4FMBA

Vira-rab1 complex structure
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
361
structure length
351
Chain Sequence
GPLGSIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine protease-like virA
publication title Structurally Distinct Bacterial TBC-like GAPs Link Arf GTPase to Rab1 Inactivation to Counteract Host Defenses.
pubmed doi rcsb
source organism Shigella flexneri
molecule tags Protein binding
total genus 90
structure length 351
sequence length 361
chains with identical sequence C, E
ec nomenclature ec 3.4.22.-:
pdb deposition date 2012-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.460 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fmbA01
3EE1A 3PCSA 4FMDA 4FMAA 4FMBA 3Q1CA 4FMCA 3EB8A 3PCRA
chains in the Genus database with same CATH superfamily
3AGNA 1LRAA 1O7HB 1YJN3 1AR0A 2W6JH 3QK9A 3NV0A 4TX4A 3G8ZA 2ZA4A 1STFI 2HMNB 1VQ73 3CCS3 4XB5A 2OTJ3 2RNTA 3JUMA 1TP6A 1ZS7A 3LOYA 3JUPA 2W56B 1FYSA 3LH4A 1NB3I 3DGOA 4WWUC 1GY5A 1BRHA 1Q40B 1JBTA 3MYTA 3G713 1Z1SA 1VQK3 5IENA 1MNLA 4N6UA 1OH0A 1IQXA 3BB9A 2QIYA 2XSOB 2IYJA 2WGQA 3T8NA 3LT9A 3AMOB 1N8QA 1T2IA 5IG0A 1JN5A 1RGKA 2ML6A 4GB5A 3X3YA 1UI7A 1CYVA 2XR8B 3S28A 2J8XB 1OACA 4EV5A 3PGBA 4BU4A 2HMOB 3UL5A 2XF3A 1B2XA 5M1AA 1K734 1RGGA 1T2HA 3Q3FA 5A0OB 3G4S3 3K9MC 3QRDA 1UCJA 1AVKA 1UUGB 1NNVA 3TDGA 1DMMA 1LOWA 1BOXA 3KZTA 1VQP3 3NHXA 1TU5A 4XDVA 3NUVA 1X1UA 1BIRA 5G2GA 1B2UA 1X1YA 3CMA3 3FGYA 4N3VA 5IG3A 2C4BA 1G02A 2CG1A 1DVCA 3EX9A 3F9SA 1B2SA 4WYKB 3F7SA 1AY7A 1N9JA 3KSED 1B2MA 1RCKA 4NHFA 3WMDA 1A90A 4WHAA 4XM4A 1N9EA 2W0QA 3GAXA 4K1VA 3LYGA 1S5AA 3VSYA 1JB2A 2UUGC 3UL6A 1IDPA 3F8XA 3MHEA 3NQZA 1AQZA 6STDA 1BSEA 1GY7A 2MC8A 3GZXB 5D82A 1M904 1BNJA 1BRGA 2W9PA 3LXUX 1RNBA 2IY2A 5AEWB 4MMXB 3HK4A 4OK0A 1BNGA 1RGCA 2OCTA 2QGUA 1I2FA 2BMRB 3BNCA 3EC9A 1GYBA 2OWPA 2ZHXB 4GL6A 2GBXB 4LEHA 4WFOA 3SXXA 1TUHA 3ZFZA 1VQ93 3CCR3 4HZBB 1ISKA 4U13A 1K41A 3KKGA 2L4VA 1JV2B 1HZ1A 1N5PA 3CD63 1E3VA 1RN4A 4FMDA 3V98A 1BAOA 3N9HA 5EEOA 2INXA 2LYXA 3H3HA 1RGHA 3S27A 1RKYA 3GRDA 1Q7HA 3PCRA 4KFFA 1SARA 4XBYA 6RNTA 2CIUA 1VQ83 3RNTA 3UNLA 1M9GA 2OQEC 1ZX2A 5G1KA 1BANA 1JB5A 4FMBA 4X2HA 3DMCA 5TGNA 1O7MB 3EN1B 2CX1A 3D5IA 1JBRA 1V58A 2P38A 7STDA 1W4NA 2E2VA 3N54B 1QJGA 2RBIA 4HYZA 2KF3A 3WOFB 1VQM3 4LZIA 2P09A 3PYJA 4Q53A 1YIT3 1PY3A 3ZG5A 2CFLA 2KF6A 3BNEA 1WNHA 3JUNA 1IVUA 5GSPA 1HU9A 3NX0A 1UUVB 3NBBA 3OW22 1V74A 1X1XA 1IVXA 2W56A 2Z77A 1QMAA 2F99A 1QVF2 2F4YA 3CCL3 1Q40A 1W7CA 4BL2A 1QVG2 1G0TA 2KXGA 1ROVA 2H0HA 3DGYA 1FUTA 1IK3A 1N8R4 4EXRA 1CYUA 4EBGA 4HM8B 3S29A 1HYFA 1EKMA 5FGOA 3WDGB 3CC43 1STDA 4HM5B 2FXTA 5D83A 1K28A 3CCU3 1GOYA 2BNGA 3AMOA 3URPA 3NXJA 3G0KA 2XRXB 5LC7A 5D81A 4L8PA 2CWVA 4IT7A 3KSPA 1JBSA 4HZ9B 1I0VA 1E3RA 5BXQA 5CF2A 4N6TA 2O9UX 4L7KA 1EQKA 2B24B 4XDWA 1IQYA 3EHCA 3SLUA 2F5WA 6GSPA 2OOVC 1MOLA 5IEPA 2W2CA 1G96A 3Q2PA 2GSPA 4N6LA 1YJW3 5G1LA 3D3LA 3T0UA 1MWTA 2QA43 3CNXA 1QALA 4G1MB 2GU3A 3V99A 4WYKA 3OWSA 2OOVA 1U5OA 5AEUB 3F40A 4R1KA 1L5GB 1LOXA 1BRNL 1FGQA 2F56A 1CQSA 2GEYA 1FGOA 1DE3A 3WA3A 3JUQA 1UW1A 3WHOA 3OV4A 3B4PA 3CNMA 1TRPA 3MSOA 1KQS2 1WMOA 2XEPA 3DY5A 5EVHA 1O7GB 3LTBA 1A2KA 4N6V0 5AIIA 1SIIA 1M1K4 2B1XB 5FW5A 1W6GA 3RGRA 1JJ22 4HJLB 1PYLA 2GBWB 5KP3A 3BLZA 3AHWA 1RHLA 4J5GA 2CC3A 1O7PB 2XH9A 3BIRA 1BUJA 1W5ZA 3RGAA 1OUNA 1BNSA 1RGFA 3PS8A 5IEOA 2JQ5A 3SYUA 4ZM8A 2Q07A 1R4CA 3B4OA 3MG3A 1MWUA 1MWSA 1W01A 5JBSA 1YGWA 1OHSA 2E2UA 1LOVA 4NPBA 1BUQA 4HM3B 2GEXA 1DETA 3NBRA 3CXC2 2PZVA 1EG9B 2RGQA 2IUJA 1JB4A 1RJOA 2K0MA 5M18A 1YVBI 2IA7A 4O8SA 3I563 1GS3A 2XGNA 3DXOA 1YNVX 3FG1A 4CDLA 5M19A 4KZ1A 1PFPA 3MG1A 3BNDA 4FCJA 1IU7A 1IQ8A 1RTUA 2Y74A 3F7XA 1GSPA 1QAFA 2W9QA 4AKYA 1D6UA 1NDOB 2CX0A 2FGTA 3FZWA 3EQQB 3KFQC 1TIJA 3ECFA 3FH1A 4AEQA 1Q864 3H51A 2IMJA 3BU4A 3SOYA 3LTCA 3NV0B 3VF1A 3LTDA 2JDIH 2BT3A 3FF0A 1B20A 1K9M4 2AAEA 3LMLA 1LOYA 2ZL8A 1IYYA 2GXFA 1AVLA 1MGRA 3K63A 3FSDA 3EB8A 3OWUA 3N8BA 3U97A 3ROBA 3CCE3 3FF2A 3I0YA 3ZG0A 3DH2A 2XFSA 1UCLA 1VZZA 3KIIA 1KC84 2YFLB 1IVWA 1T5YA 1YI23 3RDEA 1I70A 1FZUA 1RRHA 4BIRA 2KAAA 2KF5A 1UCKA 1JZDA 1W2ZA 1BNRA 2QEX3 1O7WB 3Q90A 1JN5B 1R4YA 1VQ53 2M7OA 1O7NB 4KFDA 3CC73 1EUIC 3DGNA 4FMAA 1GD3A 4HM1B 2BHMA 1VQQA 1I3IA 1BSCA 1EEJA 2H0IA 2WO0A 1NJI4 1LXEA 5IERA 3JVCA 3CPW2 3CCM3 3IJEB 2WOFA 3FKAA 1RRLA 2Z6BA 1Q824 1RMSA 2HMMB 1RGEA 1VQO3 3D4AA 5AYSC 3DGMA 3OWYA 1NO3A 1YHQ3 2GU1A 4R4KA 4EV2A 1T3BA 2YFJB 3EBYA 3FG3A 2SARA 4HVNA 4WP5A 5RNTA 1GMQA 2CK3H 2WOHA 5CXOA 2YX9A 4J9AA 4R9LA 3HZPA 8CHOA 2R4IA 5DREA 4OUQA 4FR9A 2XGLA 1OPYA 3STDA 4HOHA 3E99A 4LYLB 3CCQ3 1CH0A 3SX1A 3MWZA 1A2VA 1RSNA 3K0ZA 5AIGA 3LT8A 3EJVA 1ASKA 1WTHA 1IT7A 3NM2A 2C10A 1DVDA 3MKIA 4ILFA 3B7CA 3OX9A 1FUSA 5BVBA 1GMRA 1W00A 5IW9A 1TTOA 2HMKB 1MWRA 5ELUA 1BSBA 2P05A 3FG4A 1Q814 1JRQA 1TJDA 1ULIB 3PXMA 1QAKA 4HM6B 2BIRA 3S5CA 1FGTA 1I2EA 4CCVA 2RFRA 3IMAB 3V92A 3GSPA 1GOVA 4J5KA 2C11A 1KWIA 3I553 1BRSA 2BO9B 3ER7A 1A2PA 1Q9EA 2UGIA 4IPBA 4K1UA 1Q7Y4 3FLJA 7GSPA 5IG5A 3X41A 1LVNA 4HAAA 2OTL3 1FW7A 3CC23 1MGWA 2CFDA 3S67A 3KN4A 3WOEB 5JPPA 1OHOA 1SPUA 4DKIA 1YIJ3 1TFOA 1I2GA 2CHCA 4O02B 3D79A 3X3ZA 3CCV3 4GHOA 1X1WA 1S723 2YFIB 1RGLA 2CH9A 2CWTA 2O3OA 5AIHA 1UDII 1BRKA 2K3DA 3EN8A 1BVIA 4HM7B 3HOHA 3NQYA 1DMNA 3A76A 4BTWA 1B2ZA 2V1LA 3A5EA 2ZDJA 4FCMA 1SJWA 2RSXA 4H61A 1CEWI 5AYRB 2KCDA 1E97A 2SBLA 3GZBA 3SVAA 2HMLB 1OGXA 1BNFA 3HIGA 5JPUA 4BTYA 4MEIA 3X42A 5EQLA 4K61A 3EF8A 1OHPA 1EA2A 1Q42A 2P0MA 1UGIA 2P0XA 2AADA 1ZO2A 4PEJA 4RBNA 4CPKA 3CPOA 1BGSA 3HI7A 5IG4A 3J7Yd 4LMIA 3F14A 1D6ZA 2D1WA 3UJMA 1NB5I 3U1WA 8RNTA 1WQLB 1LQGC 2UX0A 3HIIA 2CFKA 1W6YA 3PCSA 1OF5B 4K90B 1C54A 1FGRA 1GOUA 1GMPA 1ZGXA 3BNBA 4GSPA 4KT3B 3IPTA 2BU4A 5HOHA 1JKGB 1M1XB 5BU4A 1U8CB 5BIRA 9RNTA 2Z7AA 4O3VA 1JZOA 1OGZA 1RGAA 3DM8A 3WR2A 7RNTA 1BSDA 4MMYB 2W04A 1FGMA 5KP4A 1WMNA 5HGRA 2D42A 2F5MA 4MMZB 5STDA 2BMOB 3F8HA 3GZYB 4HM0B 5LC6A 1TFKA 5IF6A 3AGOA 1V57A 1W2B2 2RCDA 1BRJA 1BRIA 1IV7A 2BMQB 3CCJ3 1BNIA 2IUKA 4BL3A 1YJ93 1RN1A 2H0GA 2K54A 2E2TA 1DMQA 3GZRA 4FCZA 3CU3A 3M8CA 3K7CA 3G16A 1BSAA 4STDA 4N6MA 1SQWA 3D5GA 5DRVA 1ROAA 1OCVA 3LZAA 2F86B 3FCSB 2XFTA 1IT8A 3DZLA 1YVSA 1US1A 3GWRA 4LGQA 2L1SA 3AHSA 1JNQA 4N6NB 1B27A 1WMPA 2XSHB 3D9RA 4RNYA 4AKZA 4J8TA 3WA2X 4R80A 4RZMA 2HMJB 4RNTA 2WGOA 1RLSA 3DGLA 5CF1A 2STDA 3O8YA 4FMCA 4KVHA 1YGEA 4CJNA 2R41A 3SOAA 3LTAA 2ML5A 2I9WA 3ALAA 3Q1CA 3PZWA 3JUOA 1BNEA 3K5TA 1D6YA 1KSIA 1Y4KA 3L0RA 1KD14 5KP1A 1RCLA 4HBRA 1I0XA 1J2BA 1TRQA 1HKXA 1UUWB 1C7HA 4NREA 1ULJB 1FUWA 2W03A 4JF8A 1F8NA 4O2HA 1N5HA 4EYCA 1VQ43 4EC6A 1LNHA 1VQ63 1PU4A 1RNTA 4X2OA 1I8VA 3CME3 2CKFB 4L8OA 2CFGA 2Z76A 1LQMB 2FNQA 4I5QA 1GY6A 3MPHA 2OQEA 2LQVA 3DUKA 1I3FA 4IIAA 1DYUA 4XBTA 2CW9A 2MF7A 1B3SA 1A67A 1W02A 4QWTA 1VQN3 3X40A 3NBJA 4I4KA 5I97A 4ORLA 1FA3A 4N6OB 1K8A4 4HKVB 5AIFA 2A15A 3UB1A 4BTXA 1UGHI 3EBTA 1NWWA 3HX8A 3VGNA 4HM2B 4LSOA 3G6E3 2CWUA 1LNIA 3X3XA 4HM4B 2HOHA 4JRFA 4OVMA 5CK6A 4EW5A 3KCHA 3NM7A 3OXAA 3SEDA 1NU3A 3T8UA 2KF4A 4RNZA 2KRTA 4R9KA 3EE1A 5AI1A 1GD4A 1RN7A 2PNCA 1UI8A 4XBXA 5ELJA 2F98A 3KE7A 1BU4A 4KFEA 1RDSA 1IVVA 1OF5A 2Y73A 3B8LA 5CLKA 1VQL3 2CFWA 3WODG 3MG2A 1W6CA 4MJDA 1JKGA 1IV9A 2CG0A 1UCIA 1B21A 4H3UA 1AV4A 1SIHA
chains in the Genus database with same CATH topology
1O7HB 1YJN3 1AR0A 2W6JH 3QK9A 3NV0A 4TX4A 3G8ZA 1STFI 2HMNB 1VQ73 3CCS3 4XB5A 2OTJ3 3JUMA 1TP6A 3LOYA 3JUPA 2W56B 3LH4A 1NB3I 3DGOA 4WWUC 1GY5A 1Q40B 3MYTA 3G713 1Z1SA 1VQK3 5IENA 1MNLA 4N6UA 1OH0A 1IQXA 3BB9A 2QIYA 2XSOB 2WGQA 3T8NA 3LT9A 3AMOB 1N8QA 5IG0A 1JN5A 4GB5A 2ML6A 3X3YA 1UI7A 1CYVA 2XR8B 3S28A 1OACA 4EV5A 3PGBA 1K734 2HMOB 3UL5A 2XF3A 5A0OB 3G4S3 3K9MC 3QRDA 1AVKA 3TDGA 1DMMA 3KZTA 1VQP3 3NHXA 1TU5A 4XDVA 3NUVA 5G2GA 3CMA3 3FGYA 4N3VA 5IG3A 2CG1A 1DVCA 3EX9A 3F9SA 4WYKB 3F7SA 1N9JA 3KSED 3WMDA 4NHFA 1A90A 4WHAA 4XM4A 1N9EA 2W0QA 3GAXA 4K1VA 3LYGA 1S5AA 3VSYA 1JB2A 3UL6A 1IDPA 3F8XA 3MHEA 3NQZA 6STDA 1GY7A 2MC8A 3GZXB 5D82A 1M904 2W9PA 3LXUX 5AEWB 4MMXB 3HK4A 4OK0A 2OCTA 2QGUA 4LEHA 2BMRB 3BNCA 3EC9A 1GYBA 2OWPA 4GL6A 4WFOA 2GBXB 3SXXA 1TUHA 1VQ93 3CCR3 4HZBB 1ISKA 4U13A 1K41A 3KKGA 2L4VA 1JV2B 1N5PA 3CD63 1E3VA 4FMDA 3V98A 3N9HA 5EEOA 2INXA 2LYXA 3H3HA 3S27A 1RKYA 3GRDA 3PCRA 4KFFA 4XBYA 2CIUA 1VQ83 3UNLA 1M9GA 2OQEC 1ZX2A 4X2HA 1JB5A 4FMBA 3DMCA 5TGNA 1O7MB 3EN1B 2P38A 7STDA 1W4NA 2E2VA 3N54B 1QJGA 4HYZA 3WOFB 1VQM3 4LZIA 2P09A 3PYJA 4Q53A 1YIT3 2CFLA 3JUNA 3BNEA 1WNHA 1IVUA 1HU9A 3NX0A 1UUVB 3NBBA 3OW22 1V74A 1IVXA 2Z77A 2W56A 1QVF2 1QMAA 2F99A 3CCL3 1Q40A 1W7CA 1QVG2 2KXGA 1ROVA 1IK3A 1N8R4 4EXRA 1CYUA 4EBGA 4HM8B 3S29A 1EKMA 5FGOA 3WDGB 3CC43 1STDA 4HM5B 2FXTA 5D83A 1K28A 3CCU3 3AMOA 2BNGA 3NXJA 3G0KA 2XRXB 5LC7A 5D81A 4L8PA 2CWVA 4IT7A 3KSPA 4HZ9B 1E3RA 5BXQA 5CF2A 4N6TA 2O9UX 4L7KA 1EQKA 2B24B 4XDWA 1IQYA 3EHCA 3SLUA 2OOVC 1MOLA 5IEPA 2W2CA 1G96A 3Q2PA 4N6LA 1YJW3 3D3LA 3T0UA 2QA43 3CNXA 1QALA 4G1MB 2GU3A 3V99A 4WYKA 3OWSA 2OOVA 1U5OA 5AEUB 3F40A 4R1KA 1L5GB 1LOXA 1FGQA 1CQSA 2GEYA 1FGOA 3WA3A 3JUQA 1UW1A 3OV4A 3B4PA 3CNMA 3MSOA 1KQS2 1WMOA 2XEPA 3DY5A 5EVHA 1O7GB 3LTBA 1A2KA 4N6V0 5AIIA 1SIIA 1M1K4 2B1XB 5FW5A 1W6GA 3RGRA 1JJ22 4HJLB 2GBWB 5KP3A 3BLZA 2CC3A 1O7PB 2XH9A 1W5ZA 3RGAA 1OUNA 3PS8A 4ZM8A 5IEOA 2JQ5A 2Q07A 1R4CA 3B4OA 3MG3A 1W01A 5JBSA 2E2UA 1OHSA 1BUQA 4HM3B 2GEXA 3NBRA 3CXC2 2PZVA 1EG9B 2RGQA 2IUJA 1JB4A 1RJOA 2K0MA 1YVBI 2IA7A 4O8SA 3I563 1GS3A 2XGNA 3DXOA 3FG1A 4CDLA 4KZ1A 1PFPA 3MG1A 3BNDA 4FCJA 1IU7A 1IQ8A 2Y74A 3F7XA 1QAFA 4AKYA 2W9QA 1D6UA 1NDOB 2FGTA 3FZWA 3KFQC 3EQQB 4AEQA 1TIJA 3ECFA 3FH1A 1Q864 3H51A 2IMJA 3SOYA 3LTCA 3NV0B 3VF1A 3LTDA 2JDIH 2BT3A 3FF0A 1K9M4 3LMLA 2ZL8A 2GXFA 1AVLA 3K63A 3FSDA 3EB8A 3OWUA 3N8BA 3U97A 3ROBA 3CCE3 3FF2A 3I0YA 2XFSA 3KIIA 1VZZA 1KC84 2YFLB 1IVWA 1T5YA 1YI23 3RDEA 1RRHA 1W2ZA 2QEX3 1O7WB 3Q90A 1JN5B 1VQ53 2M7OA 1O7NB 4KFDA 3CC73 3DGNA 4FMAA 1GD3A 4HM1B 2BHMA 2WO0A 1NJI4 1LXEA 5IERA 3JVCA 3CPW2 3CCM3 3IJEB 2WOFA 3FKAA 1RRLA 2Z6BA 1Q824 2HMMB 1VQO3 5AYSC 3DGMA 3OWYA 1NO3A 1YHQ3 2GU1A 4R4KA 4EV2A 2YFJB 3EBYA 3FG3A 4HVNA 4WP5A 2CK3H 2WOHA 5CXOA 2YX9A 4J9AA 4R9LA 3HZPA 8CHOA 2R4IA 5DREA 4OUQA 4FR9A 2XGLA 1OPYA 3STDA 3E99A 3CCQ3 3SX1A 3MWZA 1A2VA 3K0ZA 5AIGA 3LT8A 3EJVA 1ASKA 1WTHA 1IT7A 3NM2A 2C10A 1DVDA 3MKIA 3B7CA 3OX9A 5BVBA 5IW9A 1W00A 2HMKB 5ELUA 2P05A 3FG4A 1Q814 1JRQA 1ULIB 3PXMA 1QAKA 4HM6B 3S5CA 1FGTA 4CCVA 2RFRA 3IMAB 3V92A 2C11A 1KWIA 3I553 2BO9B 3ER7A 4IPBA 4K1UA 1Q7Y4 3FLJA 5IG5A 3X41A 1LVNA 2OTL3 3CC23 2CFDA 3S67A 3KN4A 3WOEB 5JPPA 1OHOA 1SPUA 1YIJ3 1TFOA 2CHCA 4O02B 3X3ZA 3CCV3 1S723 2YFIB 2CH9A 2CWTA 2O3OA 5AIHA 3EN8A 4HM7B 3NQYA 1DMNA 3A76A 4BTWA 2V1LA 2ZDJA 4FCMA 1SJWA 2RSXA 4H61A 1CEWI 5AYRB 2KCDA 1E97A 2SBLA 3GZBA 3SVAA 2HMLB 1OGXA 3HIGA 5JPUA 4BTYA 4MEIA 3X42A 5EQLA 4K61A 3EF8A 1OHPA 1EA2A 1Q42A 2P0MA 2P0XA 4PEJA 1ZO2A 4RBNA 5IG4A 3CPOA 3HI7A 3J7Yd 4LMIA 3F14A 1D6ZA 2D1WA 3UJMA 1NB5I 3U1WA 1WQLB 2UX0A 3HIIA 2CFKA 1W6YA 3PCSA 1OF5B 4K90B 1FGRA 3BNBA 3IPTA 1JKGB 1M1XB 1U8CB 2Z7AA 4O3VA 1OGZA 3DM8A 5KP4A 4MMYB 2W04A 1FGMA 1WMNA 5HGRA 2D42A 4MMZB 5STDA 2BMOB 3F8HA 3GZYB 4HM0B 5LC6A 1TFKA 5IF6A 1W2B2 2RCDA 1IV7A 2BMQB 3CCJ3 2IUKA 1YJ93 2K54A 2E2TA 1DMQA 3GZRA 4FCZA 3CU3A 3M8CA 3K7CA 3G16A 4STDA 4N6MA 1SQWA 5DRVA 1ROAA 1OCVA 3LZAA 2F86B 3FCSB 2XFTA 1IT8A 3DZLA 3GWRA 1US1A 4LGQA 1JNQA 4N6NB 2XSHB 1WMPA 3D9RA 4RNYA 4AKZA 4J8TA 3WA2X 4R80A 4RZMA 2HMJB 2WGOA 3DGLA 5CF1A 2STDA 3O8YA 4FMCA 4KVHA 1YGEA 3SOAA 3LTAA 2ML5A 2I9WA 3ALAA 3Q1CA 3PZWA 3JUOA 3K5TA 1D6YA 1KSIA 1Y4KA 3L0RA 1KD14 5KP1A 4HBRA 1J2BA 1HKXA 1UUWB 1C7HA 4NREA 1ULJB 1FUWA 2W03A 4JF8A 1F8NA 4O2HA 1N5HA 4EYCA 1VQ43 4EC6A 1LNHA 1VQ63 1PU4A 4X2OA 3CME3 2CKFB 4L8OA 2CFGA 2Z76A 2FNQA 1GY6A 3MPHA 2OQEA 2LQVA 3DUKA 4IIAA 1DYUA 4XBTA 2CW9A 2MF7A 1A67A 1W02A 4QWTA 1VQN3 3X40A 3NBJA 4I4KA 5I97A 4ORLA 1FA3A 4N6OB 1K8A4 4HKVB 5AIFA 2A15A 3UB1A 4BTXA 3EBTA 1NWWA 3HX8A 3VGNA 4HM2B 4LSOA 3G6E3 2CWUA 3X3XA 4HM4B 4JRFA 4OVMA 5CK6A 3NM7A 3OXAA 3SEDA 1NU3A 3T8UA 4RNZA 2KRTA 4R9KA 3EE1A 5AI1A 1GD4A 1RN7A 2PNCA 1UI8A 4XBXA 5ELJA 2F98A 3KE7A 4KFEA 1VQL3 1IVVA 1OF5A 2Y73A 3B8LA 5CLKA 2CFWA 3WODG 3MG2A 1W6CA 4MJDA 1JKGA 1IV9A 2CG0A 4H3UA 1AV4A 1SIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EE1 A;  3PCS A;  4FMD A;  4FMA A;  4FMB A;  3Q1C A;  4FMC A;  3EB8 A;  3PCR A; 
#chains in the Genus database with same CATH topology
 3AGN A;  1LRA A;  1O7H B;  1YJN 3;  1AR0 A;  2W6J H;  3QK9 A;  3NV0 A;  4TX4 A;  3G8Z A;  2ZA4 A;  1STF I;  2HMN B;  1VQ7 3;  3CCS 3;  4XB5 A;  2OTJ 3;  2RNT A;  3JUM A;  1TP6 A;  1ZS7 A;  3LOY A;  3JUP A;  2W56 B;  1FYS A;  3LH4 A;  1NB3 I;  3DGO A;  4WWU C;  1GY5 A;  1BRH A;  1Q40 B;  1JBT A;  3MYT A;  3G71 3;  1Z1S A;  1VQK 3;  5IEN A;  1MNL A;  4N6U A;  1OH0 A;  1IQX A;  3BB9 A;  2QIY A;  2XSO B;  2IYJ A;  2WGQ A;  3T8N A;  3LT9 A;  3AMO B;  1N8Q A;  1T2I A;  5IG0 A;  1JN5 A;  1RGK A;  2ML6 A;  4GB5 A;  3X3Y A;  1UI7 A;  1CYV A;  2XR8 B;  3S28 A;  2J8X B;  1OAC A;  4EV5 A;  3PGB A;  4BU4 A;  2HMO B;  3UL5 A;  2XF3 A;  1B2X A;  5M1A A;  1K73 4;  1RGG A;  1T2H A;  3Q3F A;  5A0O B;  3G4S 3;  3K9M C;  3QRD A;  1UCJ A;  1AVK A;  1UUG B;  1NNV A;  3TDG A;  1DMM A;  1LOW A;  1BOX A;  3KZT A;  1VQP 3;  3NHX A;  1TU5 A;  4XDV A;  3NUV A;  1X1U A;  1BIR A;  5G2G A;  1B2U A;  1X1Y A;  3CMA 3;  3FGY A;  4N3V A;  5IG3 A;  2C4B A;  1G02 A;  2CG1 A;  1DVC A;  3EX9 A;  3F9S A;  1B2S A;  4WYK B;  3F7S A;  1AY7 A;  1N9J A;  3KSE D;  1B2M A;  1RCK A;  4NHF A;  3WMD A;  1A90 A;  4WHA A;  4XM4 A;  1N9E A;  2W0Q A;  3GAX A;  4K1V A;  3LYG A;  1S5A A;  3VSY A;  1JB2 A;  2UUG C;  3UL6 A;  1IDP A;  3F8X A;  3MHE A;  3NQZ A;  1AQZ A;  6STD A;  1BSE A;  1GY7 A;  2MC8 A;  3GZX B;  5D82 A;  1M90 4;  1BNJ A;  1BRG A;  2W9P A;  3LXU X;  1RNB A;  2IY2 A;  5AEW B;  4MMX B;  3HK4 A;  4OK0 A;  1BNG A;  1RGC A;  2OCT A;  2QGU A;  1I2F A;  2BMR B;  3BNC A;  3EC9 A;  1GYB A;  2OWP A;  2ZHX B;  4GL6 A;  2GBX B;  4LEH A;  4WFO A;  3SXX A;  1TUH A;  3ZFZ A;  1VQ9 3;  3CCR 3;  4HZB B;  1ISK A;  4U13 A;  1K41 A;  3KKG A;  2L4V A;  1JV2 B;  1HZ1 A;  1N5P A;  3CD6 3;  1E3V A;  1RN4 A;  4FMD A;  3V98 A;  1BAO A;  3N9H A;  5EEO A;  2INX A;  2LYX A;  3H3H A;  1RGH A;  3S27 A;  1RKY A;  3GRD A;  1Q7H A;  3PCR A;  4KFF A;  1SAR A;  4XBY A;  6RNT A;  2CIU A;  1VQ8 3;  3RNT A;  3UNL A;  1M9G A;  2OQE C;  1ZX2 A;  5G1K A;  1BAN A;  1JB5 A;  4FMB A;  4X2H A;  3DMC A;  5TGN A;  1O7M B;  3EN1 B;  2CX1 A;  3D5I A;  1JBR A;  1V58 A;  2P38 A;  7STD A;  1W4N A;  2E2V A;  3N54 B;  1QJG A;  2RBI A;  4HYZ A;  2KF3 A;  3WOF B;  1VQM 3;  4LZI A;  2P09 A;  3PYJ A;  4Q53 A;  1YIT 3;  1PY3 A;  3ZG5 A;  2CFL A;  2KF6 A;  3BNE A;  1WNH A;  3JUN A;  1IVU A;  5GSP A;  1HU9 A;  3NX0 A;  1UUV B;  3NBB A;  3OW2 2;  1V74 A;  1X1X A;  1IVX A;  2W56 A;  2Z77 A;  1QMA A;  2F99 A;  1QVF 2;  2F4Y A;  3CCL 3;  1Q40 A;  1W7C A;  4BL2 A;  1QVG 2;  1G0T A;  2KXG A;  1ROV A;  2H0H A;  3DGY A;  1FUT A;  1IK3 A;  1N8R 4;  4EXR A;  1CYU A;  4EBG A;  4HM8 B;  3S29 A;  1HYF A;  1EKM A;  5FGO A;  3WDG B;  3CC4 3;  1STD A;  4HM5 B;  2FXT A;  5D83 A;  1K28 A;  3CCU 3;  1GOY A;  2BNG A;  3AMO A;  3URP A;  3NXJ A;  3G0K A;  2XRX B;  5LC7 A;  5D81 A;  4L8P A;  2CWV A;  4IT7 A;  3KSP A;  1JBS A;  4HZ9 B;  1I0V A;  1E3R A;  5BXQ A;  5CF2 A;  4N6T A;  2O9U X;  4L7K A;  1EQK A;  2B24 B;  4XDW A;  1IQY A;  3EHC A;  3SLU A;  2F5W A;  6GSP A;  2OOV C;  1MOL A;  5IEP A;  2W2C A;  1G96 A;  3Q2P A;  2GSP A;  4N6L A;  1YJW 3;  5G1L A;  3D3L A;  3T0U A;  1MWT A;  2QA4 3;  3CNX A;  1QAL A;  4G1M B;  2GU3 A;  3V99 A;  4WYK A;  3OWS A;  2OOV A;  1U5O A;  5AEU B;  3F40 A;  4R1K A;  1L5G B;  1LOX A;  1BRN L;  1FGQ A;  2F56 A;  1CQS A;  2GEY A;  1FGO A;  1DE3 A;  3WA3 A;  3JUQ A;  1UW1 A;  3WHO A;  3OV4 A;  3B4P A;  3CNM A;  1TRP A;  3MSO A;  1KQS 2;  1WMO A;  2XEP A;  3DY5 A;  5EVH A;  1O7G B;  3LTB A;  1A2K A;  4N6V 0;  5AII A;  1SII A;  1M1K 4;  2B1X B;  5FW5 A;  1W6G A;  3RGR A;  1JJ2 2;  4HJL B;  1PYL A;  2GBW B;  5KP3 A;  3BLZ A;  3AHW A;  1RHL A;  4J5G A;  2CC3 A;  1O7P B;  2XH9 A;  3BIR A;  1BUJ A;  1W5Z A;  3RGA A;  1OUN A;  1BNS A;  1RGF A;  3PS8 A;  5IEO A;  2JQ5 A;  3SYU A;  4ZM8 A;  2Q07 A;  1R4C A;  3B4O A;  3MG3 A;  1MWU A;  1MWS A;  1W01 A;  5JBS A;  1YGW A;  1OHS A;  2E2U A;  1LOV A;  4NPB A;  1BUQ A;  4HM3 B;  2GEX A;  1DET A;  3NBR A;  3CXC 2;  2PZV A;  1EG9 B;  2RGQ A;  2IUJ A;  1JB4 A;  1RJO A;  2K0M A;  5M18 A;  1YVB I;  2IA7 A;  4O8S A;  3I56 3;  1GS3 A;  2XGN A;  3DXO A;  1YNV X;  3FG1 A;  4CDL A;  5M19 A;  4KZ1 A;  1PFP A;  3MG1 A;  3BND A;  4FCJ A;  1IU7 A;  1IQ8 A;  1RTU A;  2Y74 A;  3F7X A;  1GSP A;  1QAF A;  2W9Q A;  4AKY A;  1D6U A;  1NDO B;  2CX0 A;  2FGT A;  3FZW A;  3EQQ B;  3KFQ C;  1TIJ A;  3ECF A;  3FH1 A;  4AEQ A;  1Q86 4;  3H51 A;  2IMJ A;  3BU4 A;  3SOY A;  3LTC A;  3NV0 B;  3VF1 A;  3LTD A;  2JDI H;  2BT3 A;  3FF0 A;  1B20 A;  1K9M 4;  2AAE A;  3LML A;  1LOY A;  2ZL8 A;  1IYY A;  2GXF A;  1AVL A;  1MGR A;  3K63 A;  3FSD A;  3EB8 A;  3OWU A;  3N8B A;  3U97 A;  3ROB A;  3CCE 3;  3FF2 A;  3I0Y A;  3ZG0 A;  3DH2 A;  2XFS A;  1UCL A;  1VZZ A;  3KII A;  1KC8 4;  2YFL B;  1IVW A;  1T5Y A;  1YI2 3;  3RDE A;  1I70 A;  1FZU A;  1RRH A;  4BIR A;  2KAA A;  2KF5 A;  1UCK A;  1JZD A;  1W2Z A;  1BNR A;  2QEX 3;  1O7W B;  3Q90 A;  1JN5 B;  1R4Y A;  1VQ5 3;  2M7O A;  1O7N B;  4KFD A;  3CC7 3;  1EUI C;  3DGN A;  4FMA A;  1GD3 A;  4HM1 B;  2BHM A;  1VQQ A;  1I3I A;  1BSC A;  1EEJ A;  2H0I A;  2WO0 A;  1NJI 4;  1LXE A;  5IER A;  3JVC A;  3CPW 2;  3CCM 3;  3IJE B;  2WOF A;  3FKA A;  1RRL A;  2Z6B A;  1Q82 4;  1RMS A;  2HMM B;  1RGE A;  1VQO 3;  3D4A A;  5AYS C;  3DGM A;  3OWY A;  1NO3 A;  1YHQ 3;  2GU1 A;  4R4K A;  4EV2 A;  1T3B A;  2YFJ B;  3EBY A;  3FG3 A;  2SAR A;  4HVN A;  4WP5 A;  5RNT A;  1GMQ A;  2CK3 H;  2WOH A;  5CXO A;  2YX9 A;  4J9A A;  4R9L A;  3HZP A;  8CHO A;  2R4I A;  5DRE A;  4OUQ A;  4FR9 A;  2XGL A;  1OPY A;  3STD A;  4HOH A;  3E99 A;  4LYL B;  3CCQ 3;  1CH0 A;  3SX1 A;  3MWZ A;  1A2V A;  1RSN A;  3K0Z A;  5AIG A;  3LT8 A;  3EJV A;  1ASK A;  1WTH A;  1IT7 A;  3NM2 A;  2C10 A;  1DVD A;  3MKI A;  4ILF A;  3B7C A;  3OX9 A;  1FUS A;  5BVB A;  1GMR A;  1W00 A;  5IW9 A;  1TTO A;  2HMK B;  1MWR A;  5ELU A;  1BSB A;  2P05 A;  3FG4 A;  1Q81 4;  1JRQ A;  1TJD A;  1ULI B;  3PXM A;  1QAK A;  4HM6 B;  2BIR A;  3S5C A;  1FGT A;  1I2E A;  4CCV A;  2RFR A;  3IMA B;  3V92 A;  3GSP A;  1GOV A;  4J5K A;  2C11 A;  1KWI A;  3I55 3;  1BRS A;  2BO9 B;  3ER7 A;  1A2P A;  1Q9E A;  2UGI A;  4IPB A;  4K1U A;  1Q7Y 4;  3FLJ A;  7GSP A;  5IG5 A;  3X41 A;  1LVN A;  4HAA A;  2OTL 3;  1FW7 A;  3CC2 3;  1MGW A;  2CFD A;  3S67 A;  3KN4 A;  3WOE B;  5JPP A;  1OHO A;  1SPU A;  4DKI A;  1YIJ 3;  1TFO A;  1I2G A;  2CHC A;  4O02 B;  3D79 A;  3X3Z A;  3CCV 3;  4GHO A;  1X1W A;  1S72 3;  2YFI B;  1RGL A;  2CH9 A;  2CWT A;  2O3O A;  5AIH A;  1UDI I;  1BRK A;  2K3D A;  3EN8 A;  1BVI A;  4HM7 B;  3HOH A;  3NQY A;  1DMN A;  3A76 A;  4BTW A;  1B2Z A;  2V1L A;  3A5E A;  2ZDJ A;  4FCM A;  1SJW A;  2RSX A;  4H61 A;  1CEW I;  5AYR B;  2KCD A;  1E97 A;  2SBL A;  3GZB A;  3SVA A;  2HML B;  1OGX A;  1BNF A;  3HIG A;  5JPU A;  4BTY A;  4MEI A;  3X42 A;  5EQL A;  4K61 A;  3EF8 A;  1OHP A;  1EA2 A;  1Q42 A;  2P0M A;  1UGI A;  2P0X A;  2AAD A;  1ZO2 A;  4PEJ A;  4RBN A;  4CPK A;  3CPO A;  1BGS A;  3HI7 A;  5IG4 A;  3J7Y d;  4LMI A;  3F14 A;  1D6Z A;  2D1W A;  3UJM A;  1NB5 I;  3U1W A;  8RNT A;  1WQL B;  1LQG C;  2UX0 A;  3HII A;  2CFK A;  1W6Y A;  3PCS A;  1OF5 B;  4K90 B;  1C54 A;  1FGR A;  1GOU A;  1GMP A;  1ZGX A;  3BNB A;  4GSP A;  4KT3 B;  3IPT A;  2BU4 A;  5HOH A;  1JKG B;  1M1X B;  5BU4 A;  1U8C B;  5BIR A;  9RNT A;  2Z7A A;  4O3V A;  1JZO A;  1OGZ A;  1RGA A;  3DM8 A;  3WR2 A;  7RNT A;  1BSD A;  4MMY B;  2W04 A;  1FGM A;  5KP4 A;  1WMN A;  5HGR A;  2D42 A;  2F5M A;  4MMZ B;  5STD A;  2BMO B;  3F8H A;  3GZY B;  4HM0 B;  5LC6 A;  1TFK A;  5IF6 A;  3AGO A;  1V57 A;  1W2B 2;  2RCD A;  1BRJ A;  1BRI A;  1IV7 A;  2BMQ B;  3CCJ 3;  1BNI A;  2IUK A;  4BL3 A;  1YJ9 3;  1RN1 A;  2H0G A;  2K54 A;  2E2T A;  1DMQ A;  3GZR A;  4FCZ A;  3CU3 A;  3M8C A;  3K7C A;  3G16 A;  1BSA A;  4STD A;  4N6M A;  1SQW A;  3D5G A;  5DRV A;  1ROA A;  1OCV A;  3LZA A;  2F86 B;  3FCS B;  2XFT A;  1IT8 A;  3DZL A;  1YVS A;  1US1 A;  3GWR A;  4LGQ A;  2L1S A;  3AHS A;  1JNQ A;  4N6N B;  1B27 A;  1WMP A;  2XSH B;  3D9R A;  4RNY A;  4AKZ A;  4J8T A;  3WA2 X;  4R80 A;  4RZM A;  2HMJ B;  4RNT A;  2WGO A;  1RLS A;  3DGL A;  5CF1 A;  2STD A;  3O8Y A;  4FMC A;  4KVH A;  1YGE A;  4CJN A;  2R41 A;  3SOA A;  3LTA A;  2ML5 A;  2I9W A;  3ALA A;  3Q1C A;  3PZW A;  3JUO A;  1BNE A;  3K5T A;  1D6Y A;  1KSI A;  1Y4K A;  3L0R A;  1KD1 4;  5KP1 A;  1RCL A;  4HBR A;  1I0X A;  1J2B A;  1TRQ A;  1HKX A;  1UUW B;  1C7H A;  4NRE A;  1ULJ B;  1FUW A;  2W03 A;  4JF8 A;  1F8N A;  4O2H A;  1N5H A;  4EYC A;  1VQ4 3;  4EC6 A;  1LNH A;  1VQ6 3;  1PU4 A;  1RNT A;  4X2O A;  1I8V A;  3CME 3;  2CKF B;  4L8O A;  2CFG A;  2Z76 A;  1LQM B;  2FNQ A;  4I5Q A;  1GY6 A;  3MPH A;  2OQE A;  2LQV A;  3DUK A;  1I3F A;  4IIA A;  1DYU A;  4XBT A;  2CW9 A;  2MF7 A;  1B3S A;  1A67 A;  1W02 A;  4QWT A;  1VQN 3;  3X40 A;  3NBJ A;  4I4K A;  5I97 A;  4ORL A;  1FA3 A;  4N6O B;  1K8A 4;  4HKV B;  5AIF A;  2A15 A;  3UB1 A;  4BTX A;  1UGH I;  3EBT A;  1NWW A;  3HX8 A;  3VGN A;  4HM2 B;  4LSO A;  3G6E 3;  2CWU A;  1LNI A;  3X3X A;  4HM4 B;  2HOH A;  4JRF A;  4OVM A;  5CK6 A;  4EW5 A;  3KCH A;  3NM7 A;  3OXA A;  3SED A;  1NU3 A;  3T8U A;  2KF4 A;  4RNZ A;  2KRT A;  4R9K A;  3EE1 A;  5AI1 A;  1GD4 A;  1RN7 A;  2PNC A;  1UI8 A;  4XBX A;  5ELJ A;  2F98 A;  3KE7 A;  1BU4 A;  4KFE A;  1RDS A;  1IVV A;  1OF5 A;  2Y73 A;  3B8L A;  5CLK A;  1VQL 3;  2CFW A;  3WOD G;  3MG2 A;  1W6C A;  4MJD A;  1JKG A;  1IV9 A;  2CG0 A;  1UCI A;  1B21 A;  4H3U A;  1AV4 A;  1SIH A; 
#chains in the Genus database with same CATH homology
 1O7H B;  1YJN 3;  1AR0 A;  2W6J H;  3QK9 A;  3NV0 A;  4TX4 A;  3G8Z A;  1STF I;  2HMN B;  1VQ7 3;  3CCS 3;  4XB5 A;  2OTJ 3;  3JUM A;  1TP6 A;  3LOY A;  3JUP A;  2W56 B;  3LH4 A;  1NB3 I;  3DGO A;  4WWU C;  1GY5 A;  1Q40 B;  3MYT A;  3G71 3;  1Z1S A;  1VQK 3;  5IEN A;  1MNL A;  4N6U A;  1OH0 A;  1IQX A;  3BB9 A;  2QIY A;  2XSO B;  2WGQ A;  3T8N A;  3LT9 A;  3AMO B;  1N8Q A;  5IG0 A;  1JN5 A;  4GB5 A;  2ML6 A;  3X3Y A;  1UI7 A;  1CYV A;  2XR8 B;  3S28 A;  1OAC A;  4EV5 A;  3PGB A;  1K73 4;  2HMO B;  3UL5 A;  2XF3 A;  5A0O B;  3G4S 3;  3K9M C;  3QRD A;  1AVK A;  3TDG A;  1DMM A;  3KZT A;  1VQP 3;  3NHX A;  1TU5 A;  4XDV A;  3NUV A;  5G2G A;  3CMA 3;  3FGY A;  4N3V A;  5IG3 A;  2CG1 A;  1DVC A;  3EX9 A;  3F9S A;  4WYK B;  3F7S A;  1N9J A;  3KSE D;  3WMD A;  4NHF A;  1A90 A;  4WHA A;  4XM4 A;  1N9E A;  2W0Q A;  3GAX A;  4K1V A;  3LYG A;  1S5A A;  3VSY A;  1JB2 A;  3UL6 A;  1IDP A;  3F8X A;  3MHE A;  3NQZ A;  6STD A;  1GY7 A;  2MC8 A;  3GZX B;  5D82 A;  1M90 4;  2W9P A;  3LXU X;  5AEW B;  4MMX B;  3HK4 A;  4OK0 A;  2OCT A;  2QGU A;  4LEH A;  2BMR B;  3BNC A;  3EC9 A;  1GYB A;  2OWP A;  4GL6 A;  4WFO A;  2GBX B;  3SXX A;  1TUH A;  1VQ9 3;  3CCR 3;  4HZB B;  1ISK A;  4U13 A;  1K41 A;  3KKG A;  2L4V A;  1JV2 B;  1N5P A;  3CD6 3;  1E3V A;  4FMD A;  3V98 A;  3N9H A;  5EEO A;  2INX A;  2LYX A;  3H3H A;  3S27 A;  1RKY A;  3GRD A;  3PCR A;  4KFF A;  4XBY A;  2CIU A;  1VQ8 3;  3UNL A;  1M9G A;  2OQE C;  1ZX2 A;  4X2H A;  1JB5 A;  4FMB A;  3DMC A;  5TGN A;  1O7M B;  3EN1 B;  2P38 A;  7STD A;  1W4N A;  2E2V A;  3N54 B;  1QJG A;  4HYZ A;  3WOF B;  1VQM 3;  4LZI A;  2P09 A;  3PYJ A;  4Q53 A;  1YIT 3;  2CFL A;  3JUN A;  3BNE A;  1WNH A;  1IVU A;  1HU9 A;  3NX0 A;  1UUV B;  3NBB A;  3OW2 2;  1V74 A;  1IVX A;  2Z77 A;  2W56 A;  1QVF 2;  1QMA A;  2F99 A;  3CCL 3;  1Q40 A;  1W7C A;  1QVG 2;  2KXG A;  1ROV A;  1IK3 A;  1N8R 4;  4EXR A;  1CYU A;  4EBG A;  4HM8 B;  3S29 A;  1EKM A;  5FGO A;  3WDG B;  3CC4 3;  1STD A;  4HM5 B;  2FXT A;  5D83 A;  1K28 A;  3CCU 3;  3AMO A;  2BNG A;  3NXJ A;  3G0K A;  2XRX B;  5LC7 A;  5D81 A;  4L8P A;  2CWV A;  4IT7 A;  3KSP A;  4HZ9 B;  1E3R A;  5BXQ A;  5CF2 A;  4N6T A;  2O9U X;  4L7K A;  1EQK A;  2B24 B;  4XDW A;  1IQY A;  3EHC A;  3SLU A;  2OOV C;  1MOL A;  5IEP A;  2W2C A;  1G96 A;  3Q2P A;  4N6L A;  1YJW 3;  3D3L A;  3T0U A;  2QA4 3;  3CNX A;  1QAL A;  4G1M B;  2GU3 A;  3V99 A;  4WYK A;  3OWS A;  2OOV A;  1U5O A;  5AEU B;  3F40 A;  4R1K A;  1L5G B;  1LOX A;  1FGQ A;  1CQS A;  2GEY A;  1FGO A;  3WA3 A;  3JUQ A;  1UW1 A;  3OV4 A;  3B4P A;  3CNM A;  3MSO A;  1KQS 2;  1WMO A;  2XEP A;  3DY5 A;  5EVH A;  1O7G B;  3LTB A;  1A2K A;  4N6V 0;  5AII A;  1SII A;  1M1K 4;  2B1X B;  5FW5 A;  1W6G A;  3RGR A;  1JJ2 2;  4HJL B;  2GBW B;  5KP3 A;  3BLZ A;  2CC3 A;  1O7P B;  2XH9 A;  1W5Z A;  3RGA A;  1OUN A;  3PS8 A;  4ZM8 A;  5IEO A;  2JQ5 A;  2Q07 A;  1R4C A;  3B4O A;  3MG3 A;  1W01 A;  5JBS A;  2E2U A;  1OHS A;  1BUQ A;  4HM3 B;  2GEX A;  3NBR A;  3CXC 2;  2PZV A;  1EG9 B;  2RGQ A;  2IUJ A;  1JB4 A;  1RJO A;  2K0M A;  1YVB I;  2IA7 A;  4O8S A;  3I56 3;  1GS3 A;  2XGN A;  3DXO A;  3FG1 A;  4CDL A;  4KZ1 A;  1PFP A;  3MG1 A;  3BND A;  4FCJ A;  1IU7 A;  1IQ8 A;  2Y74 A;  3F7X A;  1QAF A;  4AKY A;  2W9Q A;  1D6U A;  1NDO B;  2FGT A;  3FZW A;  3KFQ C;  3EQQ B;  4AEQ A;  1TIJ A;  3ECF A;  3FH1 A;  1Q86 4;  3H51 A;  2IMJ A;  3SOY A;  3LTC A;  3NV0 B;  3VF1 A;  3LTD A;  2JDI H;  2BT3 A;  3FF0 A;  1K9M 4;  3LML A;  2ZL8 A;  2GXF A;  1AVL A;  3K63 A;  3FSD A;  3EB8 A;  3OWU A;  3N8B A;  3U97 A;  3ROB A;  3CCE 3;  3FF2 A;  3I0Y A;  2XFS A;  3KII A;  1VZZ A;  1KC8 4;  2YFL B;  1IVW A;  1T5Y A;  1YI2 3;  3RDE A;  1RRH A;  1W2Z A;  2QEX 3;  1O7W B;  3Q90 A;  1JN5 B;  1VQ5 3;  2M7O A;  1O7N B;  4KFD A;  3CC7 3;  3DGN A;  4FMA A;  1GD3 A;  4HM1 B;  2BHM A;  2WO0 A;  1NJI 4;  1LXE A;  5IER A;  3JVC A;  3CPW 2;  3CCM 3;  3IJE B;  2WOF A;  3FKA A;  1RRL A;  2Z6B A;  1Q82 4;  2HMM B;  1VQO 3;  5AYS C;  3DGM A;  3OWY A;  1NO3 A;  1YHQ 3;  2GU1 A;  4R4K A;  4EV2 A;  2YFJ B;  3EBY A;  3FG3 A;  4HVN A;  4WP5 A;  2CK3 H;  2WOH A;  5CXO A;  2YX9 A;  4J9A A;  4R9L A;  3HZP A;  8CHO A;  2R4I A;  5DRE A;  4OUQ A;  4FR9 A;  2XGL A;  1OPY A;  3STD A;  3E99 A;  3CCQ 3;  3SX1 A;  3MWZ A;  1A2V A;  3K0Z A;  5AIG A;  3LT8 A;  3EJV A;  1ASK A;  1WTH A;  1IT7 A;  3NM2 A;  2C10 A;  1DVD A;  3MKI A;  3B7C A;  3OX9 A;  5BVB A;  5IW9 A;  1W00 A;  2HMK B;  5ELU A;  2P05 A;  3FG4 A;  1Q81 4;  1JRQ A;  1ULI B;  3PXM A;  1QAK A;  4HM6 B;  3S5C A;  1FGT A;  4CCV A;  2RFR A;  3IMA B;  3V92 A;  2C11 A;  1KWI A;  3I55 3;  2BO9 B;  3ER7 A;  4IPB A;  4K1U A;  1Q7Y 4;  3FLJ A;  5IG5 A;  3X41 A;  1LVN A;  2OTL 3;  3CC2 3;  2CFD A;  3S67 A;  3KN4 A;  3WOE B;  5JPP A;  1OHO A;  1SPU A;  1YIJ 3;  1TFO A;  2CHC A;  4O02 B;  3X3Z A;  3CCV 3;  1S72 3;  2YFI B;  2CH9 A;  2CWT A;  2O3O A;  5AIH A;  3EN8 A;  4HM7 B;  3NQY A;  1DMN A;  3A76 A;  4BTW A;  2V1L A;  2ZDJ A;  4FCM A;  1SJW A;  2RSX A;  4H61 A;  1CEW I;  5AYR B;  2KCD A;  1E97 A;  2SBL A;  3GZB A;  3SVA A;  2HML B;  1OGX A;  3HIG A;  5JPU A;  4BTY A;  4MEI A;  3X42 A;  5EQL A;  4K61 A;  3EF8 A;  1OHP A;  1EA2 A;  1Q42 A;  2P0M A;  2P0X A;  4PEJ A;  1ZO2 A;  4RBN A;  5IG4 A;  3CPO A;  3HI7 A;  3J7Y d;  4LMI A;  3F14 A;  1D6Z A;  2D1W A;  3UJM A;  1NB5 I;  3U1W A;  1WQL B;  2UX0 A;  3HII A;  2CFK A;  1W6Y A;  3PCS A;  1OF5 B;  4K90 B;  1FGR A;  3BNB A;  3IPT A;  1JKG B;  1M1X B;  1U8C B;  2Z7A A;  4O3V A;  1OGZ A;  3DM8 A;  5KP4 A;  4MMY B;  2W04 A;  1FGM A;  1WMN A;  5HGR A;  2D42 A;  4MMZ B;  5STD A;  2BMO B;  3F8H A;  3GZY B;  4HM0 B;  5LC6 A;  1TFK A;  5IF6 A;  1W2B 2;  2RCD A;  1IV7 A;  2BMQ B;  3CCJ 3;  2IUK A;  1YJ9 3;  2K54 A;  2E2T A;  1DMQ A;  3GZR A;  4FCZ A;  3CU3 A;  3M8C A;  3K7C A;  3G16 A;  4STD A;  4N6M A;  1SQW A;  5DRV A;  1ROA A;  1OCV A;  3LZA A;  2F86 B;  3FCS B;  2XFT A;  1IT8 A;  3DZL A;  3GWR A;  1US1 A;  4LGQ A;  1JNQ A;  4N6N B;  2XSH B;  1WMP A;  3D9R A;  4RNY A;  4AKZ A;  4J8T A;  3WA2 X;  4R80 A;  4RZM A;  2HMJ B;  2WGO A;  3DGL A;  5CF1 A;  2STD A;  3O8Y A;  4FMC A;  4KVH A;  1YGE A;  3SOA A;  3LTA A;  2ML5 A;  2I9W A;  3ALA A;  3Q1C A;  3PZW A;  3JUO A;  3K5T A;  1D6Y A;  1KSI A;  1Y4K A;  3L0R A;  1KD1 4;  5KP1 A;  4HBR A;  1J2B A;  1HKX A;  1UUW B;  1C7H A;  4NRE A;  1ULJ B;  1FUW A;  2W03 A;  4JF8 A;  1F8N A;  4O2H A;  1N5H A;  4EYC A;  1VQ4 3;  4EC6 A;  1LNH A;  1VQ6 3;  1PU4 A;  4X2O A;  3CME 3;  2CKF B;  4L8O A;  2CFG A;  2Z76 A;  2FNQ A;  1GY6 A;  3MPH A;  2OQE A;  2LQV A;  3DUK A;  4IIA A;  1DYU A;  4XBT A;  2CW9 A;  2MF7 A;  1A67 A;  1W02 A;  4QWT A;  1VQN 3;  3X40 A;  3NBJ A;  4I4K A;  5I97 A;  4ORL A;  1FA3 A;  4N6O B;  1K8A 4;  4HKV B;  5AIF A;  2A15 A;  3UB1 A;  4BTX A;  3EBT A;  1NWW A;  3HX8 A;  3VGN A;  4HM2 B;  4LSO A;  3G6E 3;  2CWU A;  3X3X A;  4HM4 B;  4JRF A;  4OVM A;  5CK6 A;  3NM7 A;  3OXA A;  3SED A;  1NU3 A;  3T8U A;  4RNZ A;  2KRT A;  4R9K A;  3EE1 A;  5AI1 A;  1GD4 A;  1RN7 A;  2PNC A;  1UI8 A;  4XBX A;  5ELJ A;  2F98 A;  3KE7 A;  4KFE A;  1VQL 3;  1IVV A;  1OF5 A;  2Y73 A;  3B8L A;  5CLK A;  2CFW A;  3WOD G;  3MG2 A;  1W6C A;  4MJD A;  1JKG A;  1IV9 A;  2CG0 A;  4H3U A;  1AV4 A;  1SIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...