3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
source organism Uncultured organism
molecule tags Transferase
molecule keywords LinA
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
3DXOA 3EHCA 3EBYA 1O7PB 3D9RA 5JPPA 1DMQA 5IG3A 3NHXA 4XM4A 3NV0A 3FZWA 2A15A 3SOAA 1SJWA 3MSOA 5AIFA 3FGYA 1JB4A 2CHCA 2HMJB 1JN5B 1OUNA 3FKAA 4WWUC 5BXQA 2BMOB 1WQLB 3H51A 4XB5A 1C7HA 3NXJA 5IF6A 2XRXB 3EJVA 3F8XA 3OWSA 5D83A 8CHOA 4LEHA 3B4PA 3JUNA 3F40A 4XBTA 4HM3B 1NDOB 5AEUB 1GY6A 3NUVA 1CQSA 4HM7B 4X2OA 1BUQA 1GY5A 1ZX2A 1W6YA 1JKGA 2IMJA 3B4OA 2QIYA 3NV0B 5CLKA 1VZZA 4HM1B 3CU3A 1NWWA 4HM0B 3OWYA 1W00A 4WP5A 5AI1A 3FLJA 3MG2A 4WYKB 4HJLB 4OUQA 4L8OA 2XSHB 3GZBA 3NBRA 4HKVB 4J8TA 4L8PA 5DRVA 1EG9B 2RFRA 4FCJA 3RGRA 3MG1A 3FF0A 3MG3A 1OHPA 5EVHA 3HZPA 3JUQA 3MKIA 2HMLB 2BNGA 3VSYA 3LYGA 5AEWB 1Q40B 1STDA 1EA2A 3F8HA 1O7MB 1QJGA 3EN1B 3EQQB 2HMNB 4XDWA 3CNMA 1JB5A 4XDVA 1W02A 4Q53A 4WYKA 5IEOA 4L7KA 1ULIB 3T8NA 2GXFA 4X2HA 3GZXB 4I4KA 1ZO2A 2XR8B 3RGAA 2OWPA 1A2KA 2QGUA 1JKGB 3DZLA 5IENA 3T8UA 3ECFA 2HMMB 5HGRA 3BLZA 4HZBB 3SOYA 5D81A 1OGZA 3G8ZA 4GB5A 3KKGA 3F9SA 1GS3A 3I0YA 3CPOA 1S5AA 4OVMA 3FH1A 2HMKB 1O7GB 1AR0A 2F86B 1O7HB 2BMRB 3HX8A 1JN5A 4FCMA 4HM6B 4K1UA 1OHOA 2PZVA 2STDA 1OHSA 3B7CA 2INXA 3G0KA 3OXAA 4LGQA 2K54A 2YFJB 4XBXA 1TP6A 4HM4B 3VGNA 5KP3A 3WMDA 3FF2A 3NM2A 1E97A 1ISKA 1OF5A 1O7WB 3G16A 3A76A 5AIHA 5IERA 3EN8A 5CK6A 2F99A 3JUMA 1NU3A 3E99A 4H3UA 5IG4A 2YFLB 3GRDA 5IG5A 2RGQA 5STDA 5DREA 1OPYA 3K0ZA 4RZMA 2F98A 4MJDA 5G2GA 3UJMA 1OCVA 1O7NB 1UUVB 3KE7A 4IIAA 1U5OA 3DUKA 4LMIA 2RCDA 3KSPA 1E3RA 1E3VA 3F7XA 1ASKA 5FW5A 2I9WA 3EX9A 4XBYA 5AIIA 6STDA 3DM8A 3EBTA 3Q90A 3S5CA 3ER7A 4R9KA 2XSOB 2GBWB 4K1VA 3MHEA 1ULJB 4N3VA 4HZ9B 2W2CA 3EF8A 3GZRA 2CKFB 3OX9A 5D82A 1IDPA 3GWRA 3HK4A 4R9LA 5IEPA 3STDA 3M8CA 2R4IA 2HMOB 1UUWB 4J9AA 4PEJA 2B24B 1DMMA 3OV4A 1GYBA 2Z76A 3KZTA 5IG0A 2UX0A 2BMQB 5KP1A 2GBXB 1Q40A 3FSDA 5AIGA 1OF5B 3ROBA 5BVBA 5KP4A 2GEYA 2Z77A 2YFIB 7STDA 3DMCA 3JUOA 4U13A 1K41A 4KVHA 1OH0A 1Z1SA 5CF2A 4HM2B 3B8LA 4HVNA 2Z7AA 1OGXA 5TGNA 5CF1A 1W01A 3JUPA 2B1XB 1Q42A 1GY7A 4HM5B 1DMNA 3EC9A 3H3HA 4R1KA 2GEXA 4CDLA 1JB2A 3IPTA 1TUHA 2JQ5A 3BB9A 3SEDA 5JPUA 3GZYB 5CXOA 3LZAA 3MYTA 3OWUA 4ORLA 4STDA 4HM8B 3UNLA 1HKXA 3CNXA 1QMAA 3K7CA 3F14A 3F7SA
chains in the Genus database with same CATH superfamily
2AAEA 2HOHA 1I2EA 9RNTA 4EV5A 1I8VA 4GHOA 3NHXA 3NV0A 1AY7A 1UCKA 5AIFA 3CCM3 4FR9A 6RNTA 3NBBA 2C4BA 5BXQA 1OUNA 1LOWA 1YI23 3SYUA 3H51A 4JF8A 1N9JA 2XRXB 3EJVA 3WDGB 4CPKA 8CHOA 1VQ83 1V58A 1FUWA 2KAAA 1RN1A 3B4PA 3JUNA 4KZ1A 4MMXB 1BSDA 4XBTA 1CYUA 1GY6A 3LTAA 1CQSA 4X2OA 1GY5A 2R41A 3B4OA 3S27A 1DVCA 3DY5A 1NWWA 2IYJA 2KF6A 4WP5A 3MG2A 1TU5A 1RSNA 2WGOA 2K0MA 3GZBA 3NBRA 2D1WA 4HKVB 4L8PA 4BL3A 1GMPA 2ML6A 3DH2A 1YJN3 2CH9A 1RN4A 1YIT3 1JV2B 3JUQA 3EB8A 1GMQA 2Z6BA 1EA2A 1FUSA 3F8HA 3GSPA 3JVCA 6GSPA 2O3OA 4XDWA 1G02A 2WOHA 1X1YA 4XDVA 4Q53A 2UGIA 1JZDA 1UUGB 1JJ22 3LOYA 1YGEA 3CMA3 4MMZB 4I4KA 1ZO2A 3RGAA 2OWPA 2FGTA 4FMBA 1EUIC 2F5WA 1JKGB 4EV2A 2WGQA 1K8A4 3BLZA 1FGMA 3PCSA 4HZBB 3AMOB 1OGZA 1GOYA 2W9PA 4N6NB 4K90B 3TDGA 3UB1A 1KSIA 1GS3A 1T5YA 2CFWA 1IVXA 4RNZA 1S5AA 5EQLA 1Q864 1RDSA 2BMRB 3HOHA 1RGCA 1IQ8A 1TFKA 2OTJ3 1LNHA 2STDA 1OHSA 2ZDJA 1AVLA 1D6YA 3OXAA 3N8BA 2K54A 2F4YA 1QAFA 1BRHA 1TP6A 2OQEA 1ISKA 1O7WB 1M9GA 1VQ73 3G16A 5AIHA 3PS8A 1V74A 2F99A 3E99A 3JUMA 4LYLB 4AEQA 3DGOA 1T3BA 5IG5A 2XGLA 1FGRA 1OPYA 2ZHXB 5G2GA 3UJMA 3U97A 1I3FA 2IUKA 3WHOA 1UGIA 2P38A 1O7NB 1Q7Y4 1KD14 3KE7A 3BNCA 3DUKA 1DVDA 1FA3A 1IT8A 5AYSC 1WTHA 1ASKA 1BRSA 1HYFA 3EX9A 5AIIA 5FW5A 3V98A 2XEPA 1CYVA 3S5CA 1A90A 2MF7A 4R9KA 2D42A 2XSOB 5KP1A 3LTDA 2CWTA 4J5GA 3EF8A 2SARA 3DGNA 3OX9A 1VQK3 3GWRA 2KCDA 2R4IA 2Y73A 3G4S3 3NQYA 1JZOA 1UGHI 3KZTA 4FMDA 2UX0A 4N6V0 4BU4A 1RJOA 4O02B 1Q40A 2CG1A 5KP4A 2GEYA 4RBNA 2M7OA 3S28A 3CD63 1OH0A 3LTCA 1R4YA 3KIIA 4EXRA 4HVNA 2Z7AA 5TGNA 1BUJA 5G1LA 5LC6A 1BRGA 1W01A 3JUPA 2GEXA 4CDLA 3SEDA 2XFTA 1LOXA 3LZAA 4STDA 4CCVA 1Q814 2CK3H 1N8QA 2CFGA 5ELJA 1NJI4 3K7CA 3EBYA 3CCJ3 1O7PB 4K61A 1UDII 1BNSA 2UUGC 1W6GA 3L0RA 1AQZA 1GOVA 1ROVA 1MGRA 4G1MB 2A15A 3PYJA 1SJWA 1BNEA 1I2FA 1Q7HA 2CWVA 2HMJB 4I5QA 2QEX3 4WWUC 3CCV3 2BMOB 3K5TA 1B21A 1QAKA 4AKYA 1OACA 2LYXA 1SARA 3N54B 5AYRB 3I563 3WA2X 1TIJA 1NDOB 2YX9A 5AEUB 1BUQA 2FNQA 3VF1A 1U8CB 2IMJA 2QIYA 1W7CA 1LNIA 1I70A 1IVWA 1B27A 1YGWA 4HM0B 1BAOA 3NM7A 5AI1A 1RNBA 3ZG0A 4LSOA 1N5PA 5HOHA 2XSHB 1LQGC 1IYYA 3RGRA 1UCJA 4ZM8A 1UCIA 3MG1A 3MG3A 3T0UA 5BU4A 4BIRA 1OHPA 1TTOA 5EVHA 1KC84 3HZPA 2BNGA 3S67A 3N9HA 2XH9A 1FYSA 3CPW2 1B2ZA 2HMNB 3CNMA 1W02A 1UW1A 2AADA 2GXFA 1A2VA 1ZGXA 1JBSA 1A2KA 1GSPA 2CX0A 2W04A 3DZLA 1KQS2 4HBRA 4RNYA 1WNHA 4CJNA 3K63A 3SOYA 1DE3A 2BU4A 1T2IA 3F9SA 3SLUA 2E2UA 1FGQA 1TRQA 2HMKB 1AR0A 1JN5A 4FCMA 4HM6B 3B7CA 4LGQA 2XFSA 1VQQA 2BT3A 3HI7A 2YFJB 4GL6A 3X41A 4HM4B 3U1WA 3CC43 1WMPA 2W56B 3NM2A 1PYLA 2PNCA 4TX4A 3CME3 1SIIA 2GU1A 2QA43 2V1LA 1VQN3 1C54A 3EN8A 2F5MA 1AV4A 1GD3A 1K734 5IG4A 3KCHA 5STDA 5DREA 3CCR3 1JBRA 4RZMA 1I2GA 2W9QA 4IT7A 3V92A 2E2VA 3QRDA 4LMIA 2RCDA 1E3RA 2RBIA 1QVG2 4BTXA 3MHEA 4N3VA 1RLSA 3DGLA 2CKFB 1M1K4 4R9LA 1RCLA 2C10A 3STDA 3LMLA 4N6OB 3SVAA 2HMOB 1UUWB 2IA7A 4PEJA 4R4KA 2B24B 1DMMA 1EEJA 1FGOA 5IG0A 1YVBI 3D4AA 3CC73 1Q824 2ZL8A 4OK0A 3FSDA 1UI8A 5AIGA 4FMCA 2Z77A 2FXTA 2H0GA 3B8LA 3LT8A 1OGXA 1RGGA 3RNTA 1D6ZA 1GY7A 1RGKA 4R1KA 3BNDA 2OOVC 5G1KA 3AMOA 3WR2A 4O2HA 1VQL3 4ORLA 1IQYA 1HKXA 4IPBA 1QVF2 1QMAA 1BIRA 2WO0A 3DXOA 3EHCA 1VQ53 3D9RA 4KT3B 3Q3FA 5IG3A 3FG4A 3OW22 3FZWA 2W0QA 4O3VA 3SOAA 3MSOA 3UL5A 3I553 3FGYA 3D3LA 3HIGA 2BO9B 2CHCA 1JN5B 3MPHA 3X3YA 1HU9A 1WQLB 4XB5A 1C7HA 3NXJA 5D83A 1BRJA 1K9M4 1RGFA 1CH0A 1KWIA 3J7Yd 2L4VA 4HM3B 1T2HA 4HM7B 3LTBA 3Q1CA 3NV0B 1Q9EA 1ZX2A 4LZIA 5CLKA 1VZZA 4KFDA 4HM1B 4BTYA 1YVSA 1W5ZA 2KRTA 1IVVA 2W56A 4WYKB 4HJLB 4OUQA 2BIRA 4L8OA 5DRVA 4J8TA 2C11A 1LOYA 3DGYA 1EG9B 2RFRA 4FCJA 3ZG5A 2CFDA 3BNEA 4NREA 1EQKA 3CCS3 2HMLB 3VSYA 1G0TA 1Q40B 1STDA 1LVNA 3EN1B 4N6LA 4HOHA 4L7KA 1ULIB 1MWSA 3T8NA 1NNVA 1DYUA 1PY3A 2XR8B 3GZXB 3NBJA 1US1A 3SXXA 1GD4A 1VQM3 4EBGA 4RNTA 4EC6A 5IENA 3T8UA 3WOFB 2WOFA 2KXGA 3LXUX 5D81A 1RN7A 5FGOA 1R4CA 1RKYA 1LOVA 3A5EA 3KKGA 3CCU3 3IJEB 1J2BA 1DETA 1O7HB 3G713 4K1UA 5IEPA 1OHOA 1CEWI 2PZVA 1B3SA 4KFFA 2INXA 4XBXA 1SQWA 1STFI 1YJW3 3WMDA 4GSPA 1GOUA 1WMOA 5KP3A 4NPBA 1VQ63 1OF5A 2OTL3 1BSBA 5CK6A 2KF3A 3X40A 1NU3A 2CWUA 5M1AA 1VQO3 1BNRA 3GRDA 1LRAA 2RGQA 1RHLA 3CCQ3 3K0ZA 2P0MA 5IW9A 2F98A 4MJDA 3CC23 4AKZA 1BVIA 1MOLA 2ML5A 1W2ZA 1BSEA 2P09A 2OQEC 3LT9A 3NQZA 1UUVB 3K9MC 4IIAA 1RMSA 1QALA 3KSPA 3F7XA 2J8XB 3D5IA 2I9WA 3Q2PA 4FCZA 2CFLA 3DM8A 3EBTA 3ER7A 2GBWB 1ULJB 2CW9A 2W2CA 3GZRA 3PXMA 1IDPA 1LXEA 1NB5I 1VQP3 1FZUA 1GYBA 2Z76A 3AHWA 1BNJA 3FCSB 3D79A 1RNTA 2OOVA 4HAAA 3X42A 2YFIB 1NB3I 3DMCA 2H0IA 3HIIA 4U13A 1K41A 3KSED 1IU7A 4KVHA 1Z1SA 1TFOA 3AGOA 3KFQC 5CF2A 1S723 4R80A 1NO3A 1I0VA 1MWTA 1IV9A 3MWZA 1DMNA 2O9UX 3EC9A 3FG1A 3S29A 1UI7A 3IPTA 1TUHA 1WMNA 2JQ5A 3BB9A 4KFEA 1BNGA 3GZYB 2XGNA 5GSPA 1Y4KA 5EEOA 1RCKA 3V99A 4HM8B 3UNLA 4MEIA 1PU4A 3PZWA 3CNXA 3F7SA 3I0YA 1I0XA 4NHFA 5M18A 2W03A 5RNTA 1DMQA 5JBSA 3EE1A 4XM4A 3CCL3 4QWTA 1VQ93 1BSCA 1JB4A 1EKMA 1RRLA 3FKAA 4JRFA 1W2B2 1VQ43 3X3XA 5IF6A 3F8XA 3OWSA 1X1WA 4LEHA 2KF5A 1K28A 2W6JH 3F40A 1LQMB 3NUVA 3GAXA 1W6YA 1JKGA 2CC3A 3WOEB 4MMYB 1YIJ3 1BU4A 3CU3A 3OWYA 1W00A 1JNQA 3FLJA 3BIRA 4O8SA 2CFKA 3DGMA 2ZA4A 1TRPA 1SIHA 3O8YA 3FF0A 3PGBA 1UCLA 3MKIA 2JDIH 3IMAB 5AEWB 3LYGA 2LQVA 1O7MB 1N5HA 1QJGA 3EQQB 1FGTA 1JB5A 5IEOA 2CX1A 4WYKA 3QK9A 3SX1A 1F8NA 4ILFA 4X2HA 5LC7A 7RNTA 1RGLA 2QGUA 2L1SA 1B2UA 3NX0A 3X3ZA 1JBTA 4EYCA 1MWUA 1MWRA 1YNVX 5M19A 3ECFA 2HMMB 3CCE3 2H0HA 5HGRA 4DKIA 8RNTA 2IY2A 3G8ZA 4GB5A 5ELUA 3AGNA 1BRKA 2SBLA 3CPOA 3CXC2 4OVMA 3FH1A 1MGWA 1O7GB 1W6CA 1JRQA 2F86B 3HX8A 4HYZA 1B2XA 4EW5A 3RDEA 1IVUA 3G0KA 5IERA 1IK3A 1M904 1L5GB 3VGNA 3FF2A 1E97A 1RGHA 1V57A 1A67A 1RRHA 3A76A 1HZ1A 1ROAA 3BNBA 4H3UA 4J5KA 4BTWA 1M1XB 2XF3A 2YFLB 5BIRA 3G6E3 3URPA 4N6TA 1BRIA 2OCTA 1A2PA 1D6UA 1B2MA 1N9EA 1OCVA 1PFPA 1X1UA 4N6MA 1U5OA 1GMRA 1B20A 1E3VA 7GSPA 4XBYA 1SPUA 6STDA 5A0OB 3Q90A 2Q07A 1RGEA 1IQXA 1BOXA 2F56A 4K1VA 1I3IA 3PCRA 2MC8A 3LH4A 4HZ9B 5D82A 5JPPA 1BSAA 1FUTA 1AVKA 2IUJA 4FMAA 3FG3A 3HK4A 3WODG 1YJ93 1BNFA 3M8CA 3ZFZA 1YHQ3 4J9AA 4WFOA 3OV4A 1MNLA 4H61A 4BL2A 2RNTA 2CG0A 2BMQB 1RTUA 2GBXB 2GSPA 2P0XA 1X1XA 3KN4A 1OF5B 3ROBA 5BVBA 3BU4A 7STDA 1ZS7A 3JUOA 1W4NA 1BGSA 1BNIA 4HM2B 5CF1A 3UL6A 1RGAA 2BHMA 2KF4A 2B1XB 1Q42A 4HM5B 2E2TA 3H3HA 3AHSA 1FW7A 5I97A 4N6UA 1JB2A 5JPUA 3ALAA 2RSXA 1B2SA 1N8R4 2K3DA 4WHAA 2GU3A 3MYTA 5CXOA 1IV7A 3OWUA 1TJDA 2P05A 1BRNL 1IT7A 3D5GA 2CIUA 1G96A 3WA3A 2Y74A 1BANA 3F14A
chains in the Genus database with same CATH topology
4EV5A 3NHXA 3NV0A 5AIFA 3CCM3 4FR9A 3NBBA 5BXQA 1OUNA 1YI23 3H51A 4JF8A 1N9JA 2XRXB 3EJVA 3WDGB 8CHOA 1VQ83 1FUWA 3B4PA 3JUNA 4KZ1A 4MMXB 4XBTA 1CYUA 1GY6A 3LTAA 1CQSA 4X2OA 1GY5A 3B4OA 3S27A 1DVCA 3DY5A 1NWWA 4WP5A 3MG2A 1TU5A 2WGOA 2K0MA 3GZBA 3NBRA 2D1WA 4HKVB 4L8PA 2ML6A 1YJN3 2CH9A 1YIT3 1JV2B 3JUQA 3EB8A 2Z6BA 1EA2A 3F8HA 3JVCA 2O3OA 4XDWA 2WOHA 4XDVA 4Q53A 1JJ22 3CMA3 3LOYA 1YGEA 4MMZB 4I4KA 1ZO2A 3RGAA 2OWPA 2FGTA 4FMBA 1JKGB 4EV2A 2WGQA 1K8A4 3BLZA 1FGMA 3PCSA 4HZBB 3AMOB 1OGZA 2W9PA 4N6NB 4K90B 3TDGA 3UB1A 1KSIA 1GS3A 1T5YA 2CFWA 1IVXA 4RNZA 1S5AA 5EQLA 1Q864 2BMRB 1IQ8A 1TFKA 2OTJ3 1LNHA 2ZDJA 1OHSA 2STDA 1AVLA 1D6YA 3OXAA 3N8BA 2K54A 3PCRA 1QAFA 1TP6A 2OQEA 1ISKA 1O7WB 1M9GA 1VQ73 3G16A 5AIHA 3PS8A 1V74A 2F99A 3E99A 3JUMA 4AEQA 3DGOA 5IG5A 2XGLA 1FGRA 1OPYA 5G2GA 3UJMA 3U97A 2IUKA 2P38A 1Q7Y4 1O7NB 1KD14 1FA3A 3KE7A 3BNCA 3DUKA 1DVDA 1IT8A 5AYSC 1WTHA 1ASKA 5FW5A 3EX9A 5AIIA 3V98A 1A90A 2XEPA 1CYVA 3S5CA 2MF7A 4R9KA 2D42A 2XSOB 5KP1A 3LTDA 2CWTA 3EF8A 3DGNA 3OX9A 1VQK3 3GWRA 2KCDA 2R4IA 2Y73A 3G4S3 3NQYA 3KZTA 4FMDA 2UX0A 4N6V0 1RJOA 4O02B 1Q40A 2CG1A 5KP4A 2GEYA 4RBNA 2M7OA 3S28A 3CD63 1OH0A 3LTCA 3KIIA 4EXRA 4HVNA 2Z7AA 5TGNA 5LC6A 1W01A 3JUPA 2GEXA 4CDLA 3SEDA 2XFTA 1LOXA 3LZAA 4STDA 4CCVA 1Q814 2CK3H 1N8QA 2CFGA 5ELJA 1NJI4 3K7CA 3EBYA 3CCJ3 1O7PB 4K61A 1W6GA 3L0RA 1ROVA 4G1MB 2A15A 3PYJA 1SJWA 2CWVA 2HMJB 2QEX3 4WWUC 3CCV3 2BMOB 3K5TA 1QAKA 4AKYA 1OACA 2LYXA 5AYRB 3N54B 3I563 3WA2X 1TIJA 1NDOB 2YX9A 5AEUB 1BUQA 2FNQA 3VF1A 1U8CB 2IMJA 2QIYA 1W7CA 1IVWA 4HM0B 5AI1A 3NM7A 4LSOA 1N5PA 2XSHB 3RGRA 4ZM8A 3MG1A 3MG3A 3T0UA 1OHPA 5EVHA 1KC84 3HZPA 2BNGA 3S67A 3N9HA 2XH9A 3CPW2 2HMNB 3CNMA 1W02A 1UW1A 2GXFA 1A2VA 1A2KA 2W04A 3DZLA 1KQS2 4HBRA 4RNYA 1WNHA 3K63A 3SOYA 3F9SA 3SLUA 2E2UA 1FGQA 2HMKB 1AR0A 1JN5A 4FCMA 4HM6B 3B7CA 4LGQA 2XFSA 2BT3A 3HI7A 2YFJB 4GL6A 3X41A 4HM4B 3U1WA 3CC43 1WMPA 2W56B 3NM2A 4TX4A 2PNCA 3CME3 1SIIA 2GU1A 2QA43 2V1LA 1VQN3 3EN8A 1AV4A 1GD3A 1K734 5IG4A 5STDA 5DREA 3CCR3 4RZMA 2W9QA 4IT7A 3V92A 2E2VA 3QRDA 4LMIA 2RCDA 1E3RA 1QVG2 4BTXA 3MHEA 4N3VA 3DGLA 2CKFB 1M1K4 4R9LA 2C10A 3STDA 3LMLA 4N6OB 3SVAA 2HMOB 1UUWB 2IA7A 4PEJA 4R4KA 2B24B 1DMMA 1FGOA 5IG0A 1YVBI 3CC73 1Q824 2ZL8A 4OK0A 3FSDA 1UI8A 5AIGA 4FMCA 2Z77A 2FXTA 3B8LA 3LT8A 1OGXA 1D6ZA 1GY7A 4R1KA 3BNDA 2OOVC 3AMOA 4O2HA 1VQL3 4ORLA 1IQYA 1HKXA 4IPBA 1QVF2 1QMAA 2WO0A 3DXOA 3EHCA 1VQ53 3D9RA 5IG3A 3FG4A 3OW22 3FZWA 2W0QA 4O3VA 3SOAA 3MSOA 3UL5A 3I553 3FGYA 3D3LA 3HIGA 2BO9B 2CHCA 1JN5B 3MPHA 3X3YA 1HU9A 1WQLB 4XB5A 1C7HA 3NXJA 5D83A 1K9M4 1KWIA 3J7Yd 2L4VA 4HM3B 4HM7B 3LTBA 3Q1CA 3NV0B 1ZX2A 4LZIA 5CLKA 1VZZA 4KFDA 4HM1B 4BTYA 1W5ZA 2KRTA 1IVVA 2W56A 4WYKB 4HJLB 4OUQA 4L8OA 5DRVA 4J8TA 2C11A 1EG9B 2RFRA 4FCJA 2CFDA 3BNEA 4NREA 1EQKA 3CCS3 2HMLB 3VSYA 1Q40B 1STDA 1LVNA 3EN1B 4N6LA 4L7KA 1ULIB 3T8NA 3GZXB 1DYUA 3SXXA 2XR8B 3NBJA 1US1A 1VQM3 1GD4A 4EBGA 4EC6A 5IENA 3T8UA 3WOFB 2WOFA 2KXGA 3LXUX 5D81A 1RN7A 5FGOA 1R4CA 1RKYA 3KKGA 3CCU3 3IJEB 1J2BA 1O7HB 3G713 4K1UA 5IEPA 1OHOA 2PZVA 1CEWI 4KFFA 2INXA 4XBXA 1SQWA 1STFI 1YJW3 3WMDA 1WMOA 5KP3A 1VQ63 1OF5A 2OTL3 5CK6A 3X40A 1NU3A 2CWUA 1VQO3 3GRDA 2RGQA 3CCQ3 3K0ZA 2P0MA 5IW9A 2F98A 4MJDA 3CC23 4AKZA 1MOLA 2ML5A 1W2ZA 2P09A 2OQEC 3NQZA 3LT9A 1UUVB 3K9MC 4IIAA 1QALA 3KSPA 3F7XA 2I9WA 3Q2PA 4FCZA 2CFLA 3DM8A 3EBTA 3ER7A 2GBWB 1ULJB 2CW9A 2W2CA 3GZRA 3PXMA 1IDPA 1LXEA 1NB5I 1VQP3 1GYBA 2Z76A 3FCSB 2OOVA 3X42A 2YFIB 1NB3I 3DMCA 3HIIA 4U13A 1K41A 3KSED 1IU7A 4KVHA 1Z1SA 1TFOA 3KFQC 5CF2A 1S723 4R80A 1NO3A 1IV9A 3MWZA 1DMNA 2O9UX 3EC9A 3FG1A 3S29A 1UI7A 3IPTA 1TUHA 1WMNA 2JQ5A 3BB9A 4KFEA 3GZYB 2XGNA 1Y4KA 5EEOA 3V99A 4HM8B 3UNLA 4MEIA 1PU4A 3PZWA 3CNXA 3F7SA 3I0YA 4NHFA 2W03A 1DMQA 5JBSA 3EE1A 4XM4A 3CCL3 4QWTA 1VQ93 1JB4A 1EKMA 1RRLA 3FKAA 4JRFA 1W2B2 1VQ43 3X3XA 5IF6A 3F8XA 3OWSA 4LEHA 1K28A 2W6JH 3F40A 3NUVA 3GAXA 1W6YA 1JKGA 2CC3A 3WOEB 4MMYB 1YIJ3 3CU3A 3OWYA 1W00A 1JNQA 3FLJA 4O8SA 2CFKA 3DGMA 1SIHA 3O8YA 3FF0A 3PGBA 3MKIA 2JDIH 3IMAB 5AEWB 3LYGA 2LQVA 1O7MB 1N5HA 1QJGA 3EQQB 1FGTA 1JB5A 5IEOA 4WYKA 3QK9A 3SX1A 1F8NA 4X2HA 5LC7A 2QGUA 3NX0A 3X3ZA 4EYCA 3ECFA 2HMMB 3CCE3 5HGRA 3G8ZA 4GB5A 5ELUA 2SBLA 3CPOA 3CXC2 4OVMA 3FH1A 1O7GB 3HX8A 1W6CA 1JRQA 2F86B 4HYZA 1IVUA 3G0KA 5IERA 1IK3A 1M904 1L5GB 3VGNA 3FF2A 1E97A 1A67A 1RRHA 3A76A 1ROAA 3BNBA 4H3UA 4BTWA 1M1XB 2XF3A 2YFLB 3G6E3 4N6TA 2OCTA 1D6UA 1N9EA 1OCVA 1PFPA 4N6MA 1U5OA 1E3VA 4XBYA 1SPUA 6STDA 5A0OB 3Q90A 2Q07A 1IQXA 4K1VA 3RDEA 5JPPA 2MC8A 3LH4A 4HZ9B 5D82A 1AVKA 2IUJA 4FMAA 3FG3A 3HK4A 3WODG 1YJ93 3M8CA 1YHQ3 4J9AA 4WFOA 3OV4A 1MNLA 4H61A 2CG0A 2BMQB 2GBXB 2P0XA 3KN4A 1OF5B 3ROBA 5BVBA 7STDA 3JUOA 1W4NA 4HM2B 5CF1A 3UL6A 2BHMA 2B1XB 1Q42A 4HM5B 2E2TA 3H3HA 5I97A 4N6UA 1JB2A 5JPUA 3ALAA 2RSXA 1N8R4 4WHAA 2GU3A 3MYTA 5CXOA 1IV7A 3OWUA 2P05A 1IT7A 2CIUA 1G96A 3WA3A 2Y74A 3F14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXO A;  3EHC A;  3EBY A;  1O7P B;  3D9R A;  5JPP A;  1DMQ A;  5IG3 A;  3NHX A;  4XM4 A;  3NV0 A;  3FZW A;  2A15 A;  3SOA A;  1SJW A;  3MSO A;  5AIF A;  3FGY A;  1JB4 A;  2CHC A;  2HMJ B;  1JN5 B;  1OUN A;  3FKA A;  4WWU C;  5BXQ A;  2BMO B;  1WQL B;  3H51 A;  4XB5 A;  1C7H A;  3NXJ A;  5IF6 A;  2XRX B;  3EJV A;  3F8X A;  3OWS A;  5D83 A;  8CHO A;  4LEH A;  3B4P A;  3JUN A;  3F40 A;  4XBT A;  4HM3 B;  1NDO B;  5AEU B;  1GY6 A;  3NUV A;  1CQS A;  4HM7 B;  4X2O A;  1BUQ A;  1GY5 A;  1ZX2 A;  1W6Y A;  1JKG A;  2IMJ A;  3B4O A;  2QIY A;  3NV0 B;  5CLK A;  1VZZ A;  4HM1 B;  3CU3 A;  1NWW A;  4HM0 B;  3OWY A;  1W00 A;  4WP5 A;  5AI1 A;  3FLJ A;  3MG2 A;  4WYK B;  4HJL B;  4OUQ A;  4L8O A;  2XSH B;  3GZB A;  3NBR A;  4HKV B;  4J8T A;  4L8P A;  5DRV A;  1EG9 B;  2RFR A;  4FCJ A;  3RGR A;  3MG1 A;  3FF0 A;  3MG3 A;  1OHP A;  5EVH A;  3HZP A;  3JUQ A;  3MKI A;  2HML B;  2BNG A;  3VSY A;  3LYG A;  5AEW B;  1Q40 B;  1STD A;  1EA2 A;  3F8H A;  1O7M B;  1QJG A;  3EN1 B;  3EQQ B;  2HMN B;  4XDW A;  3CNM A;  1JB5 A;  4XDV A;  1W02 A;  4Q53 A;  4WYK A;  5IEO A;  4L7K A;  1ULI B;  3T8N A;  2GXF A;  4X2H A;  3GZX B;  4I4K A;  1ZO2 A;  2XR8 B;  3RGA A;  2OWP A;  1A2K A;  2QGU A;  1JKG B;  3DZL A;  5IEN A;  3T8U A;  3ECF A;  2HMM B;  5HGR A;  3BLZ A;  4HZB B;  3SOY A;  5D81 A;  1OGZ A;  3G8Z A;  4GB5 A;  3KKG A;  3F9S A;  1GS3 A;  3I0Y A;  3CPO A;  1S5A A;  4OVM A;  3FH1 A;  2HMK B;  1O7G B;  1AR0 A;  2F86 B;  1O7H B;  2BMR B;  3HX8 A;  1JN5 A;  4FCM A;  4HM6 B;  4K1U A;  1OHO A;  2PZV A;  2STD A;  1OHS A;  3B7C A;  2INX A;  3G0K A;  3OXA A;  4LGQ A;  2K54 A;  2YFJ B;  4XBX A;  1TP6 A;  4HM4 B;  3VGN A;  5KP3 A;  3WMD A;  3FF2 A;  3NM2 A;  1E97 A;  1ISK A;  1OF5 A;  1O7W B;  3G16 A;  3A76 A;  5AIH A;  5IER A;  3EN8 A;  5CK6 A;  2F99 A;  3JUM A;  1NU3 A;  3E99 A;  4H3U A;  5IG4 A;  2YFL B;  3GRD A;  5IG5 A;  2RGQ A;  5STD A;  5DRE A;  1OPY A;  3K0Z A;  4RZM A;  2F98 A;  4MJD A;  5G2G A;  3UJM A;  1OCV A;  1O7N B;  1UUV B;  3KE7 A;  4IIA A;  1U5O A;  3DUK A;  4LMI A;  2RCD A;  3KSP A;  1E3R A;  1E3V A;  3F7X A;  1ASK A;  5FW5 A;  2I9W A;  3EX9 A;  4XBY A;  5AII A;  6STD A;  3DM8 A;  3EBT A;  3Q90 A;  3S5C A;  3ER7 A;  4R9K A;  2XSO B;  2GBW B;  4K1V A;  3MHE A;  1ULJ B;  4N3V A;  4HZ9 B;  2W2C A;  3EF8 A;  3GZR A;  2CKF B;  3OX9 A;  5D82 A;  1IDP A;  3GWR A;  3HK4 A;  4R9L A;  5IEP A;  3STD A;  3M8C A;  2R4I A;  2HMO B;  1UUW B;  4J9A A;  4PEJ A;  2B24 B;  1DMM A;  3OV4 A;  1GYB A;  2Z76 A;  3KZT A;  5IG0 A;  2UX0 A;  2BMQ B;  5KP1 A;  2GBX B;  1Q40 A;  3FSD A;  5AIG A;  1OF5 B;  3ROB A;  5BVB A;  5KP4 A;  2GEY A;  2Z77 A;  2YFI B;  7STD A;  3DMC A;  3JUO A;  4U13 A;  1K41 A;  4KVH A;  1OH0 A;  1Z1S A;  5CF2 A;  4HM2 B;  3B8L A;  4HVN A;  2Z7A A;  1OGX A;  5TGN A;  5CF1 A;  1W01 A;  3JUP A;  2B1X B;  1Q42 A;  1GY7 A;  4HM5 B;  1DMN A;  3EC9 A;  3H3H A;  4R1K A;  2GEX A;  4CDL A;  1JB2 A;  3IPT A;  1TUH A;  2JQ5 A;  3BB9 A;  3SED A;  5JPU A;  3GZY B;  5CXO A;  3LZA A;  3MYT A;  3OWU A;  4ORL A;  4STD A;  4HM8 B;  3UNL A;  1HKX A;  3CNX A;  1QMA A;  3K7C A;  3F14 A;  3F7S A; 
#chains in the Genus database with same CATH topology
 2AAE A;  2HOH A;  1I2E A;  9RNT A;  4EV5 A;  1I8V A;  4GHO A;  3NHX A;  3NV0 A;  1AY7 A;  1UCK A;  5AIF A;  3CCM 3;  4FR9 A;  6RNT A;  3NBB A;  2C4B A;  5BXQ A;  1OUN A;  1LOW A;  1YI2 3;  3SYU A;  3H51 A;  4JF8 A;  1N9J A;  2XRX B;  3EJV A;  3WDG B;  4CPK A;  8CHO A;  1VQ8 3;  1V58 A;  1FUW A;  2KAA A;  1RN1 A;  3B4P A;  3JUN A;  4KZ1 A;  4MMX B;  1BSD A;  4XBT A;  1CYU A;  1GY6 A;  3LTA A;  1CQS A;  4X2O A;  1GY5 A;  2R41 A;  3B4O A;  3S27 A;  1DVC A;  3DY5 A;  1NWW A;  2IYJ A;  2KF6 A;  4WP5 A;  3MG2 A;  1TU5 A;  1RSN A;  2WGO A;  2K0M A;  3GZB A;  3NBR A;  2D1W A;  4HKV B;  4L8P A;  4BL3 A;  1GMP A;  2ML6 A;  3DH2 A;  1YJN 3;  2CH9 A;  1RN4 A;  1YIT 3;  1JV2 B;  3JUQ A;  3EB8 A;  1GMQ A;  2Z6B A;  1EA2 A;  1FUS A;  3F8H A;  3GSP A;  3JVC A;  6GSP A;  2O3O A;  4XDW A;  1G02 A;  2WOH A;  1X1Y A;  4XDV A;  4Q53 A;  2UGI A;  1JZD A;  1UUG B;  1JJ2 2;  3LOY A;  1YGE A;  3CMA 3;  4MMZ B;  4I4K A;  1ZO2 A;  3RGA A;  2OWP A;  2FGT A;  4FMB A;  1EUI C;  2F5W A;  1JKG B;  4EV2 A;  2WGQ A;  1K8A 4;  3BLZ A;  1FGM A;  3PCS A;  4HZB B;  3AMO B;  1OGZ A;  1GOY A;  2W9P A;  4N6N B;  4K90 B;  3TDG A;  3UB1 A;  1KSI A;  1GS3 A;  1T5Y A;  2CFW A;  1IVX A;  4RNZ A;  1S5A A;  5EQL A;  1Q86 4;  1RDS A;  2BMR B;  3HOH A;  1RGC A;  1IQ8 A;  1TFK A;  2OTJ 3;  1LNH A;  2STD A;  1OHS A;  2ZDJ A;  1AVL A;  1D6Y A;  3OXA A;  3N8B A;  2K54 A;  2F4Y A;  1QAF A;  1BRH A;  1TP6 A;  2OQE A;  1ISK A;  1O7W B;  1M9G A;  1VQ7 3;  3G16 A;  5AIH A;  3PS8 A;  1V74 A;  2F99 A;  3E99 A;  3JUM A;  4LYL B;  4AEQ A;  3DGO A;  1T3B A;  5IG5 A;  2XGL A;  1FGR A;  1OPY A;  2ZHX B;  5G2G A;  3UJM A;  3U97 A;  1I3F A;  2IUK A;  3WHO A;  1UGI A;  2P38 A;  1O7N B;  1Q7Y 4;  1KD1 4;  3KE7 A;  3BNC A;  3DUK A;  1DVD A;  1FA3 A;  1IT8 A;  5AYS C;  1WTH A;  1ASK A;  1BRS A;  1HYF A;  3EX9 A;  5AII A;  5FW5 A;  3V98 A;  2XEP A;  1CYV A;  3S5C A;  1A90 A;  2MF7 A;  4R9K A;  2D42 A;  2XSO B;  5KP1 A;  3LTD A;  2CWT A;  4J5G A;  3EF8 A;  2SAR A;  3DGN A;  3OX9 A;  1VQK 3;  3GWR A;  2KCD A;  2R4I A;  2Y73 A;  3G4S 3;  3NQY A;  1JZO A;  1UGH I;  3KZT A;  4FMD A;  2UX0 A;  4N6V 0;  4BU4 A;  1RJO A;  4O02 B;  1Q40 A;  2CG1 A;  5KP4 A;  2GEY A;  4RBN A;  2M7O A;  3S28 A;  3CD6 3;  1OH0 A;  3LTC A;  1R4Y A;  3KII A;  4EXR A;  4HVN A;  2Z7A A;  5TGN A;  1BUJ A;  5G1L A;  5LC6 A;  1BRG A;  1W01 A;  3JUP A;  2GEX A;  4CDL A;  3SED A;  2XFT A;  1LOX A;  3LZA A;  4STD A;  4CCV A;  1Q81 4;  2CK3 H;  1N8Q A;  2CFG A;  5ELJ A;  1NJI 4;  3K7C A;  3EBY A;  3CCJ 3;  1O7P B;  4K61 A;  1UDI I;  1BNS A;  2UUG C;  1W6G A;  3L0R A;  1AQZ A;  1GOV A;  1ROV A;  1MGR A;  4G1M B;  2A15 A;  3PYJ A;  1SJW A;  1BNE A;  1I2F A;  1Q7H A;  2CWV A;  2HMJ B;  4I5Q A;  2QEX 3;  4WWU C;  3CCV 3;  2BMO B;  3K5T A;  1B21 A;  1QAK A;  4AKY A;  1OAC A;  2LYX A;  1SAR A;  3N54 B;  5AYR B;  3I56 3;  3WA2 X;  1TIJ A;  1NDO B;  2YX9 A;  5AEU B;  1BUQ A;  2FNQ A;  3VF1 A;  1U8C B;  2IMJ A;  2QIY A;  1W7C A;  1LNI A;  1I70 A;  1IVW A;  1B27 A;  1YGW A;  4HM0 B;  1BAO A;  3NM7 A;  5AI1 A;  1RNB A;  3ZG0 A;  4LSO A;  1N5P A;  5HOH A;  2XSH B;  1LQG C;  1IYY A;  3RGR A;  1UCJ A;  4ZM8 A;  1UCI A;  3MG1 A;  3MG3 A;  3T0U A;  5BU4 A;  4BIR A;  1OHP A;  1TTO A;  5EVH A;  1KC8 4;  3HZP A;  2BNG A;  3S67 A;  3N9H A;  2XH9 A;  1FYS A;  3CPW 2;  1B2Z A;  2HMN B;  3CNM A;  1W02 A;  1UW1 A;  2AAD A;  2GXF A;  1A2V A;  1ZGX A;  1JBS A;  1A2K A;  1GSP A;  2CX0 A;  2W04 A;  3DZL A;  1KQS 2;  4HBR A;  4RNY A;  1WNH A;  4CJN A;  3K63 A;  3SOY A;  1DE3 A;  2BU4 A;  1T2I A;  3F9S A;  3SLU A;  2E2U A;  1FGQ A;  1TRQ A;  2HMK B;  1AR0 A;  1JN5 A;  4FCM A;  4HM6 B;  3B7C A;  4LGQ A;  2XFS A;  1VQQ A;  2BT3 A;  3HI7 A;  2YFJ B;  4GL6 A;  3X41 A;  4HM4 B;  3U1W A;  3CC4 3;  1WMP A;  2W56 B;  3NM2 A;  1PYL A;  2PNC A;  4TX4 A;  3CME 3;  1SII A;  2GU1 A;  2QA4 3;  2V1L A;  1VQN 3;  1C54 A;  3EN8 A;  2F5M A;  1AV4 A;  1GD3 A;  1K73 4;  5IG4 A;  3KCH A;  5STD A;  5DRE A;  3CCR 3;  1JBR A;  4RZM A;  1I2G A;  2W9Q A;  4IT7 A;  3V92 A;  2E2V A;  3QRD A;  4LMI A;  2RCD A;  1E3R A;  2RBI A;  1QVG 2;  4BTX A;  3MHE A;  4N3V A;  1RLS A;  3DGL A;  2CKF B;  1M1K 4;  4R9L A;  1RCL A;  2C10 A;  3STD A;  3LML A;  4N6O B;  3SVA A;  2HMO B;  1UUW B;  2IA7 A;  4PEJ A;  4R4K A;  2B24 B;  1DMM A;  1EEJ A;  1FGO A;  5IG0 A;  1YVB I;  3D4A A;  3CC7 3;  1Q82 4;  2ZL8 A;  4OK0 A;  3FSD A;  1UI8 A;  5AIG A;  4FMC A;  2Z77 A;  2FXT A;  2H0G A;  3B8L A;  3LT8 A;  1OGX A;  1RGG A;  3RNT A;  1D6Z A;  1GY7 A;  1RGK A;  4R1K A;  3BND A;  2OOV C;  5G1K A;  3AMO A;  3WR2 A;  4O2H A;  1VQL 3;  4ORL A;  1IQY A;  1HKX A;  4IPB A;  1QVF 2;  1QMA A;  1BIR A;  2WO0 A;  3DXO A;  3EHC A;  1VQ5 3;  3D9R A;  4KT3 B;  3Q3F A;  5IG3 A;  3FG4 A;  3OW2 2;  3FZW A;  2W0Q A;  4O3V A;  3SOA A;  3MSO A;  3UL5 A;  3I55 3;  3FGY A;  3D3L A;  3HIG A;  2BO9 B;  2CHC A;  1JN5 B;  3MPH A;  3X3Y A;  1HU9 A;  1WQL B;  4XB5 A;  1C7H A;  3NXJ A;  5D83 A;  1BRJ A;  1K9M 4;  1RGF A;  1CH0 A;  1KWI A;  3J7Y d;  2L4V A;  4HM3 B;  1T2H A;  4HM7 B;  3LTB A;  3Q1C A;  3NV0 B;  1Q9E A;  1ZX2 A;  4LZI A;  5CLK A;  1VZZ A;  4KFD A;  4HM1 B;  4BTY A;  1YVS A;  1W5Z A;  2KRT A;  1IVV A;  2W56 A;  4WYK B;  4HJL B;  4OUQ A;  2BIR A;  4L8O A;  5DRV A;  4J8T A;  2C11 A;  1LOY A;  3DGY A;  1EG9 B;  2RFR A;  4FCJ A;  3ZG5 A;  2CFD A;  3BNE A;  4NRE A;  1EQK A;  3CCS 3;  2HML B;  3VSY A;  1G0T A;  1Q40 B;  1STD A;  1LVN A;  3EN1 B;  4N6L A;  4HOH A;  4L7K A;  1ULI B;  1MWS A;  3T8N A;  1NNV A;  1DYU A;  1PY3 A;  2XR8 B;  3GZX B;  3NBJ A;  1US1 A;  3SXX A;  1GD4 A;  1VQM 3;  4EBG A;  4RNT A;  4EC6 A;  5IEN A;  3T8U A;  3WOF B;  2WOF A;  2KXG A;  3LXU X;  5D81 A;  1RN7 A;  5FGO A;  1R4C A;  1RKY A;  1LOV A;  3A5E A;  3KKG A;  3CCU 3;  3IJE B;  1J2B A;  1DET A;  1O7H B;  3G71 3;  4K1U A;  5IEP A;  1OHO A;  1CEW I;  2PZV A;  1B3S A;  4KFF A;  2INX A;  4XBX A;  1SQW A;  1STF I;  1YJW 3;  3WMD A;  4GSP A;  1GOU A;  1WMO A;  5KP3 A;  4NPB A;  1VQ6 3;  1OF5 A;  2OTL 3;  1BSB A;  5CK6 A;  2KF3 A;  3X40 A;  1NU3 A;  2CWU A;  5M1A A;  1VQO 3;  1BNR A;  3GRD A;  1LRA A;  2RGQ A;  1RHL A;  3CCQ 3;  3K0Z A;  2P0M A;  5IW9 A;  2F98 A;  4MJD A;  3CC2 3;  4AKZ A;  1BVI A;  1MOL A;  2ML5 A;  1W2Z A;  1BSE A;  2P09 A;  2OQE C;  3LT9 A;  3NQZ A;  1UUV B;  3K9M C;  4IIA A;  1RMS A;  1QAL A;  3KSP A;  3F7X A;  2J8X B;  3D5I A;  2I9W A;  3Q2P A;  4FCZ A;  2CFL A;  3DM8 A;  3EBT A;  3ER7 A;  2GBW B;  1ULJ B;  2CW9 A;  2W2C A;  3GZR A;  3PXM A;  1IDP A;  1LXE A;  1NB5 I;  1VQP 3;  1FZU A;  1GYB A;  2Z76 A;  3AHW A;  1BNJ A;  3FCS B;  3D79 A;  1RNT A;  2OOV A;  4HAA A;  3X42 A;  2YFI B;  1NB3 I;  3DMC A;  2H0I A;  3HII A;  4U13 A;  1K41 A;  3KSE D;  1IU7 A;  4KVH A;  1Z1S A;  1TFO A;  3AGO A;  3KFQ C;  5CF2 A;  1S72 3;  4R80 A;  1NO3 A;  1I0V A;  1MWT A;  1IV9 A;  3MWZ A;  1DMN A;  2O9U X;  3EC9 A;  3FG1 A;  3S29 A;  1UI7 A;  3IPT A;  1TUH A;  1WMN A;  2JQ5 A;  3BB9 A;  4KFE A;  1BNG A;  3GZY B;  2XGN A;  5GSP A;  1Y4K A;  5EEO A;  1RCK A;  3V99 A;  4HM8 B;  3UNL A;  4MEI A;  1PU4 A;  3PZW A;  3CNX A;  3F7S A;  3I0Y A;  1I0X A;  4NHF A;  5M18 A;  2W03 A;  5RNT A;  1DMQ A;  5JBS A;  3EE1 A;  4XM4 A;  3CCL 3;  4QWT A;  1VQ9 3;  1BSC A;  1JB4 A;  1EKM A;  1RRL A;  3FKA A;  4JRF A;  1W2B 2;  1VQ4 3;  3X3X A;  5IF6 A;  3F8X A;  3OWS A;  1X1W A;  4LEH A;  2KF5 A;  1K28 A;  2W6J H;  3F40 A;  1LQM B;  3NUV A;  3GAX A;  1W6Y A;  1JKG A;  2CC3 A;  3WOE B;  4MMY B;  1YIJ 3;  1BU4 A;  3CU3 A;  3OWY A;  1W00 A;  1JNQ A;  3FLJ A;  3BIR A;  4O8S A;  2CFK A;  3DGM A;  2ZA4 A;  1TRP A;  1SIH A;  3O8Y A;  3FF0 A;  3PGB A;  1UCL A;  3MKI A;  2JDI H;  3IMA B;  5AEW B;  3LYG A;  2LQV A;  1O7M B;  1N5H A;  1QJG A;  3EQQ B;  1FGT A;  1JB5 A;  5IEO A;  2CX1 A;  4WYK A;  3QK9 A;  3SX1 A;  1F8N A;  4ILF A;  4X2H A;  5LC7 A;  7RNT A;  1RGL A;  2QGU A;  2L1S A;  1B2U A;  3NX0 A;  3X3Z A;  1JBT A;  4EYC A;  1MWU A;  1MWR A;  1YNV X;  5M19 A;  3ECF A;  2HMM B;  3CCE 3;  2H0H A;  5HGR A;  4DKI A;  8RNT A;  2IY2 A;  3G8Z A;  4GB5 A;  5ELU A;  3AGN A;  1BRK A;  2SBL A;  3CPO A;  3CXC 2;  4OVM A;  3FH1 A;  1MGW A;  1O7G B;  1W6C A;  1JRQ A;  2F86 B;  3HX8 A;  4HYZ A;  1B2X A;  4EW5 A;  3RDE A;  1IVU A;  3G0K A;  5IER A;  1IK3 A;  1M90 4;  1L5G B;  3VGN A;  3FF2 A;  1E97 A;  1RGH A;  1V57 A;  1A67 A;  1RRH A;  3A76 A;  1HZ1 A;  1ROA A;  3BNB A;  4H3U A;  4J5K A;  4BTW A;  1M1X B;  2XF3 A;  2YFL B;  5BIR A;  3G6E 3;  3URP A;  4N6T A;  1BRI A;  2OCT A;  1A2P A;  1D6U A;  1B2M A;  1N9E A;  1OCV A;  1PFP A;  1X1U A;  4N6M A;  1U5O A;  1GMR A;  1B20 A;  1E3V A;  7GSP A;  4XBY A;  1SPU A;  6STD A;  5A0O B;  3Q90 A;  2Q07 A;  1RGE A;  1IQX A;  1BOX A;  2F56 A;  4K1V A;  1I3I A;  3PCR A;  2MC8 A;  3LH4 A;  4HZ9 B;  5D82 A;  5JPP A;  1BSA A;  1FUT A;  1AVK A;  2IUJ A;  4FMA A;  3FG3 A;  3HK4 A;  3WOD G;  1YJ9 3;  1BNF A;  3M8C A;  3ZFZ A;  1YHQ 3;  4J9A A;  4WFO A;  3OV4 A;  1MNL A;  4H61 A;  4BL2 A;  2RNT A;  2CG0 A;  2BMQ B;  1RTU A;  2GBX B;  2GSP A;  2P0X A;  1X1X A;  3KN4 A;  1OF5 B;  3ROB A;  5BVB A;  3BU4 A;  7STD A;  1ZS7 A;  3JUO A;  1W4N A;  1BGS A;  1BNI A;  4HM2 B;  5CF1 A;  3UL6 A;  1RGA A;  2BHM A;  2KF4 A;  2B1X B;  1Q42 A;  4HM5 B;  2E2T A;  3H3H A;  3AHS A;  1FW7 A;  5I97 A;  4N6U A;  1JB2 A;  5JPU A;  3ALA A;  2RSX A;  1B2S A;  1N8R 4;  2K3D A;  4WHA A;  2GU3 A;  3MYT A;  5CXO A;  1IV7 A;  3OWU A;  1TJD A;  2P05 A;  1BRN L;  1IT7 A;  3D5G A;  2CIU A;  1G96 A;  3WA3 A;  2Y74 A;  1BAN A;  3F14 A; 
#chains in the Genus database with same CATH homology
 4EV5 A;  3NHX A;  3NV0 A;  5AIF A;  3CCM 3;  4FR9 A;  3NBB A;  5BXQ A;  1OUN A;  1YI2 3;  3H51 A;  4JF8 A;  1N9J A;  2XRX B;  3EJV A;  3WDG B;  8CHO A;  1VQ8 3;  1FUW A;  3B4P A;  3JUN A;  4KZ1 A;  4MMX B;  4XBT A;  1CYU A;  1GY6 A;  3LTA A;  1CQS A;  4X2O A;  1GY5 A;  3B4O A;  3S27 A;  1DVC A;  3DY5 A;  1NWW A;  4WP5 A;  3MG2 A;  1TU5 A;  2WGO A;  2K0M A;  3GZB A;  3NBR A;  2D1W A;  4HKV B;  4L8P A;  2ML6 A;  1YJN 3;  2CH9 A;  1YIT 3;  1JV2 B;  3JUQ A;  3EB8 A;  2Z6B A;  1EA2 A;  3F8H A;  3JVC A;  2O3O A;  4XDW A;  2WOH A;  4XDV A;  4Q53 A;  1JJ2 2;  3CMA 3;  3LOY A;  1YGE A;  4MMZ B;  4I4K A;  1ZO2 A;  3RGA A;  2OWP A;  2FGT A;  4FMB A;  1JKG B;  4EV2 A;  2WGQ A;  1K8A 4;  3BLZ A;  1FGM A;  3PCS A;  4HZB B;  3AMO B;  1OGZ A;  2W9P A;  4N6N B;  4K90 B;  3TDG A;  3UB1 A;  1KSI A;  1GS3 A;  1T5Y A;  2CFW A;  1IVX A;  4RNZ A;  1S5A A;  5EQL A;  1Q86 4;  2BMR B;  1IQ8 A;  1TFK A;  2OTJ 3;  1LNH A;  2ZDJ A;  1OHS A;  2STD A;  1AVL A;  1D6Y A;  3OXA A;  3N8B A;  2K54 A;  3PCR A;  1QAF A;  1TP6 A;  2OQE A;  1ISK A;  1O7W B;  1M9G A;  1VQ7 3;  3G16 A;  5AIH A;  3PS8 A;  1V74 A;  2F99 A;  3E99 A;  3JUM A;  4AEQ A;  3DGO A;  5IG5 A;  2XGL A;  1FGR A;  1OPY A;  5G2G A;  3UJM A;  3U97 A;  2IUK A;  2P38 A;  1Q7Y 4;  1O7N B;  1KD1 4;  1FA3 A;  3KE7 A;  3BNC A;  3DUK A;  1DVD A;  1IT8 A;  5AYS C;  1WTH A;  1ASK A;  5FW5 A;  3EX9 A;  5AII A;  3V98 A;  1A90 A;  2XEP A;  1CYV A;  3S5C A;  2MF7 A;  4R9K A;  2D42 A;  2XSO B;  5KP1 A;  3LTD A;  2CWT A;  3EF8 A;  3DGN A;  3OX9 A;  1VQK 3;  3GWR A;  2KCD A;  2R4I A;  2Y73 A;  3G4S 3;  3NQY A;  3KZT A;  4FMD A;  2UX0 A;  4N6V 0;  1RJO A;  4O02 B;  1Q40 A;  2CG1 A;  5KP4 A;  2GEY A;  4RBN A;  2M7O A;  3S28 A;  3CD6 3;  1OH0 A;  3LTC A;  3KII A;  4EXR A;  4HVN A;  2Z7A A;  5TGN A;  5LC6 A;  1W01 A;  3JUP A;  2GEX A;  4CDL A;  3SED A;  2XFT A;  1LOX A;  3LZA A;  4STD A;  4CCV A;  1Q81 4;  2CK3 H;  1N8Q A;  2CFG A;  5ELJ A;  1NJI 4;  3K7C A;  3EBY A;  3CCJ 3;  1O7P B;  4K61 A;  1W6G A;  3L0R A;  1ROV A;  4G1M B;  2A15 A;  3PYJ A;  1SJW A;  2CWV A;  2HMJ B;  2QEX 3;  4WWU C;  3CCV 3;  2BMO B;  3K5T A;  1QAK A;  4AKY A;  1OAC A;  2LYX A;  5AYR B;  3N54 B;  3I56 3;  3WA2 X;  1TIJ A;  1NDO B;  2YX9 A;  5AEU B;  1BUQ A;  2FNQ A;  3VF1 A;  1U8C B;  2IMJ A;  2QIY A;  1W7C A;  1IVW A;  4HM0 B;  5AI1 A;  3NM7 A;  4LSO A;  1N5P A;  2XSH B;  3RGR A;  4ZM8 A;  3MG1 A;  3MG3 A;  3T0U A;  1OHP A;  5EVH A;  1KC8 4;  3HZP A;  2BNG A;  3S67 A;  3N9H A;  2XH9 A;  3CPW 2;  2HMN B;  3CNM A;  1W02 A;  1UW1 A;  2GXF A;  1A2V A;  1A2K A;  2W04 A;  3DZL A;  1KQS 2;  4HBR A;  4RNY A;  1WNH A;  3K63 A;  3SOY A;  3F9S A;  3SLU A;  2E2U A;  1FGQ A;  2HMK B;  1AR0 A;  1JN5 A;  4FCM A;  4HM6 B;  3B7C A;  4LGQ A;  2XFS A;  2BT3 A;  3HI7 A;  2YFJ B;  4GL6 A;  3X41 A;  4HM4 B;  3U1W A;  3CC4 3;  1WMP A;  2W56 B;  3NM2 A;  4TX4 A;  2PNC A;  3CME 3;  1SII A;  2GU1 A;  2QA4 3;  2V1L A;  1VQN 3;  3EN8 A;  1AV4 A;  1GD3 A;  1K73 4;  5IG4 A;  5STD A;  5DRE A;  3CCR 3;  4RZM A;  2W9Q A;  4IT7 A;  3V92 A;  2E2V A;  3QRD A;  4LMI A;  2RCD A;  1E3R A;  1QVG 2;  4BTX A;  3MHE A;  4N3V A;  3DGL A;  2CKF B;  1M1K 4;  4R9L A;  2C10 A;  3STD A;  3LML A;  4N6O B;  3SVA A;  2HMO B;  1UUW B;  2IA7 A;  4PEJ A;  4R4K A;  2B24 B;  1DMM A;  1FGO A;  5IG0 A;  1YVB I;  3CC7 3;  1Q82 4;  2ZL8 A;  4OK0 A;  3FSD A;  1UI8 A;  5AIG A;  4FMC A;  2Z77 A;  2FXT A;  3B8L A;  3LT8 A;  1OGX A;  1D6Z A;  1GY7 A;  4R1K A;  3BND A;  2OOV C;  3AMO A;  4O2H A;  1VQL 3;  4ORL A;  1IQY A;  1HKX A;  4IPB A;  1QVF 2;  1QMA A;  2WO0 A;  3DXO A;  3EHC A;  1VQ5 3;  3D9R A;  5IG3 A;  3FG4 A;  3OW2 2;  3FZW A;  2W0Q A;  4O3V A;  3SOA A;  3MSO A;  3UL5 A;  3I55 3;  3FGY A;  3D3L A;  3HIG A;  2BO9 B;  2CHC A;  1JN5 B;  3MPH A;  3X3Y A;  1HU9 A;  1WQL B;  4XB5 A;  1C7H A;  3NXJ A;  5D83 A;  1K9M 4;  1KWI A;  3J7Y d;  2L4V A;  4HM3 B;  4HM7 B;  3LTB A;  3Q1C A;  3NV0 B;  1ZX2 A;  4LZI A;  5CLK A;  1VZZ A;  4KFD A;  4HM1 B;  4BTY A;  1W5Z A;  2KRT A;  1IVV A;  2W56 A;  4WYK B;  4HJL B;  4OUQ A;  4L8O A;  5DRV A;  4J8T A;  2C11 A;  1EG9 B;  2RFR A;  4FCJ A;  2CFD A;  3BNE A;  4NRE A;  1EQK A;  3CCS 3;  2HML B;  3VSY A;  1Q40 B;  1STD A;  1LVN A;  3EN1 B;  4N6L A;  4L7K A;  1ULI B;  3T8N A;  3GZX B;  1DYU A;  3SXX A;  2XR8 B;  3NBJ A;  1US1 A;  1VQM 3;  1GD4 A;  4EBG A;  4EC6 A;  5IEN A;  3T8U A;  3WOF B;  2WOF A;  2KXG A;  3LXU X;  5D81 A;  1RN7 A;  5FGO A;  1R4C A;  1RKY A;  3KKG A;  3CCU 3;  3IJE B;  1J2B A;  1O7H B;  3G71 3;  4K1U A;  5IEP A;  1OHO A;  2PZV A;  1CEW I;  4KFF A;  2INX A;  4XBX A;  1SQW A;  1STF I;  1YJW 3;  3WMD A;  1WMO A;  5KP3 A;  1VQ6 3;  1OF5 A;  2OTL 3;  5CK6 A;  3X40 A;  1NU3 A;  2CWU A;  1VQO 3;  3GRD A;  2RGQ A;  3CCQ 3;  3K0Z A;  2P0M A;  5IW9 A;  2F98 A;  4MJD A;  3CC2 3;  4AKZ A;  1MOL A;  2ML5 A;  1W2Z A;  2P09 A;  2OQE C;  3NQZ A;  3LT9 A;  1UUV B;  3K9M C;  4IIA A;  1QAL A;  3KSP A;  3F7X A;  2I9W A;  3Q2P A;  4FCZ A;  2CFL A;  3DM8 A;  3EBT A;  3ER7 A;  2GBW B;  1ULJ B;  2CW9 A;  2W2C A;  3GZR A;  3PXM A;  1IDP A;  1LXE A;  1NB5 I;  1VQP 3;  1GYB A;  2Z76 A;  3FCS B;  2OOV A;  3X42 A;  2YFI B;  1NB3 I;  3DMC A;  3HII A;  4U13 A;  1K41 A;  3KSE D;  1IU7 A;  4KVH A;  1Z1S A;  1TFO A;  3KFQ C;  5CF2 A;  1S72 3;  4R80 A;  1NO3 A;  1IV9 A;  3MWZ A;  1DMN A;  2O9U X;  3EC9 A;  3FG1 A;  3S29 A;  1UI7 A;  3IPT A;  1TUH A;  1WMN A;  2JQ5 A;  3BB9 A;  4KFE A;  3GZY B;  2XGN A;  1Y4K A;  5EEO A;  3V99 A;  4HM8 B;  3UNL A;  4MEI A;  1PU4 A;  3PZW A;  3CNX A;  3F7S A;  3I0Y A;  4NHF A;  2W03 A;  1DMQ A;  5JBS A;  3EE1 A;  4XM4 A;  3CCL 3;  4QWT A;  1VQ9 3;  1JB4 A;  1EKM A;  1RRL A;  3FKA A;  4JRF A;  1W2B 2;  1VQ4 3;  3X3X A;  5IF6 A;  3F8X A;  3OWS A;  4LEH A;  1K28 A;  2W6J H;  3F40 A;  3NUV A;  3GAX A;  1W6Y A;  1JKG A;  2CC3 A;  3WOE B;  4MMY B;  1YIJ 3;  3CU3 A;  3OWY A;  1W00 A;  1JNQ A;  3FLJ A;  4O8S A;  2CFK A;  3DGM A;  1SIH A;  3O8Y A;  3FF0 A;  3PGB A;  3MKI A;  2JDI H;  3IMA B;  5AEW B;  3LYG A;  2LQV A;  1O7M B;  1N5H A;  1QJG A;  3EQQ B;  1FGT A;  1JB5 A;  5IEO A;  4WYK A;  3QK9 A;  3SX1 A;  1F8N A;  4X2H A;  5LC7 A;  2QGU A;  3NX0 A;  3X3Z A;  4EYC A;  3ECF A;  2HMM B;  3CCE 3;  5HGR A;  3G8Z A;  4GB5 A;  5ELU A;  2SBL A;  3CPO A;  3CXC 2;  4OVM A;  3FH1 A;  1O7G B;  3HX8 A;  1W6C A;  1JRQ A;  2F86 B;  4HYZ A;  1IVU A;  3G0K A;  5IER A;  1IK3 A;  1M90 4;  1L5G B;  3VGN A;  3FF2 A;  1E97 A;  1A67 A;  1RRH A;  3A76 A;  1ROA A;  3BNB A;  4H3U A;  4BTW A;  1M1X B;  2XF3 A;  2YFL B;  3G6E 3;  4N6T A;  2OCT A;  1D6U A;  1N9E A;  1OCV A;  1PFP A;  4N6M A;  1U5O A;  1E3V A;  4XBY A;  1SPU A;  6STD A;  5A0O B;  3Q90 A;  2Q07 A;  1IQX A;  4K1V A;  3RDE A;  5JPP A;  2MC8 A;  3LH4 A;  4HZ9 B;  5D82 A;  1AVK A;  2IUJ A;  4FMA A;  3FG3 A;  3HK4 A;  3WOD G;  1YJ9 3;  3M8C A;  1YHQ 3;  4J9A A;  4WFO A;  3OV4 A;  1MNL A;  4H61 A;  2CG0 A;  2BMQ B;  2GBX B;  2P0X A;  3KN4 A;  1OF5 B;  3ROB A;  5BVB A;  7STD A;  3JUO A;  1W4N A;  4HM2 B;  5CF1 A;  3UL6 A;  2BHM A;  2B1X B;  1Q42 A;  4HM5 B;  2E2T A;  3H3H A;  5I97 A;  4N6U A;  1JB2 A;  5JPU A;  3ALA A;  2RSX A;  1N8R 4;  4WHA A;  2GU3 A;  3MYT A;  5CXO A;  1IV7 A;  3OWU A;  2P05 A;  1IT7 A;  2CIU A;  1G96 A;  3WA3 A;  2Y74 A;  3F14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...