3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LinA
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
source organism Uncultured organism
molecule tags Transferase
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
3B4PA 3CNMA 3I0YA 1JN5A 1K41A 1NU3A 3KZTA 3MYTA 3RGRA 3FLJA 3CNXA 3EQQB 5IG3A 1OGZA 4HM1B 1W00A 4R9KA 3NBRA 5IG5A 2HMKB 1QJGA 5BXQA 5CF2A 3MG2A 3EX9A 2BMRB 2GEXA 5BVBA 2YFJB 1E3RA 3M8CA 3FH1A 4WP5A 1JB4A 3IPTA 3S5CA 3SEDA 4L8OA 3EN8A 3OWSA 1WQLB 3F7XA 3D9RA 3MKIA 1O7GB 3OWUA 5JPUA 3ECFA 1ZO2A 3FF0A 3FZWA 5AIIA 4FCJA 5JPPA 1JB2A 4LEHA 1E3VA 5AIHA 3KE7A 5D82A 2F86B 3LYGA 4MJDA 3H51A 2GBXB 4XDWA 1OCVA 4OUQA 4I4KA 3T8NA 1Q42A 5IERA 1EG9B 7STDA 1Q40A 4HKVB 4ORLA 3VGNA 2HMNB 1QMAA 3F8XA 5IENA 4L7KA 5CLKA 3HK4A 3E99A 1O7PB 4HM6B 3DUKA 5IEPA 3T8UA 1E97A 1GYBA 4Q53A 3VSYA 3JUOA 3F14A 4STDA 1S5AA 1W01A 1GY6A 3NV0B 3HX8A 3KSPA 3FGYA 1HKXA 2YFIB 4HM5B 4GB5A 2HMMB 4K1UA 2RCDA 3OXAA 4FCMA 1O7MB 3HZPA 1VZZA 2I9WA 1OH0A 2GEYA 2W2CA 4XM4A 3KKGA 4HM2B 3FKAA 1GY5A 3EC9A 3MG3A 4R9LA 1UUWB 1CQSA 5FW5A 3ROBA 3OX9A 1Z1SA 2K54A 3GZBA 3SOYA 3NM2A 5IG4A 3F40A 5EVHA 1GS3A 4WYKB 3NXJA 1AR0A 2Z77A 4KVHA 4X2HA 1O7NB 4XDVA 1ULJB 3SOAA 4HM0B 5HGRA 5AIFA 5AIGA 1JKGA 4K1VA 3EBTA 3STDA 5D83A 1JN5B 1C7HA 1OHPA 1O7HB 1TUHA 3B8LA 3CU3A 3F7SA 5STDA 1NWWA 4XB5A 3EF8A 4H3UA 2OWPA 5CK6A 5TGNA 1OF5A 4R1KA 3NHXA 2B24B 5CF1A 2QIYA 3UNLA 3B7CA 3K7CA 4OVMA 1UUVB 2HMLB 4HM7B 4XBTA 3OV4A 1JKGB 1O7WB 1W02A 3FSDA 3GWRA 5G2GA 1SJWA 3NUVA 1U5OA 5AEWB 4L8PA 1ULIB 2UX0A 5CXOA 2RGQA 4U13A 3UJMA 2JQ5A 5KP4A 1Q40B 3EBYA 3FF2A 1A2KA 2GXFA 1OGXA 1OUNA 2QGUA 1DMQA 1ZX2A 2XSOB 5AI1A 3EHCA 3DXOA 2STDA 3WMDA 2RFRA 3CPOA 1JB5A 2CKFB 3Q90A 3EJVA 3K0ZA 3B4OA 5IG0A 4X2OA 2R4IA 5IEOA 2IMJA 1TP6A 3JUPA 5KP3A 3MSOA 1ISKA 4IIAA 3RGAA 4XBYA 2XR8B 3EN1B 2HMOB 4N3VA 2XRXB 2BMOB 4RZMA 4HZBB 1GY7A 4HJLB 8CHOA 5DREA 4LGQA 3F8HA 1IDPA 3GZXB 3JUMA 3DMCA 3NV0A 3A76A 4XBXA 2XSHB 2HMJB 1BUQA 3OWYA 3BB9A 1NDOB 3JUQA 3G16A 3MG1A 6STDA 1STDA 4HM4B 2F98A 5KP1A 5AEUB 5DRVA 3DZLA 4CDLA 3GZRA 4PEJA 2INXA 2CHCA 2Z76A 3GZYB 1EA2A 1ASKA 4J8TA 4HZ9B 4HM3B 1W6YA 2GBWB 1OPYA 3LZAA 2BNGA 4LMIA 1DMNA 4HM8B 2A15A 4WWUC 4HVNA 2PZVA 2F99A 2YFLB 3GRDA 1OF5B 2B1XB 1OHOA 4J9AA 3DM8A 3G8ZA 4WYKA 5IF6A 3H3HA 3BLZA 3MHEA 1DMMA 1OHSA 3ER7A 3G0KA 2Z7AA 2BMQB 3JUNA 3F9SA 5D81A
chains in the Genus database with same CATH superfamily
3B4PA 3CNMA 5EQLA 2Y73A 1MGWA 1RMSA 3I0YA 3RDEA 1JN5A 2F5MA 1RGAA 4DKIA 1K41A 1GD3A 1IU7A 1V58A 3V99A 4GHOA 5I97A 2F5WA 1NU3A 2KXGA 3I563 3KZTA 4KFFA 3CD63 1D6UA 3CCV3 1IVUA 3MYTA 3RGRA 3FLJA 3CNXA 3EQQB 5IG3A 1BNEA 1OGZA 1W00A 4HM1B 1NB5I 4R9KA 3NBRA 5IG5A 2HMKB 4HYZA 1FGRA 1QJGA 2J8XB 1VQ53 4EBGA 5BXQA 1X1XA 1RCKA 5CF2A 5IG0A 3MG2A 4G1MB 2CFWA 3EX9A 2BMRB 2ZL8A 2GEXA 5BVBA 1BANA 2XFTA 3D5IA 1M9GA 1B20A 2YFJB 3V92A 1E3RA 3M8CA 3PZWA 3FH1A 4WP5A 1KWIA 1UW1A 1JB4A 3FG3A 4FR9A 4CCVA 2V1LA 2WO0A 1ROVA 2MC8A 3IPTA 3S5CA 1Y4KA 1K9M4 3SEDA 1FA3A 1STFI 2GSPA 4L8OA 3GAXA 3EN8A 1BRGA 3OWSA 3G713 1VQN3 3CCR3 1B2ZA 4RBNA 1RGEA 3X40A 1RCLA 1WQLB 3F7XA 4HOHA 3D9RA 3L0RA 3MKIA 1O7GB 3OWUA 5JPUA 1RN1A 3ECFA 1EKMA 3PS8A 3LMLA 1JBSA 1ZO2A 3FF0A 2XF3A 3FZWA 2F56A 3QK9A 5AIIA 1L5GB 3QRDA 3MPHA 1Q9EA 2KF6A 2XFSA 1A2PA 4FCJA 1WMPA 1LRAA 3WA2X 1ROAA 5JPPA 2CFLA 4FMDA 1W2B2 1Q7Y4 1BSBA 1EUIC 3HIGA 1JB2A 1W5ZA 3CPW2 7GSPA 1KQS2 3O8YA 1SPUA 1TFOA 1GOUA 4LEHA 3HIIA 4O3VA 2H0IA 1IV7A 1E3VA 2E2UA 4IT7A 5AIHA 3KE7A 1BRNL 5D82A 2F86B 3LYGA 4MJDA 3H51A 2GBXB 1N8R4 4XDWA 1OCVA 1N9JA 2XEPA 4OUQA 1W2ZA 2BU4A 1JJ22 1N5PA 3S67A 3LTDA 4I4KA 3LTCA 3T8NA 2E2TA 1Q42A 5IERA 1B2XA 3DH2A 5BIRA 1EG9B 1A67A 1UGHI 1B21A 1Q40A 4HKVB 7STDA 4ORLA 1KC84 2XGNA 2WGOA 1I0VA 3VGNA 2HMNB 5ELJA 1QMAA 1RRLA 1VQK3 3F8XA 1VQL3 1X1YA 5IENA 4N6OB 3CMA3 3AGOA 1AVLA 1UCLA 2O9UX 2RSXA 4L7KA 5CLKA 3HK4A 1RSNA 3E99A 3WOEB 1O7PB 1YNVX 4HM6B 1W4NA 1RN4A 3DUKA 3SYUA 4BTWA 1RGGA 5M1AA 5IEPA 1I8VA 4O02B 2E2VA 3V98A 1HYFA 1E97A 3D3LA 5GSPA 3T8UA 1UI7A 1GYBA 1GMPA 2CG0A 1CH0A 2FNQA 4Q53A 3VSYA 4KT3B 3NQZA 1A90A 1BNSA 1EQKA 2K3DA 3JUOA 5A0OB 3WOFB 2D1WA 1UGIA 2HOHA 4KFDA 4BL2A 1BNRA 1PY3A 1BRJA 3F14A 4STDA 1UI8A 1S5AA 1IV9A 1W01A 3KFQC 3SX1A 1FUSA 1GY6A 3NV0B 3HX8A 3KSPA 3FGYA 2CWUA 1YIJ3 1HKXA 8RNTA 2YFIB 2W04A 4EV5A 2RNTA 1W7CA 1US1A 2CFKA 4QWTA 2OCTA 4HM5B 4WFOA 4BL3A 4GB5A 1I2EA 1MWRA 2HMMB 3D79A 3WDGB 1T2HA 4K1UA 2RCDA 5ELUA 3NBJA 2OOVA 1GOYA 3PCRA 3OXAA 4FCMA 1EEJA 1O7MB 4MMXB 2CH9A 3URPA 3HZPA 1VZZA 2I9WA 1T5YA 1GSPA 1OH0A 2FXTA 2GEYA 1BGSA 2W2CA 4XM4A 3KKGA 2WOHA 1FYSA 2W9PA 1VQM3 4HM2B 2L4VA 1DE3A 2CX0A 4KZ1A 3FKAA 2KCDA 5G1KA 6RNTA 1JZDA 1I3IA 1GY5A 3N9HA 4MMZB 1YI23 3CCQ3 5EEOA 3EC9A 3CCU3 3MG3A 2PNCA 3ZG5A 3Q2PA 3CCL3 2W6JH 4R9LA 2UUGC 1KD14 1JBTA 1VQ83 1J2BA 3DGOA 2IA7A 3LOYA 1UUWB 1CQSA 5AYSC 3UL5A 2P38A 1KSIA 5FW5A 3Q3FA 1QAKA 3ALAA 1Z1SA 3OX9A 3ROBA 1N9EA 3WODG 3CCS3 1I70A 1NO3A 2K54A 3GZBA 1Q864 1IVXA 1GOVA 2IUJA 3SOYA 9RNTA 1M1K4 1BVIA 1B3SA 3NM2A 4GL6A 5IG4A 1NJI4 3F40A 5EVHA 1GS3A 1G96A 2CIUA 3UB1A 2ML5A 1FZUA 2W56B 1UCKA 4OK0A 4WYKB 1AV4A 3D4AA 3NXJA 3G6E3 2QEX3 1AR0A 2Z77A 4KVHA 4X2HA 1O7NB 1N5HA 4XDVA 4BTYA 1X1UA 1YGWA 7RNTA 1I2GA 1K734 1ULJB 3SOAA 4HM0B 3D5GA 5HGRA 2BHMA 1JZOA 5AIFA 3AMOB 2ZHXB 1JRQA 5AIGA 4EW5A 1JKGA 4K1VA 1RDSA 3EBTA 1IVWA 1PFPA 3X41A 5M19A 3STDA 1LOVA 5D83A 2AADA 3KCHA 2OQEA 1JN5B 1V57A 2IY2A 1C7HA 1R4CA 1OHPA 1O7HB 1TUHA 2KF3A 1VQ43 1PU4A 2JDIH 1VQO3 3B8LA 4RNYA 3U1WA 1LQMB 2C11A 3KSED 4BU4A 3CU3A 1I3FA 4AEQA 3F7SA 5STDA 3X42A 1YGEA 2CWVA 2SARA 1NWWA 4N6TA 3IMAB 1I2FA 3JVCA 4EV2A 1NB3I 1FUWA 4NPBA 1G02A 4XB5A 3EF8A 5IW9A 1LXEA 1S723 4H3UA 1BSEA 1BNJA 1LNIA 1T2IA 2OWPA 1UDII 3DGNA 3NM7A 5CK6A 5TGNA 1RNTA 3LT8A 2CC3A 1OF5A 2WGQA 3NHXA 4LZIA 2CK3H 4GSPA 1WMOA 4R1KA 1IK3A 2B24B 2QA43 5CF1A 2QIYA 3NX0A 1BIRA 3AHSA 1B2SA 1GD4A 1MWSA 3UNLA 3N8BA 2Y74A 1RGCA 3B7CA 4N6LA 5BU4A 2MF7A 3K7CA 4CPKA 1MWUA 1W6GA 3BNCA 3LH4A 4NREA 4OVMA 3CXC2 3HOHA 3BNBA 1UUVB 2HMLB 3BNDA 4HM7B 4XBTA 4N6UA 4BIRA 1B2UA 4ILFA 3SLUA 1TIJA 1IQ8A 2K0MA 1FGTA 1JKGB 3OV4A 1O7WB 1W02A 2CW9A 3FSDA 3GWRA 4N6V0 5G2GA 2OTL3 6GSPA 4NHFA 1YJW3 2D42A 2LYXA 4JF8A 1FW7A 3PCSA 3X3YA 1SJWA 4MMYB 1WMNA 3NUVA 2BIRA 3U97A 3CC73 1BSDA 1TRQA 1U5OA 2OQEC 1B27A 4L8PA 5AEWB 1ULIB 2UX0A 1B2MA 1DYUA 3BU4A 5CXOA 1QALA 3FCSB 1RN7A 3PXMA 1RGKA 2RGQA 1VQ93 4U13A 4AKYA 2IUKA 1WTHA 1BOXA 1VQQA 3FG1A 4IPBA 2P0MA 5D81A 2CWTA 3UJMA 4TX4A 1MNLA 1YVSA 3CCJ3 1ZGXA 2JQ5A 3DGLA 1FGMA 5KP4A 1YJ93 1LOYA 1UCIA 1IQYA 1Q40B 2FGTA 2BO9B 3S29A 1IYYA 2XGLA 3EBYA 1R4YA 3N54B 3ZFZA 1T3BA 4FMAA 1SQWA 2C4BA 3PGBA 1FUTA 3FF2A 3J7Yd 4BTXA 1DVCA 1A2KA 1M1XB 1MGRA 1BNIA 1OGXA 1BSCA 1OUNA 1TJDA 2GXFA 2QGUA 1IT8A 4RNZA 4ZM8A 1RGHA 1DMQA 1LOXA 3AHWA 1ZX2A 1ZS7A 1MWTA 1VQ73 2M7OA 1I0XA 4R80A 2XSOB 3SVAA 3CME3 1IQXA 2Q07A 5AI1A 3S27A 1BAOA 4WHAA 3EHCA 4N6NB 1TFKA 5G1LA 1GMRA 1PYLA 2F4YA 3T0UA 3K63A 3HI7A 3DXOA 2STDA 3WMDA 2W03A 4HBRA 2Z6BA 2RFRA 3CCM3 3KN4A 3CPOA 1JB5A 2UGIA 1W6CA 2CKFB 4EXRA 1AQZA 3Q90A 1X1WA 3EJVA 3K0ZA 3B4OA 1BRKA 3DY5A 4HAAA 1BSAA 1OACA 1SARA 3NQYA 1AVKA 2ZDJA 3GSPA 2W9QA 2CG1A 1YHQ3 4X2OA 3SXXA 2P09A 2R4IA 5IEOA 2H0GA 1Q814 5LC6A 3I553 1D6YA 2IMJA 2P0XA 1TP6A 3S28A 3JUPA 5KP3A 1RRHA 4AKZA 3MSOA 3VF1A 1WNHA 4O2HA 3OW22 2OOVC 3DGYA 1ISKA 4IIAA 4FMCA 2R41A 3RGAA 2O3OA 2WOFA 5JBSA 1Q824 4XBYA 3CC43 2AAEA 1TTOA 2XR8B 3EN1B 2HMOB 2C10A 1FGOA 1Q7HA 2YX9A 4N3VA 4FMBA 2XRXB 1YIT3 4EYCA 1HU9A 3Q1CA 3WHOA 2BMOB 3LXUX 4RZMA 2KAAA 2BT3A 1GY7A 4HZBB 2OTJ3 4LYLB 5FGOA 1RTUA 2L1SA 4EC6A 1BRHA 4H61A 4HJLB 8CHOA 1LOWA 5DREA 4LGQA 3CCE3 3UL6A 1RKYA 1D6ZA 2ML6A 3F8HA 1IDPA 3GZXB 1BRIA 3AGNA 3DMCA 1UUGB 3JUMA 3KIIA 1HZ1A 3NV0A 3A76A 2GU1A 1YVBI 2XSHB 1BRSA 2HMJB 4XBXA 3WR2A 3X3XA 3BNEA 1IT7A 3X3ZA 1A2VA 1BUQA 4KFEA 5LC7A 1LQGC 1N8QA 2GU3A 1BNFA 4J5KA 1NNVA 1RLSA 1MOLA 1CYVA 2CFGA 3OWYA 4N6MA 3ZG0A 1BNGA 3BB9A 1NDOB 4I5QA 2W0QA 2SBLA 1IVVA 3JUQA 3G4S3 3G16A 3MG1A 6STDA 1TU5A 1RNBA 1U8CB 1STDA 4HM4B 2F98A 3NBBA 3PYJA 3CC23 1RHLA 1RJOA 3IJEB 5KP1A 5AEUB 5DRVA 1C54A 1BU4A 1GMQA 1YJN3 3DGMA 1QVG2 3DZLA 4CDLA 3GZRA 4PEJA 2P05A 4O8SA 2INXA 3K5TA 5RNTA 1QAFA 2CHCA 1LVNA 2Z76A 3A5EA 1JNQA 3GZYB 4RNTA 1EA2A 4MEIA 1ASKA 3EB8A 1DVDA 2KRTA 1RGLA 1LNHA 3WA3A 1TRPA 4J8TA 4HZ9B 4HM3B 1W6YA 2GBWB 2H0HA 1JBRA 1VQP3 1CYUA 1OPYA 3LZAA 4LSOA 2BNGA 4CJNA 4LMIA 3MWZA 1DMNA 2CFDA 4HM8B 1K28A 2A15A 2KF5A 4WWUC 1F8NA 4HVNA 2PZVA 2XH9A 2F99A 2YFLB 1VQ63 3GRDA 3LT9A 1OF5B 4K61A 5AYRB 5HOHA 2B1XB 1OHOA 1UCJA 1FGQA 1SIIA 4J9AA 3LTBA 3TDGA 2RBIA 3DM8A 3G8ZA 1AY7A 2W56A 2ZA4A 3BIRA 4WYKA 3EE1A 4K90B 1SIHA 3H3HA 4R4KA 5IF6A 3K9MC 3BLZA 1BUJA 3MHEA 1DETA 1RGFA 3FG4A 2LQVA 1DMMA 5M18A 2IYJA 1OHSA 4JRFA 1QVF2 3ER7A 1JV2B 3G0KA 2Z7AA 2BMQB 2KF4A 3JUNA 3LTAA 4J5GA 1G0TA 1M904 2CX1A 1K8A4 3AMOA 3F9SA 4FCZA 1V74A 3RNTA 1CEWI
chains in the Genus database with same CATH topology
3B4PA 3CNMA 5EQLA 2Y73A 3I0YA 3RDEA 1JN5A 1K41A 1GD3A 1IU7A 3V99A 5I97A 1NU3A 2KXGA 3I563 3KZTA 4KFFA 3CD63 1D6UA 3CCV3 1IVUA 3MYTA 3RGRA 3FLJA 3CNXA 3EQQB 5IG3A 1OGZA 4HM1B 1W00A 1NB5I 4R9KA 3NBRA 5IG5A 2HMKB 4HYZA 1FGRA 1QJGA 1VQ53 4EBGA 5BXQA 5CF2A 3MG2A 4G1MB 2CFWA 3EX9A 2BMRB 2ZL8A 2GEXA 5BVBA 2XFTA 1M9GA 2YFJB 3V92A 1E3RA 3M8CA 3PZWA 3FH1A 4WP5A 1KWIA 1UW1A 1JB4A 3FG3A 4FR9A 4CCVA 2V1LA 2WO0A 1ROVA 2MC8A 3IPTA 3S5CA 1Y4KA 1K9M4 3SEDA 1FA3A 1STFI 4L8OA 3GAXA 3EN8A 3OWSA 1VQN3 3G713 3CCR3 4RBNA 3X40A 1WQLB 3F7XA 3D9RA 3L0RA 3MKIA 1O7GB 3OWUA 5JPUA 3ECFA 1EKMA 3PS8A 3LMLA 1ZO2A 3FF0A 2XF3A 3FZWA 3QK9A 5AIIA 1L5GB 3QRDA 3MPHA 2XFSA 4FCJA 1WMPA 3WA2X 1ROAA 5JPPA 2CFLA 4FMDA 1W2B2 1Q7Y4 3HIGA 1JB2A 1W5ZA 3CPW2 1KQS2 3O8YA 1SPUA 1TFOA 4LEHA 3HIIA 4O3VA 4IT7A 1IV7A 1E3VA 2E2UA 5AIHA 3KE7A 5D82A 2F86B 3LYGA 4MJDA 3H51A 2GBXB 1N8R4 4XDWA 1OCVA 1N9JA 2XEPA 4OUQA 1W2ZA 1JJ22 1N5PA 3S67A 3LTDA 4I4KA 3LTCA 3T8NA 2E2TA 1Q42A 5IERA 1EG9B 1A67A 7STDA 1Q40A 4HKVB 4ORLA 1KC84 2XGNA 2WGOA 3VGNA 2HMNB 5ELJA 1QMAA 1RRLA 1VQK3 3F8XA 1VQL3 5IENA 4N6OB 3CMA3 1AVLA 2O9UX 2RSXA 4L7KA 5CLKA 3HK4A 3E99A 3WOEB 1O7PB 4HM6B 1W4NA 4BTWA 3DUKA 5IEPA 4O02B 2E2VA 1E97A 3D3LA 3T8UA 1UI7A 1GYBA 4Q53A 2CG0A 2FNQA 3VSYA 1A90A 3NQZA 1EQKA 3JUOA 5A0OB 3WOFB 2D1WA 4KFDA 3F14A 4STDA 1UI8A 1S5AA 1IV9A 1W01A 3KFQC 3SX1A 1GY6A 3NV0B 3HX8A 3KSPA 3FGYA 2CWUA 1YIJ3 1HKXA 2YFIB 2W04A 4EV5A 4QWTA 1W7CA 1US1A 2CFKA 2OCTA 4HM5B 4WFOA 4GB5A 2HMMB 3WDGB 4K1UA 2RCDA 5ELUA 3NBJA 2OOVA 3PCRA 3OXAA 4FCMA 1O7MB 4MMXB 2CH9A 3HZPA 1VZZA 2I9WA 1T5YA 1OH0A 2FXTA 2GEYA 2W2CA 4XM4A 3KKGA 2WOHA 2W9PA 1VQM3 4HM2B 2L4VA 4KZ1A 3FKAA 2KCDA 1GY5A 3N9HA 4MMZB 1YI23 3CCQ3 5EEOA 3EC9A 3CCU3 3MG3A 2PNCA 3Q2PA 3CCL3 2W6JH 4R9LA 1KD14 1VQ83 1J2BA 3DGOA 2IA7A 3LOYA 1UUWB 1CQSA 5AYSC 3UL5A 2P38A 1KSIA 5FW5A 3ROBA 1QAKA 3ALAA 1Z1SA 3OX9A 3WODG 1N9EA 3CCS3 1NO3A 2K54A 3GZBA 1Q864 1IVXA 2IUJA 3SOYA 1M1K4 3NM2A 1NJI4 4GL6A 5IG4A 3F40A 5EVHA 1GS3A 1G96A 2CIUA 3UB1A 2ML5A 2W56B 4OK0A 4WYKB 1AV4A 3NXJA 3G6E3 2QEX3 1AR0A 2Z77A 4KVHA 4X2HA 1O7NB 1N5HA 4XDVA 4BTYA 1K734 1ULJB 3SOAA 4HM0B 5HGRA 2BHMA 5AIFA 3AMOB 1JRQA 5AIGA 1JKGA 4K1VA 3EBTA 1IVWA 1PFPA 3X41A 3STDA 5D83A 2OQEA 1JN5B 1C7HA 1R4CA 1OHPA 1O7HB 1TUHA 1VQ43 1PU4A 2JDIH 1VQO3 3B8LA 4RNYA 3U1WA 2C11A 3KSED 3CU3A 4AEQA 3F7SA 5STDA 3X42A 1YGEA 2CWVA 1NWWA 4N6TA 3IMAB 3JVCA 4EV2A 1NB3I 1FUWA 4XB5A 3EF8A 5IW9A 1LXEA 1S723 4H3UA 3DGNA 2OWPA 3NM7A 5CK6A 5TGNA 3LT8A 2CC3A 1OF5A 2WGQA 3NHXA 4LZIA 2CK3H 4R1KA 1WMOA 1IK3A 2B24B 2QA43 5CF1A 2QIYA 3NX0A 1GD4A 3UNLA 3N8BA 2Y74A 3B7CA 4N6LA 2MF7A 3K7CA 1W6GA 3BNCA 3LH4A 4NREA 4OVMA 3CXC2 3BNBA 1UUVB 2HMLB 3BNDA 4HM7B 4XBTA 4N6UA 3SLUA 1TIJA 1IQ8A 2K0MA 1FGTA 1JKGB 3OV4A 1O7WB 1W02A 2CW9A 3FSDA 3GWRA 4N6V0 5G2GA 2OTL3 4NHFA 1YJW3 2D42A 2LYXA 4JF8A 3PCSA 3X3YA 1SJWA 4MMYB 1WMNA 3NUVA 3U97A 3CC73 1U5OA 2OQEC 5AEWB 4L8PA 1ULIB 2UX0A 1DYUA 5CXOA 1QALA 3FCSB 1RN7A 3PXMA 2RGQA 1VQ93 4U13A 4AKYA 2IUKA 1WTHA 3FG1A 4IPBA 2P0MA 5D81A 2CWTA 3UJMA 4TX4A 1MNLA 3CCJ3 2JQ5A 3DGLA 1FGMA 5KP4A 1YJ93 1IQYA 1Q40B 2FGTA 2BO9B 3S29A 2XGLA 3EBYA 3N54B 4FMAA 1SQWA 3PGBA 3FF2A 3J7Yd 4BTXA 1DVCA 1A2KA 1M1XB 2GXFA 1OGXA 1OUNA 4RNZA 2QGUA 1IT8A 4ZM8A 1DMQA 1LOXA 1ZX2A 1VQ73 2M7OA 4R80A 3SVAA 2XSOB 3CME3 1IQXA 2Q07A 5AI1A 3S27A 4WHAA 3EHCA 4N6NB 1TFKA 3T0UA 3K63A 3HI7A 3DXOA 2STDA 3WMDA 2W03A 4HBRA 2Z6BA 2RFRA 3CCM3 3KN4A 3CPOA 1JB5A 1W6CA 2CKFB 4EXRA 3Q90A 3EJVA 3K0ZA 3B4OA 3DY5A 5IG0A 3V98A 1OACA 3NQYA 2CG1A 1AVKA 2ZDJA 1YHQ3 2W9QA 4X2OA 3SXXA 2P09A 2R4IA 5IEOA 1Q814 5LC6A 3I553 1D6YA 2P0XA 2IMJA 1TP6A 3S28A 3JUPA 5KP3A 1RRHA 4AKZA 3MSOA 3VF1A 1WNHA 4O2HA 3OW22 2OOVC 1ISKA 4IIAA 4FMCA 3RGAA 2O3OA 2WOFA 5JBSA 1Q824 4XBYA 3CC43 2XR8B 3EN1B 2HMOB 2C10A 1FGOA 2YX9A 4N3VA 4FMBA 2XRXB 1YIT3 4EYCA 1HU9A 3Q1CA 2BMOB 3LXUX 4RZMA 2OTJ3 2BT3A 1GY7A 4HZBB 5FGOA 4EC6A 4H61A 4HJLB 8CHOA 5DREA 4LGQA 3CCE3 3UL6A 1RKYA 1D6ZA 2ML6A 3F8HA 1IDPA 3GZXB 3JUMA 3DMCA 3KIIA 3NV0A 3A76A 2GU1A 1YVBI 2XSHB 2HMJB 4XBXA 3X3XA 3BNEA 1IT7A 3X3ZA 1A2VA 1BUQA 4KFEA 5LC7A 2GU3A 1N8QA 1MOLA 1CYVA 2CFGA 3OWYA 4N6MA 3BB9A 1NDOB 2W0QA 2SBLA 1IVVA 3JUQA 3G4S3 3G16A 3MG1A 6STDA 1TU5A 1U8CB 1STDA 4HM4B 2F98A 3NBBA 3PYJA 3CC23 1RJOA 3IJEB 5KP1A 5AEUB 5DRVA 1YJN3 3DGMA 1QVG2 3DZLA 4CDLA 3GZRA 4PEJA 2P05A 4O8SA 2INXA 3K5TA 1QAFA 2CHCA 1LVNA 2Z76A 1JNQA 3GZYB 1EA2A 4MEIA 1ASKA 3EB8A 1DVDA 2KRTA 1LNHA 3WA3A 4J8TA 4HZ9B 4HM3B 1W6YA 2GBWB 1VQP3 1CYUA 1OPYA 3LZAA 4LSOA 2BNGA 4LMIA 3MWZA 1DMNA 2CFDA 4HM8B 1K28A 2A15A 4WWUC 1F8NA 4HVNA 2PZVA 2XH9A 2F99A 2YFLB 1VQ63 3GRDA 3LT9A 1OF5B 4K61A 5AYRB 2B1XB 1OHOA 1FGQA 1SIIA 4J9AA 3LTBA 3TDGA 3DM8A 3G8ZA 2W56A 4WYKA 3EE1A 4K90B 1SIHA 3H3HA 4R4KA 5IF6A 3K9MC 3BLZA 3MHEA 3FG4A 2LQVA 1DMMA 1OHSA 4JRFA 1QVF2 3ER7A 1JV2B 3G0KA 2Z7AA 2BMQB 3JUNA 3LTAA 1M904 1K8A4 3AMOA 3F9SA 4FCZA 1V74A 1CEWI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B4P A;  3CNM A;  3I0Y A;  1JN5 A;  1K41 A;  1NU3 A;  3KZT A;  3MYT A;  3RGR A;  3FLJ A;  3CNX A;  3EQQ B;  5IG3 A;  1OGZ A;  4HM1 B;  1W00 A;  4R9K A;  3NBR A;  5IG5 A;  2HMK B;  1QJG A;  5BXQ A;  5CF2 A;  3MG2 A;  3EX9 A;  2BMR B;  2GEX A;  5BVB A;  2YFJ B;  1E3R A;  3M8C A;  3FH1 A;  4WP5 A;  1JB4 A;  3IPT A;  3S5C A;  3SED A;  4L8O A;  3EN8 A;  3OWS A;  1WQL B;  3F7X A;  3D9R A;  3MKI A;  1O7G B;  3OWU A;  5JPU A;  3ECF A;  1ZO2 A;  3FF0 A;  3FZW A;  5AII A;  4FCJ A;  5JPP A;  1JB2 A;  4LEH A;  1E3V A;  5AIH A;  3KE7 A;  5D82 A;  2F86 B;  3LYG A;  4MJD A;  3H51 A;  2GBX B;  4XDW A;  1OCV A;  4OUQ A;  4I4K A;  3T8N A;  1Q42 A;  5IER A;  1EG9 B;  7STD A;  1Q40 A;  4HKV B;  4ORL A;  3VGN A;  2HMN B;  1QMA A;  3F8X A;  5IEN A;  4L7K A;  5CLK A;  3HK4 A;  3E99 A;  1O7P B;  4HM6 B;  3DUK A;  5IEP A;  3T8U A;  1E97 A;  1GYB A;  4Q53 A;  3VSY A;  3JUO A;  3F14 A;  4STD A;  1S5A A;  1W01 A;  1GY6 A;  3NV0 B;  3HX8 A;  3KSP A;  3FGY A;  1HKX A;  2YFI B;  4HM5 B;  4GB5 A;  2HMM B;  4K1U A;  2RCD A;  3OXA A;  4FCM A;  1O7M B;  3HZP A;  1VZZ A;  2I9W A;  1OH0 A;  2GEY A;  2W2C A;  4XM4 A;  3KKG A;  4HM2 B;  3FKA A;  1GY5 A;  3EC9 A;  3MG3 A;  4R9L A;  1UUW B;  1CQS A;  5FW5 A;  3ROB A;  3OX9 A;  1Z1S A;  2K54 A;  3GZB A;  3SOY A;  3NM2 A;  5IG4 A;  3F40 A;  5EVH A;  1GS3 A;  4WYK B;  3NXJ A;  1AR0 A;  2Z77 A;  4KVH A;  4X2H A;  1O7N B;  4XDV A;  1ULJ B;  3SOA A;  4HM0 B;  5HGR A;  5AIF A;  5AIG A;  1JKG A;  4K1V A;  3EBT A;  3STD A;  5D83 A;  1JN5 B;  1C7H A;  1OHP A;  1O7H B;  1TUH A;  3B8L A;  3CU3 A;  3F7S A;  5STD A;  1NWW A;  4XB5 A;  3EF8 A;  4H3U A;  2OWP A;  5CK6 A;  5TGN A;  1OF5 A;  4R1K A;  3NHX A;  2B24 B;  5CF1 A;  2QIY A;  3UNL A;  3B7C A;  3K7C A;  4OVM A;  1UUV B;  2HML B;  4HM7 B;  4XBT A;  3OV4 A;  1JKG B;  1O7W B;  1W02 A;  3FSD A;  3GWR A;  5G2G A;  1SJW A;  3NUV A;  1U5O A;  5AEW B;  4L8P A;  1ULI B;  2UX0 A;  5CXO A;  2RGQ A;  4U13 A;  3UJM A;  2JQ5 A;  5KP4 A;  1Q40 B;  3EBY A;  3FF2 A;  1A2K A;  2GXF A;  1OGX A;  1OUN A;  2QGU A;  1DMQ A;  1ZX2 A;  2XSO B;  5AI1 A;  3EHC A;  3DXO A;  2STD A;  3WMD A;  2RFR A;  3CPO A;  1JB5 A;  2CKF B;  3Q90 A;  3EJV A;  3K0Z A;  3B4O A;  5IG0 A;  4X2O A;  2R4I A;  5IEO A;  2IMJ A;  1TP6 A;  3JUP A;  5KP3 A;  3MSO A;  1ISK A;  4IIA A;  3RGA A;  4XBY A;  2XR8 B;  3EN1 B;  2HMO B;  4N3V A;  2XRX B;  2BMO B;  4RZM A;  4HZB B;  1GY7 A;  4HJL B;  8CHO A;  5DRE A;  4LGQ A;  3F8H A;  1IDP A;  3GZX B;  3JUM A;  3DMC A;  3NV0 A;  3A76 A;  4XBX A;  2XSH B;  2HMJ B;  1BUQ A;  3OWY A;  3BB9 A;  1NDO B;  3JUQ A;  3G16 A;  3MG1 A;  6STD A;  1STD A;  4HM4 B;  2F98 A;  5KP1 A;  5AEU B;  5DRV A;  3DZL A;  4CDL A;  3GZR A;  4PEJ A;  2INX A;  2CHC A;  2Z76 A;  3GZY B;  1EA2 A;  1ASK A;  4J8T A;  4HZ9 B;  4HM3 B;  1W6Y A;  2GBW B;  1OPY A;  3LZA A;  2BNG A;  4LMI A;  1DMN A;  4HM8 B;  2A15 A;  4WWU C;  4HVN A;  2PZV A;  2F99 A;  2YFL B;  3GRD A;  1OF5 B;  2B1X B;  1OHO A;  4J9A A;  3DM8 A;  3G8Z A;  4WYK A;  5IF6 A;  3H3H A;  3BLZ A;  3MHE A;  1DMM A;  1OHS A;  3ER7 A;  3G0K A;  2Z7A A;  2BMQ B;  3JUN A;  3F9S A;  5D81 A; 
#chains in the Genus database with same CATH topology
 3B4P A;  3CNM A;  5EQL A;  2Y73 A;  1MGW A;  1RMS A;  3I0Y A;  3RDE A;  1JN5 A;  2F5M A;  1RGA A;  4DKI A;  1K41 A;  1GD3 A;  1IU7 A;  1V58 A;  3V99 A;  4GHO A;  5I97 A;  2F5W A;  1NU3 A;  2KXG A;  3I56 3;  3KZT A;  4KFF A;  3CD6 3;  1D6U A;  3CCV 3;  1IVU A;  3MYT A;  3RGR A;  3FLJ A;  3CNX A;  3EQQ B;  5IG3 A;  1BNE A;  1OGZ A;  1W00 A;  4HM1 B;  1NB5 I;  4R9K A;  3NBR A;  5IG5 A;  2HMK B;  4HYZ A;  1FGR A;  1QJG A;  2J8X B;  1VQ5 3;  4EBG A;  5BXQ A;  1X1X A;  1RCK A;  5CF2 A;  5IG0 A;  3MG2 A;  4G1M B;  2CFW A;  3EX9 A;  2BMR B;  2ZL8 A;  2GEX A;  5BVB A;  1BAN A;  2XFT A;  3D5I A;  1M9G A;  1B20 A;  2YFJ B;  3V92 A;  1E3R A;  3M8C A;  3PZW A;  3FH1 A;  4WP5 A;  1KWI A;  1UW1 A;  1JB4 A;  3FG3 A;  4FR9 A;  4CCV A;  2V1L A;  2WO0 A;  1ROV A;  2MC8 A;  3IPT A;  3S5C A;  1Y4K A;  1K9M 4;  3SED A;  1FA3 A;  1STF I;  2GSP A;  4L8O A;  3GAX A;  3EN8 A;  1BRG A;  3OWS A;  3G71 3;  1VQN 3;  3CCR 3;  1B2Z A;  4RBN A;  1RGE A;  3X40 A;  1RCL A;  1WQL B;  3F7X A;  4HOH A;  3D9R A;  3L0R A;  3MKI A;  1O7G B;  3OWU A;  5JPU A;  1RN1 A;  3ECF A;  1EKM A;  3PS8 A;  3LML A;  1JBS A;  1ZO2 A;  3FF0 A;  2XF3 A;  3FZW A;  2F56 A;  3QK9 A;  5AII A;  1L5G B;  3QRD A;  3MPH A;  1Q9E A;  2KF6 A;  2XFS A;  1A2P A;  4FCJ A;  1WMP A;  1LRA A;  3WA2 X;  1ROA A;  5JPP A;  2CFL A;  4FMD A;  1W2B 2;  1Q7Y 4;  1BSB A;  1EUI C;  3HIG A;  1JB2 A;  1W5Z A;  3CPW 2;  7GSP A;  1KQS 2;  3O8Y A;  1SPU A;  1TFO A;  1GOU A;  4LEH A;  3HII A;  4O3V A;  2H0I A;  1IV7 A;  1E3V A;  2E2U A;  4IT7 A;  5AIH A;  3KE7 A;  1BRN L;  5D82 A;  2F86 B;  3LYG A;  4MJD A;  3H51 A;  2GBX B;  1N8R 4;  4XDW A;  1OCV A;  1N9J A;  2XEP A;  4OUQ A;  1W2Z A;  2BU4 A;  1JJ2 2;  1N5P A;  3S67 A;  3LTD A;  4I4K A;  3LTC A;  3T8N A;  2E2T A;  1Q42 A;  5IER A;  1B2X A;  3DH2 A;  5BIR A;  1EG9 B;  1A67 A;  1UGH I;  1B21 A;  1Q40 A;  4HKV B;  7STD A;  4ORL A;  1KC8 4;  2XGN A;  2WGO A;  1I0V A;  3VGN A;  2HMN B;  5ELJ A;  1QMA A;  1RRL A;  1VQK 3;  3F8X A;  1VQL 3;  1X1Y A;  5IEN A;  4N6O B;  3CMA 3;  3AGO A;  1AVL A;  1UCL A;  2O9U X;  2RSX A;  4L7K A;  5CLK A;  3HK4 A;  1RSN A;  3E99 A;  3WOE B;  1O7P B;  1YNV X;  4HM6 B;  1W4N A;  1RN4 A;  3DUK A;  3SYU A;  4BTW A;  1RGG A;  5M1A A;  5IEP A;  1I8V A;  4O02 B;  2E2V A;  3V98 A;  1HYF A;  1E97 A;  3D3L A;  5GSP A;  3T8U A;  1UI7 A;  1GYB A;  1GMP A;  2CG0 A;  1CH0 A;  2FNQ A;  4Q53 A;  3VSY A;  4KT3 B;  3NQZ A;  1A90 A;  1BNS A;  1EQK A;  2K3D A;  3JUO A;  5A0O B;  3WOF B;  2D1W A;  1UGI A;  2HOH A;  4KFD A;  4BL2 A;  1BNR A;  1PY3 A;  1BRJ A;  3F14 A;  4STD A;  1UI8 A;  1S5A A;  1IV9 A;  1W01 A;  3KFQ C;  3SX1 A;  1FUS A;  1GY6 A;  3NV0 B;  3HX8 A;  3KSP A;  3FGY A;  2CWU A;  1YIJ 3;  1HKX A;  8RNT A;  2YFI B;  2W04 A;  4EV5 A;  2RNT A;  1W7C A;  1US1 A;  2CFK A;  4QWT A;  2OCT A;  4HM5 B;  4WFO A;  4BL3 A;  4GB5 A;  1I2E A;  1MWR A;  2HMM B;  3D79 A;  3WDG B;  1T2H A;  4K1U A;  2RCD A;  5ELU A;  3NBJ A;  2OOV A;  1GOY A;  3PCR A;  3OXA A;  4FCM A;  1EEJ A;  1O7M B;  4MMX B;  2CH9 A;  3URP A;  3HZP A;  1VZZ A;  2I9W A;  1T5Y A;  1GSP A;  1OH0 A;  2FXT A;  2GEY A;  1BGS A;  2W2C A;  4XM4 A;  3KKG A;  2WOH A;  1FYS A;  2W9P A;  1VQM 3;  4HM2 B;  2L4V A;  1DE3 A;  2CX0 A;  4KZ1 A;  3FKA A;  2KCD A;  5G1K A;  6RNT A;  1JZD A;  1I3I A;  1GY5 A;  3N9H A;  4MMZ B;  1YI2 3;  3CCQ 3;  5EEO A;  3EC9 A;  3CCU 3;  3MG3 A;  2PNC A;  3ZG5 A;  3Q2P A;  3CCL 3;  2W6J H;  4R9L A;  2UUG C;  1KD1 4;  1JBT A;  1VQ8 3;  1J2B A;  3DGO A;  2IA7 A;  3LOY A;  1UUW B;  1CQS A;  5AYS C;  3UL5 A;  2P38 A;  1KSI A;  5FW5 A;  3Q3F A;  1QAK A;  3ALA A;  1Z1S A;  3OX9 A;  3ROB A;  1N9E A;  3WOD G;  3CCS 3;  1I70 A;  1NO3 A;  2K54 A;  3GZB A;  1Q86 4;  1IVX A;  1GOV A;  2IUJ A;  3SOY A;  9RNT A;  1M1K 4;  1BVI A;  1B3S A;  3NM2 A;  4GL6 A;  5IG4 A;  1NJI 4;  3F40 A;  5EVH A;  1GS3 A;  1G96 A;  2CIU A;  3UB1 A;  2ML5 A;  1FZU A;  2W56 B;  1UCK A;  4OK0 A;  4WYK B;  1AV4 A;  3D4A A;  3NXJ A;  3G6E 3;  2QEX 3;  1AR0 A;  2Z77 A;  4KVH A;  4X2H A;  1O7N B;  1N5H A;  4XDV A;  4BTY A;  1X1U A;  1YGW A;  7RNT A;  1I2G A;  1K73 4;  1ULJ B;  3SOA A;  4HM0 B;  3D5G A;  5HGR A;  2BHM A;  1JZO A;  5AIF A;  3AMO B;  2ZHX B;  1JRQ A;  5AIG A;  4EW5 A;  1JKG A;  4K1V A;  1RDS A;  3EBT A;  1IVW A;  1PFP A;  3X41 A;  5M19 A;  3STD A;  1LOV A;  5D83 A;  2AAD A;  3KCH A;  2OQE A;  1JN5 B;  1V57 A;  2IY2 A;  1C7H A;  1R4C A;  1OHP A;  1O7H B;  1TUH A;  2KF3 A;  1VQ4 3;  1PU4 A;  2JDI H;  1VQO 3;  3B8L A;  4RNY A;  3U1W A;  1LQM B;  2C11 A;  3KSE D;  4BU4 A;  3CU3 A;  1I3F A;  4AEQ A;  3F7S A;  5STD A;  3X42 A;  1YGE A;  2CWV A;  2SAR A;  1NWW A;  4N6T A;  3IMA B;  1I2F A;  3JVC A;  4EV2 A;  1NB3 I;  1FUW A;  4NPB A;  1G02 A;  4XB5 A;  3EF8 A;  5IW9 A;  1LXE A;  1S72 3;  4H3U A;  1BSE A;  1BNJ A;  1LNI A;  1T2I A;  2OWP A;  1UDI I;  3DGN A;  3NM7 A;  5CK6 A;  5TGN A;  1RNT A;  3LT8 A;  2CC3 A;  1OF5 A;  2WGQ A;  3NHX A;  4LZI A;  2CK3 H;  4GSP A;  1WMO A;  4R1K A;  1IK3 A;  2B24 B;  2QA4 3;  5CF1 A;  2QIY A;  3NX0 A;  1BIR A;  3AHS A;  1B2S A;  1GD4 A;  1MWS A;  3UNL A;  3N8B A;  2Y74 A;  1RGC A;  3B7C A;  4N6L A;  5BU4 A;  2MF7 A;  3K7C A;  4CPK A;  1MWU A;  1W6G A;  3BNC A;  3LH4 A;  4NRE A;  4OVM A;  3CXC 2;  3HOH A;  3BNB A;  1UUV B;  2HML B;  3BND A;  4HM7 B;  4XBT A;  4N6U A;  4BIR A;  1B2U A;  4ILF A;  3SLU A;  1TIJ A;  1IQ8 A;  2K0M A;  1FGT A;  1JKG B;  3OV4 A;  1O7W B;  1W02 A;  2CW9 A;  3FSD A;  3GWR A;  4N6V 0;  5G2G A;  2OTL 3;  6GSP A;  4NHF A;  1YJW 3;  2D42 A;  2LYX A;  4JF8 A;  1FW7 A;  3PCS A;  3X3Y A;  1SJW A;  4MMY B;  1WMN A;  3NUV A;  2BIR A;  3U97 A;  3CC7 3;  1BSD A;  1TRQ A;  1U5O A;  2OQE C;  1B27 A;  4L8P A;  5AEW B;  1ULI B;  2UX0 A;  1B2M A;  1DYU A;  3BU4 A;  5CXO A;  1QAL A;  3FCS B;  1RN7 A;  3PXM A;  1RGK A;  2RGQ A;  1VQ9 3;  4U13 A;  4AKY A;  2IUK A;  1WTH A;  1BOX A;  1VQQ A;  3FG1 A;  4IPB A;  2P0M A;  5D81 A;  2CWT A;  3UJM A;  4TX4 A;  1MNL A;  1YVS A;  3CCJ 3;  1ZGX A;  2JQ5 A;  3DGL A;  1FGM A;  5KP4 A;  1YJ9 3;  1LOY A;  1UCI A;  1IQY A;  1Q40 B;  2FGT A;  2BO9 B;  3S29 A;  1IYY A;  2XGL A;  3EBY A;  1R4Y A;  3N54 B;  3ZFZ A;  1T3B A;  4FMA A;  1SQW A;  2C4B A;  3PGB A;  1FUT A;  3FF2 A;  3J7Y d;  4BTX A;  1DVC A;  1A2K A;  1M1X B;  1MGR A;  1BNI A;  1OGX A;  1BSC A;  1OUN A;  1TJD A;  2GXF A;  2QGU A;  1IT8 A;  4RNZ A;  4ZM8 A;  1RGH A;  1DMQ A;  1LOX A;  3AHW A;  1ZX2 A;  1ZS7 A;  1MWT A;  1VQ7 3;  2M7O A;  1I0X A;  4R80 A;  2XSO B;  3SVA A;  3CME 3;  1IQX A;  2Q07 A;  5AI1 A;  3S27 A;  1BAO A;  4WHA A;  3EHC A;  4N6N B;  1TFK A;  5G1L A;  1GMR A;  1PYL A;  2F4Y A;  3T0U A;  3K63 A;  3HI7 A;  3DXO A;  2STD A;  3WMD A;  2W03 A;  4HBR A;  2Z6B A;  2RFR A;  3CCM 3;  3KN4 A;  3CPO A;  1JB5 A;  2UGI A;  1W6C A;  2CKF B;  4EXR A;  1AQZ A;  3Q90 A;  1X1W A;  3EJV A;  3K0Z A;  3B4O A;  1BRK A;  3DY5 A;  4HAA A;  1BSA A;  1OAC A;  1SAR A;  3NQY A;  1AVK A;  2ZDJ A;  3GSP A;  2W9Q A;  2CG1 A;  1YHQ 3;  4X2O A;  3SXX A;  2P09 A;  2R4I A;  5IEO A;  2H0G A;  1Q81 4;  5LC6 A;  3I55 3;  1D6Y A;  2IMJ A;  2P0X A;  1TP6 A;  3S28 A;  3JUP A;  5KP3 A;  1RRH A;  4AKZ A;  3MSO A;  3VF1 A;  1WNH A;  4O2H A;  3OW2 2;  2OOV C;  3DGY A;  1ISK A;  4IIA A;  4FMC A;  2R41 A;  3RGA A;  2O3O A;  2WOF A;  5JBS A;  1Q82 4;  4XBY A;  3CC4 3;  2AAE A;  1TTO A;  2XR8 B;  3EN1 B;  2HMO B;  2C10 A;  1FGO A;  1Q7H A;  2YX9 A;  4N3V A;  4FMB A;  2XRX B;  1YIT 3;  4EYC A;  1HU9 A;  3Q1C A;  3WHO A;  2BMO B;  3LXU X;  4RZM A;  2KAA A;  2BT3 A;  1GY7 A;  4HZB B;  2OTJ 3;  4LYL B;  5FGO A;  1RTU A;  2L1S A;  4EC6 A;  1BRH A;  4H61 A;  4HJL B;  8CHO A;  1LOW A;  5DRE A;  4LGQ A;  3CCE 3;  3UL6 A;  1RKY A;  1D6Z A;  2ML6 A;  3F8H A;  1IDP A;  3GZX B;  1BRI A;  3AGN A;  3DMC A;  1UUG B;  3JUM A;  3KII A;  1HZ1 A;  3NV0 A;  3A76 A;  2GU1 A;  1YVB I;  2XSH B;  1BRS A;  2HMJ B;  4XBX A;  3WR2 A;  3X3X A;  3BNE A;  1IT7 A;  3X3Z A;  1A2V A;  1BUQ A;  4KFE A;  5LC7 A;  1LQG C;  1N8Q A;  2GU3 A;  1BNF A;  4J5K A;  1NNV A;  1RLS A;  1MOL A;  1CYV A;  2CFG A;  3OWY A;  4N6M A;  3ZG0 A;  1BNG A;  3BB9 A;  1NDO B;  4I5Q A;  2W0Q A;  2SBL A;  1IVV A;  3JUQ A;  3G4S 3;  3G16 A;  3MG1 A;  6STD A;  1TU5 A;  1RNB A;  1U8C B;  1STD A;  4HM4 B;  2F98 A;  3NBB A;  3PYJ A;  3CC2 3;  1RHL A;  1RJO A;  3IJE B;  5KP1 A;  5AEU B;  5DRV A;  1C54 A;  1BU4 A;  1GMQ A;  1YJN 3;  3DGM A;  1QVG 2;  3DZL A;  4CDL A;  3GZR A;  4PEJ A;  2P05 A;  4O8S A;  2INX A;  3K5T A;  5RNT A;  1QAF A;  2CHC A;  1LVN A;  2Z76 A;  3A5E A;  1JNQ A;  3GZY B;  4RNT A;  1EA2 A;  4MEI A;  1ASK A;  3EB8 A;  1DVD A;  2KRT A;  1RGL A;  1LNH A;  3WA3 A;  1TRP A;  4J8T A;  4HZ9 B;  4HM3 B;  1W6Y A;  2GBW B;  2H0H A;  1JBR A;  1VQP 3;  1CYU A;  1OPY A;  3LZA A;  4LSO A;  2BNG A;  4CJN A;  4LMI A;  3MWZ A;  1DMN A;  2CFD A;  4HM8 B;  1K28 A;  2A15 A;  2KF5 A;  4WWU C;  1F8N A;  4HVN A;  2PZV A;  2XH9 A;  2F99 A;  2YFL B;  1VQ6 3;  3GRD A;  3LT9 A;  1OF5 B;  4K61 A;  5AYR B;  5HOH A;  2B1X B;  1OHO A;  1UCJ A;  1FGQ A;  1SII A;  4J9A A;  3LTB A;  3TDG A;  2RBI A;  3DM8 A;  3G8Z A;  1AY7 A;  2W56 A;  2ZA4 A;  3BIR A;  4WYK A;  3EE1 A;  4K90 B;  1SIH A;  3H3H A;  4R4K A;  5IF6 A;  3K9M C;  3BLZ A;  1BUJ A;  3MHE A;  1DET A;  1RGF A;  3FG4 A;  2LQV A;  1DMM A;  5M18 A;  2IYJ A;  1OHS A;  4JRF A;  1QVF 2;  3ER7 A;  1JV2 B;  3G0K A;  2Z7A A;  2BMQ B;  2KF4 A;  3JUN A;  3LTA A;  4J5G A;  1G0T A;  1M90 4;  2CX1 A;  1K8A 4;  3AMO A;  3F9S A;  4FCZ A;  1V74 A;  3RNT A;  1CEW I; 
#chains in the Genus database with same CATH homology
 3B4P A;  3CNM A;  5EQL A;  2Y73 A;  3I0Y A;  3RDE A;  1JN5 A;  1K41 A;  1GD3 A;  1IU7 A;  3V99 A;  5I97 A;  1NU3 A;  2KXG A;  3I56 3;  3KZT A;  4KFF A;  3CD6 3;  1D6U A;  3CCV 3;  1IVU A;  3MYT A;  3RGR A;  3FLJ A;  3CNX A;  3EQQ B;  5IG3 A;  1OGZ A;  4HM1 B;  1W00 A;  1NB5 I;  4R9K A;  3NBR A;  5IG5 A;  2HMK B;  4HYZ A;  1FGR A;  1QJG A;  1VQ5 3;  4EBG A;  5BXQ A;  5CF2 A;  3MG2 A;  4G1M B;  2CFW A;  3EX9 A;  2BMR B;  2ZL8 A;  2GEX A;  5BVB A;  2XFT A;  1M9G A;  2YFJ B;  3V92 A;  1E3R A;  3M8C A;  3PZW A;  3FH1 A;  4WP5 A;  1KWI A;  1UW1 A;  1JB4 A;  3FG3 A;  4FR9 A;  4CCV A;  2V1L A;  2WO0 A;  1ROV A;  2MC8 A;  3IPT A;  3S5C A;  1Y4K A;  1K9M 4;  3SED A;  1FA3 A;  1STF I;  4L8O A;  3GAX A;  3EN8 A;  3OWS A;  1VQN 3;  3G71 3;  3CCR 3;  4RBN A;  3X40 A;  1WQL B;  3F7X A;  3D9R A;  3L0R A;  3MKI A;  1O7G B;  3OWU A;  5JPU A;  3ECF A;  1EKM A;  3PS8 A;  3LML A;  1ZO2 A;  3FF0 A;  2XF3 A;  3FZW A;  3QK9 A;  5AII A;  1L5G B;  3QRD A;  3MPH A;  2XFS A;  4FCJ A;  1WMP A;  3WA2 X;  1ROA A;  5JPP A;  2CFL A;  4FMD A;  1W2B 2;  1Q7Y 4;  3HIG A;  1JB2 A;  1W5Z A;  3CPW 2;  1KQS 2;  3O8Y A;  1SPU A;  1TFO A;  4LEH A;  3HII A;  4O3V A;  4IT7 A;  1IV7 A;  1E3V A;  2E2U A;  5AIH A;  3KE7 A;  5D82 A;  2F86 B;  3LYG A;  4MJD A;  3H51 A;  2GBX B;  1N8R 4;  4XDW A;  1OCV A;  1N9J A;  2XEP A;  4OUQ A;  1W2Z A;  1JJ2 2;  1N5P A;  3S67 A;  3LTD A;  4I4K A;  3LTC A;  3T8N A;  2E2T A;  1Q42 A;  5IER A;  1EG9 B;  1A67 A;  7STD A;  1Q40 A;  4HKV B;  4ORL A;  1KC8 4;  2XGN A;  2WGO A;  3VGN A;  2HMN B;  5ELJ A;  1QMA A;  1RRL A;  1VQK 3;  3F8X A;  1VQL 3;  5IEN A;  4N6O B;  3CMA 3;  1AVL A;  2O9U X;  2RSX A;  4L7K A;  5CLK A;  3HK4 A;  3E99 A;  3WOE B;  1O7P B;  4HM6 B;  1W4N A;  4BTW A;  3DUK A;  5IEP A;  4O02 B;  2E2V A;  1E97 A;  3D3L A;  3T8U A;  1UI7 A;  1GYB A;  4Q53 A;  2CG0 A;  2FNQ A;  3VSY A;  1A90 A;  3NQZ A;  1EQK A;  3JUO A;  5A0O B;  3WOF B;  2D1W A;  4KFD A;  3F14 A;  4STD A;  1UI8 A;  1S5A A;  1IV9 A;  1W01 A;  3KFQ C;  3SX1 A;  1GY6 A;  3NV0 B;  3HX8 A;  3KSP A;  3FGY A;  2CWU A;  1YIJ 3;  1HKX A;  2YFI B;  2W04 A;  4EV5 A;  4QWT A;  1W7C A;  1US1 A;  2CFK A;  2OCT A;  4HM5 B;  4WFO A;  4GB5 A;  2HMM B;  3WDG B;  4K1U A;  2RCD A;  5ELU A;  3NBJ A;  2OOV A;  3PCR A;  3OXA A;  4FCM A;  1O7M B;  4MMX B;  2CH9 A;  3HZP A;  1VZZ A;  2I9W A;  1T5Y A;  1OH0 A;  2FXT A;  2GEY A;  2W2C A;  4XM4 A;  3KKG A;  2WOH A;  2W9P A;  1VQM 3;  4HM2 B;  2L4V A;  4KZ1 A;  3FKA A;  2KCD A;  1GY5 A;  3N9H A;  4MMZ B;  1YI2 3;  3CCQ 3;  5EEO A;  3EC9 A;  3CCU 3;  3MG3 A;  2PNC A;  3Q2P A;  3CCL 3;  2W6J H;  4R9L A;  1KD1 4;  1VQ8 3;  1J2B A;  3DGO A;  2IA7 A;  3LOY A;  1UUW B;  1CQS A;  5AYS C;  3UL5 A;  2P38 A;  1KSI A;  5FW5 A;  3ROB A;  1QAK A;  3ALA A;  1Z1S A;  3OX9 A;  3WOD G;  1N9E A;  3CCS 3;  1NO3 A;  2K54 A;  3GZB A;  1Q86 4;  1IVX A;  2IUJ A;  3SOY A;  1M1K 4;  3NM2 A;  1NJI 4;  4GL6 A;  5IG4 A;  3F40 A;  5EVH A;  1GS3 A;  1G96 A;  2CIU A;  3UB1 A;  2ML5 A;  2W56 B;  4OK0 A;  4WYK B;  1AV4 A;  3NXJ A;  3G6E 3;  2QEX 3;  1AR0 A;  2Z77 A;  4KVH A;  4X2H A;  1O7N B;  1N5H A;  4XDV A;  4BTY A;  1K73 4;  1ULJ B;  3SOA A;  4HM0 B;  5HGR A;  2BHM A;  5AIF A;  3AMO B;  1JRQ A;  5AIG A;  1JKG A;  4K1V A;  3EBT A;  1IVW A;  1PFP A;  3X41 A;  3STD A;  5D83 A;  2OQE A;  1JN5 B;  1C7H A;  1R4C A;  1OHP A;  1O7H B;  1TUH A;  1VQ4 3;  1PU4 A;  2JDI H;  1VQO 3;  3B8L A;  4RNY A;  3U1W A;  2C11 A;  3KSE D;  3CU3 A;  4AEQ A;  3F7S A;  5STD A;  3X42 A;  1YGE A;  2CWV A;  1NWW A;  4N6T A;  3IMA B;  3JVC A;  4EV2 A;  1NB3 I;  1FUW A;  4XB5 A;  3EF8 A;  5IW9 A;  1LXE A;  1S72 3;  4H3U A;  3DGN A;  2OWP A;  3NM7 A;  5CK6 A;  5TGN A;  3LT8 A;  2CC3 A;  1OF5 A;  2WGQ A;  3NHX A;  4LZI A;  2CK3 H;  4R1K A;  1WMO A;  1IK3 A;  2B24 B;  2QA4 3;  5CF1 A;  2QIY A;  3NX0 A;  1GD4 A;  3UNL A;  3N8B A;  2Y74 A;  3B7C A;  4N6L A;  2MF7 A;  3K7C A;  1W6G A;  3BNC A;  3LH4 A;  4NRE A;  4OVM A;  3CXC 2;  3BNB A;  1UUV B;  2HML B;  3BND A;  4HM7 B;  4XBT A;  4N6U A;  3SLU A;  1TIJ A;  1IQ8 A;  2K0M A;  1FGT A;  1JKG B;  3OV4 A;  1O7W B;  1W02 A;  2CW9 A;  3FSD A;  3GWR A;  4N6V 0;  5G2G A;  2OTL 3;  4NHF A;  1YJW 3;  2D42 A;  2LYX A;  4JF8 A;  3PCS A;  3X3Y A;  1SJW A;  4MMY B;  1WMN A;  3NUV A;  3U97 A;  3CC7 3;  1U5O A;  2OQE C;  5AEW B;  4L8P A;  1ULI B;  2UX0 A;  1DYU A;  5CXO A;  1QAL A;  3FCS B;  1RN7 A;  3PXM A;  2RGQ A;  1VQ9 3;  4U13 A;  4AKY A;  2IUK A;  1WTH A;  3FG1 A;  4IPB A;  2P0M A;  5D81 A;  2CWT A;  3UJM A;  4TX4 A;  1MNL A;  3CCJ 3;  2JQ5 A;  3DGL A;  1FGM A;  5KP4 A;  1YJ9 3;  1IQY A;  1Q40 B;  2FGT A;  2BO9 B;  3S29 A;  2XGL A;  3EBY A;  3N54 B;  4FMA A;  1SQW A;  3PGB A;  3FF2 A;  3J7Y d;  4BTX A;  1DVC A;  1A2K A;  1M1X B;  2GXF A;  1OGX A;  1OUN A;  4RNZ A;  2QGU A;  1IT8 A;  4ZM8 A;  1DMQ A;  1LOX A;  1ZX2 A;  1VQ7 3;  2M7O A;  4R80 A;  3SVA A;  2XSO B;  3CME 3;  1IQX A;  2Q07 A;  5AI1 A;  3S27 A;  4WHA A;  3EHC A;  4N6N B;  1TFK A;  3T0U A;  3K63 A;  3HI7 A;  3DXO A;  2STD A;  3WMD A;  2W03 A;  4HBR A;  2Z6B A;  2RFR A;  3CCM 3;  3KN4 A;  3CPO A;  1JB5 A;  1W6C A;  2CKF B;  4EXR A;  3Q90 A;  3EJV A;  3K0Z A;  3B4O A;  3DY5 A;  5IG0 A;  3V98 A;  1OAC A;  3NQY A;  2CG1 A;  1AVK A;  2ZDJ A;  1YHQ 3;  2W9Q A;  4X2O A;  3SXX A;  2P09 A;  2R4I A;  5IEO A;  1Q81 4;  5LC6 A;  3I55 3;  1D6Y A;  2P0X A;  2IMJ A;  1TP6 A;  3S28 A;  3JUP A;  5KP3 A;  1RRH A;  4AKZ A;  3MSO A;  3VF1 A;  1WNH A;  4O2H A;  3OW2 2;  2OOV C;  1ISK A;  4IIA A;  4FMC A;  3RGA A;  2O3O A;  2WOF A;  5JBS A;  1Q82 4;  4XBY A;  3CC4 3;  2XR8 B;  3EN1 B;  2HMO B;  2C10 A;  1FGO A;  2YX9 A;  4N3V A;  4FMB A;  2XRX B;  1YIT 3;  4EYC A;  1HU9 A;  3Q1C A;  2BMO B;  3LXU X;  4RZM A;  2OTJ 3;  2BT3 A;  1GY7 A;  4HZB B;  5FGO A;  4EC6 A;  4H61 A;  4HJL B;  8CHO A;  5DRE A;  4LGQ A;  3CCE 3;  3UL6 A;  1RKY A;  1D6Z A;  2ML6 A;  3F8H A;  1IDP A;  3GZX B;  3JUM A;  3DMC A;  3KII A;  3NV0 A;  3A76 A;  2GU1 A;  1YVB I;  2XSH B;  2HMJ B;  4XBX A;  3X3X A;  3BNE A;  1IT7 A;  3X3Z A;  1A2V A;  1BUQ A;  4KFE A;  5LC7 A;  2GU3 A;  1N8Q A;  1MOL A;  1CYV A;  2CFG A;  3OWY A;  4N6M A;  3BB9 A;  1NDO B;  2W0Q A;  2SBL A;  1IVV A;  3JUQ A;  3G4S 3;  3G16 A;  3MG1 A;  6STD A;  1TU5 A;  1U8C B;  1STD A;  4HM4 B;  2F98 A;  3NBB A;  3PYJ A;  3CC2 3;  1RJO A;  3IJE B;  5KP1 A;  5AEU B;  5DRV A;  1YJN 3;  3DGM A;  1QVG 2;  3DZL A;  4CDL A;  3GZR A;  4PEJ A;  2P05 A;  4O8S A;  2INX A;  3K5T A;  1QAF A;  2CHC A;  1LVN A;  2Z76 A;  1JNQ A;  3GZY B;  1EA2 A;  4MEI A;  1ASK A;  3EB8 A;  1DVD A;  2KRT A;  1LNH A;  3WA3 A;  4J8T A;  4HZ9 B;  4HM3 B;  1W6Y A;  2GBW B;  1VQP 3;  1CYU A;  1OPY A;  3LZA A;  4LSO A;  2BNG A;  4LMI A;  3MWZ A;  1DMN A;  2CFD A;  4HM8 B;  1K28 A;  2A15 A;  4WWU C;  1F8N A;  4HVN A;  2PZV A;  2XH9 A;  2F99 A;  2YFL B;  1VQ6 3;  3GRD A;  3LT9 A;  1OF5 B;  4K61 A;  5AYR B;  2B1X B;  1OHO A;  1FGQ A;  1SII A;  4J9A A;  3LTB A;  3TDG A;  3DM8 A;  3G8Z A;  2W56 A;  4WYK A;  3EE1 A;  4K90 B;  1SIH A;  3H3H A;  4R4K A;  5IF6 A;  3K9M C;  3BLZ A;  3MHE A;  3FG4 A;  2LQV A;  1DMM A;  1OHS A;  4JRF A;  1QVF 2;  3ER7 A;  1JV2 B;  3G0K A;  2Z7A A;  2BMQ B;  3JUN A;  3LTA A;  1M90 4;  1K8A 4;  3AMO A;  3F9S A;  4FCZ A;  1V74 A;  1CEW I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...