3LZAA

Crystal structure of putative snoal-like polyketide cyclase (yp_563807.1) from shewanella denitrificans os-217 at 1.70 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
137
structure length
137
Chain Sequence
DRPIEQQLALGYIKALTEHDYQTLSKYYNRDSVFYDKTADTKYIGTRSIIAFLQRSHEGVLEFDFNIEHMFNTGPLVVMIGNYHLRGPGEQFGKPGKIIDIAIPGVTTLKFDPNTQRLTEQVDLMDYQTMSDQLQSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative SnoaL-like polyketide cyclase
publication title CRYSTAL STRUCTURE OF PUTATIVE SNOAL-LIKE POLYKETIDE CYCLASE (YP_563807.1) FROM SHEWANELLA DENITRIFICANS OS-217 AT 1.70 A RESOLUTION
rcsb
source organism Shewanella denitrificans
molecule tags Lyase
total genus 44
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3lzaA00
4X2OA 3T8UA 5IEPA 1O7NB 3B4OA 4H3UA 4HZ9B 2F99A 3OXAA 2A15A 2Z7AA 3EQQB 4HM0B 3IPTA 3CU3A 1NWWA 1DMQA 2PZVA 3B4PA 3GZRA 5IG5A 1ISKA 4U13A 2QIYA 1UUWB 3JUMA 1OF5A 3DZLA 2HMOB 4X2HA 3SOAA 2BMQB 4J9AA 1OH0A 4HVNA 5STDA 1GS3A 4STDA 2F98A 1JKGA 3GWRA 2YFLB 4N3VA 1STDA 2STDA 2XSHB 2W2CA 2CKFB 1ZO2A 5D82A 4I4KA 5AEWB 1OF5B 2OWPA 4IIAA 1O7GB 4XBYA 3KKGA 4LGQA 5IEOA 3T8NA 1Q40A 2Z77A 1GY5A 2RCDA 3ROBA 4J8TA 2CHCA 5DREA 3EHCA 4HM6B 6STDA 4OVMA 1AR0A 3FH1A 1EG9B 3SEDA 3S5CA 1IDPA 2HMJB 1JN5B 1UUVB 1A2KA 1HKXA 3MG1A 3JUOA 2INXA 3OWYA 3RGAA 3ECFA 3CNXA 3NBRA 5DRVA 2HMLB 1Q40B 3EC9A 3HZPA 1TP6A 5BVBA 3VSYA 5KP4A 4L8PA 3F7XA 4KVHA 1TUHA 1ULIB 5IENA 2GXFA 1OCVA 1GY7A 3MHEA 3FLJA 3Q90A 3DMCA 5KP3A 3A76A 1W02A 1BUQA 5AEUB 1OGZA 7STDA 3K0ZA 3B8LA 2IMJA 2R4IA 4HM5B 5AIFA 4FCMA 4WP5A 3M8CA 3F8XA 4HKVB 4XB5A 3BLZA 4K1UA 3OX9A 4ORLA 4XDVA 2BMRB 5FW5A 5BXQA 1NDOB 3NV0B 4XDWA 3JUPA 3OV4A 5JPPA 1W6YA 5IG0A 1OHSA 3UJMA 3D9RA 5AIGA 2GEXA 4HZBB 5IG3A 3MSOA 1E3VA 1JN5A 3MG3A 3STDA 3GZYB 1VZZA 3FZWA 3MYTA 2YFJB 2I9WA 3OWUA 4FCJA 4PEJA 3B7CA 1E3RA 1DMNA 5JPUA 4R9KA 3OWSA 3DXOA 4GB5A 5D83A 4CDLA 3NM2A 3HK4A 4XM4A 3NXJA 2RFRA 4HM8B 3GZXB 4HM2B 3FSDA 3ER7A 4Q53A 5D81A 3MG2A 3KE7A 5KP1A 5IF6A 3GZBA 3DUKA 3G8ZA 3F8HA 3EJVA 1O7PB 4WYKB 5EVHA 3KZTA 1SJWA 5CLKA 1GYBA 1OGXA 4HM7B 4XBTA 5CF2A 1JB5A 3NV0A 3K7CA 4RZMA 5IERA 4HJLB 2HMMB 3CPOA 1OPYA 3G16A 3F9SA 1O7WB 2BNGA 3FGYA 1QJGA 4L8OA 3MKIA 2JQ5A 3F40A 1GY6A 2QGUA 3NUVA 3EN1B 8CHOA 1OHOA 1CQSA 5CK6A 1ZX2A 2K54A 3I0YA 1W00A 1Q42A 3SOYA 2UX0A 1W01A 3EN8A 4L7KA 3RGRA 4R1KA 3FKAA 5AIIA 5IG4A 3UNLA 3LZAA 4HM4B 3EX9A 2HMKB 3NHXA 1WQLB 1Z1SA 4LMIA 1JB4A 4XBXA 4OUQA 1JB2A 3EF8A 2F86B 4K1VA 3H3HA 3BB9A 5AI1A 3FF2A 1OUNA 1EA2A 2RGQA 4HM1B 3JUQA 2Z76A 5AIHA 1ASKA 1U5OA 4R9LA 3JUNA 3G0KA 1E97A 4LEHA 2GBXB 2B24B 5CF1A 1S5AA 1JKGB 4WYKA 2HMNB 4MJDA 3GRDA 3KSPA 2GEYA 5TGNA 5G2GA 3EBTA 1OHPA 1DMMA 1NU3A 4HM3B 1QMAA 2YFIB 1ULJB 3HX8A 3EBYA 1O7MB 2XRXB 1K41A 2B1XB 3H51A 3VGNA 2XR8B 2XSOB 5HGRA 3F14A 1C7HA 3DM8A 2BMOB 2GBWB 5CXOA 3WMDA 4WWUC 1O7HB 3F7SA 3LYGA 3FF0A 3E99A 3CNMA
chains in the Genus database with same CATH superfamily
1I0XA 2WGOA 4X2OA 3T8UA 1BNRA 4AKZA 5JBSA 2KCDA 5IEPA 2ZDJA 3SYUA 1QALA 4KT3B 1O7NB 4R4KA 4HYZA 4NPBA 3B4OA 4H3UA 4HZ9B 3X3ZA 4LZIA 2BT3A 2J8XB 2F99A 3OXAA 3PYJA 1B2UA 2A15A 2Z7AA 2D1WA 3EQQB 4HM0B 1UCJA 3IPTA 3WDGB 1CEWI 2LQVA 3CU3A 5RNTA 1W4NA 3LTAA 1FUWA 1NNVA 1NWWA 1DMQA 2PZVA 1B21A 3B4PA 3GZRA 2CX0A 7GSPA 1WMPA 3DGOA 3NBJA 5IG5A 2CWVA 2P09A 4BL2A 1ISKA 2UGIA 4U13A 3NQZA 2QIYA 1BOXA 4FR9A 1Q7Y4 1BRNL 1UUWB 1UUGB 3KCHA 1BNIA 3JUMA 1B2SA 1OF5A 3DZLA 2BIRA 2L1SA 2HMOB 1G96A 4X2HA 4N6TA 2Q07A 1PYLA 4O3VA 3SOAA 2H0GA 1YIT3 3BNBA 2BMQB 4J9AA 3DGNA 1X1WA 1OH0A 3CCL3 5ELUA 2SBLA 2CC3A 2W0QA 3LT9A 3Q3FA 4TX4A 4HVNA 5STDA 3LT8A 2OTL3 1GS3A 1FUSA 4STDA 2F98A 1JKGA 1GD4A 3EB8A 4IPBA 3GWRA 2YFLB 4NHFA 4N6LA 2MC8A 3AGNA 1QAKA 4N3VA 1RGFA 4O2HA 1VQ53 1A67A 4IT7A 3BNDA 1STDA 2STDA 1LVNA 2CFGA 3CMA3 1Q814 3UB1A 1AQZA 1M1K4 1B3SA 1MWSA 2XSHB 3G713 1YVBI 4BTXA 4KFDA 3N8BA 4EW5A 2W2CA 1BSAA 2CKFB 2W04A 1ROAA 1T5YA 1ZO2A 3LMLA 4I4KA 5D82A 5AEWB 1OF5B 1A90A 1F8NA 1RGKA 3HI7A 2OWPA 1RGCA 3HIGA 1L5GB 4IIAA 1C54A 1WNHA 1GOUA 1T2HA 3WOFB 1MGRA 4J5KA 1U8CB 1RSNA 3K5TA 1VQL3 4N6OB 1O7GB 3ZFZA 3X3YA 3QK9A 1B20A 2P38A 2RNTA 1MNLA 2RBIA 4XBYA 1MOLA 3KKGA 4LGQA 5IEOA 3T8NA 1Q40A 2Z77A 3N9HA 1BRKA 1GY5A 2RCDA 1AVLA 3ROBA 4J8TA 2P05A 2CHCA 5DREA 2FNQA 3LTBA 3EHCA 2ML6A 4HM6B 4DKIA 6STDA 1PU4A 4OVMA 1AR0A 3FH1A 3CXC2 1EG9B 3SEDA 3S5CA 1UI8A 2W9PA 1DETA 3KSED 1IDPA 1I2FA 2XH9A 1TFOA 1GMRA 1UUVB 1JN5B 1UGIA 2GU3A 2HMJB 1LNHA 2CFWA 1A2KA 1W2ZA 2OQEA 1NB5I 3D5IA 3MWZA 1BAOA 4FMCA 1HKXA 3MG1A 2H0HA 3JUOA 1QVF2 2GSPA 1JNQA 2INXA 3FCSB 1MWUA 3OW22 1GMPA 1N8QA 1YGEA 3OWYA 3GAXA 3RGAA 3ECFA 3CNXA 3NBRA 3UL5A 4FCZA 1EQKA 3PGBA 5DRVA 1IV7A 1FGTA 3AMOB 1EEJA 1FGQA 2HMLB 1Q40B 1WTHA 1B2MA 3EC9A 3FG4A 3HZPA 1QAFA 1N5HA 1YI23 1TP6A 5BVBA 4GHOA 4MMYB 3CME3 3LTDA 3SVAA 3NQYA 1EKMA 1LNIA 4K90B 1K734 3VSYA 5KP4A 4L8PA 1BNJA 1IK3A 3LXUX 3F7XA 3I563 5HOHA 1DE3A 4KVHA 1TUHA 1ULIB 2BHMA 2F56A 2W03A 5IENA 1IYYA 2GXFA 3GSPA 1GY7A 1NB3I 1D6YA 1OCVA 1RGEA 4G1MB 3MHEA 1TRPA 3FLJA 2IY2A 3Q90A 4CJNA 4FMAA 1TRQA 3DMCA 5KP3A 2WO0A 2Y73A 1GSPA 3A76A 1W02A 2IA7A 3BNCA 1BUQA 3DGYA 2ZHXB 1JBRA 5AEUB 1OGZA 2CW9A 4KFFA 4MMXB 1UCKA 1Y4KA 3V99A 1BNSA 4AKYA 3CCV3 1V57A 4RNTA 1BU4A 3D79A 3K0ZA 4RNYA 7STDA 2RSXA 1Q864 1I0VA 3B8LA 2IMJA 1BUJA 2R4IA 2Y74A 1S723 1WMNA 4RBNA 4HOHA 4AEQA 2KXGA 4ZM8A 1RTUA 3IMAB 4HM5B 1LOVA 5AIFA 4FCMA 1BSBA 1VQK3 4WP5A 1IU7A 1GD3A 3CC23 1BVIA 3M8CA 3F8XA 4HKVB 1R4YA 3BLZA 4XB5A 5EQLA 4K1UA 3UL6A 3OX9A 1W2B2 3CCS3 5G1LA 1KQS2 4ORLA 1FZUA 2CH9A 1MWRA 4XDVA 2CIUA 2BMRB 3K9MC 5FW5A 5M19A 5BXQA 3DGMA 2KF3A 4EV2A 1NDOB 4OK0A 3NV0B 2IYJA 1RNTA 1SPUA 2F4YA 2KF6A 4BIRA 7RNTA 4XDWA 3JUPA 1PY3A 3OV4A 5JPPA 3CCM3 3CCQ3 1W6YA 2CFKA 5IG0A 1OHSA 1LOXA 3UJMA 2F5MA 1CYUA 1IQ8A 3D9RA 5AIGA 5GSPA 3WODG 2O3OA 2GEXA 3ALAA 2XFSA 4HZBB 3CCJ3 1JBSA 3DGLA 1FGRA 5IG3A 2C11A 2WGQA 3MSOA 1E3VA 2D42A 2OOVC 1T2IA 1JN5A 3MG3A 3BIRA 2K0MA 1YIJ3 1RN4A 1I3IA 4HAAA 1I3FA 3STDA 1BRIA 1VZZA 1RDSA 3GZYB 2OQEC 3D3LA 2HOHA 2WOHA 2P0MA 3I553 1FUTA 1CYVA 3FZWA 3MYTA 2YFJB 2I9WA 3OWUA 5IW9A 4WFOA 3S67A 4FCJA 4NREA 1SQWA 3SLUA 3AMOA 2KF5A 1GMQA 4PEJA 4QWTA 1B2ZA 1VQN3 1M904 3B7CA 1RGHA 3V92A 4BTYA 1VQ83 1E3RA 3S27A 3BNEA 2LYXA 1DMNA 1AV4A 4EC6A 1JZOA 1SIIA 3K63A 3Q2PA 4N6V0 4R9KA 5JPUA 1FA3A 1CH0A 1T3BA 1TTOA 2CG0A 3CC73 5M1AA 3OWSA 2OOVA 1LRAA 1VQQA 3DXOA 1Q824 1VQ73 4RNZA 1ROVA 4GB5A 2P0XA 1ZGXA 5D83A 1RHLA 1OACA 4EYCA 2XGNA 4EBGA 1M1XB 5G1KA 4CDLA 3X42A 3NM2A 3HK4A 2OTJ3 1BSEA 4XM4A 4H61A 2QA43 1IQYA 4J5GA 8RNTA 3NXJA 2W56B 6RNTA 1HU9A 2RFRA 1IVVA 1FGMA 1VQO3 2K3DA 2ZA4A 4HM8B 1N5PA 1BNEA 1QVG2 3GZXB 1HZ1A 2E2UA 1US1A 1JBTA 1BRGA 1LOYA 2E2VA 1RLSA 4HM2B 2CG1A 3FSDA 1RCLA 3ER7A 1SIHA 1G0TA 4Q53A 3MG2A 5D81A 2C4BA 1SARA 1I8VA 1IQXA 1YNVX 3WA3A 3CCU3 2IUJA 1BNGA 2ML5A 1AY7A 3KE7A 4I5QA 3WOEB 2FXTA 5IF6A 1B27A 3S28A 5KP1A 3GZBA 3T0UA 2O9UX 3U97A 3DUKA 3G8ZA 1RGGA 3KIIA 3F8HA 3NX0A 3EJVA 1BRJA 1O7PB 3HIIA 1M9GA 4GL6A 4WYKB 1IVUA 1EUIC 5EVHA 5AYSC 3E99A 3KZTA 1W6CA 2CFLA 1Q7HA 3LH4A 3RNTA 1SJWA 3KFQC 3QRDA 5CLKA 1GYBA 1OGXA 4HM7B 3J7Yd 3ZG0A 4XBTA 2WOFA 1N9JA 5CF2A 4O02B 2R41A 1RCKA 1YJ93 1JB5A 3LTCA 3NV0A 1D6ZA 3K7CA 4RZMA 1LQMB 1JRQA 1NO3A 5IERA 1FYSA 1TIJA 4HJLB 2XEPA 3LOYA 4N6MA 1VQM3 3CD63 2W9QA 2IUKA 3PCSA 2HMMB 3WA2X 1YJW3 1DVCA 3CPOA 3SXXA 5I97A 1OPYA 1DYUA 1IVWA 2YX9A 3BU4A 3PXMA 1K9M4 1RNBA 1UDII 1LQGC 4EXRA 3G16A 3F9SA 2CWTA 2KRTA 3X3XA 1O7WB 3CCR3 2BNGA 3FGYA 1QJGA 4JF8A 4L8OA 3MKIA 3ZG5A 2JQ5A 1TU5A 2KAAA 3F40A 2GU1A 2E2TA 3NBBA 1R4CA 1GY6A 2QGUA 3NUVA 1IT7A 3X40A 4EV5A 3TDGA 3EN1B 1KSIA 1K28A 2XF3A 2AADA 1BRSA 4MEIA 1OHOA 3VF1A 8CHOA 1CQSA 5CK6A 1ZX2A 1Q9EA 2K54A 1BRHA 3I0YA 1W00A 1UI7A 1Q42A 3SX1A 3SOYA 1X1UA 2UX0A 1W01A 1W7CA 1TFKA 3EN8A 2CX1A 4L7KA 3RGRA 2F5WA 1STFI 9RNTA 4R1KA 3AGOA 3FKAA 1BIRA 5AIIA 2MF7A 1UGHI 1W5ZA 4LSOA 3V98A 5IG4A 1V74A 3UNLA 1UW1A 3G6E3 1MGWA 3LZAA 4HM4B 1BANA 5BIRA 3EX9A 1YHQ3 2HMKB 1UCLA 1V58A 1VQ63 1JZDA 1MWTA 1GOYA 3G4S3 1VQ93 3NHXA 3X41A 1IT8A 3A5EA 3FG1A 1WQLB 2Z6BA 1BSDA 1Z1SA 4LMIA 1GOVA 1J2BA 1JB4A 4XBXA 4OUQA 1JB2A 3EF8A 2F86B 1I70A 4K1VA 1UCIA 2XFTA 1BNFA 1RMSA 3H3HA 5M18A 3L0RA 1A2VA 3AHWA 3BB9A 5AI1A 1RKYA 1W6GA 3FF2A 1RN7A 1A2PA 4ILFA 2CFDA 1FW7A 3U1WA 1OUNA 1AVKA 1EA2A 4FMBA 2BO9B 3CPW2 2CK3H 2RGQA 4HM1B 1RN1A 2W56A 3JUQA 2M7OA 1KWIA 3MPHA 2Z76A 1KD14 5AIHA 2SARA 1IV9A 2XGLA 2QEX3 1ASKA 5LC6A 5BU4A 1U5OA 3PCRA 4R9LA 2UUGC 1HYFA 1RRLA 4N6UA 1K8A4 4WHAA 2L4VA 1RGLA 3JUNA 3O8YA 5ELJA 2JDIH 1RRHA 1LXEA 4CPKA 3WHOA 3G0KA 1N9EA 2H0IA 3AHSA 1E97A 3CCE3 1B2XA 1YJN3 1I2EA 1LOWA 4KFEA 1RJOA 4LEHA 2GBXB 2B24B 1BSCA 5CF1A 1S5AA 1JV2B 3CC43 3Q1CA 4N6NB 1JKGB 5AYRB 3IJEB 5LC7A 1KC84 4WYKA 2HMNB 4MJDA 1WMOA 1I2GA 3GRDA 3KSPA 2OCTA 3FG3A 2W6JH 2GEYA 2AAEA 5G2GA 5TGNA 3URPA 4BTWA 3EBTA 1OHPA 1DMMA 1X1XA 1NU3A 4HM3B 4BU4A 3WR2A 4CCVA 1QMAA 2YFIB 3EE1A 1DVDA 1ULJB 1FGOA 2V1LA 3HX8A 3EBYA 5EEOA 3PZWA 3S29A 4O8SA 1NJI4 3DH2A 1O7MB 4LYLB 1N8R4 4MMZB 5FGOA 2C10A 2KF4A 2XRXB 1K41A 1YGWA 2B1XB 3H51A 4R80A 3PS8A 1PFPA 1JJ22 3KN4A 3N54B 3RDEA 3NM7A 3VGNA 3HOHA 2XR8B 6GSPA 4JRFA 4HBRA 1D6UA 2XSOB 4KZ1A 2PNCA 5HGRA 1TJDA 2ZL8A 3JVCA 2FGTA 3F14A 2BU4A 1C7HA 3DM8A 2BMOB 2GBWB 5CXOA 4BL3A 1VQ43 4FMDA 1X1YA 1BGSA 4K61A 1VQP3 1YVSA 1IVXA 3WMDA 3DY5A 3D5GA 1RGAA 4WWUC 2CWUA 5A0OB 1O7HB 3F7SA 3LYGA 3D4AA 1ZS7A 3FF0A 4GSPA 1G02A 3CNMA
chains in the Genus database with same CATH topology
2WGOA 4X2OA 3T8UA 4AKZA 5JBSA 2KCDA 5IEPA 2ZDJA 1QALA 1O7NB 4R4KA 4HYZA 3B4OA 4H3UA 4HZ9B 3X3ZA 4LZIA 2BT3A 2F99A 3OXAA 3PYJA 2A15A 2Z7AA 2D1WA 3EQQB 4HM0B 3WDGB 3IPTA 1CEWI 2LQVA 3CU3A 1W4NA 3LTAA 1FUWA 1NWWA 1DMQA 2PZVA 3B4PA 3GZRA 1WMPA 3DGOA 3NBJA 5IG5A 2CWVA 2P09A 1ISKA 4U13A 3NQZA 2QIYA 4FR9A 1Q7Y4 1UUWB 3JUMA 1OF5A 3DZLA 2HMOB 1G96A 4X2HA 4N6TA 2Q07A 4O3VA 3SOAA 1YIT3 3BNBA 2BMQB 4J9AA 3DGNA 3CCL3 1OH0A 5ELUA 2SBLA 2CC3A 2W0QA 3LT9A 4TX4A 4HVNA 5STDA 3LT8A 2OTL3 1GS3A 4STDA 2F98A 1JKGA 1GD4A 3EB8A 4IPBA 3GWRA 2YFLB 4NHFA 4N6LA 2MC8A 1QAKA 4N3VA 1A67A 4O2HA 1VQ53 4IT7A 3BNDA 1STDA 2STDA 1LVNA 2CFGA 3CMA3 1Q814 3UB1A 1M1K4 2XSHB 3G713 1YVBI 4BTXA 4KFDA 3N8BA 2W2CA 2CKFB 2W04A 1ROAA 1T5YA 1ZO2A 3LMLA 4I4KA 5D82A 5AEWB 1OF5B 1A90A 1F8NA 3HI7A 2OWPA 3HIGA 1L5GB 4IIAA 1WNHA 3WOFB 1U8CB 3K5TA 1VQL3 4N6OB 1O7GB 3X3YA 3QK9A 2P38A 1MNLA 4XBYA 1MOLA 3KKGA 4LGQA 5IEOA 3T8NA 1Q40A 2Z77A 3N9HA 1GY5A 2RCDA 1AVLA 3ROBA 4J8TA 2P05A 2CHCA 5DREA 2FNQA 3LTBA 3EHCA 2ML6A 4HM6B 6STDA 4OVMA 1AR0A 3FH1A 3CXC2 1EG9B 3SEDA 3S5CA 1UI8A 2W9PA 3KSED 1IDPA 2XH9A 1TFOA 2HMJB 1JN5B 1UUVB 2GU3A 1LNHA 2CFWA 1A2KA 1W2ZA 2OQEA 1NB5I 3MWZA 4FMCA 1HKXA 3MG1A 3JUOA 1QVF2 1JNQA 2INXA 3FCSB 3OW22 1N8QA 1YGEA 3OWYA 3GAXA 3RGAA 3ECFA 3CNXA 3NBRA 3UL5A 4FCZA 1EQKA 3PGBA 5DRVA 1IV7A 1FGTA 3AMOB 1FGQA 2HMLB 1Q40B 1WTHA 3EC9A 3FG4A 3HZPA 1QAFA 1N5HA 1YI23 1TP6A 5BVBA 4MMYB 3CME3 3LTDA 3SVAA 3NQYA 1EKMA 4K90B 1K734 3VSYA 5KP4A 4L8PA 1IK3A 3LXUX 3F7XA 3I563 4KVHA 1TUHA 1ULIB 2BHMA 2W03A 5IENA 2GXFA 1PU4A 1GY7A 1NB3I 1D6YA 1OCVA 4G1MB 3MHEA 3FLJA 3Q90A 4FMAA 3DMCA 5KP3A 2WO0A 2Y73A 3A76A 1W02A 2IA7A 3BNCA 1BUQA 5AEUB 1OGZA 2CW9A 4KFFA 4MMXB 1Y4KA 3V99A 4AKYA 3CCV3 7STDA 3K0ZA 4RNYA 2RSXA 1Q864 3B8LA 2IMJA 2R4IA 2Y74A 1S723 1WMNA 4RBNA 4AEQA 4ZM8A 2KXGA 3IMAB 4HM5B 5AIFA 4FCMA 1VQK3 4WP5A 1IU7A 1GD3A 3CC23 3M8CA 3F8XA 4HKVB 4XB5A 3BLZA 5EQLA 4K1UA 3UL6A 3OX9A 1W2B2 3CCS3 1KQS2 4ORLA 2CH9A 4XDVA 2CIUA 2BMRB 3K9MC 5FW5A 5BXQA 3DGMA 4EV2A 1NDOB 4OK0A 3NV0B 1SPUA 4XDWA 3JUPA 3CCQ3 3OV4A 5JPPA 3CCM3 1W6YA 2CFKA 5IG0A 1OHSA 1LOXA 3UJMA 1CYUA 1IQ8A 3D9RA 5AIGA 3WODG 2O3OA 2GEXA 3ALAA 2XFSA 4HZBB 3CCJ3 3DGLA 1FGRA 5IG3A 2C11A 2WGQA 3MSOA 1E3VA 2D42A 2OOVC 1JN5A 3MG3A 2K0MA 1YIJ3 3STDA 3GZYB 1VZZA 2OQEC 3D3LA 2WOHA 2P0MA 3I553 1CYVA 3FZWA 3MYTA 2YFJB 2I9WA 3OWUA 5IW9A 4WFOA 3S67A 4FCJA 4NREA 1SQWA 3SLUA 3AMOA 4PEJA 1VQN3 4QWTA 1M904 3B7CA 3V92A 4BTYA 1VQ83 1E3RA 3S27A 3BNEA 2LYXA 1DMNA 1AV4A 4EC6A 3K63A 1SIIA 3Q2PA 4N6V0 4R9KA 5JPUA 1FA3A 2CG0A 3CC73 3OWSA 2OOVA 3DXOA 1Q824 1VQ73 4RNZA 1ROVA 4GB5A 2P0XA 5D83A 1OACA 4EYCA 2XGNA 4EBGA 1M1XB 4CDLA 3X42A 3NM2A 3HK4A 2OTJ3 4XM4A 4H61A 2QA43 1IQYA 3NXJA 2W56B 1HU9A 2RFRA 1IVVA 1FGMA 1VQO3 4HM8B 1N5PA 1QVG2 3GZXB 2E2UA 1US1A 2E2VA 4HM2B 2CG1A 3FSDA 3ER7A 4Q53A 1SIHA 5D81A 3CCU3 3MG2A 1IQXA 3WA3A 2IUJA 2ML5A 3KE7A 3WOEB 5KP1A 2FXTA 5IF6A 3S28A 3GZBA 3T0UA 2O9UX 3U97A 3DUKA 3G8ZA 3KIIA 3F8HA 3NX0A 3EJVA 1O7PB 3HIIA 1M9GA 4GL6A 4WYKB 1IVUA 5EVHA 5AYSC 3KZTA 1W6CA 2CFLA 3LH4A 1SJWA 3KFQC 3QRDA 5CLKA 1GYBA 1OGXA 4HM7B 3J7Yd 4XBTA 2WOFA 1N9JA 5CF2A 4O02B 1YJ93 1JB5A 3LTCA 3NV0A 1D6ZA 3K7CA 4RZMA 1NO3A 1JRQA 1VQM3 5IERA 1TIJA 4HJLB 2XEPA 3LOYA 4N6MA 3CD63 2W9QA 2IUKA 3PCSA 2HMMB 3WA2X 1YJW3 1DVCA 3CPOA 3SXXA 5I97A 1OPYA 1DYUA 1IVWA 2YX9A 3PXMA 1K9M4 4EXRA 3G16A 3F9SA 2CWTA 2KRTA 3X3XA 1O7WB 3CCR3 2BNGA 3FGYA 1QJGA 4JF8A 4L8OA 3MKIA 2JQ5A 1TU5A 3F40A 2GU1A 2E2TA 3NBBA 1R4CA 1GY6A 2QGUA 3NUVA 1IT7A 3X40A 4EV5A 3TDGA 3EN1B 1KSIA 2XF3A 1K28A 4MEIA 3VF1A 8CHOA 1OHOA 1CQSA 5CK6A 1ZX2A 2K54A 3I0YA 1W00A 1UI7A 1Q42A 3SX1A 3SOYA 2UX0A 1W01A 1W7CA 1TFKA 3EN8A 4L7KA 3RGRA 1STFI 4R1KA 3FKAA 5AIIA 2MF7A 4LSOA 1W5ZA 3V98A 5IG4A 1V74A 3UNLA 1UW1A 3G6E3 3LZAA 4HM4B 3EX9A 1YHQ3 2HMKB 1VQ63 3G4S3 1VQ93 3NHXA 3X41A 1IT8A 3FG1A 1WQLB 2Z6BA 1Z1SA 4LMIA 1J2BA 1JB4A 4XBXA 4OUQA 1JB2A 3EF8A 2F86B 4K1VA 2XFTA 3H3HA 3L0RA 1A2VA 3BB9A 1RKYA 5AI1A 1W6GA 3FF2A 1RN7A 2CFDA 3U1WA 1OUNA 1AVKA 1EA2A 4FMBA 2BO9B 3CPW2 2CK3H 2RGQA 4HM1B 3JUQA 2W56A 2M7OA 1KWIA 3MPHA 2Z76A 1KD14 5AIHA 2XGLA 1IV9A 2QEX3 1ASKA 5LC6A 1U5OA 3PCRA 4R9LA 1RRLA 4N6UA 1K8A4 4WHAA 2L4VA 3JUNA 5ELJA 3O8YA 2JDIH 1RRHA 1LXEA 3G0KA 1N9EA 1E97A 3CCE3 1YJN3 4KFEA 4LEHA 1RJOA 2GBXB 2B24B 5CF1A 1S5AA 1JV2B 3CC43 3Q1CA 4N6NB 1JKGB 5AYRB 3IJEB 5LC7A 1KC84 4WYKA 2HMNB 4MJDA 1WMOA 3GRDA 3KSPA 2OCTA 3FG3A 2W6JH 2GEYA 5TGNA 5G2GA 4BTWA 3EBTA 1OHPA 1DMMA 1NU3A 4HM3B 4CCVA 1QMAA 2YFIB 3EE1A 1DVDA 1ULJB 1FGOA 2V1LA 3HX8A 3EBYA 5EEOA 3PZWA 3S29A 4O8SA 1NJI4 1O7MB 1N8R4 4MMZB 5FGOA 2C10A 2XRXB 1K41A 2B1XB 3H51A 4R80A 3PS8A 1PFPA 1JJ22 3KN4A 3N54B 3RDEA 3NM7A 3VGNA 2XR8B 4JRFA 4HBRA 1D6UA 2XSOB 4KZ1A 2PNCA 5HGRA 2ZL8A 3JVCA 2FGTA 3F14A 1C7HA 3DM8A 2BMOB 2GBWB 5CXOA 1VQ43 4FMDA 4K61A 1VQP3 1IVXA 3WMDA 3DY5A 4WWUC 2CWUA 5A0OB 1O7HB 3F7SA 3LYGA 3FF0A 3E99A 3CNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2O A;  3T8U A;  5IEP A;  1O7N B;  3B4O A;  4H3U A;  4HZ9 B;  2F99 A;  3OXA A;  2A15 A;  2Z7A A;  3EQQ B;  4HM0 B;  3IPT A;  3CU3 A;  1NWW A;  1DMQ A;  2PZV A;  3B4P A;  3GZR A;  5IG5 A;  1ISK A;  4U13 A;  2QIY A;  1UUW B;  3JUM A;  1OF5 A;  3DZL A;  2HMO B;  4X2H A;  3SOA A;  2BMQ B;  4J9A A;  1OH0 A;  4HVN A;  5STD A;  1GS3 A;  4STD A;  2F98 A;  1JKG A;  3GWR A;  2YFL B;  4N3V A;  1STD A;  2STD A;  2XSH B;  2W2C A;  2CKF B;  1ZO2 A;  5D82 A;  4I4K A;  5AEW B;  1OF5 B;  2OWP A;  4IIA A;  1O7G B;  4XBY A;  3KKG A;  4LGQ A;  5IEO A;  3T8N A;  1Q40 A;  2Z77 A;  1GY5 A;  2RCD A;  3ROB A;  4J8T A;  2CHC A;  5DRE A;  3EHC A;  4HM6 B;  6STD A;  4OVM A;  1AR0 A;  3FH1 A;  1EG9 B;  3SED A;  3S5C A;  1IDP A;  2HMJ B;  1JN5 B;  1UUV B;  1A2K A;  1HKX A;  3MG1 A;  3JUO A;  2INX A;  3OWY A;  3RGA A;  3ECF A;  3CNX A;  3NBR A;  5DRV A;  2HML B;  1Q40 B;  3EC9 A;  3HZP A;  1TP6 A;  5BVB A;  3VSY A;  5KP4 A;  4L8P A;  3F7X A;  4KVH A;  1TUH A;  1ULI B;  5IEN A;  2GXF A;  1OCV A;  1GY7 A;  3MHE A;  3FLJ A;  3Q90 A;  3DMC A;  5KP3 A;  3A76 A;  1W02 A;  1BUQ A;  5AEU B;  1OGZ A;  7STD A;  3K0Z A;  3B8L A;  2IMJ A;  2R4I A;  4HM5 B;  5AIF A;  4FCM A;  4WP5 A;  3M8C A;  3F8X A;  4HKV B;  4XB5 A;  3BLZ A;  4K1U A;  3OX9 A;  4ORL A;  4XDV A;  2BMR B;  5FW5 A;  5BXQ A;  1NDO B;  3NV0 B;  4XDW A;  3JUP A;  3OV4 A;  5JPP A;  1W6Y A;  5IG0 A;  1OHS A;  3UJM A;  3D9R A;  5AIG A;  2GEX A;  4HZB B;  5IG3 A;  3MSO A;  1E3V A;  1JN5 A;  3MG3 A;  3STD A;  3GZY B;  1VZZ A;  3FZW A;  3MYT A;  2YFJ B;  2I9W A;  3OWU A;  4FCJ A;  4PEJ A;  3B7C A;  1E3R A;  1DMN A;  5JPU A;  4R9K A;  3OWS A;  3DXO A;  4GB5 A;  5D83 A;  4CDL A;  3NM2 A;  3HK4 A;  4XM4 A;  3NXJ A;  2RFR A;  4HM8 B;  3GZX B;  4HM2 B;  3FSD A;  3ER7 A;  4Q53 A;  5D81 A;  3MG2 A;  3KE7 A;  5KP1 A;  5IF6 A;  3GZB A;  3DUK A;  3G8Z A;  3F8H A;  3EJV A;  1O7P B;  4WYK B;  5EVH A;  3KZT A;  1SJW A;  5CLK A;  1GYB A;  1OGX A;  4HM7 B;  4XBT A;  5CF2 A;  1JB5 A;  3NV0 A;  3K7C A;  4RZM A;  5IER A;  4HJL B;  2HMM B;  3CPO A;  1OPY A;  3G16 A;  3F9S A;  1O7W B;  2BNG A;  3FGY A;  1QJG A;  4L8O A;  3MKI A;  2JQ5 A;  3F40 A;  1GY6 A;  2QGU A;  3NUV A;  3EN1 B;  8CHO A;  1OHO A;  1CQS A;  5CK6 A;  1ZX2 A;  2K54 A;  3I0Y A;  1W00 A;  1Q42 A;  3SOY A;  2UX0 A;  1W01 A;  3EN8 A;  4L7K A;  3RGR A;  4R1K A;  3FKA A;  5AII A;  5IG4 A;  3UNL A;  3LZA A;  4HM4 B;  3EX9 A;  2HMK B;  3NHX A;  1WQL B;  1Z1S A;  4LMI A;  1JB4 A;  4XBX A;  4OUQ A;  1JB2 A;  3EF8 A;  2F86 B;  4K1V A;  3H3H A;  3BB9 A;  5AI1 A;  3FF2 A;  1OUN A;  1EA2 A;  2RGQ A;  4HM1 B;  3JUQ A;  2Z76 A;  5AIH A;  1ASK A;  1U5O A;  4R9L A;  3JUN A;  3G0K A;  1E97 A;  4LEH A;  2GBX B;  2B24 B;  5CF1 A;  1S5A A;  1JKG B;  4WYK A;  2HMN B;  4MJD A;  3GRD A;  3KSP A;  2GEY A;  5TGN A;  5G2G A;  3EBT A;  1OHP A;  1DMM A;  1NU3 A;  4HM3 B;  1QMA A;  2YFI B;  1ULJ B;  3HX8 A;  3EBY A;  1O7M B;  2XRX B;  1K41 A;  2B1X B;  3H51 A;  3VGN A;  2XR8 B;  2XSO B;  5HGR A;  3F14 A;  1C7H A;  3DM8 A;  2BMO B;  2GBW B;  5CXO A;  3WMD A;  4WWU C;  1O7H B;  3F7S A;  3LYG A;  3FF0 A;  3E99 A;  3CNM A; 
#chains in the Genus database with same CATH topology
 1I0X A;  2WGO A;  4X2O A;  3T8U A;  1BNR A;  4AKZ A;  5JBS A;  2KCD A;  5IEP A;  2ZDJ A;  3SYU A;  1QAL A;  4KT3 B;  1O7N B;  4R4K A;  4HYZ A;  4NPB A;  3B4O A;  4H3U A;  4HZ9 B;  3X3Z A;  4LZI A;  2BT3 A;  2J8X B;  2F99 A;  3OXA A;  3PYJ A;  1B2U A;  2A15 A;  2Z7A A;  2D1W A;  3EQQ B;  4HM0 B;  1UCJ A;  3IPT A;  3WDG B;  1CEW I;  2LQV A;  3CU3 A;  5RNT A;  1W4N A;  3LTA A;  1FUW A;  1NNV A;  1NWW A;  1DMQ A;  2PZV A;  1B21 A;  3B4P A;  3GZR A;  2CX0 A;  7GSP A;  1WMP A;  3DGO A;  3NBJ A;  5IG5 A;  2CWV A;  2P09 A;  4BL2 A;  1ISK A;  2UGI A;  4U13 A;  3NQZ A;  2QIY A;  1BOX A;  4FR9 A;  1Q7Y 4;  1BRN L;  1UUW B;  1UUG B;  3KCH A;  1BNI A;  3JUM A;  1B2S A;  1OF5 A;  3DZL A;  2BIR A;  2L1S A;  2HMO B;  1G96 A;  4X2H A;  4N6T A;  2Q07 A;  1PYL A;  4O3V A;  3SOA A;  2H0G A;  1YIT 3;  3BNB A;  2BMQ B;  4J9A A;  3DGN A;  1X1W A;  1OH0 A;  3CCL 3;  5ELU A;  2SBL A;  2CC3 A;  2W0Q A;  3LT9 A;  3Q3F A;  4TX4 A;  4HVN A;  5STD A;  3LT8 A;  2OTL 3;  1GS3 A;  1FUS A;  4STD A;  2F98 A;  1JKG A;  1GD4 A;  3EB8 A;  4IPB A;  3GWR A;  2YFL B;  4NHF A;  4N6L A;  2MC8 A;  3AGN A;  1QAK A;  4N3V A;  1RGF A;  4O2H A;  1VQ5 3;  1A67 A;  4IT7 A;  3BND A;  1STD A;  2STD A;  1LVN A;  2CFG A;  3CMA 3;  1Q81 4;  3UB1 A;  1AQZ A;  1M1K 4;  1B3S A;  1MWS A;  2XSH B;  3G71 3;  1YVB I;  4BTX A;  4KFD A;  3N8B A;  4EW5 A;  2W2C A;  1BSA A;  2CKF B;  2W04 A;  1ROA A;  1T5Y A;  1ZO2 A;  3LML A;  4I4K A;  5D82 A;  5AEW B;  1OF5 B;  1A90 A;  1F8N A;  1RGK A;  3HI7 A;  2OWP A;  1RGC A;  3HIG A;  1L5G B;  4IIA A;  1C54 A;  1WNH A;  1GOU A;  1T2H A;  3WOF B;  1MGR A;  4J5K A;  1U8C B;  1RSN A;  3K5T A;  1VQL 3;  4N6O B;  1O7G B;  3ZFZ A;  3X3Y A;  3QK9 A;  1B20 A;  2P38 A;  2RNT A;  1MNL A;  2RBI A;  4XBY A;  1MOL A;  3KKG A;  4LGQ A;  5IEO A;  3T8N A;  1Q40 A;  2Z77 A;  3N9H A;  1BRK A;  1GY5 A;  2RCD A;  1AVL A;  3ROB A;  4J8T A;  2P05 A;  2CHC A;  5DRE A;  2FNQ A;  3LTB A;  3EHC A;  2ML6 A;  4HM6 B;  4DKI A;  6STD A;  1PU4 A;  4OVM A;  1AR0 A;  3FH1 A;  3CXC 2;  1EG9 B;  3SED A;  3S5C A;  1UI8 A;  2W9P A;  1DET A;  3KSE D;  1IDP A;  1I2F A;  2XH9 A;  1TFO A;  1GMR A;  1UUV B;  1JN5 B;  1UGI A;  2GU3 A;  2HMJ B;  1LNH A;  2CFW A;  1A2K A;  1W2Z A;  2OQE A;  1NB5 I;  3D5I A;  3MWZ A;  1BAO A;  4FMC A;  1HKX A;  3MG1 A;  2H0H A;  3JUO A;  1QVF 2;  2GSP A;  1JNQ A;  2INX A;  3FCS B;  1MWU A;  3OW2 2;  1GMP A;  1N8Q A;  1YGE A;  3OWY A;  3GAX A;  3RGA A;  3ECF A;  3CNX A;  3NBR A;  3UL5 A;  4FCZ A;  1EQK A;  3PGB A;  5DRV A;  1IV7 A;  1FGT A;  3AMO B;  1EEJ A;  1FGQ A;  2HML B;  1Q40 B;  1WTH A;  1B2M A;  3EC9 A;  3FG4 A;  3HZP A;  1QAF A;  1N5H A;  1YI2 3;  1TP6 A;  5BVB A;  4GHO A;  4MMY B;  3CME 3;  3LTD A;  3SVA A;  3NQY A;  1EKM A;  1LNI A;  4K90 B;  1K73 4;  3VSY A;  5KP4 A;  4L8P A;  1BNJ A;  1IK3 A;  3LXU X;  3F7X A;  3I56 3;  5HOH A;  1DE3 A;  4KVH A;  1TUH A;  1ULI B;  2BHM A;  2F56 A;  2W03 A;  5IEN A;  1IYY A;  2GXF A;  3GSP A;  1GY7 A;  1NB3 I;  1D6Y A;  1OCV A;  1RGE A;  4G1M B;  3MHE A;  1TRP A;  3FLJ A;  2IY2 A;  3Q90 A;  4CJN A;  4FMA A;  1TRQ A;  3DMC A;  5KP3 A;  2WO0 A;  2Y73 A;  1GSP A;  3A76 A;  1W02 A;  2IA7 A;  3BNC A;  1BUQ A;  3DGY A;  2ZHX B;  1JBR A;  5AEU B;  1OGZ A;  2CW9 A;  4KFF A;  4MMX B;  1UCK A;  1Y4K A;  3V99 A;  1BNS A;  4AKY A;  3CCV 3;  1V57 A;  4RNT A;  1BU4 A;  3D79 A;  3K0Z A;  4RNY A;  7STD A;  2RSX A;  1Q86 4;  1I0V A;  3B8L A;  2IMJ A;  1BUJ A;  2R4I A;  2Y74 A;  1S72 3;  1WMN A;  4RBN A;  4HOH A;  4AEQ A;  2KXG A;  4ZM8 A;  1RTU A;  3IMA B;  4HM5 B;  1LOV A;  5AIF A;  4FCM A;  1BSB A;  1VQK 3;  4WP5 A;  1IU7 A;  1GD3 A;  3CC2 3;  1BVI A;  3M8C A;  3F8X A;  4HKV B;  1R4Y A;  3BLZ A;  4XB5 A;  5EQL A;  4K1U A;  3UL6 A;  3OX9 A;  1W2B 2;  3CCS 3;  5G1L A;  1KQS 2;  4ORL A;  1FZU A;  2CH9 A;  1MWR A;  4XDV A;  2CIU A;  2BMR B;  3K9M C;  5FW5 A;  5M19 A;  5BXQ A;  3DGM A;  2KF3 A;  4EV2 A;  1NDO B;  4OK0 A;  3NV0 B;  2IYJ A;  1RNT A;  1SPU A;  2F4Y A;  2KF6 A;  4BIR A;  7RNT A;  4XDW A;  3JUP A;  1PY3 A;  3OV4 A;  5JPP A;  3CCM 3;  3CCQ 3;  1W6Y A;  2CFK A;  5IG0 A;  1OHS A;  1LOX A;  3UJM A;  2F5M A;  1CYU A;  1IQ8 A;  3D9R A;  5AIG A;  5GSP A;  3WOD G;  2O3O A;  2GEX A;  3ALA A;  2XFS A;  4HZB B;  3CCJ 3;  1JBS A;  3DGL A;  1FGR A;  5IG3 A;  2C11 A;  2WGQ A;  3MSO A;  1E3V A;  2D42 A;  2OOV C;  1T2I A;  1JN5 A;  3MG3 A;  3BIR A;  2K0M A;  1YIJ 3;  1RN4 A;  1I3I A;  4HAA A;  1I3F A;  3STD A;  1BRI A;  1VZZ A;  1RDS A;  3GZY B;  2OQE C;  3D3L A;  2HOH A;  2WOH A;  2P0M A;  3I55 3;  1FUT A;  1CYV A;  3FZW A;  3MYT A;  2YFJ B;  2I9W A;  3OWU A;  5IW9 A;  4WFO A;  3S67 A;  4FCJ A;  4NRE A;  1SQW A;  3SLU A;  3AMO A;  2KF5 A;  1GMQ A;  4PEJ A;  4QWT A;  1B2Z A;  1VQN 3;  1M90 4;  3B7C A;  1RGH A;  3V92 A;  4BTY A;  1VQ8 3;  1E3R A;  3S27 A;  3BNE A;  2LYX A;  1DMN A;  1AV4 A;  4EC6 A;  1JZO A;  1SII A;  3K63 A;  3Q2P A;  4N6V 0;  4R9K A;  5JPU A;  1FA3 A;  1CH0 A;  1T3B A;  1TTO A;  2CG0 A;  3CC7 3;  5M1A A;  3OWS A;  2OOV A;  1LRA A;  1VQQ A;  3DXO A;  1Q82 4;  1VQ7 3;  4RNZ A;  1ROV A;  4GB5 A;  2P0X A;  1ZGX A;  5D83 A;  1RHL A;  1OAC A;  4EYC A;  2XGN A;  4EBG A;  1M1X B;  5G1K A;  4CDL A;  3X42 A;  3NM2 A;  3HK4 A;  2OTJ 3;  1BSE A;  4XM4 A;  4H61 A;  2QA4 3;  1IQY A;  4J5G A;  8RNT A;  3NXJ A;  2W56 B;  6RNT A;  1HU9 A;  2RFR A;  1IVV A;  1FGM A;  1VQO 3;  2K3D A;  2ZA4 A;  4HM8 B;  1N5P A;  1BNE A;  1QVG 2;  3GZX B;  1HZ1 A;  2E2U A;  1US1 A;  1JBT A;  1BRG A;  1LOY A;  2E2V A;  1RLS A;  4HM2 B;  2CG1 A;  3FSD A;  1RCL A;  3ER7 A;  1SIH A;  1G0T A;  4Q53 A;  3MG2 A;  5D81 A;  2C4B A;  1SAR A;  1I8V A;  1IQX A;  1YNV X;  3WA3 A;  3CCU 3;  2IUJ A;  1BNG A;  2ML5 A;  1AY7 A;  3KE7 A;  4I5Q A;  3WOE B;  2FXT A;  5IF6 A;  1B27 A;  3S28 A;  5KP1 A;  3GZB A;  3T0U A;  2O9U X;  3U97 A;  3DUK A;  3G8Z A;  1RGG A;  3KII A;  3F8H A;  3NX0 A;  3EJV A;  1BRJ A;  1O7P B;  3HII A;  1M9G A;  4GL6 A;  4WYK B;  1IVU A;  1EUI C;  5EVH A;  5AYS C;  3E99 A;  3KZT A;  1W6C A;  2CFL A;  1Q7H A;  3LH4 A;  3RNT A;  1SJW A;  3KFQ C;  3QRD A;  5CLK A;  1GYB A;  1OGX A;  4HM7 B;  3J7Y d;  3ZG0 A;  4XBT A;  2WOF A;  1N9J A;  5CF2 A;  4O02 B;  2R41 A;  1RCK A;  1YJ9 3;  1JB5 A;  3LTC A;  3NV0 A;  1D6Z A;  3K7C A;  4RZM A;  1LQM B;  1JRQ A;  1NO3 A;  5IER A;  1FYS A;  1TIJ A;  4HJL B;  2XEP A;  3LOY A;  4N6M A;  1VQM 3;  3CD6 3;  2W9Q A;  2IUK A;  3PCS A;  2HMM B;  3WA2 X;  1YJW 3;  1DVC A;  3CPO A;  3SXX A;  5I97 A;  1OPY A;  1DYU A;  1IVW A;  2YX9 A;  3BU4 A;  3PXM A;  1K9M 4;  1RNB A;  1UDI I;  1LQG C;  4EXR A;  3G16 A;  3F9S A;  2CWT A;  2KRT A;  3X3X A;  1O7W B;  3CCR 3;  2BNG A;  3FGY A;  1QJG A;  4JF8 A;  4L8O A;  3MKI A;  3ZG5 A;  2JQ5 A;  1TU5 A;  2KAA A;  3F40 A;  2GU1 A;  2E2T A;  3NBB A;  1R4C A;  1GY6 A;  2QGU A;  3NUV A;  1IT7 A;  3X40 A;  4EV5 A;  3TDG A;  3EN1 B;  1KSI A;  1K28 A;  2XF3 A;  2AAD A;  1BRS A;  4MEI A;  1OHO A;  3VF1 A;  8CHO A;  1CQS A;  5CK6 A;  1ZX2 A;  1Q9E A;  2K54 A;  1BRH A;  3I0Y A;  1W00 A;  1UI7 A;  1Q42 A;  3SX1 A;  3SOY A;  1X1U A;  2UX0 A;  1W01 A;  1W7C A;  1TFK A;  3EN8 A;  2CX1 A;  4L7K A;  3RGR A;  2F5W A;  1STF I;  9RNT A;  4R1K A;  3AGO A;  3FKA A;  1BIR A;  5AII A;  2MF7 A;  1UGH I;  1W5Z A;  4LSO A;  3V98 A;  5IG4 A;  1V74 A;  3UNL A;  1UW1 A;  3G6E 3;  1MGW A;  3LZA A;  4HM4 B;  1BAN A;  5BIR A;  3EX9 A;  1YHQ 3;  2HMK B;  1UCL A;  1V58 A;  1VQ6 3;  1JZD A;  1MWT A;  1GOY A;  3G4S 3;  1VQ9 3;  3NHX A;  3X41 A;  1IT8 A;  3A5E A;  3FG1 A;  1WQL B;  2Z6B A;  1BSD A;  1Z1S A;  4LMI A;  1GOV A;  1J2B A;  1JB4 A;  4XBX A;  4OUQ A;  1JB2 A;  3EF8 A;  2F86 B;  1I70 A;  4K1V A;  1UCI A;  2XFT A;  1BNF A;  1RMS A;  3H3H A;  5M18 A;  3L0R A;  1A2V A;  3AHW A;  3BB9 A;  5AI1 A;  1RKY A;  1W6G A;  3FF2 A;  1RN7 A;  1A2P A;  4ILF A;  2CFD A;  1FW7 A;  3U1W A;  1OUN A;  1AVK A;  1EA2 A;  4FMB A;  2BO9 B;  3CPW 2;  2CK3 H;  2RGQ A;  4HM1 B;  1RN1 A;  2W56 A;  3JUQ A;  2M7O A;  1KWI A;  3MPH A;  2Z76 A;  1KD1 4;  5AIH A;  2SAR A;  1IV9 A;  2XGL A;  2QEX 3;  1ASK A;  5LC6 A;  5BU4 A;  1U5O A;  3PCR A;  4R9L A;  2UUG C;  1HYF A;  1RRL A;  4N6U A;  1K8A 4;  4WHA A;  2L4V A;  1RGL A;  3JUN A;  3O8Y A;  5ELJ A;  2JDI H;  1RRH A;  1LXE A;  4CPK A;  3WHO A;  3G0K A;  1N9E A;  2H0I A;  3AHS A;  1E97 A;  3CCE 3;  1B2X A;  1YJN 3;  1I2E A;  1LOW A;  4KFE A;  1RJO A;  4LEH A;  2GBX B;  2B24 B;  1BSC A;  5CF1 A;  1S5A A;  1JV2 B;  3CC4 3;  3Q1C A;  4N6N B;  1JKG B;  5AYR B;  3IJE B;  5LC7 A;  1KC8 4;  4WYK A;  2HMN B;  4MJD A;  1WMO A;  1I2G A;  3GRD A;  3KSP A;  2OCT A;  3FG3 A;  2W6J H;  2GEY A;  2AAE A;  5G2G A;  5TGN A;  3URP A;  4BTW A;  3EBT A;  1OHP A;  1DMM A;  1X1X A;  1NU3 A;  4HM3 B;  4BU4 A;  3WR2 A;  4CCV A;  1QMA A;  2YFI B;  3EE1 A;  1DVD A;  1ULJ B;  1FGO A;  2V1L A;  3HX8 A;  3EBY A;  5EEO A;  3PZW A;  3S29 A;  4O8S A;  1NJI 4;  3DH2 A;  1O7M B;  4LYL B;  1N8R 4;  4MMZ B;  5FGO A;  2C10 A;  2KF4 A;  2XRX B;  1K41 A;  1YGW A;  2B1X B;  3H51 A;  4R80 A;  3PS8 A;  1PFP A;  1JJ2 2;  3KN4 A;  3N54 B;  3RDE A;  3NM7 A;  3VGN A;  3HOH A;  2XR8 B;  6GSP A;  4JRF A;  4HBR A;  1D6U A;  2XSO B;  4KZ1 A;  2PNC A;  5HGR A;  1TJD A;  2ZL8 A;  3JVC A;  2FGT A;  3F14 A;  2BU4 A;  1C7H A;  3DM8 A;  2BMO B;  2GBW B;  5CXO A;  4BL3 A;  1VQ4 3;  4FMD A;  1X1Y A;  1BGS A;  4K61 A;  1VQP 3;  1YVS A;  1IVX A;  3WMD A;  3DY5 A;  3D5G A;  1RGA A;  4WWU C;  2CWU A;  5A0O B;  1O7H B;  3F7S A;  3LYG A;  3D4A A;  1ZS7 A;  3FF0 A;  4GSP A;  1G02 A;  3CNM A; 
#chains in the Genus database with same CATH homology
 2WGO A;  4X2O A;  3T8U A;  4AKZ A;  5JBS A;  2KCD A;  5IEP A;  2ZDJ A;  1QAL A;  1O7N B;  4R4K A;  4HYZ A;  3B4O A;  4H3U A;  4HZ9 B;  3X3Z A;  4LZI A;  2BT3 A;  2F99 A;  3OXA A;  3PYJ A;  2A15 A;  2Z7A A;  2D1W A;  3EQQ B;  4HM0 B;  3WDG B;  3IPT A;  1CEW I;  2LQV A;  3CU3 A;  1W4N A;  3LTA A;  1FUW A;  1NWW A;  1DMQ A;  2PZV A;  3B4P A;  3GZR A;  1WMP A;  3DGO A;  3NBJ A;  5IG5 A;  2CWV A;  2P09 A;  1ISK A;  4U13 A;  3NQZ A;  2QIY A;  4FR9 A;  1Q7Y 4;  1UUW B;  3JUM A;  1OF5 A;  3DZL A;  2HMO B;  1G96 A;  4X2H A;  4N6T A;  2Q07 A;  4O3V A;  3SOA A;  1YIT 3;  3BNB A;  2BMQ B;  4J9A A;  3DGN A;  3CCL 3;  1OH0 A;  5ELU A;  2SBL A;  2CC3 A;  2W0Q A;  3LT9 A;  4TX4 A;  4HVN A;  5STD A;  3LT8 A;  2OTL 3;  1GS3 A;  4STD A;  2F98 A;  1JKG A;  1GD4 A;  3EB8 A;  4IPB A;  3GWR A;  2YFL B;  4NHF A;  4N6L A;  2MC8 A;  1QAK A;  4N3V A;  1A67 A;  4O2H A;  1VQ5 3;  4IT7 A;  3BND A;  1STD A;  2STD A;  1LVN A;  2CFG A;  3CMA 3;  1Q81 4;  3UB1 A;  1M1K 4;  2XSH B;  3G71 3;  1YVB I;  4BTX A;  4KFD A;  3N8B A;  2W2C A;  2CKF B;  2W04 A;  1ROA A;  1T5Y A;  1ZO2 A;  3LML A;  4I4K A;  5D82 A;  5AEW B;  1OF5 B;  1A90 A;  1F8N A;  3HI7 A;  2OWP A;  3HIG A;  1L5G B;  4IIA A;  1WNH A;  3WOF B;  1U8C B;  3K5T A;  1VQL 3;  4N6O B;  1O7G B;  3X3Y A;  3QK9 A;  2P38 A;  1MNL A;  4XBY A;  1MOL A;  3KKG A;  4LGQ A;  5IEO A;  3T8N A;  1Q40 A;  2Z77 A;  3N9H A;  1GY5 A;  2RCD A;  1AVL A;  3ROB A;  4J8T A;  2P05 A;  2CHC A;  5DRE A;  2FNQ A;  3LTB A;  3EHC A;  2ML6 A;  4HM6 B;  6STD A;  4OVM A;  1AR0 A;  3FH1 A;  3CXC 2;  1EG9 B;  3SED A;  3S5C A;  1UI8 A;  2W9P A;  3KSE D;  1IDP A;  2XH9 A;  1TFO A;  2HMJ B;  1JN5 B;  1UUV B;  2GU3 A;  1LNH A;  2CFW A;  1A2K A;  1W2Z A;  2OQE A;  1NB5 I;  3MWZ A;  4FMC A;  1HKX A;  3MG1 A;  3JUO A;  1QVF 2;  1JNQ A;  2INX A;  3FCS B;  3OW2 2;  1N8Q A;  1YGE A;  3OWY A;  3GAX A;  3RGA A;  3ECF A;  3CNX A;  3NBR A;  3UL5 A;  4FCZ A;  1EQK A;  3PGB A;  5DRV A;  1IV7 A;  1FGT A;  3AMO B;  1FGQ A;  2HML B;  1Q40 B;  1WTH A;  3EC9 A;  3FG4 A;  3HZP A;  1QAF A;  1N5H A;  1YI2 3;  1TP6 A;  5BVB A;  4MMY B;  3CME 3;  3LTD A;  3SVA A;  3NQY A;  1EKM A;  4K90 B;  1K73 4;  3VSY A;  5KP4 A;  4L8P A;  1IK3 A;  3LXU X;  3F7X A;  3I56 3;  4KVH A;  1TUH A;  1ULI B;  2BHM A;  2W03 A;  5IEN A;  2GXF A;  1PU4 A;  1GY7 A;  1NB3 I;  1D6Y A;  1OCV A;  4G1M B;  3MHE A;  3FLJ A;  3Q90 A;  4FMA A;  3DMC A;  5KP3 A;  2WO0 A;  2Y73 A;  3A76 A;  1W02 A;  2IA7 A;  3BNC A;  1BUQ A;  5AEU B;  1OGZ A;  2CW9 A;  4KFF A;  4MMX B;  1Y4K A;  3V99 A;  4AKY A;  3CCV 3;  7STD A;  3K0Z A;  4RNY A;  2RSX A;  1Q86 4;  3B8L A;  2IMJ A;  2R4I A;  2Y74 A;  1S72 3;  1WMN A;  4RBN A;  4AEQ A;  4ZM8 A;  2KXG A;  3IMA B;  4HM5 B;  5AIF A;  4FCM A;  1VQK 3;  4WP5 A;  1IU7 A;  1GD3 A;  3CC2 3;  3M8C A;  3F8X A;  4HKV B;  4XB5 A;  3BLZ A;  5EQL A;  4K1U A;  3UL6 A;  3OX9 A;  1W2B 2;  3CCS 3;  1KQS 2;  4ORL A;  2CH9 A;  4XDV A;  2CIU A;  2BMR B;  3K9M C;  5FW5 A;  5BXQ A;  3DGM A;  4EV2 A;  1NDO B;  4OK0 A;  3NV0 B;  1SPU A;  4XDW A;  3JUP A;  3CCQ 3;  3OV4 A;  5JPP A;  3CCM 3;  1W6Y A;  2CFK A;  5IG0 A;  1OHS A;  1LOX A;  3UJM A;  1CYU A;  1IQ8 A;  3D9R A;  5AIG A;  3WOD G;  2O3O A;  2GEX A;  3ALA A;  2XFS A;  4HZB B;  3CCJ 3;  3DGL A;  1FGR A;  5IG3 A;  2C11 A;  2WGQ A;  3MSO A;  1E3V A;  2D42 A;  2OOV C;  1JN5 A;  3MG3 A;  2K0M A;  1YIJ 3;  3STD A;  3GZY B;  1VZZ A;  2OQE C;  3D3L A;  2WOH A;  2P0M A;  3I55 3;  1CYV A;  3FZW A;  3MYT A;  2YFJ B;  2I9W A;  3OWU A;  5IW9 A;  4WFO A;  3S67 A;  4FCJ A;  4NRE A;  1SQW A;  3SLU A;  3AMO A;  4PEJ A;  1VQN 3;  4QWT A;  1M90 4;  3B7C A;  3V92 A;  4BTY A;  1VQ8 3;  1E3R A;  3S27 A;  3BNE A;  2LYX A;  1DMN A;  1AV4 A;  4EC6 A;  3K63 A;  1SII A;  3Q2P A;  4N6V 0;  4R9K A;  5JPU A;  1FA3 A;  2CG0 A;  3CC7 3;  3OWS A;  2OOV A;  3DXO A;  1Q82 4;  1VQ7 3;  4RNZ A;  1ROV A;  4GB5 A;  2P0X A;  5D83 A;  1OAC A;  4EYC A;  2XGN A;  4EBG A;  1M1X B;  4CDL A;  3X42 A;  3NM2 A;  3HK4 A;  2OTJ 3;  4XM4 A;  4H61 A;  2QA4 3;  1IQY A;  3NXJ A;  2W56 B;  1HU9 A;  2RFR A;  1IVV A;  1FGM A;  1VQO 3;  4HM8 B;  1N5P A;  1QVG 2;  3GZX B;  2E2U A;  1US1 A;  2E2V A;  4HM2 B;  2CG1 A;  3FSD A;  3ER7 A;  4Q53 A;  1SIH A;  5D81 A;  3CCU 3;  3MG2 A;  1IQX A;  3WA3 A;  2IUJ A;  2ML5 A;  3KE7 A;  3WOE B;  5KP1 A;  2FXT A;  5IF6 A;  3S28 A;  3GZB A;  3T0U A;  2O9U X;  3U97 A;  3DUK A;  3G8Z A;  3KII A;  3F8H A;  3NX0 A;  3EJV A;  1O7P B;  3HII A;  1M9G A;  4GL6 A;  4WYK B;  1IVU A;  5EVH A;  5AYS C;  3KZT A;  1W6C A;  2CFL A;  3LH4 A;  1SJW A;  3KFQ C;  3QRD A;  5CLK A;  1GYB A;  1OGX A;  4HM7 B;  3J7Y d;  4XBT A;  2WOF A;  1N9J A;  5CF2 A;  4O02 B;  1YJ9 3;  1JB5 A;  3LTC A;  3NV0 A;  1D6Z A;  3K7C A;  4RZM A;  1NO3 A;  1JRQ A;  1VQM 3;  5IER A;  1TIJ A;  4HJL B;  2XEP A;  3LOY A;  4N6M A;  3CD6 3;  2W9Q A;  2IUK A;  3PCS A;  2HMM B;  3WA2 X;  1YJW 3;  1DVC A;  3CPO A;  3SXX A;  5I97 A;  1OPY A;  1DYU A;  1IVW A;  2YX9 A;  3PXM A;  1K9M 4;  4EXR A;  3G16 A;  3F9S A;  2CWT A;  2KRT A;  3X3X A;  1O7W B;  3CCR 3;  2BNG A;  3FGY A;  1QJG A;  4JF8 A;  4L8O A;  3MKI A;  2JQ5 A;  1TU5 A;  3F40 A;  2GU1 A;  2E2T A;  3NBB A;  1R4C A;  1GY6 A;  2QGU A;  3NUV A;  1IT7 A;  3X40 A;  4EV5 A;  3TDG A;  3EN1 B;  1KSI A;  2XF3 A;  1K28 A;  4MEI A;  3VF1 A;  8CHO A;  1OHO A;  1CQS A;  5CK6 A;  1ZX2 A;  2K54 A;  3I0Y A;  1W00 A;  1UI7 A;  1Q42 A;  3SX1 A;  3SOY A;  2UX0 A;  1W01 A;  1W7C A;  1TFK A;  3EN8 A;  4L7K A;  3RGR A;  1STF I;  4R1K A;  3FKA A;  5AII A;  2MF7 A;  4LSO A;  1W5Z A;  3V98 A;  5IG4 A;  1V74 A;  3UNL A;  1UW1 A;  3G6E 3;  3LZA A;  4HM4 B;  3EX9 A;  1YHQ 3;  2HMK B;  1VQ6 3;  3G4S 3;  1VQ9 3;  3NHX A;  3X41 A;  1IT8 A;  3FG1 A;  1WQL B;  2Z6B A;  1Z1S A;  4LMI A;  1J2B A;  1JB4 A;  4XBX A;  4OUQ A;  1JB2 A;  3EF8 A;  2F86 B;  4K1V A;  2XFT A;  3H3H A;  3L0R A;  1A2V A;  3BB9 A;  1RKY A;  5AI1 A;  1W6G A;  3FF2 A;  1RN7 A;  2CFD A;  3U1W A;  1OUN A;  1AVK A;  1EA2 A;  4FMB A;  2BO9 B;  3CPW 2;  2CK3 H;  2RGQ A;  4HM1 B;  3JUQ A;  2W56 A;  2M7O A;  1KWI A;  3MPH A;  2Z76 A;  1KD1 4;  5AIH A;  2XGL A;  1IV9 A;  2QEX 3;  1ASK A;  5LC6 A;  1U5O A;  3PCR A;  4R9L A;  1RRL A;  4N6U A;  1K8A 4;  4WHA A;  2L4V A;  3JUN A;  5ELJ A;  3O8Y A;  2JDI H;  1RRH A;  1LXE A;  3G0K A;  1N9E A;  1E97 A;  3CCE 3;  1YJN 3;  4KFE A;  4LEH A;  1RJO A;  2GBX B;  2B24 B;  5CF1 A;  1S5A A;  1JV2 B;  3CC4 3;  3Q1C A;  4N6N B;  1JKG B;  5AYR B;  3IJE B;  5LC7 A;  1KC8 4;  4WYK A;  2HMN B;  4MJD A;  1WMO A;  3GRD A;  3KSP A;  2OCT A;  3FG3 A;  2W6J H;  2GEY A;  5TGN A;  5G2G A;  4BTW A;  3EBT A;  1OHP A;  1DMM A;  1NU3 A;  4HM3 B;  4CCV A;  1QMA A;  2YFI B;  3EE1 A;  1DVD A;  1ULJ B;  1FGO A;  2V1L A;  3HX8 A;  3EBY A;  5EEO A;  3PZW A;  3S29 A;  4O8S A;  1NJI 4;  1O7M B;  1N8R 4;  4MMZ B;  5FGO A;  2C10 A;  2XRX B;  1K41 A;  2B1X B;  3H51 A;  4R80 A;  3PS8 A;  1PFP A;  1JJ2 2;  3KN4 A;  3N54 B;  3RDE A;  3NM7 A;  3VGN A;  2XR8 B;  4JRF A;  4HBR A;  1D6U A;  2XSO B;  4KZ1 A;  2PNC A;  5HGR A;  2ZL8 A;  3JVC A;  2FGT A;  3F14 A;  1C7H A;  3DM8 A;  2BMO B;  2GBW B;  5CXO A;  1VQ4 3;  4FMD A;  4K61 A;  1VQP 3;  1IVX A;  3WMD A;  3DY5 A;  4WWU C;  2CWU A;  5A0O B;  1O7H B;  3F7S A;  3LYG A;  3FF0 A;  3E99 A;  3CNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...