3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LinA
molecule tags Transferase
source organism Uncultured organism
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
3NUVA 3RGRA 4XBTA 3B7CA 3EJVA 3H51A 3OWYA 3EC9A 3GRDA 3K7CA 3KKGA 6STDA 2OWPA 3G16A 5IG5A 1GY7A 2IMJA 1W6YA 2YFIB 4OVMA 2Z77A 3CPOA 3F7XA 1JKGB 3GZYB 1AR0A 2BMQB 1Q42A 1O7WB 3G8ZA 4HZBB 3NV0A 4LGQA 4PEJA 5D83A 2HMOB 5JPUA 3UNLA 3MG2A 3FF0A 4HM2B 5AIFA 4XBYA 3OWUA 5JPPA 2GEYA 4HM1B 5HGRA 1UUWB 1O7MB 3FZWA 3JUMA 5EVHA 3DZLA 2GBWB 1GY6A 4L7KA 3S5CA 3OWSA 3GZRA 5CK6A 3WMDA 3DXOA 5CF2A 3MKIA 3FKAA 3H3HA 4HM5B 3EHCA 3T8NA 2F98A 2RGQA 4STDA 3FF2A 5D81A 3OX9A 5IERA 1A2KA 2A15A 2Z76A 1W02A 1OUNA 3F14A 2R4IA 4HKVB 1QJGA 5AEUB 1OHOA 5G2GA 1O7PB 2XSOB 3CNMA 1OCVA 1DMNA 3STDA 2QGUA 1QMAA 1OGXA 2UX0A 3MHEA 3DM8A 5IEOA 1JB4A 1NWWA 3NM2A 5AIIA 1O7HB 3UJMA 3GZBA 2XR8B 1S5AA 4XDWA 4L8PA 3LZAA 5AI1A 5CLKA 3Q90A 4R1KA 4WP5A 1NDOB 1U5OA 2CHCA 1E97A 5IENA 3SEDA 3FSDA 1OPYA 1E3VA 3KSPA 1CQSA 1TP6A 1ZX2A 2F99A 2XSHB 3MG3A 3ECFA 4HM0B 5IG4A 4ORLA 2HMLB 1OHPA 7STDA 1ULJB 4I4KA 1O7GB 1Z1SA 3K0ZA 1TUHA 3NBRA 4IIAA 2HMKB 3MG1A 3B4OA 3DUKA 2HMNB 5AIGA 4X2OA 3EN1B 1OGZA 4CDLA 8CHOA 5BVBA 5D82A 2GXFA 2YFJB 3VGNA 1WQLB 2Z7AA 3F9SA 1EG9B 3MSOA 2F86B 4KVHA 2B24B 4MJDA 3F7SA 1STDA 3SOYA 1O7NB 1GY5A 3BB9A 2B1XB 1W00A 1W01A 1OHSA 3M8CA 3LYGA 4J8TA 1OF5B 2RFRA 3A76A 5AIHA 5IF6A 4X2HA 4K1UA 4HVNA 2W2CA 1ULIB 3EQQB 2CKFB 3HK4A 4HM8B 4K1VA 5IG0A 1JB5A 4HZ9B 3T8UA 3G0KA 1BUQA 4GB5A 5AEWB 5BXQA 5IEPA 4R9KA 1OH0A 5FW5A 3BLZA 2PZVA 3ER7A 5TGNA 3F40A 3ROBA 1VZZA 4HJLB 3CNXA 3MYTA 5KP3A 4OUQA 1NU3A 1SJWA 3KE7A 4RZMA 3IPTA 2BMRB 1OF5A 2XRXB 1ASKA 4H3UA 3OV4A 1JKGA 4WWUC 3JUOA 4FCJA 1JN5B 1JB2A 5STDA 3RGAA 1C7HA 3HX8A 4LMIA 2K54A 3KZTA 4XB5A 5CXOA 5KP1A 1JN5A 4J9AA 3DMCA 4U13A 4XM4A 4FCMA 2GBXB 3NXJA 2I9WA 4HM4B 3EBYA 3VSYA 3EBTA 5KP4A 3EF8A 1Q40A 2HMJB 3NV0B 3NHXA 1ISKA 1ZO2A 3B8LA 3GWRA 4L8OA 3B4PA 4WYKA 1Q40B 2GEXA 3E99A 3F8XA 4XDVA 3JUQA 3CU3A 5DREA 1E3RA 5CF1A 4R9LA 2STDA 1GS3A 1IDPA 1DMMA 3FH1A 4HM6B 4WYKB 3D9RA 1HKXA 3JUPA 2HMMB 3JUNA 4XBXA 3SOAA 3EX9A 4HM3B 2BMOB 2RCDA 3EN8A 3HZPA 4Q53A 4N3VA 5DRVA 3FLJA 2QIYA 3OXAA 3GZXB 4LEHA 2INXA 3FGYA 2YFLB 1GYBA 1EA2A 2JQ5A 3F8HA 5IG3A 1DMQA 1UUVB 1K41A 2BNGA 4HM7B 3I0YA
chains in the Genus database with same CATH superfamily
3RGRA 1QVG2 3AHWA 3H51A 3OWYA 2Z6BA 3GRDA 2F5MA 4CPKA 1LNIA 1X1UA 3G16A 4KFEA 3S67A 5IG5A 2YFIB 1BOXA 3CPOA 2QEX3 2Y73A 1R4YA 2BMQB 3G8ZA 5EQLA 1K8A4 3LH4A 1JZDA 1QALA 2E2VA 2OQEC 4HM2B 4XBYA 3KN4A 1UUWB 1O7MB 4BU4A 3DZLA 1GY6A 3S5CA 1W4NA 3DGLA 1BRIA 3DXOA 2XGLA 2RSXA 3FKAA 3WMDA 1W6CA 3SXXA 5RNTA 1TU5A 3PCRA 3URPA 1DETA 2LQVA 1RN4A 5IERA 3D3LA 4IPBA 1W02A 1BNIA 1UCIA 1OHOA 1PY3A 1OCVA 1DMNA 1B2UA 1OGXA 2AAEA 1B2SA 2L1SA 3NM2A 1O7HB 1SQWA 3X40A 3UJMA 1MWTA 3GZBA 3I553 1LOYA 1GOUA 4BTYA 4L8PA 1YHQ3 2IY2A 3ZFZA 2MF7A 3WA2X 1E97A 2H0HA 3UL6A 3WA3A 1UDII 2BT3A 1HU9A 3FG3A 3K0ZA 1Z1SA 2UGIA 4EYCA 4IIAA 2HMKB 3PXMA 3MG1A 3B4OA 3DUKA 3DGYA 4O02B 2CX1A 1OGZA 2IYJA 6RNTA 1J2BA 8CHOA 1RRHA 5BVBA 2F86B 1CH0A 4N6NB 1KQS2 1T2IA 2CWTA 1N5PA 1SIIA 2P0MA 1B2ZA 3BB9A 3KCHA 2BO9B 1W00A 2F56A 3D5IA 1AV4A 4FR9A 1OF5B 2XGNA 4QWTA 3LT8A 3NQZA 3NBBA 3HK4A 4K1VA 3EQQB 3AHSA 4HZ9B 3QRDA 4GB5A 1YGWA 4R9KA 1ZGXA 5FW5A 2OTJ3 1N5HA 4BL3A 1I2GA 3ER7A 2PZVA 3CCR3 2C4BA 3DH2A 4HJLB 3WR2A 4OUQA 2XF3A 1SJWA 4RZMA 2GU1A 2XRXB 3PZWA 3NM7A 4FCJA 1BRKA 1JB2A 4ILFA 5STDA 3RGAA 4LMIA 1FZUA 4NPBA 2K54A 4MMZB 1HYFA 1LNHA 1MOLA 4J9AA 2GBXB 1YJN3 1Q7Y4 4N6V0 1UI8A 3EF8A 1Q40A 2HMJB 2SBLA 5EEOA 1LOWA 3NHXA 1VQM3 1MGRA 1UGHI 1V57A 4K90B 4L8OA 4LYLB 1W2B2 3E99A 3Q1CA 2K0MA 1GD4A 1UW1A 2STDA 1GS3A 1WNHA 4I5QA 1X1WA 1ZS7A 2H0IA 1BSEA 4WYKB 1LQGC 4KFFA 3SOAA 6GSPA 1BNEA 1L5GB 3EX9A 1RJOA 2BMOB 2RCDA 1FUSA 2C11A 2UUGC 3EN8A 7GSPA 1W7CA 3OXAA 1FYSA 2INXA 2KF6A 1GYBA 3F8HA 3Q2PA 2QIYA 1JRQA 2BNGA 4HM7B 4HYZA 5AYRB 1QVF2 3NUVA 1EUIC 4XBTA 6STDA 1LVNA 3K7CA 3KSED 4N6UA 4WHAA 2OWPA 1MWRA 1VQ73 2P0XA 2IMJA 1YNVX 2KRTA 2RNTA 1F8NA 3IMAB 1JKGB 3GZYB 4HZBB 4LGQA 1Q42A 4PEJA 1VQ93 1PYLA 2WO0A 1AVLA 2IUJA 3FF0A 2YX9A 5AIFA 2GEYA 1N8QA 2CW9A 1FGQA 4JF8A 4MMYB 1I3FA 3LOYA 4L7KA 3U1WA 1NNVA 2C10A 3OWSA 3PYJA 2OQEA 3O8YA 1B2XA 1IVWA 3MKIA 1Q824 2LYXA 1B2MA 1VQL3 1IV7A 1BRNL 3T8NA 2FGTA 4BL2A 1VQ43 1BNRA 2RGQA 3G4S3 1MNLA 1RDSA 5A0OB 2Z76A 4HKVB 1OUNA 1TJDA 1DE3A 4RNZA 3SX1A 1YGEA 1A2PA 1NO3A 1RN1A 3MWZA 1QMAA 2UX0A 1NWWA 5BIRA 4KZ1A 1M904 1S5AA 4XDWA 1C54A 1RGKA 1UGIA 1IQXA 4AEQA 4R1KA 4WP5A 2WOFA 1R4CA 3N54B 2BU4A 1TRPA 1OPYA 1E3VA 2CWVA 1TP6A 3KSPA 1WMNA 2XSHB 3CCS3 1V74A 1FUWA 1BNJA 4HM0B 5IG4A 4ORLA 2HMLB 5ELJA 4RBNA 4I4KA 1O7GB 1YVBI 1FA3A 3NBRA 1YJW3 1RNBA 5AIGA 1M9GA 4X2OA 4NREA 3HI7A 1VQQA 2RBIA 2KAAA 1D6ZA 1I0VA 3VGNA 3F9SA 3ZG0A 2WGQA 1RRLA 3WOEB 1BSDA 1GY5A 1W01A 3FCSB 1VQ53 5AIHA 1RGLA 4WFOA 4HVNA 2CC3A 4HM8B 1B27A 2F5WA 2O9UX 3G0KA 1BUQA 1EKMA 4BIRA 3N8BA 5AEWB 1N9EA 1BRJA 2D42A 2IUKA 2XFSA 2P09A 4N6OB 1W6GA 5TGNA 3ROBA 1RGAA 7RNTA 3K9MC 1WTHA 5IW9A 3A5EA 2BMRB 1ASKA 1YIJ3 1JKGA 4WWUC 3JUOA 2XEPA 4CJNA 4J5KA 3G713 3V99A 3WOFB 1C7HA 2GU3A 2Y74A 3JVCA 5CXOA 1JN5A 3TDGA 3DMCA 4U13A 3UB1A 2H0GA 2V1LA 2W04A 2FXTA 3D5GA 2ML6A 4HM4B 3X41A 1FGRA 3NV0B 3B8LA 3GWRA 2P05A 3QK9A 3ZG5A 1VQP3 4WYKA 3JUQA 1E3RA 1YJ93 1A67A 1NB3I 1V58A 1IDPA 2M7OA 3FH1A 4TX4A 1US1A 1K734 4GSPA 2O3OA 3AMOB 1T3BA 1BANA 4HM3B 3U97A 1DYUA 1AVKA 1GMPA 3GZXB 3VF1A 3X3XA 2JQ5A 5IG3A 1NJI4 1UCKA 5LC6A 1HZ1A 9RNTA 2Q07A 4RNYA 1BSAA 3B7CA 3KKGA 1B21A 1GMRA 1IK3A 1JBRA 5AYSC 1A2VA 2Z77A 4FMAA 5G1LA 1LOVA 1AR0A 3LTAA 2OOVC 3NV0A 1STFI 2ZHXB 1ROVA 3UNLA 3SLUA 4K61A 5JPPA 1WMOA 3OWUA 4H61A 4HM1B 5HGRA 1G96A 5EVHA 1RCLA 3BNDA 4AKYA 3NQYA 3BIRA 1GMQA 3SYUA 4EC6A 1CYUA 5CK6A 3HIGA 3GAXA 4RNTA 3AGOA 3H3HA 4R4KA 5LC7A 4HM5B 1AY7A 5D81A 4STDA 3FF2A 3LTCA 3OX9A 4LSOA 2CFLA 2OOVA 3CCQ3 3F14A 3N9HA 1BSCA 1LRAA 1QJGA 2CH9A 4AKZA 5G1KA 2OTL3 2XH9A 1FGOA 1IT8A 2XFTA 3STDA 2QGUA 3MPHA 4ZM8A 1YIT3 1Q864 1QAKA 3D4AA 1DVDA 1KWIA 5AIIA 1JNQA 2SARA 4MEIA 5GSPA 1RGFA 1X1XA 3DGOA 1LXEA 3K5TA 1VQ83 2JDIH 4FMBA 2QA43 1U5OA 2CHCA 2R41A 5IENA 1IVXA 1M1XB 1ZX2A 1CQSA 1UCJA 2CFWA 2ZDJA 3DGMA 4HBRA 3V98A 1EEJA 3L0RA 3WHOA 4EBGA 3CMA3 2K3DA 4GHOA 1OHPA 2OCTA 7STDA 1ULJB 2E2UA 2WOHA 3D79A 3G6E3 1UCLA 2ZL8A 1G0TA 1AQZA 2E2TA 2AADA 3BNEA 4FMCA 2L4VA 3EN1B 2CFGA 1S723 4CDLA 3CPW2 1BRSA 1OACA 1UUGB 2GXFA 2CG1A 2YFJB 4DKIA 1BVIA 1BU4A 4MJDA 1STDA 1JBSA 1RN7A 1Q7HA 1ROAA 3AMOA 1BSBA 1OHSA 2J8XB 3M8CA 1RGGA 1BIRA 2RFRA 3LYGA 1CEWI 4HOHA 2BIRA 1KSIA 1RGEA 4K1UA 4EXRA 3PGBA 5IF6A 1VQK3 1BRGA 1ULIB 2W2CA 5ELUA 3CC23 5JBSA 2D1WA 1TFOA 1Y4KA 2W56B 1VZZA 3MYTA 3RDEA 2PNCA 1W2ZA 1NU3A 1TRQA 1I0XA 3KE7A 3IPTA 4H3UA 3OV4A 1LOXA 3CCM3 1SARA 2CG0A 2FNQA 3BNCA 1JN5B 2IA7A 3HX8A 8RNTA 1KD14 1YI23 1RTUA 2BHMA 2KF5A 4XM4A 3V92A 2I9WA 4O8SA 3X3YA 2HOHA 3EBYA 1MGWA 3EBTA 1RNTA 1IT7A 5I97A 3CCE3 1ZO2A 1ISKA 2P38A 1A90A 1RLSA 4JRFA 4XDVA 3CCU3 1I3IA 5DREA 5FGOA 3CU3A 2W9QA 1M1K4 2W03A 4HM6B 1K28A 5CF2A 4XBXA 3DGNA 1I8VA 3JUNA 3K63A 1D6UA 4EV5A 1BNGA 2CFDA 5DRVA 3FLJA 1RSNA 4BTXA 1RHLA 4LEHA 3FGYA 3I0YA 1N8R4 1X1YA 1EA2A 3T0UA 1Q814 4BTWA 1DMQA 1UUVB 1K41A 3DY5A 1IQYA 1LQMB 3EJVA 3LT9A 3PS8A 3EC9A 3UL5A 1BUJA 1N9JA 1GY7A 2GSPA 1W6YA 3HOHA 4OVMA 3LTBA 3WODG 3S27A 3F7XA 3GSPA 4R80A 1O7WB 5D83A 2HMOB 5JPUA 1VQ63 3MG2A 3CXC2 1EQKA 4FCZA 1GOVA 3FZWA 3JUMA 1IV9A 3KIIA 1RMSA 1SPUA 2GBWB 3FG4A 3GZRA 1K9M4 3NBJA 1T5YA 3EHCA 2F98A 1KC84 5HOHA 3CCV3 2KCDA 3S29A 1FW7A 3LMLA 1A2KA 2A15A 1JBTA 4KFDA 2R4IA 5AEUB 1JZOA 5G2GA 1O7PB 2XSOB 3CNMA 3I563 1JJ22 1VQN3 1RKYA 3MHEA 2CFKA 3DM8A 5IEOA 1JB4A 1G02A 1W5ZA 1RCKA 2XR8B 4IT7A 4NHFA 5AI1A 3BU4A 3LZAA 3PCSA 1BAOA 3Q90A 1NDOB 1JV2B 3SEDA 3FSDA 2F4YA 3KFQC 4KT3B 5CLKA 1UI7A 2F99A 3MG3A 3ECFA 3X42A 1IVVA 1TUHA 3Q3FA 2HMNB 2W9PA 3WDGB 1I2FA 1BRHA 4EW5A 2KF3A 1GOYA 2ZA4A 4G1MB 3EE1A 5D82A 1SIHA 4FMDA 1WQLB 2Z7AA 3LTDA 1EG9B 3MSOA 4KVHA 4N6TA 1MWUA 2B24B 1BNSA 3CCL3 1VQO3 1I70A 3F7SA 3HIIA 3SOYA 1TFKA 1O7NB 4N6LA 1YVSA 2B1XB 1QAFA 1FGTA 3NX0A 3CME3 1B3SA 4J8TA 3A76A 4HAAA 4X2HA 2W6JH 1TIJA 2CKFB 3T8UA 5IG0A 1JB5A 1PFPA 3AGNA 1IVUA 4CCVA 5BXQA 5IEPA 1OH0A 3X3ZA 3CC43 3IJEB 3BLZA 3F40A 3CNXA 2CK3H 5KP3A 4EV2A 1OF5A 1Q9EA 3LXUX 5BU4A 2ML5A 1DVCA 1D6YA 1GD3A 2MC8A 2KXGA 3J7Yd 2WGOA 1IYYA 1WMPA 1BNFA 3KZTA 1T2HA 4XB5A 5KP1A 3OW22 1FUTA 4FCMA 5M19A 3CCJ3 3NXJA 3ALAA 1IU7A 3S28A 1TTOA 3BNBA 2W0QA 1IQ8A 1CYVA 3VSYA 5KP4A 4N6MA 2KF4A 2CIUA 4LZIA 4OK0A 5M1AA 4MMXB 4O2HA 3CD63 1I2EA 3B4PA 1PU4A 1Q40B 2GEXA 1GSPA 3F8XA 3FG1A 5CF1A 4R9LA 2CWUA 1DMMA 4O3VA 3SVAA 3D9RA 1HKXA 3JUPA 2HMMB 3RNTA 2W56A 3CC73 1MWSA 4Q53A 1FGMA 4J5GA 3HZPA 1NB5I 4N3VA 4GL6A 1RGCA 3EB8A 5M18A 1RGHA 1BGSA 2YFLB 2CX0A 1U8CB 1B20A
chains in the Genus database with same CATH topology
3RGRA 1QVG2 3H51A 3OWYA 2Z6BA 3GRDA 5IG5A 3S67A 3G16A 4KFEA 2YFIB 3CPOA 2QEX3 2Y73A 3G8ZA 2BMQB 5EQLA 1K8A4 3LH4A 1QALA 2E2VA 2OQEC 4HM2B 4XBYA 3KN4A 1UUWB 1O7MB 3DZLA 1GY6A 3S5CA 1W4NA 3DGLA 3DXOA 3WMDA 2XGLA 2RSXA 3FKAA 1W6CA 1TU5A 3PCRA 2LQVA 5IERA 3D3LA 4IPBA 1W02A 1OHOA 1OCVA 1DMNA 1OGXA 3NM2A 1O7HB 1SQWA 3X40A 3UJMA 3GZBA 3I553 4BTYA 4L8PA 1YHQ3 2MF7A 3WA2X 1E97A 3WA3A 3UL6A 2BT3A 1HU9A 3FG3A 3K0ZA 1Z1SA 4EYCA 4IIAA 2HMKB 3PXMA 3MG1A 3B4OA 3DUKA 4O02B 1OGZA 1J2BA 8CHOA 1RRHA 5BVBA 2F86B 4N6NB 1KQS2 1N5PA 2CWTA 1SIIA 2P0MA 3BB9A 2BO9B 1W00A 1AV4A 4FR9A 1OF5B 2XGNA 4QWTA 3LT8A 3NQZA 3NBBA 3HK4A 4K1VA 3EQQB 4HZ9B 3QRDA 4GB5A 4R9KA 5FW5A 1N5HA 3ER7A 2PZVA 3CCR3 4HJLB 4OUQA 2XF3A 1SJWA 4RZMA 2GU1A 2XRXB 3PZWA 3NM7A 4FCJA 3RGAA 1JB2A 5STDA 4LMIA 2K54A 4MMZB 1LNHA 1MOLA 4J9AA 2GBXB 1YJN3 1Q7Y4 4N6V0 1UI8A 3EF8A 1Q40A 2HMJB 2SBLA 5EEOA 3NHXA 1VQM3 4L8OA 4K90B 1W2B2 3E99A 3Q1CA 2K0MA 1GD4A 1UW1A 2STDA 1GS3A 1WNHA 3SXXA 1Q824 4WYKB 2OTJ3 3SOAA 4KFFA 1L5GB 3EX9A 1RJOA 2BMOB 2RCDA 3EN8A 2C11A 1W7CA 3OXAA 2INXA 1GYBA 3F8HA 3Q2PA 2QIYA 1JRQA 2BNGA 4HM7B 4HYZA 5AYRB 1QVF2 3NUVA 4XBTA 6STDA 1LVNA 3K7CA 3KSED 4N6UA 4WHAA 2OWPA 1VQ73 2P0XA 2IMJA 2KRTA 1F8NA 3IMAB 1JKGB 3GZYB 4HZBB 4LGQA 1Q42A 4PEJA 1VQ93 2WO0A 1AVLA 2IUJA 3FF0A 2YX9A 5AIFA 2GEYA 1N8QA 2CW9A 1FGQA 4JF8A 4MMYB 3U1WA 3LOYA 4L7KA 2C10A 3PYJA 3OWSA 2OQEA 3O8YA 1IVWA 3MKIA 2LYXA 1VQL3 1IV7A 3T8NA 2FGTA 1VQ43 2RGQA 3G4S3 1MNLA 5A0OB 2Z76A 4HKVB 1OUNA 4RNZA 3SX1A 1YGEA 1NO3A 3MWZA 1QMAA 2UX0A 1NWWA 4KZ1A 1M904 1S5AA 4XDWA 1IQXA 4AEQA 4R1KA 4WP5A 2WOFA 1R4CA 3N54B 3KSPA 1OPYA 1E3VA 2CWVA 1TP6A 3CCS3 1WMNA 2XSHB 1FUWA 1V74A 4HM0B 5IG4A 4ORLA 2HMLB 5ELJA 4RBNA 4I4KA 1O7GB 1YVBI 1FA3A 3NBRA 1YJW3 5AIGA 1M9GA 4X2OA 4NREA 3HI7A 1D6ZA 3VGNA 3F9SA 2WGQA 1RRLA 3WOEB 1GY5A 1W01A 3FCSB 1VQ53 5AIHA 4WFOA 4HVNA 2CC3A 4HM8B 2O9UX 3G0KA 1BUQA 1EKMA 3N8BA 5AEWB 1N9EA 2D42A 2XFSA 2IUKA 2P09A 4N6OB 1W6GA 5TGNA 3ROBA 5IW9A 3K9MC 1WTHA 2BMRB 1ASKA 1YIJ3 1JKGA 4WWUC 3JUOA 2XEPA 3G713 3V99A 3WOFB 1C7HA 2GU3A 2Y74A 3JVCA 5CXOA 1JN5A 3TDGA 3DMCA 4U13A 3UB1A 2V1LA 2W04A 2FXTA 2ML6A 4HM4B 3X41A 1FGRA 3NV0B 3B8LA 3GWRA 2P05A 3QK9A 1VQP3 4WYKA 3JUQA 1E3RA 1YJ93 1A67A 1NB3I 2M7OA 1IDPA 3FH1A 4TX4A 1US1A 1K734 2O3OA 3AMOB 4HM3B 3U97A 1DYUA 1AVKA 3VF1A 3GZXB 3X3XA 2JQ5A 5IG3A 1NJI4 5LC6A 2Q07A 4RNYA 3B7CA 3KKGA 1IK3A 5AYSC 1A2VA 2Z77A 4FMAA 1AR0A 3LTAA 2OOVC 3NV0A 1STFI 1ROVA 3UNLA 3SLUA 4K61A 5JPPA 1WMOA 3OWUA 4H61A 4HM1B 5HGRA 1G96A 5EVHA 4AKYA 3BNDA 3NQYA 4EC6A 1CYUA 5CK6A 3HIGA 3GAXA 3H3HA 4R4KA 5LC7A 4HM5B 5D81A 4STDA 3FF2A 3LTCA 3OX9A 4LSOA 2CFLA 2OOVA 3CCQ3 3F14A 3N9HA 2CH9A 4AKZA 1QJGA 2OTL3 2XH9A 1FGOA 1IT8A 2XFTA 3STDA 2QGUA 3MPHA 4ZM8A 1YIT3 1Q864 1QAKA 1DVDA 1KWIA 5AIIA 1JNQA 4MEIA 3DGOA 1LXEA 3K5TA 1VQ83 2JDIH 4FMBA 2QA43 1U5OA 2CHCA 5IENA 1M1XB 1IVXA 1CQSA 1ZX2A 2CFWA 2ZDJA 3DGMA 4HBRA 3V98A 4EBGA 3CMA3 3L0RA 1OHPA 2OCTA 7STDA 1ULJB 2E2UA 2WOHA 3G6E3 2ZL8A 2E2TA 4FMCA 3BNEA 2L4VA 3EN1B 2CFGA 1S723 4CDLA 3CPW2 1OACA 2GXFA 2CG1A 2YFJB 4MJDA 1STDA 1RN7A 1ROAA 3AMOA 1OHSA 3M8CA 3LYGA 2RFRA 1CEWI 5IF6A 1KSIA 4K1UA 4EXRA 3PGBA 1VQK3 2W2CA 1ULIB 5ELUA 3CC23 5JBSA 2D1WA 1TFOA 1Y4KA 2W56B 1VZZA 3MYTA 3RDEA 2PNCA 1W2ZA 1NU3A 3KE7A 3IPTA 4H3UA 3OV4A 1LOXA 3CCM3 2CG0A 2FNQA 3BNCA 1JN5B 2IA7A 3HX8A 1KD14 1YI23 2BHMA 4XM4A 3V92A 2I9WA 4O8SA 3X3YA 3EBYA 3EBTA 1IT7A 5I97A 3CCE3 1ZO2A 1ISKA 2P38A 1A90A 4JRFA 4XDVA 3CCU3 5DREA 5FGOA 3CU3A 2W9QA 1M1K4 2W03A 4HM6B 1K28A 5CF2A 4XBXA 3DGNA 3JUNA 4EV5A 3K63A 1D6UA 2CFDA 5DRVA 3FLJA 4BTXA 4LEHA 3FGYA 3I0YA 1N8R4 1EA2A 3T0UA 1Q814 4BTWA 1DMQA 1UUVB 1K41A 3DY5A 1IQYA 3EJVA 3LT9A 3PS8A 3EC9A 3UL5A 1N9JA 1GY7A 1W6YA 4OVMA 3LTBA 3WODG 3S27A 3F7XA 4R80A 1O7WB 5D83A 2HMOB 5JPUA 1VQ63 3MG2A 3CXC2 1EQKA 4FCZA 3FZWA 3JUMA 1IV9A 3KIIA 1SPUA 2GBWB 3FG4A 3GZRA 1K9M4 3NBJA 1T5YA 3EHCA 2F98A 1KC84 3CCV3 2KCDA 3S29A 3LMLA 1A2KA 2A15A 4KFDA 2R4IA 5AEUB 5G2GA 1O7PB 2XSOB 3CNMA 3I563 1JJ22 1VQN3 1RKYA 3MHEA 2CFKA 3DM8A 5IEOA 1JB4A 1W5ZA 2XR8B 4IT7A 4NHFA 5AI1A 3LZAA 3PCSA 3Q90A 1NDOB 1JV2B 3SEDA 3FSDA 5CLKA 3KFQC 1UI7A 2F99A 3MG3A 3ECFA 3X42A 1IVVA 1TUHA 2HMNB 2W9PA 3WDGB 4G1MB 3EE1A 5D82A 1SIHA 4FMDA 1WQLB 2Z7AA 3LTDA 1EG9B 3MSOA 4KVHA 4N6TA 2B24B 3CCL3 1VQO3 3F7SA 3HIIA 3SOYA 1TFKA 1O7NB 4N6LA 2B1XB 1QAFA 1FGTA 3NX0A 3CME3 4J8TA 3A76A 4X2HA 2W6JH 1TIJA 2CKFB 3T8UA 5IG0A 1JB5A 1PFPA 1IVUA 4CCVA 5BXQA 5IEPA 1OH0A 3X3ZA 3CC43 3IJEB 3BLZA 3F40A 3CNXA 2CK3H 5KP3A 4EV2A 1OF5A 3LXUX 2ML5A 1DVCA 1D6YA 1GD3A 2MC8A 2KXGA 3J7Yd 2WGOA 1WMPA 3KZTA 4XB5A 5KP1A 3OW22 4FCMA 3CCJ3 3NXJA 3ALAA 1IU7A 3S28A 3BNBA 2W0QA 1IQ8A 1CYVA 3VSYA 5KP4A 4N6MA 4LZIA 2CIUA 4OK0A 4MMXB 4O2HA 3CD63 3B4PA 1PU4A 1Q40B 2GEXA 3F8XA 3FG1A 5CF1A 4R9LA 2CWUA 1DMMA 4O3VA 3SVAA 3D9RA 1HKXA 3JUPA 2HMMB 2W56A 3CC73 4Q53A 1FGMA 1NB5I 3HZPA 4N3VA 4GL6A 3EB8A 2YFLB 1U8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUV A;  3RGR A;  4XBT A;  3B7C A;  3EJV A;  3H51 A;  3OWY A;  3EC9 A;  3GRD A;  3K7C A;  3KKG A;  6STD A;  2OWP A;  3G16 A;  5IG5 A;  1GY7 A;  2IMJ A;  1W6Y A;  2YFI B;  4OVM A;  2Z77 A;  3CPO A;  3F7X A;  1JKG B;  3GZY B;  1AR0 A;  2BMQ B;  1Q42 A;  1O7W B;  3G8Z A;  4HZB B;  3NV0 A;  4LGQ A;  4PEJ A;  5D83 A;  2HMO B;  5JPU A;  3UNL A;  3MG2 A;  3FF0 A;  4HM2 B;  5AIF A;  4XBY A;  3OWU A;  5JPP A;  2GEY A;  4HM1 B;  5HGR A;  1UUW B;  1O7M B;  3FZW A;  3JUM A;  5EVH A;  3DZL A;  2GBW B;  1GY6 A;  4L7K A;  3S5C A;  3OWS A;  3GZR A;  5CK6 A;  3WMD A;  3DXO A;  5CF2 A;  3MKI A;  3FKA A;  3H3H A;  4HM5 B;  3EHC A;  3T8N A;  2F98 A;  2RGQ A;  4STD A;  3FF2 A;  5D81 A;  3OX9 A;  5IER A;  1A2K A;  2A15 A;  2Z76 A;  1W02 A;  1OUN A;  3F14 A;  2R4I A;  4HKV B;  1QJG A;  5AEU B;  1OHO A;  5G2G A;  1O7P B;  2XSO B;  3CNM A;  1OCV A;  1DMN A;  3STD A;  2QGU A;  1QMA A;  1OGX A;  2UX0 A;  3MHE A;  3DM8 A;  5IEO A;  1JB4 A;  1NWW A;  3NM2 A;  5AII A;  1O7H B;  3UJM A;  3GZB A;  2XR8 B;  1S5A A;  4XDW A;  4L8P A;  3LZA A;  5AI1 A;  5CLK A;  3Q90 A;  4R1K A;  4WP5 A;  1NDO B;  1U5O A;  2CHC A;  1E97 A;  5IEN A;  3SED A;  3FSD A;  1OPY A;  1E3V A;  3KSP A;  1CQS A;  1TP6 A;  1ZX2 A;  2F99 A;  2XSH B;  3MG3 A;  3ECF A;  4HM0 B;  5IG4 A;  4ORL A;  2HML B;  1OHP A;  7STD A;  1ULJ B;  4I4K A;  1O7G B;  1Z1S A;  3K0Z A;  1TUH A;  3NBR A;  4IIA A;  2HMK B;  3MG1 A;  3B4O A;  3DUK A;  2HMN B;  5AIG A;  4X2O A;  3EN1 B;  1OGZ A;  4CDL A;  8CHO A;  5BVB A;  5D82 A;  2GXF A;  2YFJ B;  3VGN A;  1WQL B;  2Z7A A;  3F9S A;  1EG9 B;  3MSO A;  2F86 B;  4KVH A;  2B24 B;  4MJD A;  3F7S A;  1STD A;  3SOY A;  1O7N B;  1GY5 A;  3BB9 A;  2B1X B;  1W00 A;  1W01 A;  1OHS A;  3M8C A;  3LYG A;  4J8T A;  1OF5 B;  2RFR A;  3A76 A;  5AIH A;  5IF6 A;  4X2H A;  4K1U A;  4HVN A;  2W2C A;  1ULI B;  3EQQ B;  2CKF B;  3HK4 A;  4HM8 B;  4K1V A;  5IG0 A;  1JB5 A;  4HZ9 B;  3T8U A;  3G0K A;  1BUQ A;  4GB5 A;  5AEW B;  5BXQ A;  5IEP A;  4R9K A;  1OH0 A;  5FW5 A;  3BLZ A;  2PZV A;  3ER7 A;  5TGN A;  3F40 A;  3ROB A;  1VZZ A;  4HJL B;  3CNX A;  3MYT A;  5KP3 A;  4OUQ A;  1NU3 A;  1SJW A;  3KE7 A;  4RZM A;  3IPT A;  2BMR B;  1OF5 A;  2XRX B;  1ASK A;  4H3U A;  3OV4 A;  1JKG A;  4WWU C;  3JUO A;  4FCJ A;  1JN5 B;  1JB2 A;  5STD A;  3RGA A;  1C7H A;  3HX8 A;  4LMI A;  2K54 A;  3KZT A;  4XB5 A;  5CXO A;  5KP1 A;  1JN5 A;  4J9A A;  3DMC A;  4U13 A;  4XM4 A;  4FCM A;  2GBX B;  3NXJ A;  2I9W A;  4HM4 B;  3EBY A;  3VSY A;  3EBT A;  5KP4 A;  3EF8 A;  1Q40 A;  2HMJ B;  3NV0 B;  3NHX A;  1ISK A;  1ZO2 A;  3B8L A;  3GWR A;  4L8O A;  3B4P A;  4WYK A;  1Q40 B;  2GEX A;  3E99 A;  3F8X A;  4XDV A;  3JUQ A;  3CU3 A;  5DRE A;  1E3R A;  5CF1 A;  4R9L A;  2STD A;  1GS3 A;  1IDP A;  1DMM A;  3FH1 A;  4HM6 B;  4WYK B;  3D9R A;  1HKX A;  3JUP A;  2HMM B;  3JUN A;  4XBX A;  3SOA A;  3EX9 A;  4HM3 B;  2BMO B;  2RCD A;  3EN8 A;  3HZP A;  4Q53 A;  4N3V A;  5DRV A;  3FLJ A;  2QIY A;  3OXA A;  3GZX B;  4LEH A;  2INX A;  3FGY A;  2YFL B;  1GYB A;  1EA2 A;  2JQ5 A;  3F8H A;  5IG3 A;  1DMQ A;  1UUV B;  1K41 A;  2BNG A;  4HM7 B;  3I0Y A; 
#chains in the Genus database with same CATH topology
 3RGR A;  1QVG 2;  3AHW A;  3H51 A;  3OWY A;  2Z6B A;  3GRD A;  2F5M A;  4CPK A;  1LNI A;  1X1U A;  3G16 A;  4KFE A;  3S67 A;  5IG5 A;  2YFI B;  1BOX A;  3CPO A;  2QEX 3;  2Y73 A;  1R4Y A;  2BMQ B;  3G8Z A;  5EQL A;  1K8A 4;  3LH4 A;  1JZD A;  1QAL A;  2E2V A;  2OQE C;  4HM2 B;  4XBY A;  3KN4 A;  1UUW B;  1O7M B;  4BU4 A;  3DZL A;  1GY6 A;  3S5C A;  1W4N A;  3DGL A;  1BRI A;  3DXO A;  2XGL A;  2RSX A;  3FKA A;  3WMD A;  1W6C A;  3SXX A;  5RNT A;  1TU5 A;  3PCR A;  3URP A;  1DET A;  2LQV A;  1RN4 A;  5IER A;  3D3L A;  4IPB A;  1W02 A;  1BNI A;  1UCI A;  1OHO A;  1PY3 A;  1OCV A;  1DMN A;  1B2U A;  1OGX A;  2AAE A;  1B2S A;  2L1S A;  3NM2 A;  1O7H B;  1SQW A;  3X40 A;  3UJM A;  1MWT A;  3GZB A;  3I55 3;  1LOY A;  1GOU A;  4BTY A;  4L8P A;  1YHQ 3;  2IY2 A;  3ZFZ A;  2MF7 A;  3WA2 X;  1E97 A;  2H0H A;  3UL6 A;  3WA3 A;  1UDI I;  2BT3 A;  1HU9 A;  3FG3 A;  3K0Z A;  1Z1S A;  2UGI A;  4EYC A;  4IIA A;  2HMK B;  3PXM A;  3MG1 A;  3B4O A;  3DUK A;  3DGY A;  4O02 B;  2CX1 A;  1OGZ A;  2IYJ A;  6RNT A;  1J2B A;  8CHO A;  1RRH A;  5BVB A;  2F86 B;  1CH0 A;  4N6N B;  1KQS 2;  1T2I A;  2CWT A;  1N5P A;  1SII A;  2P0M A;  1B2Z A;  3BB9 A;  3KCH A;  2BO9 B;  1W00 A;  2F56 A;  3D5I A;  1AV4 A;  4FR9 A;  1OF5 B;  2XGN A;  4QWT A;  3LT8 A;  3NQZ A;  3NBB A;  3HK4 A;  4K1V A;  3EQQ B;  3AHS A;  4HZ9 B;  3QRD A;  4GB5 A;  1YGW A;  4R9K A;  1ZGX A;  5FW5 A;  2OTJ 3;  1N5H A;  4BL3 A;  1I2G A;  3ER7 A;  2PZV A;  3CCR 3;  2C4B A;  3DH2 A;  4HJL B;  3WR2 A;  4OUQ A;  2XF3 A;  1SJW A;  4RZM A;  2GU1 A;  2XRX B;  3PZW A;  3NM7 A;  4FCJ A;  1BRK A;  1JB2 A;  4ILF A;  5STD A;  3RGA A;  4LMI A;  1FZU A;  4NPB A;  2K54 A;  4MMZ B;  1HYF A;  1LNH A;  1MOL A;  4J9A A;  2GBX B;  1YJN 3;  1Q7Y 4;  4N6V 0;  1UI8 A;  3EF8 A;  1Q40 A;  2HMJ B;  2SBL A;  5EEO A;  1LOW A;  3NHX A;  1VQM 3;  1MGR A;  1UGH I;  1V57 A;  4K90 B;  4L8O A;  4LYL B;  1W2B 2;  3E99 A;  3Q1C A;  2K0M A;  1GD4 A;  1UW1 A;  2STD A;  1GS3 A;  1WNH A;  4I5Q A;  1X1W A;  1ZS7 A;  2H0I A;  1BSE A;  4WYK B;  1LQG C;  4KFF A;  3SOA A;  6GSP A;  1BNE A;  1L5G B;  3EX9 A;  1RJO A;  2BMO B;  2RCD A;  1FUS A;  2C11 A;  2UUG C;  3EN8 A;  7GSP A;  1W7C A;  3OXA A;  1FYS A;  2INX A;  2KF6 A;  1GYB A;  3F8H A;  3Q2P A;  2QIY A;  1JRQ A;  2BNG A;  4HM7 B;  4HYZ A;  5AYR B;  1QVF 2;  3NUV A;  1EUI C;  4XBT A;  6STD A;  1LVN A;  3K7C A;  3KSE D;  4N6U A;  4WHA A;  2OWP A;  1MWR A;  1VQ7 3;  2P0X A;  2IMJ A;  1YNV X;  2KRT A;  2RNT A;  1F8N A;  3IMA B;  1JKG B;  3GZY B;  4HZB B;  4LGQ A;  1Q42 A;  4PEJ A;  1VQ9 3;  1PYL A;  2WO0 A;  1AVL A;  2IUJ A;  3FF0 A;  2YX9 A;  5AIF A;  2GEY A;  1N8Q A;  2CW9 A;  1FGQ A;  4JF8 A;  4MMY B;  1I3F A;  3LOY A;  4L7K A;  3U1W A;  1NNV A;  2C10 A;  3OWS A;  3PYJ A;  2OQE A;  3O8Y A;  1B2X A;  1IVW A;  3MKI A;  1Q82 4;  2LYX A;  1B2M A;  1VQL 3;  1IV7 A;  1BRN L;  3T8N A;  2FGT A;  4BL2 A;  1VQ4 3;  1BNR A;  2RGQ A;  3G4S 3;  1MNL A;  1RDS A;  5A0O B;  2Z76 A;  4HKV B;  1OUN A;  1TJD A;  1DE3 A;  4RNZ A;  3SX1 A;  1YGE A;  1A2P A;  1NO3 A;  1RN1 A;  3MWZ A;  1QMA A;  2UX0 A;  1NWW A;  5BIR A;  4KZ1 A;  1M90 4;  1S5A A;  4XDW A;  1C54 A;  1RGK A;  1UGI A;  1IQX A;  4AEQ A;  4R1K A;  4WP5 A;  2WOF A;  1R4C A;  3N54 B;  2BU4 A;  1TRP A;  1OPY A;  1E3V A;  2CWV A;  1TP6 A;  3KSP A;  1WMN A;  2XSH B;  3CCS 3;  1V74 A;  1FUW A;  1BNJ A;  4HM0 B;  5IG4 A;  4ORL A;  2HML B;  5ELJ A;  4RBN A;  4I4K A;  1O7G B;  1YVB I;  1FA3 A;  3NBR A;  1YJW 3;  1RNB A;  5AIG A;  1M9G A;  4X2O A;  4NRE A;  3HI7 A;  1VQQ A;  2RBI A;  2KAA A;  1D6Z A;  1I0V A;  3VGN A;  3F9S A;  3ZG0 A;  2WGQ A;  1RRL A;  3WOE B;  1BSD A;  1GY5 A;  1W01 A;  3FCS B;  1VQ5 3;  5AIH A;  1RGL A;  4WFO A;  4HVN A;  2CC3 A;  4HM8 B;  1B27 A;  2F5W A;  2O9U X;  3G0K A;  1BUQ A;  1EKM A;  4BIR A;  3N8B A;  5AEW B;  1N9E A;  1BRJ A;  2D42 A;  2IUK A;  2XFS A;  2P09 A;  4N6O B;  1W6G A;  5TGN A;  3ROB A;  1RGA A;  7RNT A;  3K9M C;  1WTH A;  5IW9 A;  3A5E A;  2BMR B;  1ASK A;  1YIJ 3;  1JKG A;  4WWU C;  3JUO A;  2XEP A;  4CJN A;  4J5K A;  3G71 3;  3V99 A;  3WOF B;  1C7H A;  2GU3 A;  2Y74 A;  3JVC A;  5CXO A;  1JN5 A;  3TDG A;  3DMC A;  4U13 A;  3UB1 A;  2H0G A;  2V1L A;  2W04 A;  2FXT A;  3D5G A;  2ML6 A;  4HM4 B;  3X41 A;  1FGR A;  3NV0 B;  3B8L A;  3GWR A;  2P05 A;  3QK9 A;  3ZG5 A;  1VQP 3;  4WYK A;  3JUQ A;  1E3R A;  1YJ9 3;  1A67 A;  1NB3 I;  1V58 A;  1IDP A;  2M7O A;  3FH1 A;  4TX4 A;  1US1 A;  1K73 4;  4GSP A;  2O3O A;  3AMO B;  1T3B A;  1BAN A;  4HM3 B;  3U97 A;  1DYU A;  1AVK A;  1GMP A;  3GZX B;  3VF1 A;  3X3X A;  2JQ5 A;  5IG3 A;  1NJI 4;  1UCK A;  5LC6 A;  1HZ1 A;  9RNT A;  2Q07 A;  4RNY A;  1BSA A;  3B7C A;  3KKG A;  1B21 A;  1GMR A;  1IK3 A;  1JBR A;  5AYS C;  1A2V A;  2Z77 A;  4FMA A;  5G1L A;  1LOV A;  1AR0 A;  3LTA A;  2OOV C;  3NV0 A;  1STF I;  2ZHX B;  1ROV A;  3UNL A;  3SLU A;  4K61 A;  5JPP A;  1WMO A;  3OWU A;  4H61 A;  4HM1 B;  5HGR A;  1G96 A;  5EVH A;  1RCL A;  3BND A;  4AKY A;  3NQY A;  3BIR A;  1GMQ A;  3SYU A;  4EC6 A;  1CYU A;  5CK6 A;  3HIG A;  3GAX A;  4RNT A;  3AGO A;  3H3H A;  4R4K A;  5LC7 A;  4HM5 B;  1AY7 A;  5D81 A;  4STD A;  3FF2 A;  3LTC A;  3OX9 A;  4LSO A;  2CFL A;  2OOV A;  3CCQ 3;  3F14 A;  3N9H A;  1BSC A;  1LRA A;  1QJG A;  2CH9 A;  4AKZ A;  5G1K A;  2OTL 3;  2XH9 A;  1FGO A;  1IT8 A;  2XFT A;  3STD A;  2QGU A;  3MPH A;  4ZM8 A;  1YIT 3;  1Q86 4;  1QAK A;  3D4A A;  1DVD A;  1KWI A;  5AII A;  1JNQ A;  2SAR A;  4MEI A;  5GSP A;  1RGF A;  1X1X A;  3DGO A;  1LXE A;  3K5T A;  1VQ8 3;  2JDI H;  4FMB A;  2QA4 3;  1U5O A;  2CHC A;  2R41 A;  5IEN A;  1IVX A;  1M1X B;  1ZX2 A;  1CQS A;  1UCJ A;  2CFW A;  2ZDJ A;  3DGM A;  4HBR A;  3V98 A;  1EEJ A;  3L0R A;  3WHO A;  4EBG A;  3CMA 3;  2K3D A;  4GHO A;  1OHP A;  2OCT A;  7STD A;  1ULJ B;  2E2U A;  2WOH A;  3D79 A;  3G6E 3;  1UCL A;  2ZL8 A;  1G0T A;  1AQZ A;  2E2T A;  2AAD A;  3BNE A;  4FMC A;  2L4V A;  3EN1 B;  2CFG A;  1S72 3;  4CDL A;  3CPW 2;  1BRS A;  1OAC A;  1UUG B;  2GXF A;  2CG1 A;  2YFJ B;  4DKI A;  1BVI A;  1BU4 A;  4MJD A;  1STD A;  1JBS A;  1RN7 A;  1Q7H A;  1ROA A;  3AMO A;  1BSB A;  1OHS A;  2J8X B;  3M8C A;  1RGG A;  1BIR A;  2RFR A;  3LYG A;  1CEW I;  4HOH A;  2BIR A;  1KSI A;  1RGE A;  4K1U A;  4EXR A;  3PGB A;  5IF6 A;  1VQK 3;  1BRG A;  1ULI B;  2W2C A;  5ELU A;  3CC2 3;  5JBS A;  2D1W A;  1TFO A;  1Y4K A;  2W56 B;  1VZZ A;  3MYT A;  3RDE A;  2PNC A;  1W2Z A;  1NU3 A;  1TRQ A;  1I0X A;  3KE7 A;  3IPT A;  4H3U A;  3OV4 A;  1LOX A;  3CCM 3;  1SAR A;  2CG0 A;  2FNQ A;  3BNC A;  1JN5 B;  2IA7 A;  3HX8 A;  8RNT A;  1KD1 4;  1YI2 3;  1RTU A;  2BHM A;  2KF5 A;  4XM4 A;  3V92 A;  2I9W A;  4O8S A;  3X3Y A;  2HOH A;  3EBY A;  1MGW A;  3EBT A;  1RNT A;  1IT7 A;  5I97 A;  3CCE 3;  1ZO2 A;  1ISK A;  2P38 A;  1A90 A;  1RLS A;  4JRF A;  4XDV A;  3CCU 3;  1I3I A;  5DRE A;  5FGO A;  3CU3 A;  2W9Q A;  1M1K 4;  2W03 A;  4HM6 B;  1K28 A;  5CF2 A;  4XBX A;  3DGN A;  1I8V A;  3JUN A;  3K63 A;  1D6U A;  4EV5 A;  1BNG A;  2CFD A;  5DRV A;  3FLJ A;  1RSN A;  4BTX A;  1RHL A;  4LEH A;  3FGY A;  3I0Y A;  1N8R 4;  1X1Y A;  1EA2 A;  3T0U A;  1Q81 4;  4BTW A;  1DMQ A;  1UUV B;  1K41 A;  3DY5 A;  1IQY A;  1LQM B;  3EJV A;  3LT9 A;  3PS8 A;  3EC9 A;  3UL5 A;  1BUJ A;  1N9J A;  1GY7 A;  2GSP A;  1W6Y A;  3HOH A;  4OVM A;  3LTB A;  3WOD G;  3S27 A;  3F7X A;  3GSP A;  4R80 A;  1O7W B;  5D83 A;  2HMO B;  5JPU A;  1VQ6 3;  3MG2 A;  3CXC 2;  1EQK A;  4FCZ A;  1GOV A;  3FZW A;  3JUM A;  1IV9 A;  3KII A;  1RMS A;  1SPU A;  2GBW B;  3FG4 A;  3GZR A;  1K9M 4;  3NBJ A;  1T5Y A;  3EHC A;  2F98 A;  1KC8 4;  5HOH A;  3CCV 3;  2KCD A;  3S29 A;  1FW7 A;  3LML A;  1A2K A;  2A15 A;  1JBT A;  4KFD A;  2R4I A;  5AEU B;  1JZO A;  5G2G A;  1O7P B;  2XSO B;  3CNM A;  3I56 3;  1JJ2 2;  1VQN 3;  1RKY A;  3MHE A;  2CFK A;  3DM8 A;  5IEO A;  1JB4 A;  1G02 A;  1W5Z A;  1RCK A;  2XR8 B;  4IT7 A;  4NHF A;  5AI1 A;  3BU4 A;  3LZA A;  3PCS A;  1BAO A;  3Q90 A;  1NDO B;  1JV2 B;  3SED A;  3FSD A;  2F4Y A;  3KFQ C;  4KT3 B;  5CLK A;  1UI7 A;  2F99 A;  3MG3 A;  3ECF A;  3X42 A;  1IVV A;  1TUH A;  3Q3F A;  2HMN B;  2W9P A;  3WDG B;  1I2F A;  1BRH A;  4EW5 A;  2KF3 A;  1GOY A;  2ZA4 A;  4G1M B;  3EE1 A;  5D82 A;  1SIH A;  4FMD A;  1WQL B;  2Z7A A;  3LTD A;  1EG9 B;  3MSO A;  4KVH A;  4N6T A;  1MWU A;  2B24 B;  1BNS A;  3CCL 3;  1VQO 3;  1I70 A;  3F7S A;  3HII A;  3SOY A;  1TFK A;  1O7N B;  4N6L A;  1YVS A;  2B1X B;  1QAF A;  1FGT A;  3NX0 A;  3CME 3;  1B3S A;  4J8T A;  3A76 A;  4HAA A;  4X2H A;  2W6J H;  1TIJ A;  2CKF B;  3T8U A;  5IG0 A;  1JB5 A;  1PFP A;  3AGN A;  1IVU A;  4CCV A;  5BXQ A;  5IEP A;  1OH0 A;  3X3Z A;  3CC4 3;  3IJE B;  3BLZ A;  3F40 A;  3CNX A;  2CK3 H;  5KP3 A;  4EV2 A;  1OF5 A;  1Q9E A;  3LXU X;  5BU4 A;  2ML5 A;  1DVC A;  1D6Y A;  1GD3 A;  2MC8 A;  2KXG A;  3J7Y d;  2WGO A;  1IYY A;  1WMP A;  1BNF A;  3KZT A;  1T2H A;  4XB5 A;  5KP1 A;  3OW2 2;  1FUT A;  4FCM A;  5M19 A;  3CCJ 3;  3NXJ A;  3ALA A;  1IU7 A;  3S28 A;  1TTO A;  3BNB A;  2W0Q A;  1IQ8 A;  1CYV A;  3VSY A;  5KP4 A;  4N6M A;  2KF4 A;  2CIU A;  4LZI A;  4OK0 A;  5M1A A;  4MMX B;  4O2H A;  3CD6 3;  1I2E A;  3B4P A;  1PU4 A;  1Q40 B;  2GEX A;  1GSP A;  3F8X A;  3FG1 A;  5CF1 A;  4R9L A;  2CWU A;  1DMM A;  4O3V A;  3SVA A;  3D9R A;  1HKX A;  3JUP A;  2HMM B;  3RNT A;  2W56 A;  3CC7 3;  1MWS A;  4Q53 A;  1FGM A;  4J5G A;  3HZP A;  1NB5 I;  4N3V A;  4GL6 A;  1RGC A;  3EB8 A;  5M18 A;  1RGH A;  1BGS A;  2YFL B;  2CX0 A;  1U8C B;  1B20 A; 
#chains in the Genus database with same CATH homology
 3RGR A;  1QVG 2;  3H51 A;  3OWY A;  2Z6B A;  3GRD A;  5IG5 A;  3S67 A;  3G16 A;  4KFE A;  2YFI B;  3CPO A;  2QEX 3;  2Y73 A;  3G8Z A;  2BMQ B;  5EQL A;  1K8A 4;  3LH4 A;  1QAL A;  2E2V A;  2OQE C;  4HM2 B;  4XBY A;  3KN4 A;  1UUW B;  1O7M B;  3DZL A;  1GY6 A;  3S5C A;  1W4N A;  3DGL A;  3DXO A;  3WMD A;  2XGL A;  2RSX A;  3FKA A;  1W6C A;  1TU5 A;  3PCR A;  2LQV A;  5IER A;  3D3L A;  4IPB A;  1W02 A;  1OHO A;  1OCV A;  1DMN A;  1OGX A;  3NM2 A;  1O7H B;  1SQW A;  3X40 A;  3UJM A;  3GZB A;  3I55 3;  4BTY A;  4L8P A;  1YHQ 3;  2MF7 A;  3WA2 X;  1E97 A;  3WA3 A;  3UL6 A;  2BT3 A;  1HU9 A;  3FG3 A;  3K0Z A;  1Z1S A;  4EYC A;  4IIA A;  2HMK B;  3PXM A;  3MG1 A;  3B4O A;  3DUK A;  4O02 B;  1OGZ A;  1J2B A;  8CHO A;  1RRH A;  5BVB A;  2F86 B;  4N6N B;  1KQS 2;  1N5P A;  2CWT A;  1SII A;  2P0M A;  3BB9 A;  2BO9 B;  1W00 A;  1AV4 A;  4FR9 A;  1OF5 B;  2XGN A;  4QWT A;  3LT8 A;  3NQZ A;  3NBB A;  3HK4 A;  4K1V A;  3EQQ B;  4HZ9 B;  3QRD A;  4GB5 A;  4R9K A;  5FW5 A;  1N5H A;  3ER7 A;  2PZV A;  3CCR 3;  4HJL B;  4OUQ A;  2XF3 A;  1SJW A;  4RZM A;  2GU1 A;  2XRX B;  3PZW A;  3NM7 A;  4FCJ A;  3RGA A;  1JB2 A;  5STD A;  4LMI A;  2K54 A;  4MMZ B;  1LNH A;  1MOL A;  4J9A A;  2GBX B;  1YJN 3;  1Q7Y 4;  4N6V 0;  1UI8 A;  3EF8 A;  1Q40 A;  2HMJ B;  2SBL A;  5EEO A;  3NHX A;  1VQM 3;  4L8O A;  4K90 B;  1W2B 2;  3E99 A;  3Q1C A;  2K0M A;  1GD4 A;  1UW1 A;  2STD A;  1GS3 A;  1WNH A;  3SXX A;  1Q82 4;  4WYK B;  2OTJ 3;  3SOA A;  4KFF A;  1L5G B;  3EX9 A;  1RJO A;  2BMO B;  2RCD A;  3EN8 A;  2C11 A;  1W7C A;  3OXA A;  2INX A;  1GYB A;  3F8H A;  3Q2P A;  2QIY A;  1JRQ A;  2BNG A;  4HM7 B;  4HYZ A;  5AYR B;  1QVF 2;  3NUV A;  4XBT A;  6STD A;  1LVN A;  3K7C A;  3KSE D;  4N6U A;  4WHA A;  2OWP A;  1VQ7 3;  2P0X A;  2IMJ A;  2KRT A;  1F8N A;  3IMA B;  1JKG B;  3GZY B;  4HZB B;  4LGQ A;  1Q42 A;  4PEJ A;  1VQ9 3;  2WO0 A;  1AVL A;  2IUJ A;  3FF0 A;  2YX9 A;  5AIF A;  2GEY A;  1N8Q A;  2CW9 A;  1FGQ A;  4JF8 A;  4MMY B;  3U1W A;  3LOY A;  4L7K A;  2C10 A;  3PYJ A;  3OWS A;  2OQE A;  3O8Y A;  1IVW A;  3MKI A;  2LYX A;  1VQL 3;  1IV7 A;  3T8N A;  2FGT A;  1VQ4 3;  2RGQ A;  3G4S 3;  1MNL A;  5A0O B;  2Z76 A;  4HKV B;  1OUN A;  4RNZ A;  3SX1 A;  1YGE A;  1NO3 A;  3MWZ A;  1QMA A;  2UX0 A;  1NWW A;  4KZ1 A;  1M90 4;  1S5A A;  4XDW A;  1IQX A;  4AEQ A;  4R1K A;  4WP5 A;  2WOF A;  1R4C A;  3N54 B;  3KSP A;  1OPY A;  1E3V A;  2CWV A;  1TP6 A;  3CCS 3;  1WMN A;  2XSH B;  1FUW A;  1V74 A;  4HM0 B;  5IG4 A;  4ORL A;  2HML B;  5ELJ A;  4RBN A;  4I4K A;  1O7G B;  1YVB I;  1FA3 A;  3NBR A;  1YJW 3;  5AIG A;  1M9G A;  4X2O A;  4NRE A;  3HI7 A;  1D6Z A;  3VGN A;  3F9S A;  2WGQ A;  1RRL A;  3WOE B;  1GY5 A;  1W01 A;  3FCS B;  1VQ5 3;  5AIH A;  4WFO A;  4HVN A;  2CC3 A;  4HM8 B;  2O9U X;  3G0K A;  1BUQ A;  1EKM A;  3N8B A;  5AEW B;  1N9E A;  2D42 A;  2XFS A;  2IUK A;  2P09 A;  4N6O B;  1W6G A;  5TGN A;  3ROB A;  5IW9 A;  3K9M C;  1WTH A;  2BMR B;  1ASK A;  1YIJ 3;  1JKG A;  4WWU C;  3JUO A;  2XEP A;  3G71 3;  3V99 A;  3WOF B;  1C7H A;  2GU3 A;  2Y74 A;  3JVC A;  5CXO A;  1JN5 A;  3TDG A;  3DMC A;  4U13 A;  3UB1 A;  2V1L A;  2W04 A;  2FXT A;  2ML6 A;  4HM4 B;  3X41 A;  1FGR A;  3NV0 B;  3B8L A;  3GWR A;  2P05 A;  3QK9 A;  1VQP 3;  4WYK A;  3JUQ A;  1E3R A;  1YJ9 3;  1A67 A;  1NB3 I;  2M7O A;  1IDP A;  3FH1 A;  4TX4 A;  1US1 A;  1K73 4;  2O3O A;  3AMO B;  4HM3 B;  3U97 A;  1DYU A;  1AVK A;  3VF1 A;  3GZX B;  3X3X A;  2JQ5 A;  5IG3 A;  1NJI 4;  5LC6 A;  2Q07 A;  4RNY A;  3B7C A;  3KKG A;  1IK3 A;  5AYS C;  1A2V A;  2Z77 A;  4FMA A;  1AR0 A;  3LTA A;  2OOV C;  3NV0 A;  1STF I;  1ROV A;  3UNL A;  3SLU A;  4K61 A;  5JPP A;  1WMO A;  3OWU A;  4H61 A;  4HM1 B;  5HGR A;  1G96 A;  5EVH A;  4AKY A;  3BND A;  3NQY A;  4EC6 A;  1CYU A;  5CK6 A;  3HIG A;  3GAX A;  3H3H A;  4R4K A;  5LC7 A;  4HM5 B;  5D81 A;  4STD A;  3FF2 A;  3LTC A;  3OX9 A;  4LSO A;  2CFL A;  2OOV A;  3CCQ 3;  3F14 A;  3N9H A;  2CH9 A;  4AKZ A;  1QJG A;  2OTL 3;  2XH9 A;  1FGO A;  1IT8 A;  2XFT A;  3STD A;  2QGU A;  3MPH A;  4ZM8 A;  1YIT 3;  1Q86 4;  1QAK A;  1DVD A;  1KWI A;  5AII A;  1JNQ A;  4MEI A;  3DGO A;  1LXE A;  3K5T A;  1VQ8 3;  2JDI H;  4FMB A;  2QA4 3;  1U5O A;  2CHC A;  5IEN A;  1M1X B;  1IVX A;  1CQS A;  1ZX2 A;  2CFW A;  2ZDJ A;  3DGM A;  4HBR A;  3V98 A;  4EBG A;  3CMA 3;  3L0R A;  1OHP A;  2OCT A;  7STD A;  1ULJ B;  2E2U A;  2WOH A;  3G6E 3;  2ZL8 A;  2E2T A;  4FMC A;  3BNE A;  2L4V A;  3EN1 B;  2CFG A;  1S72 3;  4CDL A;  3CPW 2;  1OAC A;  2GXF A;  2CG1 A;  2YFJ B;  4MJD A;  1STD A;  1RN7 A;  1ROA A;  3AMO A;  1OHS A;  3M8C A;  3LYG A;  2RFR A;  1CEW I;  5IF6 A;  1KSI A;  4K1U A;  4EXR A;  3PGB A;  1VQK 3;  2W2C A;  1ULI B;  5ELU A;  3CC2 3;  5JBS A;  2D1W A;  1TFO A;  1Y4K A;  2W56 B;  1VZZ A;  3MYT A;  3RDE A;  2PNC A;  1W2Z A;  1NU3 A;  3KE7 A;  3IPT A;  4H3U A;  3OV4 A;  1LOX A;  3CCM 3;  2CG0 A;  2FNQ A;  3BNC A;  1JN5 B;  2IA7 A;  3HX8 A;  1KD1 4;  1YI2 3;  2BHM A;  4XM4 A;  3V92 A;  2I9W A;  4O8S A;  3X3Y A;  3EBY A;  3EBT A;  1IT7 A;  5I97 A;  3CCE 3;  1ZO2 A;  1ISK A;  2P38 A;  1A90 A;  4JRF A;  4XDV A;  3CCU 3;  5DRE A;  5FGO A;  3CU3 A;  2W9Q A;  1M1K 4;  2W03 A;  4HM6 B;  1K28 A;  5CF2 A;  4XBX A;  3DGN A;  3JUN A;  4EV5 A;  3K63 A;  1D6U A;  2CFD A;  5DRV A;  3FLJ A;  4BTX A;  4LEH A;  3FGY A;  3I0Y A;  1N8R 4;  1EA2 A;  3T0U A;  1Q81 4;  4BTW A;  1DMQ A;  1UUV B;  1K41 A;  3DY5 A;  1IQY A;  3EJV A;  3LT9 A;  3PS8 A;  3EC9 A;  3UL5 A;  1N9J A;  1GY7 A;  1W6Y A;  4OVM A;  3LTB A;  3WOD G;  3S27 A;  3F7X A;  4R80 A;  1O7W B;  5D83 A;  2HMO B;  5JPU A;  1VQ6 3;  3MG2 A;  3CXC 2;  1EQK A;  4FCZ A;  3FZW A;  3JUM A;  1IV9 A;  3KII A;  1SPU A;  2GBW B;  3FG4 A;  3GZR A;  1K9M 4;  3NBJ A;  1T5Y A;  3EHC A;  2F98 A;  1KC8 4;  3CCV 3;  2KCD A;  3S29 A;  3LML A;  1A2K A;  2A15 A;  4KFD A;  2R4I A;  5AEU B;  5G2G A;  1O7P B;  2XSO B;  3CNM A;  3I56 3;  1JJ2 2;  1VQN 3;  1RKY A;  3MHE A;  2CFK A;  3DM8 A;  5IEO A;  1JB4 A;  1W5Z A;  2XR8 B;  4IT7 A;  4NHF A;  5AI1 A;  3LZA A;  3PCS A;  3Q90 A;  1NDO B;  1JV2 B;  3SED A;  3FSD A;  5CLK A;  3KFQ C;  1UI7 A;  2F99 A;  3MG3 A;  3ECF A;  3X42 A;  1IVV A;  1TUH A;  2HMN B;  2W9P A;  3WDG B;  4G1M B;  3EE1 A;  5D82 A;  1SIH A;  4FMD A;  1WQL B;  2Z7A A;  3LTD A;  1EG9 B;  3MSO A;  4KVH A;  4N6T A;  2B24 B;  3CCL 3;  1VQO 3;  3F7S A;  3HII A;  3SOY A;  1TFK A;  1O7N B;  4N6L A;  2B1X B;  1QAF A;  1FGT A;  3NX0 A;  3CME 3;  4J8T A;  3A76 A;  4X2H A;  2W6J H;  1TIJ A;  2CKF B;  3T8U A;  5IG0 A;  1JB5 A;  1PFP A;  1IVU A;  4CCV A;  5BXQ A;  5IEP A;  1OH0 A;  3X3Z A;  3CC4 3;  3IJE B;  3BLZ A;  3F40 A;  3CNX A;  2CK3 H;  5KP3 A;  4EV2 A;  1OF5 A;  3LXU X;  2ML5 A;  1DVC A;  1D6Y A;  1GD3 A;  2MC8 A;  2KXG A;  3J7Y d;  2WGO A;  1WMP A;  3KZT A;  4XB5 A;  5KP1 A;  3OW2 2;  4FCM A;  3CCJ 3;  3NXJ A;  3ALA A;  1IU7 A;  3S28 A;  3BNB A;  2W0Q A;  1IQ8 A;  1CYV A;  3VSY A;  5KP4 A;  4N6M A;  4LZI A;  2CIU A;  4OK0 A;  4MMX B;  4O2H A;  3CD6 3;  3B4P A;  1PU4 A;  1Q40 B;  2GEX A;  3F8X A;  3FG1 A;  5CF1 A;  4R9L A;  2CWU A;  1DMM A;  4O3V A;  3SVA A;  3D9R A;  1HKX A;  3JUP A;  2HMM B;  2W56 A;  3CC7 3;  4Q53 A;  1FGM A;  1NB5 I;  3HZP A;  4N3V A;  4GL6 A;  3EB8 A;  2YFL B;  1U8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...