOV A;  4J5K A;  3F14 A;  1B27 A;  4BTY A;  3D4A A;  5IEP A;  1BRN L;  2D42 A;  1W6G A;  2F5W A;  1A2P A;  4N6U A;  3LH4 A;  3HK4 A;  1VQ5 3;  5FGO A;  1UCI A;  2W2C A;  1JBT A;  2GBW B;  1RGK A;  4Q53 A;  2CWT A;  1AVK A;  8RNT A;  2P05 A;  4BTX A;  1I2E A;  3X42 A;  2OTL 3;  2F5M A;  2ML5 A;  5RNT A;  3T0U A;  2RFR A;  1GOV A;  4RBN A;  1Q9E A;  2WO0 A;  3X40 A;  1UCJ A;  1T3B A;  1V58 A;  3ZG0 A;  4G1M B;  1MWR A;  4HOH A;  1IQX A;  1RKY A;  4XB5 A;  1RTU A;  1OAC A;  2KF6 A;  2W6J H;  2Z7A A;  3ALA A;  3DUK A;  3QRD A;  1BUQ A;  4NPB A;  2YFI B;  1Q86 4;  1GOY A;  5EVH A;  3TDG A;  2QA4 3;  3S28 A;  3EBY A;  3EHC A;  6STD A;  4HM7 B;  1J2B A;  1N8R 4;  4WYK A;  1BSC A;  1W4N A;  5JBS A;  5STD A;  2QGU A;  4HM2 B;  3ZG5 A;  4N3V A;  3CC7 3;  4EYC A;  3F7X A;  3LT9 A;  3DGN A;  1B2U A;  3H51 A;  2MC8 A;  4CCV A;  1TUH A;  3I55 3;  3EC9 A;  1GSP A;  2XGN A;  3K5T A;  4XDW A;  4ORL A;  5KP1 A;  3X3X A;  2OCT A;  1FZU A;  1GY6 A;  2CFG A;  1B2S A;  1FUT A;  1G02 A;  3L0R A;  1BNJ A;  3S67 A;  3FG4 A;  3X3Y A;  4BL2 A;  2JQ5 A;  4KZ1 A;  1N9E A;  2Y74 A;  3DGL A;  3LTD A;  3FF2 A;  1Q7Y 4;  2W04 A;  4HJL B;  1LOX A;  5LC7 A;  5IG4 A;  1B2Z A;  2GBX B;  3DZL A;  2Z77 A;  1BNE A;  3Q3F A;  2XFT A;  1BVI A;  7STD A;  2HMK B;  3DGO A;  4JRF A;  1B21 A;  4RNY A;  1Z1S A;  3BIR A;  3FG3 A;  5M18 A;  1ZX2 A;  1YIJ 3;  3HI7 A;  1G0T A;  4R80 A;  1OPY A;  1TFK A;  2GU1 A;  4WYK B;  4CPK A;  1E3R A;  4X2H A;  1GY7 A;  3NQY A;  3G6E 3;  4FMC A;  2A15 A;  4HM4 B;  4I4K A;  1RNT A;  3GAX A;  1QAL A;  3NBJ A;  1YIT 3;  3SOA A;  1KQS 2;  2PZV A;  4R9K A;  5AIF A;  1RGH A;  3CCQ 3;  2CFD A;  1PU4 A;  4KT3 B;  1R4Y A;  1TU5 A;  2SBL A;  1K41 A;  1IV7 A;  2JDI H;  2XGL A;  3EBT A;  1BAN A;  1FGR A;  1MOL A;  1UGI A;  1JKG A;  4HM1 B;  4K61 A;  4HM8 B;  3I0Y A;  1QVF 2;  1LOY A;  3RGA A;  1BRH A;  1PYL A;  3PS8 A;  1QAK A;  1A2V A;  2Z76 A;  1MWT A;  3HOH A;  1OHP A;  4GHO A;  3N54 B;  3UL5 A;  3LZA A;  5AIG A;  1C7H A;  1SJW A;  1QMA A;  2O9U X;  3D5G A;  3MKI A;  1CQS A;  1NWW A;  1PY3 A;  1WQL B;  3S29 A;  6GSP A;  2F56 A;  3EN8 A;  1YHQ 3;  3DH2 A;  4FMA A;  3FZW A;  3OXA A;  1W2Z A;  3GZB A;  4OUQ A;  2QEX 3;  2CWV A;  1OGX A;  3D5I A;  2BHM A;  1ASK A;  3IPT A;  1DMM A;  2P0M A;  3MHE A;  1JZD A;  2P38 A;  1I0X A;  1EG9 B;  1A2K A;  3GZR A;  4ILF A;  1EA2 A;  4LEH A;  1Q82 4;  1X1U A;  1AR0 A;  3DXO A;  3DY5 A;  3KSP A;  2BMR B;  4IT7 A;  2OTJ 3;  2FGT A;  3JUN A;  1RGL A;  3O8Y A;  4O8S A;  1BRS A;  1DVD A;  4X2O A;  1V57 A;  1GD4 A;  1BRJ A;  1ROV A;  4BU4 A;  1N5H A;  1JN5 B;  1JKG B;  5BIR A;  1HKX A;  2O3O A;  3OX9 A;  3EQQ B;  3S27 A;  4BTW A;  3KCH A;  2QIY A;  3DMC A;  2R41 A;  3G16 A;  2BT3 A;  5IG3 A;  1DE3 A;  3NBR A;  4K1V A;  2IUJ A;  5HGR A;  4RNT A;  3BB9 A;  1CEW I;  1CYV A;  1M9G A;  3JUM A;  4L8P A;  5G1L A;  1VQ9 3;  1HYF A;  1JB4 A;  2V1L A;  3WMD A;  4N6L A;  2CFL A;  2CG1 A;  2P09 A;  1SQW A;  2IA7 A;  1AVL A;  3NUV A;  1RN4 A;  2BNG A;  3FSD A;  3IJE B;  4L7K A;  4NHF A;  1OUN A;  3CNX A;  2W56 A;  4IPB A;  3CXC 2;  1MGW A;  3OV4 A;  1GMQ A;  4MMZ B;  2F99 A;  1HZ1 A;  1W6Y A;  2CKF B;  1IVW A;  3BLZ A;  3BNC A;  3MYT A;  2C4B A;  4HZB B;  4LGQ A;  4R9L A;  1DVC A;  1VQN 3;  3F9S A;  4HKV B;  1FYS A;  1CYU A;  2LYX A;  3UNL A;  1BSB A;  3DGY A;  2GSP A;  1IVX A;  3T8N A;  3K9M C;  1D6Z A;  2CH9 A;  5BXQ A;  4N6M A;  2H0G A;  1D6U A;  4EXR A;  1NDO B;  4OVM A;  1FGQ A;  5JPU A;  3AGN A;  1TRQ A;  3J7Y d;  1VQL 3;  2BIR A;  1JZO A;  4N6V 0;  1BNF A;  5CLK A;  3KSE D;  1B2X A;  3JUQ A;  5AI1 A;  1M1K 4;  4H3U A;  1W00 A;  4OK0 A;  1WMN A;  4CDL A;  5M19 A;  1YI2 3;  1YVS A;  1BOX A;  2CG0 A;  3CC4 3;  2H0I A;  3PZW A;  4XDV A;  3UL6 A;  1W6C A;  2HMN B;  1MWS A;  1E97 A;  1JJ2 2;  4HBR A;  1L5G B;  3CMA 3;  2RCD A;  1Y4K A;  4FMD A;  3F8H A;  1YJW 3;  4AEQ A;  2W56 B;  4MMX B;  1DYU A;  1Q7H A;  3WOD G;  3E99 A;  4RNZ A;  2IY2 A;  3RDE A;  1IT8 A;  2Y73 A;  1N8Q A;  2J8X B;  5IG0 A;  3CME 3;  3CPW 2;  2YFJ B;  4KVH A;  1LNI A;  2OWP A;  1O7W B;  1IV9 A;  4U13 A;  2SAR A;  3CNM A;  4K90 B;  4WWU C;  1WNH A;  1O7G B;  4O2H A;  3V98 A;  2GU3 A;  2CIU A;  3KII A;  1QVG 2;  2RSX A;  1VQ8 3;  2KF5 A;  2OQE A;  1JB2 A;  1UGH I;  3MPH A;  1RGA A;  1US1 A;  2FXT A;  1ZGX A;  2CK3 H;  4XBY A;  3VF1 A;  1A90 A;  2STD A;  2HML B;  1O7P B;  3GSP A;  1BAO A;  1FUW A;  1RNB A;  3NBB A;  2FNQ A;  2IYJ A;  1G96 A;  2XH9 A;  3VGN A;  3BND A;  3GWR A;  4JF8 A;  1RN1 A;  4QWT A;  2C11 A;  1Q40 A;  4EV2 A;  3PXM A;  1QJG A;  1BSA A;  4MEI A;  1YGE A;  4HZ9 B;  1JBS A;  5CF2 A;  3D9R A;  1TJD A;  3URP A;  2K54 A;  2KXG A;  1Q42 A;  1JN5 A;  1Q81 4;  2RBI A;  1UCK A;  3T8U A;  2BO9 B;  1KD1 4;  1PFP A;  1YGW A;  2M7O A;  1RMS A;  3S5C A;  2ML6 A;  3U1W A;  3U97 A;  5IF6 A;  4L8O A;  4FR9 A;  3CCJ 3;  1BNI A;  1OF5 A;  1BGS A;  2XR8 B;  1BRI A;  5DRV A;  1ZO2 A;  1NB3 I;  5IER A;  1VQK 3;  3CU3 A;  3JVC A;  7GSP A;  4AKY A;  4EW5 A;  3CCU 3;  2P0X A;  3D3L A;  1KSI A;  1OHO A;  1T2I A;  3F40 A;  3MG3 A;  3FGY A;  3UJM A;  1KC8 4;  4LYL B;  1UUV B;  3WOE B;  1UI7 A;  4LZI A;  4NRE A;  4MMY B;  2W03 A;  1F8N A;  2WOH A;  3EN1 B;  5LC6 A;  1EQK A;  1Q40 B;  1RGF A;  1RGE A;  2K3D A;  3HIG A;  4J9A A;  2HMO B;  1MWU A;  3GZX B;  5BU4 A;  1IU7 A;  1JNQ A;  1STD A;  3NHX A;  3ECF A;  1W01 A;  4AKZ A;  3LXU X;  1STF I;  1I2F A;  2RGQ A;  4LMI A;  3MG1 A;  2Q07 A;  1DET A;  1YJ9 3;  3SLU A;  1LQM B;  3KKG A;  4HM6 B;  1RSN A;  5IG5 A;  1AY7 A;  1BNG A;  3LTC A;  1OHS A;  3V92 A;  2ZL8 A;  2YX9 A;  5IEN A;  1UUG B;  1W7C A;  2CFW A;  3Q2P A;  3WOF B;  5AEW B;  3NX0 A;  1OF5 B;  3FF0 A;  1VQ4 3;  5HOH A;  1HU9 A;  1K9M 4;  2MF7 A;  4FCJ A;  5M1A A;  2XSO B;  5ELJ A;  1EEJ A;  3CD6 3;  1I0V A;  3G8Z A;  3B7C A;  2E2U A;  3A5E A;  2HOH A;  1K8A 4;  4J5G A;  1SIH A;  4CJN A;  1S72 3;  2CHC A;  2R4I A;  1DMQ A;  1EKM A;  1GS3 A;  1M1X B;  4GL6 A;  4EV5 A;  2KF4 A;  1GYB A;  2RNT A;  2CX0 A;  1I8V A;  1RGC A;  2W9Q A;  3B4O A;  3BU4 A;  5I97 A;  1RHL A;  6RNT A;  3SXX A;  3LYG A;  3NXJ A;  2ZHX B;  3WA3 A;  1K73 4;  1VQO 3;  2L4V A;  2W9P A;  3CCR 3;  3DM8 A;  3B4P A;  5DRE A;  4PEJ A;  2WOF A;  1B2M A;  1NNV A;  2AAD A;  4EBG A;  1GMR A;  1FGM A;  3ZFZ A;  1D6Y A;  2CC3 A;  3MWZ A;  5GSP A;  1AQZ A;  2KCD A;  4STD A;  3I56 3;  1OGZ A;  4WHA A;  1X1X A;  1LVN A;  3A76 A;  3AHW A;  4KFF A;  4R4K A;  2HMM B;  3LOY A;  3FKA A;  2B24 B;  1TIJ A;  1YJN 3;  1W5Z A;  2PNC A;  3MSO A;  1T2H A;  1BNR A;  1LRA A;  3EX9 A;  2IMJ A;  2KRT A;  3OWY A;  1B3S A;  1T5Y A;  1IK3 A;  1TRP A;  1FGO A;  3EJV A;  1RRL A;  1IYY A;  1I70 A;  3G71 3;  5CXO A;  4N6N B;  3KN4 A;  3WR2 A;  1C54 A;  2XSH B;  1OH0 A;  1FA3 A;  3NM2 A;  1RDS A;  3AMO A;  3CPO A;  4XBX A;  4N6O B;  1RLS A;  2HMJ B;  3G4S 3;  4HAA A;  1I3I A;  1I2G A;  3SX1 A;  3FH1 A;  2GEX A;  2IUK A;  3JUP A;  4HM5 B;  2BMQ B;  2OOV C;  1VQ6 3;  1LQG C;  1LNH A;  2F4Y A;  3SOY A;  3H3H A;  3UB1 A;  2E2V A;  3D79 A;  1VQ7 3;  1RGG A;  2XEP A;  3CCV 3;  1I3F A;  1LXE A;  1VQQ A; 
#chains in the Genus database with same CATH homology
 3BNB A;  3V99 A;  1UI8 A;  3F7S A;  3KFQ C;  1W02 A;  1K28 A;  3JUO A;  1N9J A;  4J8T A;  4TX4 A;  2YFL B;  4XM4 A;  2E2T A;  3Q90 A;  1O7H B;  2I9W A;  2INX A;  5D82 A;  1WTH A;  1WMO A;  3HII A;  3PYJ A;  4O3V A;  1RRH A;  5AEU B;  1IDP A;  4K1U A;  5AIH A;  3QK9 A;  3X3Z A;  3AMO B;  1N5P A;  3K7C A;  3X41 A;  5G2G A;  3FCS B;  3PCR A;  1RJO A;  1GD3 A;  3LTB A;  3SVA A;  5KP4 A;  4ZM8 A;  3WDG B;  1MNL A;  1VQP 3;  1IT7 A;  2XFS A;  3PGB A;  3KE7 A;  4HM3 B;  1O7M B;  4R1K A;  5CK6 A;  4RZM A;  1FGT A;  3LML A;  4FCZ A;  5FW5 A;  1O7N B;  3ER7 A;  1JB5 A;  3RGR A;  3HX8 A;  2BMO B;  3CCE 3;  3DGM A;  1ROA A;  2K0M A;  4H61 A;  5A0O B;  3EF8 A;  1IQY A;  1TP6 A;  3HZP A;  3K63 A;  4WP5 A;  2UX0 A;  1V74 A;  3B8L A;  5KP3 A;  4EC6 A;  1S5A A;  1VZZ A;  4KFE A;  1JV2 B;  4XBT A;  3Q1C A;  4WFO A;  1IVV A;  1NU3 A;  3WA2 X;  3GZY B;  5CF1 A;  3SED A;  5D83 A;  3NV0 A;  1WMP A;  1IVU A;  1GY5 A;  4HVN A;  1UW1 A;  3M8C A;  3NQZ A;  2CWU A;  2OQE C;  3EE1 A;  1TFO A;  4KFD A;  1NO3 A;  5JPP A;  5BVB A;  2GEY A;  1VQM 3;  4LSO A;  2ZDJ A;  5EQL A;  1R4C A;  5ELU A;  2W0Q A;  3N8B A;  2C10 A;  3G0K A;  3K0Z A;  4MJD A;  1NJI 4;  1QAF A;  2F86 B;  1W2B 2;  3OW2 2;  4FCM A;  3CCL 3;  1IQ8 A;  4HM0 B;  5AII A;  1SII A;  3STD A;  4FMB A;  3GRD A;  1E3V A;  2GXF A;  1YVB I;  3MG2 A;  3OWS A;  3FLJ A;  1JRQ A;  5TGN A;  2F98 A;  3FG1 A;  1DMN A;  3N9H A;  3BNE A;  5EEO A;  3CCM 3;  1SPU A;  1U8C B;  2B1X B;  3ROB A;  4IIA A;  3PCS A;  1RN7 A;  4O02 B;  2XF3 A;  3OWU A;  3NV0 B;  3CCS 3;  5IEO A;  4GB5 A;  5IW9 A;  1OCV A;  2OOV A;  1A67 A;  1ISK A;  5D81 A;  1UUW B;  1ULI B;  2CW9 A;  2WGO A;  5AYR B;  1ULJ B;  2XRX B;  3IMA B;  3EB8 A;  1NB5 I;  1M90 4;  3NM7 A;  3KZT A;  3VSY A;  3LTA A;  3F8X A;  2LQV A;  5AYS C;  2WGQ A;  4N6T A;  8CHO A;  3CC2 3;  1U5O A;  1KWI A;  2Z6B A;  3LT8 A;  1AV4 A;  2D1W A;  2CFK A;  4HYZ A;  3F14 A;  4BTY A;  5IEP A;  2D42 A;  1W6G A;  4N6U A;  3LH4 A;  3HK4 A;  1VQ5 3;  5FGO A;  2W2C A;  2GBW B;  4Q53 A;  2CWT A;  1AVK A;  2P05 A;  4BTX A;  3X42 A;  2OTL 3;  2ML5 A;  3T0U A;  2RFR A;  4RBN A;  2WO0 A;  4G1M B;  1RKY A;  1IQX A;  4XB5 A;  1OAC A;  2W6J H;  2Z7A A;  3ALA A;  3DUK A;  3QRD A;  1BUQ A;  2YFI B;  1Q86 4;  5EVH A;  3TDG A;  2QA4 3;  3S28 A;  3EBY A;  3EHC A;  6STD A;  4HM7 B;  1J2B A;  1N8R 4;  4WYK A;  1W4N A;  5JBS A;  5STD A;  2QGU A;  4HM2 B;  4N3V A;  3CC7 3;  4EYC A;  3F7X A;  3LT9 A;  3DGN A;  3H51 A;  2MC8 A;  4CCV A;  1TUH A;  3I55 3;  3EC9 A;  2XGN A;  3K5T A;  4XDW A;  4ORL A;  5KP1 A;  3X3X A;  2OCT A;  1GY6 A;  2CFG A;  3X3Y A;  3L0R A;  3S67 A;  3FG4 A;  2JQ5 A;  4KZ1 A;  1N9E A;  2Y74 A;  3DGL A;  3LTD A;  3FF2 A;  1Q7Y 4;  2W04 A;  4HJL B;  1LOX A;  5LC7 A;  5IG4 A;  2GBX B;  3DZL A;  2Z77 A;  2XFT A;  7STD A;  2HMK B;  3DGO A;  4JRF A;  4RNY A;  1Z1S A;  3FG3 A;  1ZX2 A;  1YIJ 3;  3HI7 A;  4R80 A;  1OPY A;  1TFK A;  2GU1 A;  4WYK B;  1E3R A;  4X2H A;  1GY7 A;  3NQY A;  3G6E 3;  4FMC A;  2A15 A;  4HM4 B;  4I4K A;  3GAX A;  1QAL A;  3NBJ A;  1YIT 3;  3SOA A;  1KQS 2;  2PZV A;  4R9K A;  5AIF A;  3CCQ 3;  2CFD A;  1PU4 A;  1TU5 A;  2SBL A;  1K41 A;  1IV7 A;  2JDI H;  2XGL A;  3EBT A;  4K61 A;  1FGR A;  1MOL A;  3X40 A;  1JKG A;  4HM1 B;  1QVF 2;  4HM8 B;  3I0Y A;  3RGA A;  3PS8 A;  1QAK A;  1A2V A;  2Z76 A;  1OHP A;  3N54 B;  3UL5 A;  3LZA A;  5AIG A;  1C7H A;  1SJW A;  1QMA A;  2O9U X;  3MKI A;  1CQS A;  1NWW A;  1WQL B;  3S29 A;  1YHQ 3;  3EN8 A;  4FMA A;  3FZW A;  3OXA A;  1W2Z A;  3GZB A;  4OUQ A;  2QEX 3;  2CWV A;  1OGX A;  2BHM A;  1ASK A;  3IPT A;  1DMM A;  2P0M A;  3MHE A;  2P38 A;  1EG9 B;  1A2K A;  3GZR A;  4LEH A;  1EA2 A;  1Q82 4;  3DY5 A;  1AR0 A;  3DXO A;  3KSP A;  4IT7 A;  2BMR B;  2OTJ 3;  2FGT A;  3JUN A;  3O8Y A;  4O8S A;  1DVD A;  4X2O A;  1GD4 A;  1ROV A;  1N5H A;  1JN5 B;  1JKG B;  1HKX A;  2O3O A;  3OX9 A;  3EQQ B;  3S27 A;  4BTW A;  2QIY A;  3DMC A;  3G16 A;  2BT3 A;  5IG3 A;  3NBR A;  4K1V A;  2IUJ A;  5HGR A;  3BB9 A;  1CEW I;  1CYV A;  1M9G A;  3JUM A;  4L8P A;  1VQ9 3;  1JB4 A;  2V1L A;  3WMD A;  4N6L A;  2CFL A;  2CG1 A;  2P09 A;  1SQW A;  2IA7 A;  1AVL A;  3NUV A;  2BNG A;  3FSD A;  3IJE B;  4L7K A;  4NHF A;  1OUN A;  3CNX A;  2W56 A;  4IPB A;  3CXC 2;  3OV4 A;  4MMZ B;  2F99 A;  4HZB B;  1W6Y A;  2CKF B;  1IVW A;  3BLZ A;  3BNC A;  3MYT A;  4LGQ A;  1VQN 3;  4R9L A;  1DVC A;  1CYU A;  3F9S A;  4HKV B;  2LYX A;  3UNL A;  1IVX A;  3T8N A;  3K9M C;  1D6Z A;  2CH9 A;  5BXQ A;  4N6M A;  1D6U A;  4EXR A;  1NDO B;  4OVM A;  1FGQ A;  5JPU A;  3J7Y d;  1VQL 3;  4N6V 0;  5CLK A;  3KSE D;  3JUQ A;  1M1K 4;  5AI1 A;  4H3U A;  1W00 A;  4OK0 A;  1WMN A;  4CDL A;  1YI2 3;  2CG0 A;  3CC4 3;  3PZW A;  4XDV A;  3UL6 A;  1W6C A;  2HMN B;  1E97 A;  1JJ2 2;  4HBR A;  1L5G B;  3CMA 3;  2RCD A;  1Y4K A;  4FMD A;  3F8H A;  1YJW 3;  4AEQ A;  2W56 B;  4MMX B;  1DYU A;  3WOD G;  3E99 A;  4RNZ A;  3RDE A;  1IT8 A;  2Y73 A;  1N8Q A;  5IG0 A;  3CME 3;  3CPW 2;  2YFJ B;  4KVH A;  2OWP A;  1O7W B;  1IV9 A;  4U13 A;  3CNM A;  4K90 B;  4WWU C;  1WNH A;  1O7G B;  4O2H A;  3V98 A;  2GU3 A;  2CIU A;  3KII A;  1QVG 2;  2RSX A;  1VQ8 3;  2OQE A;  1JB2 A;  3MPH A;  1US1 A;  2FXT A;  2CK3 H;  4XBY A;  3VF1 A;  1A90 A;  2STD A;  2HML B;  1O7P B;  1FUW A;  3NBB A;  2FNQ A;  1G96 A;  2XH9 A;  3VGN A;  3BND A;  3GWR A;  4JF8 A;  4QWT A;  2C11 A;  1Q40 A;  4EV2 A;  3PXM A;  1QJG A;  4MEI A;  1YGE A;  4HZ9 B;  5CF2 A;  3D9R A;  2K54 A;  2KXG A;  1Q42 A;  1JN5 A;  1Q81 4;  3T8U A;  2BO9 B;  1KD1 4;  1PFP A;  2M7O A;  3S5C A;  2ML6 A;  3U1W A;  3U97 A;  5IF6 A;  4L8O A;  4FR9 A;  3CCJ 3;  1OF5 A;  2XR8 B;  5DRV A;  1ZO2 A;  1NB3 I;  5IER A;  1VQK 3;  3CU3 A;  3JVC A;  4AKY A;  3CCU 3;  2P0X A;  3D3L A;  1KSI A;  1OHO A;  3F40 A;  3UJM A;  3MG3 A;  3FGY A;  1KC8 4;  1UUV B;  3WOE B;  1UI7 A;  4LZI A;  4NRE A;  4MMY B;  2W03 A;  1F8N A;  2WOH A;  3EN1 B;  5LC6 A;  1EQK A;  1Q40 B;  3HIG A;  4J9A A;  2HMO B;  3GZX B;  1IU7 A;  1JNQ A;  1STD A;  3NHX A;  3ECF A;  1W01 A;  4AKZ A;  3LXU X;  1STF I;  2RGQ A;  4LMI A;  3MG1 A;  2Q07 A;  1YJ9 3;  3SLU A;  5IG5 A;  3KKG A;  4HM6 B;  3LTC A;  1OHS A;  3V92 A;  2ZL8 A;  2YX9 A;  5IEN A;  1W7C A;  3WOF B;  2CFW A;  3Q2P A;  5AEW B;  3NX0 A;  1OF5 B;  3FF0 A;  1VQ4 3;  1HU9 A;  1K9M 4;  2MF7 A;  4FCJ A;  2XSO B;  5ELJ A;  3CD6 3;  3G8Z A;  3B7C A;  2E2U A;  1K8A 4;  1SIH A;  1S72 3;  2CHC A;  2R4I A;  1DMQ A;  1EKM A;  1GS3 A;  1M1X B;  4GL6 A;  4EV5 A;  1GYB A;  2W9Q A;  3B4O A;  5I97 A;  3SXX A;  3LYG A;  3NXJ A;  3WA3 A;  1K73 4;  1VQO 3;  2L4V A;  2W9P A;  3CCR 3;  3DM8 A;  3B4P A;  5DRE A;  4PEJ A;  2WOF A;  4EBG A;  1FGM A;  1D6Y A;  2CC3 A;  3MWZ A;  2KCD A;  4STD A;  3I56 3;  1OGZ A;  1LVN A;  3A76 A;  4KFF A;  4R4K A;  2HMM B;  3LOY A;  3FKA A;  2B24 B;  1TIJ A;  1YJN 3;  1W5Z A;  2PNC A;  3MSO A;  3EX9 A;  2IMJ A;  2KRT A;  3OWY A;  1T5Y A;  1IK3 A;  1FGO A;  3EJV A;  1RRL A;  3G71 3;  5CXO A;  4N6N B;  3KN4 A;  2XSH B;  1OH0 A;  1FA3 A;  3NM2 A;  3AMO A;  3CPO A;  4XBX A;  4N6O B;  2HMJ B;  3G4S 3;  3SX1 A;  3FH1 A;  2GEX A;  2IUK A;  3JUP A;  4HM5 B;  2BMQ B;  2OOV C;  1VQ6 3;  1LNH A;  3SOY A;  3H3H A;  3UB1 A;  2E2V A;  1VQ7 3;  2XEP A;  3CCV 3;  4WHA A;  1LXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...