4FMBA

Vira-rab1 complex structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
361
structure length
351
Chain Sequence
b'GPLGSIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease-like virA
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Protein binding
total genus 90
structure length 351
sequence length 361
chains with identical sequence C, E
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fmbA01
3EB8A 4FMAA 3PCSA 4FMCA 4FMDA 3PCRA 3EE1A 3Q1CA 4FMBA
chains in the Genus database with same CATH superfamily
1V57A 2W56B 1UCIA 1RGCA 4LYLB 4WWUC 2CFDA 4O02B 1RNBA 2IUKA 4ILFA 1NU3A 2P0MA 2XEPA 1PY3A 2BIRA 3S28A 1D6ZA 4N6UA 1B20A 9RNTA 1RRHA 3OWSA 3K7CA 3NHXA 1PYLA 1AR0A 1IV7A 2CWTA 4KT3B 5HGRA 2P09A 3U1WA 1WMNA 3EB8A 1RGLA 1RN7A 4R1KA 1VQ93 3OW22 3FCSB 3DUKA 5AIGA 3PZWA 2UGIA 5IG4A 3MSOA 4CPKA 1N8R4 3E99A 1VQ43 3N9HA 1B2UA 1M1XB 4RNYA 1BNSA 5AI1A 1IU7A 5CF2A 1BRIA 2CFGA 3B4PA 3RGAA 5M18A 2F4YA 3BB9A 1OH0A 3B7CA 5AIHA 3D4AA 1N8QA 1RN1A 2L1SA 2Z76A 3EQQB 2KCDA 3KCHA 1AQZA 3MYTA 4MMYB 1HYFA 1HKXA 3SOYA 4BL3A 2RNTA 1BU4A 3G8ZA 1JNQA 1O7NB 3D9RA 3EF8A 4K90B 5KP4A 3LTAA 3LXUX 1L5GB 2WGQA 1OACA 1TUHA 2KF4A 4LMIA 1RGFA 4KVHA 4AKYA 1FGOA 5EEOA 2ZA4A 1AV4A 3KSED 1VQ83 3CPW2 1LRAA 2OQEA 3GZXB 4HZBB 1YVSA 2GU3A 4BL2A 2YFJB 1BRSA 3GZRA 3CCQ3 5AIFA 4HJLB 3F7SA 1GY6A 3EC9A 1B2ZA 4IT7A 3X3YA 5IENA 3Q90A 1BSEA 3GZBA 4GHOA 3MKIA 1LQGC 3STDA 1VQP3 1YJW3 1UCKA 3V92A 4WFOA 1RGKA 2ML6A 1I2GA 1B3SA 5KP1A 1T2IA 1RGAA 1RTUA 1Q9EA 2RGQA 4HKVB 4N6MA 1RKYA 3CC73 3HIGA 4ORLA 4MEIA 4JF8A 2ZDJA 4XBXA 5ELUA 1W6GA 5AYSC 3AGOA 1F8NA 3HI7A 2KF6A 3S67A 1QJGA 3CNMA 4WYKA 5IF6A 5GSPA 3I553 4N6NB 1JB5A 1MGWA 1OHOA 3LH4A 5IW9A 1IK3A 3CNXA 1IV9A 1LOVA 3FG1A 4FCZA 2RFRA 3QRDA 2XSHB 1WQLB 2F86B 1BNGA 3AGNA 1BRNL 1QAFA 4HM5B 2JQ5A 1I2FA 2KRTA 2PNCA 2KF3A 4H3UA 3CCJ3 3J7Yd 3CCV3 4X2OA 1X1UA 2BMQB 1CH0A 3CCS3 4EW5A 2KAAA 4IIAA 1KWIA 3IMAB 1OF5A 5AEWB 5IEPA 3CC43 1QVF2 1VQ73 4J9AA 2WO0A 1FW7A 2CX0A 3CPOA 7GSPA 1BSAA 3NV0A 3WOFB 1SIIA 3QK9A 3D5IA 3LTDA 1YI23 2R4IA 1JB2A 1G96A 3CC23 3PCSA 4BTYA 1R4CA 5AYRB 1ASKA 4HM8B 1KD14 2UX0A 1RLSA 1MWUA 2CW9A 2P38A 3RDEA 5JPUA 2FNQA 3DM8A 4XDVA 3DXOA 5G1KA 3X40A 1GD4A 4O2HA 3ROBA 4N6OB 3CMA3 2IUJA 1PFPA 1SQWA 1BRJA 2A15A 2W9PA 3MHEA 4HM4B 1Q40B 4HYZA 1IVUA 1IVVA 1OPYA 3B4OA 4MMZB 1HU9A 4FMCA 1GD3A 3SYUA 2O3OA 1TTOA 1OGXA 2Q07A 3DH2A 2HMLB 3EE1A 3LOYA 1TIJA 3OWUA 1FYSA 4IPBA 3WOEB 1Q7HA 4HVNA 5A0OB 1VQN3 2IYJA 1E3VA 3MWZA 3MG3A 3UL6A 1B21A 1NB3I 3NBJA 5CLKA 2OQEC 2CC3A 4TX4A 1VQM3 1VQL3 1V74A 1VQ53 1JN5A 3VF1A 1GSPA 1LVNA 3AMOA 4R4KA 2INXA 1YIJ3 3H51A 4XDWA 1E3RA 3DGLA 1Q824 1O7WB 1LOYA 3NQYA 3ZG5A 1NDOB 2CIUA 2J8XB 5BVBA 5CF1A 2W6JH 4I4KA 1ISKA 4RZMA 1Q864 1TRQA 1BNFA 1BRHA 1JRQA 1WTHA 3UL5A 3GRDA 4FCJA 2IY2A 2O9UX 2WOFA 3M8CA 4OUQA 1RGGA 1ZX2A 1IDPA 1EUIC 2W56A 1CYVA 3BNDA 1BAOA 4CJNA 1W2ZA 2E2VA 1BNRA 2GEYA 5D82A 5LC7A 1CYUA 1BOXA 3HIIA 4GSPA 4EV2A 3AHWA 2FXTA 2F5MA 1EA2A 2FGTA 3Q1CA 3K5TA 4K1VA 1TFOA 1UUWB 5LC6A 3F8HA 1IT8A 1VQQA 2CFLA 4RNZA 2HMMB 3G713 3SLUA 4R9KA 4WHAA 1UW1A 5STDA 1FGQA 1MWSA 1DMMA 1VZZA 2PZVA 1YJN3 5IERA 3G4S3 3FZWA 3F40A 5G1LA 3WODG 1A67A 1WMPA 2P05A 3JUPA 3G6E3 2ML5A 1U8CB 2F99A 2AADA 1RSNA 1TRPA 7RNTA 2XFTA 3GZYB 1STDA 3JUMA 5D83A 1JBRA 2YX9A 5AEUB 3DGNA 1TFKA 3UJMA 1FUTA 3CXC2 1B2SA 4HM1B 5I97A 1QAKA 5HOHA 4R80A 5EQLA 5EVHA 3X3ZA 4G1MB 3NM2A 2W0QA 2LYXA 1N5PA 5D81A 1UCJA 4I5QA 1NWWA 1AY7A 3HZPA 6STDA 1VQO3 1WMOA 4FR9A 3CD63 4R9LA 3X42A 2L4VA 1IQXA 1KQS2 2XH9A 3U97A 1I70A 1ROVA 1Y4KA 3H3HA 4EYCA 2C10A 4LSOA 1Q814 3NBRA 1A90A 4GL6A 2AAEA 3NBBA 2W2CA 2H0IA 3DGMA 1HZ1A 3NX0A 1OUNA 4HAAA 1W01A 3I563 3CCR3 1JKGA 2GU1A 1RHLA 2H0GA 3SX1A 4EV5A 1O7PB 1V58A 4N6LA 3UB1A 3CCM3 5RNTA 3EBTA 2OCTA 2QEX3 4HM6B 1A2VA 3A76A 3SXXA 1TP6A 4HZ9B 3WHOA 1YGEA 1LQMB 1D6UA 2GXFA 1IVWA 5JBSA 3FGYA 3PGBA 3K0ZA 3O8YA 2CWVA 3MG1A 1K734 4KFEA 3FG3A 3JUQA 1DETA 1N5HA 2HMJB 5AIIA 1I3IA 1DMNA 3X41A 3KE7A 1A2PA 4H61A 6RNTA 4X2HA 2F56A 2MF7A 1N9EA 4BU4A 2BMOB 2UUGC 1FZUA 2WGOA 3SOAA 4KZ1A 5BXQA 7STDA 3CCU3 3FF2A 3PYJA 1JZOA 1BSBA 2CKFB 4L8OA 2K3DA 1K9M4 1A2KA 1AVLA 3JUNA 1GMQA 2R41A 2HMKB 3FLJA 2CG0A 3WR2A 3CCL3 1QALA 4QWTA 1I2EA 2K0MA 1EQKA 4J5KA 1B2XA 1YHQ3 1QVG2 1M904 4NREA 3N54B 1IVXA 3D79A 5IG0A 2CHCA 1GS3A 1I0XA 1I8VA 3FKAA 4BIRA 4ZM8A 1C54A 2E2UA 1BSDA 1NO3A 1MNLA 2BNGA 3PCRA 1NNVA 1JZDA 2V1LA 3L0RA 2XGLA 3EHCA 3GAXA 3ECFA 3RNTA 3LTCA 2BMRB 2CFWA 1W2B2 3AHSA 1VQ63 1B27A 2IA7A 3PS8A 3EJVA 1UI8A 3EX9A 1MOLA 3LTBA 1GMRA 1TU5A 4DKIA 1M1K4 3VGNA 3BNBA 5TGNA 3KZTA 2KXGA 5G2GA 1UDII 1YJ93 1J2BA 3LMLA 3KIIA 5DREA 5BIRA 3CCE3 3WDGB 3LT8A 1WNHA 2BO9B 2C4BA 1I0VA 1ULIB 3NUVA 2Y73A 3DGOA 1K28A 1FGMA 4XBYA 1UGIA 1CQSA 1JN5B 5FW5A 1Q42A 2CWUA 3MPHA 1K41A 2HMNB 1N9JA 1B2MA 4STDA 4N6V0 4JRFA 3OX9A 1TJDA 2D42A 2JDIH 1EKMA 1BGSA 2YFIB 3Q2PA 2Z7AA 4L7KA 5FGOA 1YNVX 4HM7B 3N8BA 5IG5A 1W6YA 3G16A 1DVCA 1YVBI 2XGNA 4N6TA 1OCVA 2CG1A 1RCKA 4XB5A 1E97A 3DZLA 4FMDA 1R4YA 4EBGA 1G0TA 3FG4A 1EG9B 1W6CA 1RJOA 2SBLA 2QIYA 3EN1B 1SJWA 3WA3A 2B1XB 4XM4A 4OVMA 4GB5A 5IEOA 3T8NA 2Y74A 4WP5A 1BUQA 4PEJA 3DY5A 3FF0A 2OOVA 1UUGB 1LNHA 3IJEB 1GOVA 2RSXA 2GSPA 2XF3A 1GYBA 3F7XA 5KP3A 5M1AA 1KSIA 3K9MC 3LZAA 4EC6A 1AVKA 3NM7A 4RBNA 4LEHA 4HM3B 2B24B 3CU3A 1BIRA 1NJI4 2IMJA 1QMAA 2XFSA 3EN8A 3GWRA 4FMAA 2F5WA 1I3FA 3SVAA 2GBWB 1ULJB 2QGUA 1EEJA 1FGRA 4MJDA 1W4NA 2M7OA 3ZG0A 1STFI 2XR8B 1UI7A 1MWRA 2C11A 1VQK3 1CEWI 3BLZA 3HOHA 1RNTA 1RMSA 4KFFA 3F9SA 3BU4A 4LGQA 3LYGA 4LZIA 4AEQA 2LQVA 1JBTA 1RGHA 2BT3A 2HOHA 3KSPA 2H0HA 3LT9A 2P0XA 4N3VA 3S27A 6GSPA 3T0UA 3OWYA 3V98A 5DRVA 1Q7Y4 1T5YA 4L8PA 2W04A 2K54A 3B8LA 1BRGA 1FUSA 3D5GA 4CCVA 1K8A4 3HK4A 3WA2X 1FUWA 1BUJA 3RGRA 2XSOB 4XBTA 3VSYA 1BVIA 1JKGB 1S5AA 1C7HA 4WYKB 1DVDA 1KC84 1X1YA 1BANA 1O7HB 1Z1SA 3D3LA 3EBYA 4FMBA 3CME3 2OTL3 2ZHXB 1UCLA 1T2HA 8RNTA 2QA43 3FH1A 1UUVB 3BNEA 1RN4A 3HX8A 2KF5A 1D6YA 1W7CA 1GMPA 1SPUA 3JVCA 2ZL8A 3F14A 4OK0A 4CDLA 1YGWA 2Z77A 3BNCA 3KKGA 8CHOA 1JV2B 1BNJA 1SARA 1BNIA 2RCDA 4RNTA 3URPA 1GOYA 1X1WA 1OHPA 1YIT3 1PU4A 1W02A 2I9WA 3ALAA 2W9QA 3UNLA 1OF5B 1RGEA 2SARA 1MGRA 2CK3H 1DE3A 3T8UA 1JB4A 1GY7A 1G02A 3NV0B 1ZGXA 4O8SA 1ROAA 3ZFZA 4K1UA 4Q53A 3DMCA 1SIHA 5CXOA 3Q3FA 3GSPA 3V99A 4K61A 4EXRA 1S723 1DMQA 2YFLB 4HOHA 1BRKA 3NQZA 1JBSA 5M19A 1LNIA 4AKZA 2OOVC 1RDSA 1ZO2A 1UGHI 4KFDA 5CK6A 3WMDA 3MG2A 2OWPA 1T3BA 3K63A 1MWTA 2E2TA 4NHFA 2F98A 4HM0B 2GBXB 1ZS7A 5IG3A 1IQ8A 3I0YA 1O7GB 1W00A 2CX1A 2BU4A 1RCLA 1W5ZA 5BU4A 1OGZA 3PXMA 1FGTA 1LXEA 1JJ22 2OTJ3 1NB5I 1US1A 1Q40A 1IQYA 2W03A 4U13A 2MC8A 3OXAA 3S5CA 1IYYA 1LOWA 1BSCA 2CFKA 3BIRA 4HBRA 1GOUA 5JPPA 3ER7A 4J8TA 2WOHA 2XRXB 3S29A 5ELJA 1X1XA 4HM2B 3X3XA 1GY5A 3G0KA 1RRLA 4BTXA 1DYUA 1LOXA 2D1WA 3F8XA 2BHMA 1M9GA 3AMOB 1OHSA 3SEDA 3TDGA 4MMXB 2CH9A 2STDA 3JUOA 3KFQC 4J5GA 4O3VA 4FCMA 1FA3A 3FSDA 2Z6BA 3OV4A 2HMOB 3KN4A 1O7MB 2GEXA 1U5OA 1IT7A 3DGYA 4NPBA 4BTWA 2RBIA 3IPTA 3A5EA 3NXJA 1BNEA
chains in the Genus database with same CATH topology
2W56B 4WWUC 2CFDA 4O02B 2IUKA 1NU3A 2P0MA 2XEPA 3S28A 1D6ZA 4N6UA 1RRHA 3OWSA 3K7CA 3NHXA 3U1WA 1AR0A 1IV7A 2CWTA 5HGRA 2P09A 1WMNA 3EB8A 4R1KA 1RN7A 1VQ93 3OW22 3FCSB 3DUKA 5AIGA 3PZWA 5IG4A 3MSOA 1N8R4 3E99A 1VQ43 3N9HA 4RNYA 1M1XB 5AI1A 1IU7A 5CF2A 2CFGA 3B4PA 3RGAA 3BB9A 1OH0A 3B7CA 5AIHA 1N8QA 2Z76A 3EQQB 2KCDA 4MMYB 3MYTA 1HKXA 3SOYA 3G8ZA 1JNQA 1O7NB 3D9RA 3EF8A 4K90B 5KP4A 3LTAA 3LXUX 1L5GB 2WGQA 1OACA 1TUHA 4LMIA 4KVHA 4AKYA 1FGOA 5EEOA 1AV4A 3KSED 1VQ83 3CPW2 2OQEA 3GZXB 4HZBB 2GU3A 2YFJB 3GZRA 3CCQ3 5AIFA 4HJLB 3F7SA 1GY6A 3EC9A 4IT7A 3X3YA 5IENA 3Q90A 3GZBA 3STDA 3MKIA 1VQP3 1YJW3 3V92A 4WFOA 5KP1A 2ML6A 4HKVB 3CC73 2RGQA 4N6MA 1RKYA 3HIGA 4ORLA 4MEIA 4JF8A 2ZDJA 4XBXA 5ELUA 1W6GA 5AYSC 1F8NA 3HI7A 3S67A 1QJGA 3CNMA 4WYKA 5IF6A 3I553 4N6NB 1JB5A 1OHOA 3LH4A 5IW9A 1IK3A 3CNXA 1IV9A 3FG1A 4FCZA 2RFRA 3QRDA 2XSHB 1WQLB 2F86B 1QAFA 4HM5B 2JQ5A 2KRTA 2PNCA 4H3UA 3CCJ3 3J7Yd 3CCV3 4X2OA 2BMQB 3CCS3 4IIAA 1KWIA 3IMAB 1OF5A 5AEWB 5IEPA 3CC43 1QVF2 1VQ73 4J9AA 2WO0A 3CPOA 3NV0A 3WOFB 1SIIA 3QK9A 1YI23 3LTDA 2R4IA 1JB2A 1G96A 3CC23 3PCSA 4BTYA 1R4CA 5AYRB 1ASKA 4HM8B 1KD14 2UX0A 5JPUA 2CW9A 2P38A 3RDEA 2FNQA 3DM8A 4XDVA 3DXOA 3X40A 1GD4A 4O2HA 3ROBA 4N6OB 3CMA3 2IUJA 1PFPA 1SQWA 2A15A 2W9PA 3MHEA 4HM4B 4HYZA 1Q40B 1IVUA 1IVVA 1OPYA 3B4OA 4MMZB 1HU9A 4FMCA 1GD3A 3I563 2O3OA 1OGXA 2Q07A 3EE1A 2HMLB 3LOYA 1TIJA 3OWUA 4IPBA 3WOEB 4HVNA 5A0OB 1VQN3 1E3VA 3MWZA 3MG3A 3UL6A 1NB3I 3NBJA 5CLKA 2OQEC 2CC3A 4TX4A 1VQM3 1VQL3 1V74A 1VQ53 1JN5A 3VF1A 1LVNA 3AMOA 4R4KA 1YIJ3 2INXA 3H51A 4XDWA 1E3RA 3DGLA 1Q824 1O7WB 3NQYA 1NDOB 2CIUA 5CF1A 5BVBA 2W6JH 4I4KA 1ISKA 4RZMA 1Q864 1JRQA 1WTHA 3UL5A 3GRDA 4FCJA 2O9UX 2WOFA 3M8CA 4OUQA 1ZX2A 1IDPA 2W56A 1CYVA 3BNDA 1W2ZA 2E2VA 2GEYA 5D82A 5LC7A 1CYUA 3HIIA 4EV2A 2FXTA 2FGTA 1EA2A 3Q1CA 3K5TA 4K1VA 1TFOA 1UUWB 5LC6A 3F8HA 1IT8A 4RNZA 2CFLA 2HMMB 3G713 3SLUA 4R9KA 4WHAA 1UW1A 5STDA 1FGQA 1DMMA 1VZZA 2PZVA 1YJN3 5IERA 3G4S3 3FZWA 3F40A 1A67A 3WODG 1WMPA 2P05A 3JUPA 3G6E3 2ML5A 1U8CB 2F99A 2XFTA 3GZYB 1STDA 3JUMA 5D83A 2YX9A 5AEUB 3DGNA 1TFKA 3UJMA 3CXC2 4HM1B 5I97A 1QAKA 4R80A 5EQLA 5EVHA 3X3ZA 4G1MB 3NM2A 2W0QA 2LYXA 1N5PA 5D81A 1NWWA 3HZPA 6STDA 1VQO3 1WMOA 4FR9A 3CD63 4R9LA 3X42A 2L4VA 1IQXA 1KQS2 2XH9A 3U97A 1ROVA 1Y4KA 3H3HA 4EYCA 2C10A 4LSOA 1Q814 3NBRA 1A90A 4GL6A 3NBBA 2W2CA 3DGMA 3NX0A 1OUNA 3CCR3 1W01A 1JKGA 2GU1A 3SX1A 4EV5A 1O7PB 4N6LA 3UB1A 3CCM3 3EBTA 2OCTA 2QEX3 4HM6B 1A2VA 3A76A 3SXXA 1TP6A 4HZ9B 1YGEA 1D6UA 2GXFA 1IVWA 5JBSA 3FGYA 3PGBA 3K0ZA 3O8YA 2CWVA 3MG1A 1K734 4KFEA 3FG3A 3JUQA 1N5HA 2HMJB 5AIIA 1DMNA 3X41A 3KE7A 4H61A 4X2HA 2MF7A 1N9EA 2BMOB 2WGOA 3SOAA 5BXQA 4KZ1A 7STDA 3CCU3 3FF2A 3PYJA 2CKFB 4L8OA 1K9M4 1A2KA 1AVLA 3JUNA 2HMKB 3FLJA 2CG0A 3CCL3 1QALA 4QWTA 2K0MA 1EQKA 1YHQ3 1QVG2 1M904 4NREA 3N54B 1IVXA 5IG0A 2CHCA 1GS3A 3FKAA 4ZM8A 2E2UA 3PCRA 1NO3A 1MNLA 2BNGA 2V1LA 3L0RA 2XGLA 3EHCA 3GAXA 3ECFA 3LTCA 2BMRB 2CFWA 1W2B2 1VQ63 2IA7A 3PS8A 3EJVA 1UI8A 3EX9A 1MOLA 3LTBA 1TU5A 1M1K4 3VGNA 3BNBA 5TGNA 3KZTA 2KXGA 5G2GA 1YJ93 1J2BA 3LMLA 3KIIA 5DREA 3CCE3 3WDGB 3LT8A 1WNHA 2BO9B 1ULIB 3NUVA 2Y73A 3DGOA 1K28A 1FGMA 4XBYA 1CQSA 1JN5B 5FW5A 1Q42A 2CWUA 3MPHA 1K41A 2HMNB 1N9JA 4STDA 4N6V0 4JRFA 3OX9A 2D42A 2JDIH 1EKMA 3Q2PA 2YFIB 4L7KA 2Z7AA 5FGOA 4HM7B 3N8BA 5IG5A 1W6YA 3G16A 1DVCA 1YVBI 2XGNA 4N6TA 1OCVA 2CG1A 4XB5A 1E97A 3DZLA 4FMDA 4EBGA 3FG4A 1EG9B 1W6CA 1RJOA 2SBLA 2QIYA 3EN1B 1SJWA 3WA3A 2B1XB 4XM4A 4OVMA 4GB5A 5IEOA 3T8NA 2Y74A 4WP5A 1BUQA 4PEJA 3DY5A 3FF0A 2OOVA 1LNHA 3IJEB 2RSXA 2XF3A 3F7XA 1GYBA 5KP3A 4EC6A 1KSIA 3K9MC 3LZAA 1AVKA 3NM7A 4RBNA 4LEHA 4HM3B 2B24B 3CU3A 1NJI4 2IMJA 1QMAA 2XFSA 3EN8A 3GWRA 4FMAA 3SVAA 2GBWB 1ULJB 2QGUA 1FGRA 4MJDA 2M7OA 1W4NA 1STFI 2XR8B 1UI7A 2C11A 1VQK3 1CEWI 3BLZA 4KFFA 3F9SA 4LGQA 3LYGA 4LZIA 4AEQA 2LQVA 2BT3A 3KSPA 3LT9A 2P0XA 4N3VA 3S27A 3T0UA 3OWYA 3V98A 5DRVA 1Q7Y4 1T5YA 4L8PA 2W04A 2K54A 3B8LA 4CCVA 1K8A4 3HK4A 3WA2X 1FUWA 3RGRA 2XSOB 4XBTA 3VSYA 1JKGB 1S5AA 1C7HA 4WYKB 1DVDA 1KC84 1Z1SA 1O7HB 3EBYA 3D3LA 4FMBA 3CME3 2OTL3 2QA43 3FH1A 1UUVB 3BNEA 3HX8A 1D6YA 1W7CA 1SPUA 3JVCA 2ZL8A 3F14A 4OK0A 4CDLA 2Z77A 3BNCA 3KKGA 8CHOA 1JV2B 2RCDA 1OHPA 1YIT3 1PU4A 1W02A 2I9WA 3ALAA 2W9QA 3UNLA 1OF5B 2CK3H 3T8UA 1JB4A 1GY7A 3NV0B 4O8SA 1ROAA 4K1UA 4Q53A 3DMCA 1SIHA 5CXOA 4EXRA 3V99A 4K61A 1S723 1DMQA 2YFLB 3NQZA 4AKZA 2OOVC 1ZO2A 4KFDA 5CK6A 3WMDA 3MG2A 2OWPA 3K63A 2E2TA 4NHFA 2F98A 4HM0B 2GBXB 5IG3A 1IQ8A 3I0YA 1O7GB 1W00A 1W5ZA 1OGZA 3PXMA 1FGTA 1LXEA 1JJ22 2OTJ3 1NB5I 1US1A 1Q40A 1IQYA 2W03A 4U13A 2MC8A 3OXAA 3S5CA 2CFKA 4HBRA 5JPPA 3ER7A 4J8TA 2WOHA 2XRXB 3S29A 5ELJA 4HM2B 3X3XA 1GY5A 3G0KA 1RRLA 4BTXA 1DYUA 1LOXA 2D1WA 3F8XA 2BHMA 1M9GA 3AMOB 1OHSA 3SEDA 3TDGA 4MMXB 2CH9A 2STDA 3JUOA 3KFQC 4O3VA 4FCMA 1FA3A 3FSDA 2Z6BA 3OV4A 2HMOB 1O7MB 2GEXA 1U5OA 1IT7A 4BTWA 3IPTA 3NXJA 3KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EB8 A;  4FMA A;  3PCS A;  4FMC A;  4FMD A;  3PCR A;  3EE1 A;  3Q1C A;  4FMB A; 
#chains in the Genus database with same CATH topology
 1V57 A;  2W56 B;  1UCI A;  1RGC A;  4LYL B;  4WWU C;  2CFD A;  4O02 B;  1RNB A;  2IUK A;  4ILF A;  1NU3 A;  2P0M A;  2XEP A;  1PY3 A;  2BIR A;  3S28 A;  1D6Z A;  4N6U A;  1B20 A;  9RNT A;  1RRH A;  3OWS A;  3K7C A;  3NHX A;  1PYL A;  1AR0 A;  1IV7 A;  2CWT A;  4KT3 B;  5HGR A;  2P09 A;  3U1W A;  1WMN A;  3EB8 A;  1RGL A;  1RN7 A;  4R1K A;  1VQ9 3;  3OW2 2;  3FCS B;  3DUK A;  5AIG A;  3PZW A;  2UGI A;  5IG4 A;  3MSO A;  4CPK A;  1N8R 4;  3E99 A;  1VQ4 3;  3N9H A;  1B2U A;  1M1X B;  4RNY A;  1BNS A;  5AI1 A;  1IU7 A;  5CF2 A;  1BRI A;  2CFG A;  3B4P A;  3RGA A;  5M18 A;  2F4Y A;  3BB9 A;  1OH0 A;  3B7C A;  5AIH A;  3D4A A;  1N8Q A;  1RN1 A;  2L1S A;  2Z76 A;  3EQQ B;  2KCD A;  3KCH A;  1AQZ A;  3MYT A;  4MMY B;  1HYF A;  1HKX A;  3SOY A;  4BL3 A;  2RNT A;  1BU4 A;  3G8Z A;  1JNQ A;  1O7N B;  3D9R A;  3EF8 A;  4K90 B;  5KP4 A;  3LTA A;  3LXU X;  1L5G B;  2WGQ A;  1OAC A;  1TUH A;  2KF4 A;  4LMI A;  1RGF A;  4KVH A;  4AKY A;  1FGO A;  5EEO A;  2ZA4 A;  1AV4 A;  3KSE D;  1VQ8 3;  3CPW 2;  1LRA A;  2OQE A;  3GZX B;  4HZB B;  1YVS A;  2GU3 A;  4BL2 A;  2YFJ B;  1BRS A;  3GZR A;  3CCQ 3;  5AIF A;  4HJL B;  3F7S A;  1GY6 A;  3EC9 A;  1B2Z A;  4IT7 A;  3X3Y A;  5IEN A;  3Q90 A;  1BSE A;  3GZB A;  4GHO A;  3MKI A;  1LQG C;  3STD A;  1VQP 3;  1YJW 3;  1UCK A;  3V92 A;  4WFO A;  1RGK A;  2ML6 A;  1I2G A;  1B3S A;  5KP1 A;  1T2I A;  1RGA A;  1RTU A;  1Q9E A;  2RGQ A;  4HKV B;  4N6M A;  1RKY A;  3CC7 3;  3HIG A;  4ORL A;  4MEI A;  4JF8 A;  2ZDJ A;  4XBX A;  5ELU A;  1W6G A;  5AYS C;  3AGO A;  1F8N A;  3HI7 A;  2KF6 A;  3S67 A;  1QJG A;  3CNM A;  4WYK A;  5IF6 A;  5GSP A;  3I55 3;  4N6N B;  1JB5 A;  1MGW A;  1OHO A;  3LH4 A;  5IW9 A;  1IK3 A;  3CNX A;  1IV9 A;  1LOV A;  3FG1 A;  4FCZ A;  2RFR A;  3QRD A;  2XSH B;  1WQL B;  2F86 B;  1BNG A;  3AGN A;  1BRN L;  1QAF A;  4HM5 B;  2JQ5 A;  1I2F A;  2KRT A;  2PNC A;  2KF3 A;  4H3U A;  3CCJ 3;  3J7Y d;  3CCV 3;  4X2O A;  1X1U A;  2BMQ B;  1CH0 A;  3CCS 3;  4EW5 A;  2KAA A;  4IIA A;  1KWI A;  3IMA B;  1OF5 A;  5AEW B;  5IEP A;  3CC4 3;  1QVF 2;  1VQ7 3;  4J9A A;  2WO0 A;  1FW7 A;  2CX0 A;  3CPO A;  7GSP A;  1BSA A;  3NV0 A;  3WOF B;  1SII A;  3QK9 A;  3D5I A;  3LTD A;  1YI2 3;  2R4I A;  1JB2 A;  1G96 A;  3CC2 3;  3PCS A;  4BTY A;  1R4C A;  5AYR B;  1ASK A;  4HM8 B;  1KD1 4;  2UX0 A;  1RLS A;  1MWU A;  2CW9 A;  2P38 A;  3RDE A;  5JPU A;  2FNQ A;  3DM8 A;  4XDV A;  3DXO A;  5G1K A;  3X40 A;  1GD4 A;  4O2H A;  3ROB A;  4N6O B;  3CMA 3;  2IUJ A;  1PFP A;  1SQW A;  1BRJ A;  2A15 A;  2W9P A;  3MHE A;  4HM4 B;  1Q40 B;  4HYZ A;  1IVU A;  1IVV A;  1OPY A;  3B4O A;  4MMZ B;  1HU9 A;  4FMC A;  1GD3 A;  3SYU A;  2O3O A;  1TTO A;  1OGX A;  2Q07 A;  3DH2 A;  2HML B;  3EE1 A;  3LOY A;  1TIJ A;  3OWU A;  1FYS A;  4IPB A;  3WOE B;  1Q7H A;  4HVN A;  5A0O B;  1VQN 3;  2IYJ A;  1E3V A;  3MWZ A;  3MG3 A;  3UL6 A;  1B21 A;  1NB3 I;  3NBJ A;  5CLK A;  2OQE C;  2CC3 A;  4TX4 A;  1VQM 3;  1VQL 3;  1V74 A;  1VQ5 3;  1JN5 A;  3VF1 A;  1GSP A;  1LVN A;  3AMO A;  4R4K A;  2INX A;  1YIJ 3;  3H51 A;  4XDW A;  1E3R A;  3DGL A;  1Q82 4;  1O7W B;  1LOY A;  3NQY A;  3ZG5 A;  1NDO B;  2CIU A;  2J8X B;  5BVB A;  5CF1 A;  2W6J H;  4I4K A;  1ISK A;  4RZM A;  1Q86 4;  1TRQ A;  1BNF A;  1BRH A;  1JRQ A;  1WTH A;  3UL5 A;  3GRD A;  4FCJ A;  2IY2 A;  2O9U X;  2WOF A;  3M8C A;  4OUQ A;  1RGG A;  1ZX2 A;  1IDP A;  1EUI C;  2W56 A;  1CYV A;  3BND A;  1BAO A;  4CJN A;  1W2Z A;  2E2V A;  1BNR A;  2GEY A;  5D82 A;  5LC7 A;  1CYU A;  1BOX A;  3HII A;  4GSP A;  4EV2 A;  3AHW A;  2FXT A;  2F5M A;  1EA2 A;  2FGT A;  3Q1C A;  3K5T A;  4K1V A;  1TFO A;  1UUW B;  5LC6 A;  3F8H A;  1IT8 A;  1VQQ A;  2CFL A;  4RNZ A;  2HMM B;  3G71 3;  3SLU A;  4R9K A;  4WHA A;  1UW1 A;  5STD A;  1FGQ A;  1MWS A;  1DMM A;  1VZZ A;  2PZV A;  1YJN 3;  5IER A;  3G4S 3;  3FZW A;  3F40 A;  5G1L A;  3WOD G;  1A67 A;  1WMP A;  2P05 A;  3JUP A;  3G6E 3;  2ML5 A;  1U8C B;  2F99 A;  2AAD A;  1RSN A;  1TRP A;  7RNT A;  2XFT A;  3GZY B;  1STD A;  3JUM A;  5D83 A;  1JBR A;  2YX9 A;  5AEU B;  3DGN A;  1TFK A;  3UJM A;  1FUT A;  3CXC 2;  1B2S A;  4HM1 B;  5I97 A;  1QAK A;  5HOH A;  4R80 A;  5EQL A;  5EVH A;  3X3Z A;  4G1M B;  3NM2 A;  2W0Q A;  2LYX A;  1N5P A;  5D81 A;  1UCJ A;  4I5Q A;  1NWW A;  1AY7 A;  3HZP A;  6STD A;  1VQO 3;  1WMO A;  4FR9 A;  3CD6 3;  4R9L A;  3X42 A;  2L4V A;  1IQX A;  1KQS 2;  2XH9 A;  3U97 A;  1I70 A;  1ROV A;  1Y4K A;  3H3H A;  4EYC A;  2C10 A;  4LSO A;  1Q81 4;  3NBR A;  1A90 A;  4GL6 A;  2AAE A;  3NBB A;  2W2C A;  2H0I A;  3DGM A;  1HZ1 A;  3NX0 A;  1OUN A;  4HAA A;  1W01 A;  3I56 3;  3CCR 3;  1JKG A;  2GU1 A;  1RHL A;  2H0G A;  3SX1 A;  4EV5 A;  1O7P B;  1V58 A;  4N6L A;  3UB1 A;  3CCM 3;  5RNT A;  3EBT A;  2OCT A;  2QEX 3;  4HM6 B;  1A2V A;  3A76 A;  3SXX A;  1TP6 A;  4HZ9 B;  3WHO A;  1YGE A;  1LQM B;  1D6U A;  2GXF A;  1IVW A;  5JBS A;  3FGY A;  3PGB A;  3K0Z A;  3O8Y A;  2CWV A;  3MG1 A;  1K73 4;  4KFE A;  3FG3 A;  3JUQ A;  1DET A;  1N5H A;  2HMJ B;  5AII A;  1I3I A;  1DMN A;  3X41 A;  3KE7 A;  1A2P A;  4H61 A;  6RNT A;  4X2H A;  2F56 A;  2MF7 A;  1N9E A;  4BU4 A;  2BMO B;  2UUG C;  1FZU A;  2WGO A;  3SOA A;  4KZ1 A;  5BXQ A;  7STD A;  3CCU 3;  3FF2 A;  3PYJ A;  1JZO A;  1BSB A;  2CKF B;  4L8O A;  2K3D A;  1K9M 4;  1A2K A;  1AVL A;  3JUN A;  1GMQ A;  2R41 A;  2HMK B;  3FLJ A;  2CG0 A;  3WR2 A;  3CCL 3;  1QAL A;  4QWT A;  1I2E A;  2K0M A;  1EQK A;  4J5K A;  1B2X A;  1YHQ 3;  1QVG 2;  1M90 4;  4NRE A;  3N54 B;  1IVX A;  3D79 A;  5IG0 A;  2CHC A;  1GS3 A;  1I0X A;  1I8V A;  3FKA A;  4BIR A;  4ZM8 A;  1C54 A;  2E2U A;  1BSD A;  1NO3 A;  1MNL A;  2BNG A;  3PCR A;  1NNV A;  1JZD A;  2V1L A;  3L0R A;  2XGL A;  3EHC A;  3GAX A;  3ECF A;  3RNT A;  3LTC A;  2BMR B;  2CFW A;  1W2B 2;  3AHS A;  1VQ6 3;  1B27 A;  2IA7 A;  3PS8 A;  3EJV A;  1UI8 A;  3EX9 A;  1MOL A;  3LTB A;  1GMR A;  1TU5 A;  4DKI A;  1M1K 4;  3VGN A;  3BNB A;  5TGN A;  3KZT A;  2KXG A;  5G2G A;  1UDI I;  1YJ9 3;  1J2B A;  3LML A;  3KII A;  5DRE A;  5BIR A;  3CCE 3;  3WDG B;  3LT8 A;  1WNH A;  2BO9 B;  2C4B A;  1I0V A;  1ULI B;  3NUV A;  2Y73 A;  3DGO A;  1K28 A;  1FGM A;  4XBY A;  1UGI A;  1CQS A;  1JN5 B;  5FW5 A;  1Q42 A;  2CWU A;  3MPH A;  1K41 A;  2HMN B;  1N9J A;  1B2M A;  4STD A;  4N6V 0;  4JRF A;  3OX9 A;  1TJD A;  2D42 A;  2JDI H;  1EKM A;  1BGS A;  2YFI B;  3Q2P A;  2Z7A A;  4L7K A;  5FGO A;  1YNV X;  4HM7 B;  3N8B A;  5IG5 A;  1W6Y A;  3G16 A;  1DVC A;  1YVB I;  2XGN A;  4N6T A;  1OCV A;  2CG1 A;  1RCK A;  4XB5 A;  1E97 A;  3DZL A;  4FMD A;  1R4Y A;  4EBG A;  1G0T A;  3FG4 A;  1EG9 B;  1W6C A;  1RJO A;  2SBL A;  2QIY A;  3EN1 B;  1SJW A;  3WA3 A;  2B1X B;  4XM4 A;  4OVM A;  4GB5 A;  5IEO A;  3T8N A;  2Y74 A;  4WP5 A;  1BUQ A;  4PEJ A;  3DY5 A;  3FF0 A;  2OOV A;  1UUG B;  1LNH A;  3IJE B;  1GOV A;  2RSX A;  2GSP A;  2XF3 A;  1GYB A;  3F7X A;  5KP3 A;  5M1A A;  1KSI A;  3K9M C;  3LZA A;  4EC6 A;  1AVK A;  3NM7 A;  4RBN A;  4LEH A;  4HM3 B;  2B24 B;  3CU3 A;  1BIR A;  1NJI 4;  2IMJ A;  1QMA A;  2XFS A;  3EN8 A;  3GWR A;  4FMA A;  2F5W A;  1I3F A;  3SVA A;  2GBW B;  1ULJ B;  2QGU A;  1EEJ A;  1FGR A;  4MJD A;  1W4N A;  2M7O A;  3ZG0 A;  1STF I;  2XR8 B;  1UI7 A;  1MWR A;  2C11 A;  1VQK 3;  1CEW I;  3BLZ A;  3HOH A;  1RNT A;  1RMS A;  4KFF A;  3F9S A;  3BU4 A;  4LGQ A;  3LYG A;  4LZI A;  4AEQ A;  2LQV A;  1JBT A;  1RGH A;  2BT3 A;  2HOH A;  3KSP A;  2H0H A;  3LT9 A;  2P0X A;  4N3V A;  3S27 A;  6GSP A;  3T0U A;  3OWY A;  3V98 A;  5DRV A;  1Q7Y 4;  1T5Y A;  4L8P A;  2W04 A;  2K54 A;  3B8L A;  1BRG A;  1FUS A;  3D5G A;  4CCV A;  1K8A 4;  3HK4 A;  3WA2 X;  1FUW A;  1BUJ A;  3RGR A;  2XSO B;  4XBT A;  3VSY A;  1BVI A;  1JKG B;  1S5A A;  1C7H A;  4WYK B;  1DVD A;  1KC8 4;  1X1Y A;  1BAN A;  1O7H B;  1Z1S A;  3D3L A;  3EBY A;  4FMB A;  3CME 3;  2OTL 3;  2ZHX B;  1UCL A;  1T2H A;  8RNT A;  2QA4 3;  3FH1 A;  1UUV B;  3BNE A;  1RN4 A;  3HX8 A;  2KF5 A;  1D6Y A;  1W7C A;  1GMP A;  1SPU A;  3JVC A;  2ZL8 A;  3F14 A;  4OK0 A;  4CDL A;  1YGW A;  2Z77 A;  3BNC A;  3KKG A;  8CHO A;  1JV2 B;  1BNJ A;  1SAR A;  1BNI A;  2RCD A;  4RNT A;  3URP A;  1GOY A;  1X1W A;  1OHP A;  1YIT 3;  1PU4 A;  1W02 A;  2I9W A;  3ALA A;  2W9Q A;  3UNL A;  1OF5 B;  1RGE A;  2SAR A;  1MGR A;  2CK3 H;  1DE3 A;  3T8U A;  1JB4 A;  1GY7 A;  1G02 A;  3NV0 B;  1ZGX A;  4O8S A;  1ROA A;  3ZFZ A;  4K1U A;  4Q53 A;  3DMC A;  1SIH A;  5CXO A;  3Q3F A;  3GSP A;  3V99 A;  4K61 A;  4EXR A;  1S72 3;  1DMQ A;  2YFL B;  4HOH A;  1BRK A;  3NQZ A;  1JBS A;  5M19 A;  1LNI A;  4AKZ A;  2OOV C;  1RDS A;  1ZO2 A;  1UGH I;  4KFD A;  5CK6 A;  3WMD A;  3MG2 A;  2OWP A;  1T3B A;  3K63 A;  1MWT A;  2E2T A;  4NHF A;  2F98 A;  4HM0 B;  2GBX B;  1ZS7 A;  5IG3 A;  1IQ8 A;  3I0Y A;  1O7G B;  1W00 A;  2CX1 A;  2BU4 A;  1RCL A;  1W5Z A;  5BU4 A;  1OGZ A;  3PXM A;  1FGT A;  1LXE A;  1JJ2 2;  2OTJ 3;  1NB5 I;  1US1 A;  1Q40 A;  1IQY A;  2W03 A;  4U13 A;  2MC8 A;  3OXA A;  3S5C A;  1IYY A;  1LOW A;  1BSC A;  2CFK A;  3BIR A;  4HBR A;  1GOU A;  5JPP A;  3ER7 A;  4J8T A;  2WOH A;  2XRX B;  3S29 A;  5ELJ A;  1X1X A;  4HM2 B;  3X3X A;  1GY5 A;  3G0K A;  1RRL A;  4BTX A;  1DYU A;  1LOX A;  2D1W A;  3F8X A;  2BHM A;  1M9G A;  3AMO B;  1OHS A;  3SED A;  3TDG A;  4MMX B;  2CH9 A;  2STD A;  3JUO A;  3KFQ C;  4J5G A;  4O3V A;  4FCM A;  1FA3 A;  3FSD A;  2Z6B A;  3OV4 A;  2HMO B;  3KN4 A;  1O7M B;  2GEX A;  1U5O A;  1IT7 A;  3DGY A;  4NPB A;  4BTW A;  2RBI A;  3IPT A;  3A5E A;  3NXJ A;  1BNE A; 
#chains in the Genus database with same CATH homology
 2W56 B;  4WWU C;  2CFD A;  4O02 B;  2IUK A;  1NU3 A;  2P0M A;  2XEP A;  3S28 A;  1D6Z A;  4N6U A;  1RRH A;  3OWS A;  3K7C A;  3NHX A;  3U1W A;  1AR0 A;  1IV7 A;  2CWT A;  5HGR A;  2P09 A;  1WMN A;  3EB8 A;  4R1K A;  1RN7 A;  1VQ9 3;  3OW2 2;  3FCS B;  3DUK A;  5AIG A;  3PZW A;  5IG4 A;  3MSO A;  1N8R 4;  3E99 A;  1VQ4 3;  3N9H A;  4RNY A;  1M1X B;  5AI1 A;  1IU7 A;  5CF2 A;  2CFG A;  3B4P A;  3RGA A;  3BB9 A;  1OH0 A;  3B7C A;  5AIH A;  1N8Q A;  2Z76 A;  3EQQ B;  2KCD A;  4MMY B;  3MYT A;  1HKX A;  3SOY A;  3G8Z A;  1JNQ A;  1O7N B;  3D9R A;  3EF8 A;  4K90 B;  5KP4 A;  3LTA A;  3LXU X;  1L5G B;  2WGQ A;  1OAC A;  1TUH A;  4LMI A;  4KVH A;  4AKY A;  1FGO A;  5EEO A;  1AV4 A;  3KSE D;  1VQ8 3;  3CPW 2;  2OQE A;  3GZX B;  4HZB B;  2GU3 A;  2YFJ B;  3GZR A;  3CCQ 3;  5AIF A;  4HJL B;  3F7S A;  1GY6 A;  3EC9 A;  4IT7 A;  3X3Y A;  5IEN A;  3Q90 A;  3GZB A;  3STD A;  3MKI A;  1VQP 3;  1YJW 3;  3V92 A;  4WFO A;  5KP1 A;  2ML6 A;  4HKV B;  3CC7 3;  2RGQ A;  4N6M A;  1RKY A;  3HIG A;  4ORL A;  4MEI A;  4JF8 A;  2ZDJ A;  4XBX A;  5ELU A;  1W6G A;  5AYS C;  1F8N A;  3HI7 A;  3S67 A;  1QJG A;  3CNM A;  4WYK A;  5IF6 A;  3I55 3;  4N6N B;  1JB5 A;  1OHO A;  3LH4 A;  5IW9 A;  1IK3 A;  3CNX A;  1IV9 A;  3FG1 A;  4FCZ A;  2RFR A;  3QRD A;  2XSH B;  1WQL B;  2F86 B;  1QAF A;  4HM5 B;  2JQ5 A;  2KRT A;  2PNC A;  4H3U A;  3CCJ 3;  3J7Y d;  3CCV 3;  4X2O A;  2BMQ B;  3CCS 3;  4IIA A;  1KWI A;  3IMA B;  1OF5 A;  5AEW B;  5IEP A;  3CC4 3;  1QVF 2;  1VQ7 3;  4J9A A;  2WO0 A;  3CPO A;  3NV0 A;  3WOF B;  1SII A;  3QK9 A;  1YI2 3;  3LTD A;  2R4I A;  1JB2 A;  1G96 A;  3CC2 3;  3PCS A;  4BTY A;  1R4C A;  5AYR B;  1ASK A;  4HM8 B;  1KD1 4;  2UX0 A;  5JPU A;  2CW9 A;  2P38 A;  3RDE A;  2FNQ A;  3DM8 A;  4XDV A;  3DXO A;  3X40 A;  1GD4 A;  4O2H A;  3ROB A;  4N6O B;  3CMA 3;  2IUJ A;  1PFP A;  1SQW A;  2A15 A;  2W9P A;  3MHE A;  4HM4 B;  4HYZ A;  1Q40 B;  1IVU A;  1IVV A;  1OPY A;  3B4O A;  4MMZ B;  1HU9 A;  4FMC A;  1GD3 A;  3I56 3;  2O3O A;  1OGX A;  2Q07 A;  3EE1 A;  2HML B;  3LOY A;  1TIJ A;  3OWU A;  4IPB A;  3WOE B;  4HVN A;  5A0O B;  1VQN 3;  1E3V A;  3MWZ A;  3MG3 A;  3UL6 A;  1NB3 I;  3NBJ A;  5CLK A;  2OQE C;  2CC3 A;  4TX4 A;  1VQM 3;  1VQL 3;  1V74 A;  1VQ5 3;  1JN5 A;  3VF1 A;  1LVN A;  3AMO A;  4R4K A;  1YIJ 3;  2INX A;  3H51 A;  4XDW A;  1E3R A;  3DGL A;  1Q82 4;  1O7W B;  3NQY A;  1NDO B;  2CIU A;  5CF1 A;  5BVB A;  2W6J H;  4I4K A;  1ISK A;  4RZM A;  1Q86 4;  1JRQ A;  1WTH A;  3UL5 A;  3GRD A;  4FCJ A;  2O9U X;  2WOF A;  3M8C A;  4OUQ A;  1ZX2 A;  1IDP A;  2W56 A;  1CYV A;  3BND A;  1W2Z A;  2E2V A;  2GEY A;  5D82 A;  5LC7 A;  1CYU A;  3HII A;  4EV2 A;  2FXT A;  2FGT A;  1EA2 A;  3Q1C A;  3K5T A;  4K1V A;  1TFO A;  1UUW B;  5LC6 A;  3F8H A;  1IT8 A;  4RNZ A;  2CFL A;  2HMM B;  3G71 3;  3SLU A;  4R9K A;  4WHA A;  1UW1 A;  5STD A;  1FGQ A;  1DMM A;  1VZZ A;  2PZV A;  1YJN 3;  5IER A;  3G4S 3;  3FZW A;  3F40 A;  1A67 A;  3WOD G;  1WMP A;  2P05 A;  3JUP A;  3G6E 3;  2ML5 A;  1U8C B;  2F99 A;  2XFT A;  3GZY B;  1STD A;  3JUM A;  5D83 A;  2YX9 A;  5AEU B;  3DGN A;  1TFK A;  3UJM A;  3CXC 2;  4HM1 B;  5I97 A;  1QAK A;  4R80 A;  5EQL A;  5EVH A;  3X3Z A;  4G1M B;  3NM2 A;  2W0Q A;  2LYX A;  1N5P A;  5D81 A;  1NWW A;  3HZP A;  6STD A;  1VQO 3;  1WMO A;  4FR9 A;  3CD6 3;  4R9L A;  3X42 A;  2L4V A;  1IQX A;  1KQS 2;  2XH9 A;  3U97 A;  1ROV A;  1Y4K A;  3H3H A;  4EYC A;  2C10 A;  4LSO A;  1Q81 4;  3NBR A;  1A90 A;  4GL6 A;  3NBB A;  2W2C A;  3DGM A;  3NX0 A;  1OUN A;  3CCR 3;  1W01 A;  1JKG A;  2GU1 A;  3SX1 A;  4EV5 A;  1O7P B;  4N6L A;  3UB1 A;  3CCM 3;  3EBT A;  2OCT A;  2QEX 3;  4HM6 B;  1A2V A;  3A76 A;  3SXX A;  1TP6 A;  4HZ9 B;  1YGE A;  1D6U A;  2GXF A;  1IVW A;  5JBS A;  3FGY A;  3PGB A;  3K0Z A;  3O8Y A;  2CWV A;  3MG1 A;  1K73 4;  4KFE A;  3FG3 A;  3JUQ A;  1N5H A;  2HMJ B;  5AII A;  1DMN A;  3X41 A;  3KE7 A;  4H61 A;  4X2H A;  2MF7 A;  1N9E A;  2BMO B;  2WGO A;  3SOA A;  5BXQ A;  4KZ1 A;  7STD A;  3CCU 3;  3FF2 A;  3PYJ A;  2CKF B;  4L8O A;  1K9M 4;  1A2K A;  1AVL A;  3JUN A;  2HMK B;  3FLJ A;  2CG0 A;  3CCL 3;  1QAL A;  4QWT A;  2K0M A;  1EQK A;  1YHQ 3;  1QVG 2;  1M90 4;  4NRE A;  3N54 B;  1IVX A;  5IG0 A;  2CHC A;  1GS3 A;  3FKA A;  4ZM8 A;  2E2U A;  3PCR A;  1NO3 A;  1MNL A;  2BNG A;  2V1L A;  3L0R A;  2XGL A;  3EHC A;  3GAX A;  3ECF A;  3LTC A;  2BMR B;  2CFW A;  1W2B 2;  1VQ6 3;  2IA7 A;  3PS8 A;  3EJV A;  1UI8 A;  3EX9 A;  1MOL A;  3LTB A;  1TU5 A;  1M1K 4;  3VGN A;  3BNB A;  5TGN A;  3KZT A;  2KXG A;  5G2G A;  1YJ9 3;  1J2B A;  3LML A;  3KII A;  5DRE A;  3CCE 3;  3WDG B;  3LT8 A;  1WNH A;  2BO9 B;  1ULI B;  3NUV A;  2Y73 A;  3DGO A;  1K28 A;  1FGM A;  4XBY A;  1CQS A;  1JN5 B;  5FW5 A;  1Q42 A;  2CWU A;  3MPH A;  1K41 A;  2HMN B;  1N9J A;  4STD A;  4N6V 0;  4JRF A;  3OX9 A;  2D42 A;  2JDI H;  1EKM A;  3Q2P A;  2YFI B;  4L7K A;  2Z7A A;  5FGO A;  4HM7 B;  3N8B A;  5IG5 A;  1W6Y A;  3G16 A;  1DVC A;  1YVB I;  2XGN A;  4N6T A;  1OCV A;  2CG1 A;  4XB5 A;  1E97 A;  3DZL A;  4FMD A;  4EBG A;  3FG4 A;  1EG9 B;  1W6C A;  1RJO A;  2SBL A;  2QIY A;  3EN1 B;  1SJW A;  3WA3 A;  2B1X B;  4XM4 A;  4OVM A;  4GB5 A;  5IEO A;  3T8N A;  2Y74 A;  4WP5 A;  1BUQ A;  4PEJ A;  3DY5 A;  3FF0 A;  2OOV A;  1LNH A;  3IJE B;  2RSX A;  2XF3 A;  3F7X A;  1GYB A;  5KP3 A;  4EC6 A;  1KSI A;  3K9M C;  3LZA A;  1AVK A;  3NM7 A;  4RBN A;  4LEH A;  4HM3 B;  2B24 B;  3CU3 A;  1NJI 4;  2IMJ A;  1QMA A;  2XFS A;  3EN8 A;  3GWR A;  4FMA A;  3SVA A;  2GBW B;  1ULJ B;  2QGU A;  1FGR A;  4MJD A;  2M7O A;  1W4N A;  1STF I;  2XR8 B;  1UI7 A;  2C11 A;  1VQK 3;  1CEW I;  3BLZ A;  4KFF A;  3F9S A;  4LGQ A;  3LYG A;  4LZI A;  4AEQ A;  2LQV A;  2BT3 A;  3KSP A;  3LT9 A;  2P0X A;  4N3V A;  3S27 A;  3T0U A;  3OWY A;  3V98 A;  5DRV A;  1Q7Y 4;  1T5Y A;  4L8P A;  2W04 A;  2K54 A;  3B8L A;  4CCV A;  1K8A 4;  3HK4 A;  3WA2 X;  1FUW A;  3RGR A;  2XSO B;  4XBT A;  3VSY A;  1JKG B;  1S5A A;  1C7H A;  4WYK B;  1DVD A;  1KC8 4;  1Z1S A;  1O7H B;  3EBY A;  3D3L A;  4FMB A;  3CME 3;  2OTL 3;  2QA4 3;  3FH1 A;  1UUV B;  3BNE A;  3HX8 A;  1D6Y A;  1W7C A;  1SPU A;  3JVC A;  2ZL8 A;  3F14 A;  4OK0 A;  4CDL A;  2Z77 A;  3BNC A;  3KKG A;  8CHO A;  1JV2 B;  2RCD A;  1OHP A;  1YIT 3;  1PU4 A;  1W02 A;  2I9W A;  3ALA A;  2W9Q A;  3UNL A;  1OF5 B;  2CK3 H;  3T8U A;  1JB4 A;  1GY7 A;  3NV0 B;  4O8S A;  1ROA A;  4K1U A;  4Q53 A;  3DMC A;  1SIH A;  5CXO A;  4EXR A;  3V99 A;  4K61 A;  1S72 3;  1DMQ A;  2YFL B;  3NQZ A;  4AKZ A;  2OOV C;  1ZO2 A;  4KFD A;  5CK6 A;  3WMD A;  3MG2 A;  2OWP A;  3K63 A;  2E2T A;  4NHF A;  2F98 A;  4HM0 B;  2GBX B;  5IG3 A;  1IQ8 A;  3I0Y A;  1O7G B;  1W00 A;  1W5Z A;  1OGZ A;  3PXM A;  1FGT A;  1LXE A;  1JJ2 2;  2OTJ 3;  1NB5 I;  1US1 A;  1Q40 A;  1IQY A;  2W03 A;  4U13 A;  2MC8 A;  3OXA A;  3S5C A;  2CFK A;  4HBR A;  5JPP A;  3ER7 A;  4J8T A;  2WOH A;  2XRX B;  3S29 A;  5ELJ A;  4HM2 B;  3X3X A;  1GY5 A;  3G0K A;  1RRL A;  4BTX A;  1DYU A;  1LOX A;  2D1W A;  3F8X A;  2BHM A;  1M9G A;  3AMO B;  1OHS A;  3SED A;  3TDG A;  4MMX B;  2CH9 A;  2STD A;  3JUO A;  3KFQ C;  4O3V A;  4FCM A;  1FA3 A;  3FSD A;  2Z6B A;  3OV4 A;  2HMO B;  1O7M B;  2GEX A;  1U5O A;  1IT7 A;  4BTW A;  3IPT A;  3NXJ A;  3KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...