3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LinA
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
source organism Uncultured organism
molecule tags Transferase
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
1JB5A 1ASKA 3I0YA 3HZPA 3MG3A 3Q90A 1QJGA 4K1UA 1DMQA 4XDVA 4R1KA 1BUQA 4GB5A 2BMOB 3STDA 1OH0A 4HM2B 3F8XA 2QGUA 1Q40B 3F14A 3JUMA 2UX0A 1U5OA 2BMRB 1S5AA 3GZXB 4L8OA 1QMAA 3SEDA 3WMDA 2IMJA 6STDA 2HMMB 5G2GA 4HM1B 2I9WA 4HM4B 2GBXB 1OF5B 3OWYA 1WQLB 4L7KA 5BXQA 3BLZA 1GY5A 5EVHA 3DM8A 4J9AA 1STDA 3MHEA 4OUQA 2HMKB 3F40A 1E97A 1GY6A 3GWRA 1E3VA 3EC9A 4HVNA 3KE7A 3ER7A 1OGXA 2INXA 3NUVA 1UUVB 4HM0B 3F9SA 2A15A 3T8UA 1OCVA 2STDA 4XBYA 4KVHA 5DRVA 3FKAA 4R9LA 1NWWA 1OHOA 2Z76A 3EN8A 3FH1A 3RGRA 2GEYA 4X2HA 3KZTA 3OV4A 1O7GB 4IIAA 3OWSA 1IDPA 5KP1A 2PZVA 1OUNA 2CHCA 3BB9A 4WWUC 1JKGB 3NV0A 4HJLB 5AEUB 3SOAA 4HZ9B 1W6YA 5AIFA 1OHPA 3EF8A 2JQ5A 5AIGA 3UJMA 3ECFA 2RFRA 3MKIA 3GZYB 3EQQB 3F7XA 3EHCA 3LZAA 5IERA 5IG4A 3CPOA 3JUQA 1GS3A 1VZZA 4U13A 1ZX2A 4X2OA 1ULIB 1ULJB 3G8ZA 1JB4A 1EA2A 4Q53A 3JUOA 1W00A 1OGZA 3EN1B 4XB5A 1A2KA 4L8PA 2XR8B 2RCDA 5KP3A 5BVBA 1O7WB 2GXFA 3EJVA 1ZO2A 5CF1A 1ISKA 3S5CA 3FF0A 2B1XB 3B8LA 1DMNA 3NHXA 4XM4A 5TGNA 4XBXA 4MJDA 8CHOA 1C7HA 3DUKA 5AIHA 3NBRA 4XBTA 3K7CA 3A76A 3GRDA 3ROBA 4OVMA 5D81A 2XRXB 5AI1A 1CQSA 2OWPA 4STDA 1EG9B 3MSOA 4HM6B 3FF2A 2YFLB 3EBTA 2RGQA 2HMOB 4HKVB 2HMLB 3RGAA 5IG3A 5AEWB 1GY7A 4WYKA 1E3RA 4CDLA 3H51A 1OHSA 1W02A 3GZBA 3KKGA 3DMCA 3EBYA 3JUPA 3UNLA 5IEPA 5CK6A 3NXJA 5D83A 2XSOB 5IF6A 1NDOB 1JN5A 2F99A 3H3HA 4FCMA 5D82A 5CLKA 2QIYA 3KSPA 3HK4A 1O7HB 1O7PB 2YFJB 5JPUA 4HM3B 1GYBA 1O7MB 3FSDA 3OX9A 1Q40A 4FCJA 5IG0A 1NU3A 1K41A 3MG1A 3NV0B 2R4IA 5IG5A 1SJWA 5CXOA 3E99A 4J8TA 5CF2A 1OF5A 5IEOA 5DREA 5IENA 3B4OA 3MG2A 5AIIA 4LMIA 1AR0A 3VGNA 3GZRA 2Z77A 3B7CA 4HM5B 2GEXA 2XSHB 3F7SA 5HGRA 3DZLA 2F86B 1DMMA 2HMNB 2W2CA 5STDA 2F98A 4R9KA 3T8NA 2Z7AA 3NM2A 4H3UA 3OWUA 3EX9A 3D9RA 3LYGA 1Z1SA 1UUWB 3VSYA 3CNMA 3G0KA 3G16A 2B24B 2GBWB 4XDWA 4WP5A 4PEJA 1O7NB 4N3VA 3HX8A 3FLJA 4K1VA 7STDA 2HMJB 2K54A 4I4KA 4LEHA 3FZWA 1JKGA 3CU3A 3OXAA 5JPPA 3K0ZA 4HZBB 4HM7B 2BMQB 4WYKB 5KP4A 3FGYA 2YFIB 4HM8B 1W01A 3B4PA 4LGQA 1TP6A 1OPYA 4ORLA 1JB2A 3CNXA 4RZMA 3JUNA 3SOYA 1HKXA 3DXOA 1Q42A 3IPTA 2BNGA 1TUHA 5FW5A 3MYTA 2CKFB 1JN5B 3F8HA 3M8CA
chains in the Genus database with same CATH superfamily
4J5GA 1RTUA 2W9PA 1JB5A 2ZL8A 1GMRA 5JBSA 1ASKA 4R4KA 2OOVA 4AEQA 1RKYA 3I0YA 1N8QA 1UGIA 1MWSA 1RGCA 3HZPA 3MG3A 9RNTA 2W03A 3WHOA 3Q90A 1QJGA 4O8SA 3CCJ3 3EE1A 4K1UA 1DMQA 2MF7A 4JF8A 5ELUA 1YJ93 1B20A 1TFOA 1W7CA 3HIGA 4XDVA 2CWTA 4R1KA 1BUQA 4I5QA 4GB5A 1FW7A 2BMOB 3STDA 1FGRA 1SARA 1IVXA 2IUJA 1OH0A 4FMBA 4WHAA 1ROVA 4HM2B 1VQK3 1Q7HA 3F8XA 1SIIA 2C10A 2QGUA 1Q40B 3BNEA 2R41A 5M19A 1J2BA 3F14A 3JUMA 4BTXA 2UX0A 1U5OA 2BMRB 1DYUA 1FGTA 4JRFA 1S5AA 3LMLA 1B2ZA 2BHMA 2P0XA 1KC84 2J8XB 3DY5A 1JZDA 3GZXB 4L8OA 2E2TA 4RNZA 1UUGB 1QMAA 2W9QA 3SEDA 3WMDA 2UGIA 1BNGA 1LOXA 2KF5A 1BOXA 2IMJA 6STDA 2K3DA 1RJOA 2Y73A 2HMMB 3LH4A 1RSNA 3Q1CA 4HM1B 5G2GA 4QWTA 1YHQ3 2I9WA 2CFDA 4HM4B 3D4AA 4FR9A 3IMAB 4HBRA 3CMA3 1CH0A 1GMQA 1OF5B 2GBXB 1B27A 4HOHA 1A90A 5ELJA 3LT9A 2BIRA 3OWYA 3S27A 1TFKA 1WQLB 4TX4A 1RRLA 5IW9A 2F56A 3LTAA 4L7KA 3G713 5BXQA 2AADA 5I97A 4CCVA 3BLZA 1LNIA 3CC73 1T5YA 3PXMA 4RBNA 7RNTA 1CYVA 1GY5A 5EVHA 2FGTA 1YVSA 3DM8A 2BT3A 2M7OA 1FZUA 4J9AA 1JBSA 3WDGB 2KF4A 1STDA 3MHEA 1N5PA 4N6UA 1YI23 4OUQA 2HMKB 2C11A 3F40A 3TDGA 1T3BA 1TRQA 1E97A 5LC7A 1GY6A 1RGFA 1RLSA 2ZHXB 1BAOA 1E3VA 2F5WA 3EC9A 3GWRA 3IJEB 4HVNA 1W5ZA 3KE7A 3X3ZA 1VQ93 3ER7A 3FG1A 3T0UA 1OGXA 1MWUA 2CWVA 2INXA 3NUVA 4N6LA 3CCU3 1PFPA 1UUVB 4HM0B 3F9SA 4O02B 2A15A 3K9MC 2O9UX 3T8UA 2OQEC 1OCVA 2D1WA 2FNQA 2STDA 2GSPA 4XBYA 4KVHA 1VQ53 1W6CA 5DRVA 2KXGA 1F8NA 3FKAA 3O8YA 4AKYA 3MWZA 1M904 1MNLA 2W04A 4R9LA 2F4YA 1NWWA 2KCDA 3Q3FA 2CWUA 1OHOA 3HOHA 2Z76A 3EN8A 3V98A 1CEWI 1BSEA 1GOUA 2RNTA 2GEYA 3FH1A 3LTDA 4MMXB 3RGRA 4O2HA 4N6V0 4N6NB 2GU3A 4X2HA 3KZTA 3OV4A 1O7GB 4IIAA 1K734 1IT7A 1IK3A 5G1KA 3PZWA 3DGYA 4AKZA 3OWSA 1Q864 3CCM3 5LC6A 1RNBA 2MC8A 1IDPA 5A0OB 5KP1A 1RCKA 2PZVA 1TU5A 3PGBA 1OUNA 1EUIC 1GMPA 2CHCA 2W56B 1OACA 3BB9A 1T2IA 3CC43 1X1WA 3UB1A 3CD63 3N8BA 1TJDA 2XFTA 3LTCA 3BU4A 1BSDA 2QEX3 1VQL3 1LNHA 2RBIA 4WWUC 1K9M4 1L5GB 1V74A 4WFOA 1BNFA 1JKGB 2CFWA 3NV0A 2LYXA 3PYJA 4HJLB 4BTYA 3QRDA 5AEUB 1RCLA 4HYZA 3SOAA 1I0XA 3G4S3 2E2VA 1AVLA 4HZ9B 1WNHA 1W6YA 1RN1A 2IY2A 3DH2A 1OHPA 3EF8A 4K61A 5AIFA 2JQ5A 5AIGA 1RGHA 4BL2A 3UJMA 2WO0A 6GSPA 1AQZA 3ECFA 1B2UA 2RFRA 3MKIA 4MMYB 1LOWA 2KRTA 1VQN3 2KF3A 3GZYB 2OTJ3 3DGOA 3EQQB 3F7XA 3EHCA 3X3XA 3LZAA 5IERA 5IG4A 1PY3A 3CPOA 3JUQA 1GS3A 1GD3A 1K28A 1UCIA 4NHFA 1VZZA 4U13A 3NX0A 1BSCA 2JDIH 1ZX2A 4X2OA 1YNVX 1ULIB 1ULJB 3G8ZA 2Y74A 3DGNA 3VF1A 1BRKA 1W2ZA 1JB4A 1EA2A 4Q53A 3JUOA 1W2B2 2L4VA 3A5EA 2AAEA 1KSIA 1RGLA 2KF6A 1VQP3 1FUSA 1W00A 1OGZA 1RN7A 1UI8A 1X1UA 2W0QA 2ZDJA 3EN1B 4N6MA 4XB5A 1A2KA 3KSED 4L8PA 3S67A 3AHWA 2XR8B 2XH9A 1G0TA 1HYFA 2RCDA 3D3LA 2Q07A 5KP3A 2OQEA 5BVBA 3G6E3 3WOFB 1O7WB 2GXFA 3EJVA 3WA3A 1B21A 1WMPA 3NQYA 1ZO2A 3DGLA 1TTOA 5CF1A 1I3FA 3S5CA 3FF0A 1ISKA 1BSBA 2ML6A 4IPBA 1BNRA 2B1XB 3B8LA 3U1WA 1DMNA 2F5MA 4HAAA 4KFFA 1NB3I 3NHXA 1X1XA 4XM4A 5TGNA 2WGOA 4XBXA 1BRJA 3BIRA 4MJDA 8CHOA 4GHOA 1C7HA 3KIIA 1T2HA 1STFI 3DUKA 4G1MB 5AIHA 1VQ63 4EXRA 1EEJA 1WTHA 4H61A 1NB5I 4FMAA 1JNQA 3NBRA 4XBTA 3K7CA 5G1LA 1US1A 3A76A 4EW5A 1VQ83 1FUWA 4FCZA 2IYJA 1IT8A 2LQVA 3GRDA 1BSAA 3L0RA 4OVMA 3ROBA 1SQWA 3SX1A 4KFEA 4KFDA 4N6TA 5D81A 1JJ22 1B2XA 1BRHA 1MWRA 1RGKA 2XRXB 1I70A 2H0IA 5AI1A 1CQSA 1D6UA 2OWPA 1DVCA 2P0MA 4STDA 2WOFA 1YVBI 1EG9B 1KD14 2XFSA 3MSOA 4HM6B 3FF2A 3URPA 2YFLB 1W4NA 2CK3H 1IVVA 2CH9A 3KCHA 1BVIA 1ZS7A 1QAFA 3AHSA 3WOEB 1MWTA 3BNBA 3FG4A 1B2SA 3EBTA 2RGQA 2HMOB 3ZFZA 2GU1A 2WOHA 1LXEA 3LOYA 4HKVB 2HMLB 1I2EA 1MGWA 2P05A 1VQM3 4LYLB 3RGAA 5IG3A 4GSPA 5AEWB 1GY7A 1DVDA 3CCE3 4WYKA 1GD4A 3RDEA 3MPHA 2KAAA 3BNDA 3EB8A 1E3RA 4CDLA 1NNVA 3H51A 4BIRA 3CCS3 3NBJA 4N6OB 1GOVA 1OHSA 4CJNA 3PCSA 1QALA 1W02A 2P38A 3AMOA 4MEIA 2XF3A 3GZBA 3KKGA 1YGWA 4J5KA 3CC23 4KZ1A 1FGMA 1UCLA 3DMCA 1LOYA 3EBYA 2WGQA 1W6GA 3JUPA 1AY7A 3UNLA 3U97A 1RGAA 1QVF2 5IEPA 3X42A 3KN4A 1FYSA 5CK6A 1JV2B 1VQO3 3NXJA 5D83A 2XSOB 2CW9A 3K5TA 5IF6A 3CCQ3 2CX1A 1NDOB 1R4YA 2D42A 2O3OA 1JN5A 3JVCA 3NM7A 2F99A 3H3HA 4RNTA 4FCMA 1BNJA 5D82A 5CLKA 1N5HA 1JBRA 2QIYA 2W6JH 3KSPA 3NQZA 1FGQA 3LT8A 1BIRA 2SARA 2CFKA 1IQXA 1O7HB 1O7PB 2BO9B 2YFJB 3BNCA 3HK4A 1QVG2 1D6ZA 3SYUA 4DKIA 1RHLA 1JBTA 3LXUX 5JPUA 1DE3A 1BRSA 2CG0A 1IV9A 1HU9A 1WMNA 2V1LA 4HM3B 1AVKA 2ZA4A 4K90B 4NREA 1TIJA 1IU7A 1GYBA 1O7MB 3AGNA 1Q814 3FSDA 2XEPA 3OX9A 1Q40A 1TRPA 3WA2X 4FCJA 5AYRB 1BRIA 4CPKA 2C4BA 1PYLA 1WMOA 5IG0A 1C54A 2CC3A 1BUJA 1NU3A 5EQLA 1BGSA 1A67A 1K41A 3CPW2 2BU4A 2XGNA 3CCL3 3J7Yd 1Q9EA 3MG1A 3NV0B 1FGOA 2R4IA 5BU4A 5EEOA 5IG5A 1BRGA 3S29A 2H0GA 1SJWA 5CXOA 3E99A 1I2FA 1NO3A 4J8TA 3UL6A 5CF2A 4R80A 2XGLA 1N9EA 1OF5A 5IEOA 4BU4A 4EYCA 3LTBA 1NJI4 5DREA 2IUKA 5IENA 3SVAA 4ILFA 3AGOA 4OK0A 1MOLA 1YIT3 1V58A 3PS8A 1LQGC 3RNTA 3WODG 1ZGXA 4BL3A 2CIUA 3B4OA 4ZM8A 2SBLA 2RSXA 3MG2A 2HOHA 4O3VA 5AIIA 3V92A 1CYUA 4RNYA 1N8R4 4LMIA 1AR0A 3X3YA 3N54B 1EQKA 1UI7A 3K63A 1D6YA 3VGNA 3GZRA 1UDII 2Z77A 3B7CA 3FCSB 3CXC2 1RDSA 4HM5B 2GEXA 4IT7A 2XSHB 1DETA 1YGEA 3ZG0A 3F7SA 5HGRA 3DZLA 2F86B 5RNTA 1V57A 4FMCA 1DMMA 2CG1A 1B3SA 1R4CA 4EV2A 1YIJ3 3CCV3 1U8CB 4FMDA 2HMNB 5M18A 3I563 2UUGC 2W2CA 3N9HA 5STDA 4BTWA 3FG3A 2K0MA 1LRAA 2F98A 4R9KA 1ROAA 1RRHA 3ALAA 2OOVC 1G96A 1IVWA 3X41A 1RNTA 3T8NA 2Z7AA 3HIIA 2ML5A 3NM2A 4H3UA 3PCRA 4MMZB 3OWUA 3EX9A 3D9RA 3LYGA 3I553 1BNSA 1UUWB 1Z1SA 3V99A 1UGHI 1LOVA 3VSYA 3CNMA 1A2PA 3G0KA 3G16A 4LSOA 8RNTA 1IVUA 1FA3A 1RGEA 2B24B 3DGMA 1RN4A 3ZG5A 3D5IA 2GBWB 1HZ1A 3Q2PA 3NBBA 4XDWA 3SXXA 1I2GA 2IA7A 1UCKA 4PEJA 1IQ8A 4WP5A 1K8A4 2Z6BA 1M1K4 3WR2A 2OCTA 1JZOA 1Q7Y4 1O7NB 4N3VA 5FGOA 1VQQA 1B2MA 2CFGA 2CX0A 3HX8A 3FLJA 2W56A 1BNEA 4K1VA 4NPBA 3S28A 1BANA 3KFQC 1VQ73 1IV7A 1RMSA 7STDA 3HI7A 1FUTA 2HMJB 1GOYA 2K54A 4I4KA 1M1XB 1MGRA 2L1SA 2YX9A 4LEHA 5BIRA 3FZWA 1Q824 3D5GA 1BNIA 1JKGA 3CU3A 3OXAA 5JPPA 1G02A 1N9JA 3K0ZA 4HZBB 6RNTA 4HM7B 1SPUA 2BMQB 4WYKB 5KP4A 2FXTA 1AV4A 1YJN3 2P09A 2CFLA 3FGYA 3CME3 4EV5A 1BRNL 2YFIB 1KWIA 1S723 3SLUA 5GSPA 1VQ43 4HM8B 1W01A 1EKMA 3UL5A 4GL6A 1A2VA 7GSPA 1I3IA 1SIHA 1PU4A 4LZIA 3AMOB 3B4PA 4LGQA 1TP6A 1OPYA 4ORLA 1JB2A 3CNXA 5M1AA 4EBGA 4RZMA 3JUNA 5AYSC 3QK9A 3SOYA 1HKXA 1BU4A 1LVNA 3GAXA 3D79A 2PNCA 2OTL3 3DXOA 3CCR3 2QA43 1JRQA 1I0VA 1X1YA 5HOHA 3GSPA 1LQMB 1Q42A 4EC6A 1YJW3 3X40A 1IYYA 2H0HA 1Y4KA 3IPTA 1UW1A 2BNGA 1TUHA 5FW5A 1I8VA 1QAKA 1GSPA 3MYTA 1M9GA 3OW22 2CKFB 1KQS2 1JN5B 2E2UA 3F8HA 4KT3B 1RGGA 1IQYA 1UCJA 3M8CA
chains in the Genus database with same CATH topology
2W9PA 1JB5A 2ZL8A 5JBSA 1ASKA 4R4KA 2OOVA 4AEQA 1RKYA 3I0YA 1N8QA 3HZPA 3MG3A 2W03A 3Q90A 1QJGA 4O8SA 3CCJ3 3EE1A 4K1UA 1DMQA 2MF7A 4JF8A 5ELUA 1YJ93 1TFOA 1W7CA 3HIGA 4XDVA 2CWTA 4R1KA 1BUQA 4GB5A 2BMOB 3STDA 1FGRA 1IVXA 2IUJA 1OH0A 4FMBA 4WHAA 1ROVA 4HM2B 1VQK3 3F8XA 1SIIA 2C10A 2QGUA 1Q40B 3BNEA 1J2BA 3F14A 3JUMA 4BTXA 2UX0A 1U5OA 2BMRB 1DYUA 1FGTA 4JRFA 1S5AA 3LMLA 2BHMA 2P0XA 1KC84 4RNZA 3DY5A 3GZXB 4L8OA 2E2TA 1QMAA 2W9QA 3SEDA 3WMDA 1LOXA 2IMJA 6STDA 1RJOA 2Y73A 2HMMB 3LH4A 3Q1CA 4HM1B 5G2GA 4QWTA 1YHQ3 2I9WA 2CFDA 4HM4B 4FR9A 3IMAB 4HBRA 3CMA3 2GBXB 1OF5B 1A90A 5ELJA 3LT9A 3OWYA 3S27A 1TFKA 1WQLB 4TX4A 1RRLA 5IW9A 3LTAA 4L7KA 3G713 5BXQA 5I97A 4CCVA 3BLZA 3CC73 1T5YA 3PXMA 4RBNA 1CYVA 1GY5A 5EVHA 2FGTA 3DM8A 2BT3A 2M7OA 4J9AA 3WDGB 1STDA 3MHEA 1N5PA 4N6UA 1YI23 4OUQA 2HMKB 2C11A 3F40A 3TDGA 1E97A 5LC7A 1GY6A 3IJEB 3GWRA 1E3VA 3EC9A 3X3ZA 4HVNA 1W5ZA 3KE7A 1VQ93 3ER7A 3FG1A 3T0UA 1OGXA 2CWVA 2INXA 4N6LA 3NUVA 3CCU3 1PFPA 1UUVB 4HM0B 3F9SA 4O02B 2A15A 3K9MC 2O9UX 3T8UA 2OQEC 1OCVA 2D1WA 2FNQA 2STDA 4XBYA 1VQ53 4KVHA 1W6CA 5DRVA 2KXGA 1F8NA 3FKAA 3O8YA 4AKYA 3MWZA 1M904 1MNLA 2W04A 4R9LA 1NWWA 2KCDA 2CWUA 1OHOA 2Z76A 3EN8A 3V98A 1CEWI 3FH1A 3LTDA 3RGRA 2GEYA 4MMXB 4O2HA 4N6V0 4N6NB 2GU3A 4X2HA 3KZTA 3OV4A 1O7GB 4IIAA 1K734 1IT7A 1IK3A 3PZWA 4AKZA 3OWSA 1Q864 3CCM3 5LC6A 2MC8A 1IDPA 5A0OB 5KP1A 2PZVA 1TU5A 3PGBA 1OUNA 2CHCA 2W56B 1OACA 3BB9A 3CC43 3UB1A 3CD63 3N8BA 2XFTA 3LTCA 2QEX3 1VQL3 1LNHA 4WWUC 1K9M4 1L5GB 1V74A 4WFOA 1JKGB 3PYJA 2CFWA 3NV0A 2LYXA 4HJLB 4BTYA 3QRDA 5AEUB 3SOAA 4HYZA 3G4S3 2E2VA 1AVLA 4HZ9B 1WNHA 1W6YA 5AIFA 1OHPA 3EF8A 4K61A 2JQ5A 5AIGA 3UJMA 2WO0A 3ECFA 2RFRA 3MKIA 4MMYB 2KRTA 1VQN3 3GZYB 2OTJ3 3DGOA 3EQQB 3F7XA 3EHCA 3X3XA 3LZAA 5IERA 5IG4A 3CPOA 3JUQA 1GS3A 1GD3A 1K28A 4NHFA 1VZZA 4U13A 3NX0A 2JDIH 1ZX2A 4X2OA 1ULIB 1ULJB 3G8ZA 2Y74A 3DGNA 3VF1A 1W2ZA 1JB4A 1EA2A 4Q53A 3JUOA 1W2B2 2L4VA 1KSIA 1VQP3 1W00A 2ZDJA 1OGZA 1RN7A 1UI8A 3EN1B 2W0QA 4N6MA 4XB5A 1A2KA 3KSED 4L8PA 3S67A 2XR8B 2XH9A 2RCDA 3D3LA 2Q07A 5KP3A 2OQEA 5BVBA 3G6E3 3WOFB 1O7WB 2GXFA 3EJVA 3WA3A 1WMPA 3NQYA 1ZO2A 3DGLA 5CF1A 1ISKA 3S5CA 3FF0A 2ML6A 4IPBA 2B1XB 3B8LA 3U1WA 1DMNA 4KFFA 1NB3I 3NHXA 4XM4A 5TGNA 2WGOA 4XBXA 4MJDA 8CHOA 1C7HA 3KIIA 4G1MB 1STFI 3DUKA 5AIHA 1VQ63 4EXRA 1WTHA 4H61A 1NB5I 4FMAA 1JNQA 3NBRA 4XBTA 3K7CA 1US1A 3A76A 1VQ83 1FUWA 4FCZA 1IT8A 2LQVA 3GRDA 3L0RA 4OVMA 3ROBA 3SX1A 1SQWA 4KFEA 4KFDA 4N6TA 5D81A 1JJ22 2XRXB 5AI1A 1CQSA 1D6UA 2OWPA 1DVCA 2P0MA 4STDA 2WOFA 1YVBI 1EG9B 1KD14 2XFSA 3MSOA 4HM6B 3FF2A 2YFLB 1W4NA 2CK3H 1IVVA 2CH9A 1QAFA 3WOEB 3BNBA 3FG4A 3EBTA 2RGQA 2HMOB 2GU1A 2WOHA 1LXEA 3LOYA 4HKVB 2HMLB 2P05A 1VQM3 3RGAA 5IG3A 5AEWB 1GY7A 1DVDA 3CCE3 4WYKA 1GD4A 3RDEA 3MPHA 3BNDA 3EB8A 1E3RA 4CDLA 3H51A 3CCS3 3NBJA 4N6OB 1OHSA 3PCSA 1QALA 1W02A 2P38A 3AMOA 4MEIA 2XF3A 3GZBA 3KKGA 3CC23 4KZ1A 1FGMA 3DMCA 3EBYA 2WGQA 1W6GA 3JUPA 3UNLA 3U97A 1QVF2 5IEPA 3X42A 3KN4A 5CK6A 1JV2B 1VQO3 3NXJA 5D83A 2XSOB 2CW9A 3K5TA 5IF6A 3CCQ3 1NDOB 2D42A 2O3OA 1JN5A 3JVCA 3NM7A 2F99A 3H3HA 4FCMA 5D82A 5CLKA 1N5HA 2QIYA 2W6JH 3KSPA 3NQZA 1FGQA 3LT8A 2CFKA 1IQXA 1O7HB 1O7PB 2BO9B 2YFJB 3BNCA 3HK4A 1QVG2 1D6ZA 3LXUX 5JPUA 2CG0A 1IV9A 1HU9A 1WMNA 2V1LA 4HM3B 1AVKA 4K90B 4NREA 1TIJA 1IU7A 1GYBA 1O7MB 1Q814 3FSDA 2XEPA 3OX9A 1Q40A 3WA2X 4FCJA 5AYRB 1WMOA 5IG0A 2CC3A 1NU3A 5EQLA 1A67A 1K41A 3CPW2 2XGNA 3CCL3 3J7Yd 3MG1A 3NV0B 1FGOA 2R4IA 5EEOA 5IG5A 3S29A 1SJWA 5CXOA 3E99A 1NO3A 4J8TA 3UL6A 5CF2A 4R80A 2XGLA 1N9EA 1OF5A 5IEOA 4EYCA 3LTBA 1NJI4 5DREA 2IUKA 5IENA 3SVAA 4OK0A 1MOLA 1YIT3 3PS8A 3WODG 2CIUA 3B4OA 4ZM8A 2SBLA 2RSXA 3MG2A 4O3VA 5AIIA 3V92A 1CYUA 4RNYA 1N8R4 4LMIA 1AR0A 3X3YA 3N54B 1EQKA 1UI7A 3K63A 1D6YA 3VGNA 3GZRA 2Z77A 3B7CA 3FCSB 3CXC2 4HM5B 2GEXA 4IT7A 2XSHB 1YGEA 3F7SA 5HGRA 3DZLA 2F86B 4FMCA 1DMMA 2CG1A 1R4CA 4EV2A 1YIJ3 3CCV3 1U8CB 4FMDA 2HMNB 3I563 2W2CA 3N9HA 5STDA 4BTWA 3FG3A 2K0MA 2F98A 4R9KA 1ROAA 1RRHA 3ALAA 2OOVC 1G96A 1IVWA 3X41A 3T8NA 2Z7AA 3HIIA 2ML5A 3NM2A 4H3UA 3PCRA 4MMZB 3OWUA 3EX9A 3D9RA 3LYGA 3I553 1Z1SA 1UUWB 3V99A 3VSYA 3CNMA 3G0KA 3G16A 4LSOA 1IVUA 1FA3A 2B24B 3DGMA 2GBWB 3Q2PA 3NBBA 4XDWA 3SXXA 2IA7A 4PEJA 4WP5A 1IQ8A 1K8A4 2Z6BA 1M1K4 2OCTA 1Q7Y4 1O7NB 4N3VA 5FGOA 2CFGA 3HX8A 3FLJA 2W56A 4K1VA 3S28A 3KFQC 1VQ73 1IV7A 7STDA 3HI7A 2HMJB 2K54A 4I4KA 1M1XB 2YX9A 4LEHA 3FZWA 1Q824 1JKGA 3CU3A 3OXAA 5JPPA 3K0ZA 1N9JA 4HZBB 4HM7B 1SPUA 2BMQB 4WYKB 5KP4A 2FXTA 1AV4A 1YJN3 2P09A 2CFLA 3FGYA 3CME3 4EV5A 2YFIB 1KWIA 1S723 3SLUA 4HM8B 1W01A 1EKMA 3UL5A 4GL6A 1A2VA 1SIHA 1PU4A 4LZIA 3AMOB 3B4PA 4LGQA 1TP6A 1OPYA 4ORLA 1JB2A 3CNXA 4EBGA 4RZMA 3JUNA 5AYSC 3QK9A 3SOYA 1HKXA 1LVNA 3GAXA 2PNCA 2OTL3 3DXOA 3CCR3 2QA43 1JRQA 1YJW3 1Q42A 4EC6A 3X40A 1Y4KA 3IPTA 1UW1A 2BNGA 1TUHA 5FW5A 3MYTA 1QAKA 1KQS2 1VQ43 1M9GA 3OW22 2CKFB 1JN5B 2E2UA 3F8HA 1IQYA 3M8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB5 A;  1ASK A;  3I0Y A;  3HZP A;  3MG3 A;  3Q90 A;  1QJG A;  4K1U A;  1DMQ A;  4XDV A;  4R1K A;  1BUQ A;  4GB5 A;  2BMO B;  3STD A;  1OH0 A;  4HM2 B;  3F8X A;  2QGU A;  1Q40 B;  3F14 A;  3JUM A;  2UX0 A;  1U5O A;  2BMR B;  1S5A A;  3GZX B;  4L8O A;  1QMA A;  3SED A;  3WMD A;  2IMJ A;  6STD A;  2HMM B;  5G2G A;  4HM1 B;  2I9W A;  4HM4 B;  2GBX B;  1OF5 B;  3OWY A;  1WQL B;  4L7K A;  5BXQ A;  3BLZ A;  1GY5 A;  5EVH A;  3DM8 A;  4J9A A;  1STD A;  3MHE A;  4OUQ A;  2HMK B;  3F40 A;  1E97 A;  1GY6 A;  3GWR A;  1E3V A;  3EC9 A;  4HVN A;  3KE7 A;  3ER7 A;  1OGX A;  2INX A;  3NUV A;  1UUV B;  4HM0 B;  3F9S A;  2A15 A;  3T8U A;  1OCV A;  2STD A;  4XBY A;  4KVH A;  5DRV A;  3FKA A;  4R9L A;  1NWW A;  1OHO A;  2Z76 A;  3EN8 A;  3FH1 A;  3RGR A;  2GEY A;  4X2H A;  3KZT A;  3OV4 A;  1O7G B;  4IIA A;  3OWS A;  1IDP A;  5KP1 A;  2PZV A;  1OUN A;  2CHC A;  3BB9 A;  4WWU C;  1JKG B;  3NV0 A;  4HJL B;  5AEU B;  3SOA A;  4HZ9 B;  1W6Y A;  5AIF A;  1OHP A;  3EF8 A;  2JQ5 A;  5AIG A;  3UJM A;  3ECF A;  2RFR A;  3MKI A;  3GZY B;  3EQQ B;  3F7X A;  3EHC A;  3LZA A;  5IER A;  5IG4 A;  3CPO A;  3JUQ A;  1GS3 A;  1VZZ A;  4U13 A;  1ZX2 A;  4X2O A;  1ULI B;  1ULJ B;  3G8Z A;  1JB4 A;  1EA2 A;  4Q53 A;  3JUO A;  1W00 A;  1OGZ A;  3EN1 B;  4XB5 A;  1A2K A;  4L8P A;  2XR8 B;  2RCD A;  5KP3 A;  5BVB A;  1O7W B;  2GXF A;  3EJV A;  1ZO2 A;  5CF1 A;  1ISK A;  3S5C A;  3FF0 A;  2B1X B;  3B8L A;  1DMN A;  3NHX A;  4XM4 A;  5TGN A;  4XBX A;  4MJD A;  8CHO A;  1C7H A;  3DUK A;  5AIH A;  3NBR A;  4XBT A;  3K7C A;  3A76 A;  3GRD A;  3ROB A;  4OVM A;  5D81 A;  2XRX B;  5AI1 A;  1CQS A;  2OWP A;  4STD A;  1EG9 B;  3MSO A;  4HM6 B;  3FF2 A;  2YFL B;  3EBT A;  2RGQ A;  2HMO B;  4HKV B;  2HML B;  3RGA A;  5IG3 A;  5AEW B;  1GY7 A;  4WYK A;  1E3R A;  4CDL A;  3H51 A;  1OHS A;  1W02 A;  3GZB A;  3KKG A;  3DMC A;  3EBY A;  3JUP A;  3UNL A;  5IEP A;  5CK6 A;  3NXJ A;  5D83 A;  2XSO B;  5IF6 A;  1NDO B;  1JN5 A;  2F99 A;  3H3H A;  4FCM A;  5D82 A;  5CLK A;  2QIY A;  3KSP A;  3HK4 A;  1O7H B;  1O7P B;  2YFJ B;  5JPU A;  4HM3 B;  1GYB A;  1O7M B;  3FSD A;  3OX9 A;  1Q40 A;  4FCJ A;  5IG0 A;  1NU3 A;  1K41 A;  3MG1 A;  3NV0 B;  2R4I A;  5IG5 A;  1SJW A;  5CXO A;  3E99 A;  4J8T A;  5CF2 A;  1OF5 A;  5IEO A;  5DRE A;  5IEN A;  3B4O A;  3MG2 A;  5AII A;  4LMI A;  1AR0 A;  3VGN A;  3GZR A;  2Z77 A;  3B7C A;  4HM5 B;  2GEX A;  2XSH B;  3F7S A;  5HGR A;  3DZL A;  2F86 B;  1DMM A;  2HMN B;  2W2C A;  5STD A;  2F98 A;  4R9K A;  3T8N A;  2Z7A A;  3NM2 A;  4H3U A;  3OWU A;  3EX9 A;  3D9R A;  3LYG A;  1Z1S A;  1UUW B;  3VSY A;  3CNM A;  3G0K A;  3G16 A;  2B24 B;  2GBW B;  4XDW A;  4WP5 A;  4PEJ A;  1O7N B;  4N3V A;  3HX8 A;  3FLJ A;  4K1V A;  7STD A;  2HMJ B;  2K54 A;  4I4K A;  4LEH A;  3FZW A;  1JKG A;  3CU3 A;  3OXA A;  5JPP A;  3K0Z A;  4HZB B;  4HM7 B;  2BMQ B;  4WYK B;  5KP4 A;  3FGY A;  2YFI B;  4HM8 B;  1W01 A;  3B4P A;  4LGQ A;  1TP6 A;  1OPY A;  4ORL A;  1JB2 A;  3CNX A;  4RZM A;  3JUN A;  3SOY A;  1HKX A;  3DXO A;  1Q42 A;  3IPT A;  2BNG A;  1TUH A;  5FW5 A;  3MYT A;  2CKF B;  1JN5 B;  3F8H A;  3M8C A; 
#chains in the Genus database with same CATH topology
 4J5G A;  1RTU A;  2W9P A;  1JB5 A;  2ZL8 A;  1GMR A;  5JBS A;  1ASK A;  4R4K A;  2OOV A;  4AEQ A;  1RKY A;  3I0Y A;  1N8Q A;  1UGI A;  1MWS A;  1RGC A;  3HZP A;  3MG3 A;  9RNT A;  2W03 A;  3WHO A;  3Q90 A;  1QJG A;  4O8S A;  3CCJ 3;  3EE1 A;  4K1U A;  1DMQ A;  2MF7 A;  4JF8 A;  5ELU A;  1YJ9 3;  1B20 A;  1TFO A;  1W7C A;  3HIG A;  4XDV A;  2CWT A;  4R1K A;  1BUQ A;  4I5Q A;  4GB5 A;  1FW7 A;  2BMO B;  3STD A;  1FGR A;  1SAR A;  1IVX A;  2IUJ A;  1OH0 A;  4FMB A;  4WHA A;  1ROV A;  4HM2 B;  1VQK 3;  1Q7H A;  3F8X A;  1SII A;  2C10 A;  2QGU A;  1Q40 B;  3BNE A;  2R41 A;  5M19 A;  1J2B A;  3F14 A;  3JUM A;  4BTX A;  2UX0 A;  1U5O A;  2BMR B;  1DYU A;  1FGT A;  4JRF A;  1S5A A;  3LML A;  1B2Z A;  2BHM A;  2P0X A;  1KC8 4;  2J8X B;  3DY5 A;  1JZD A;  3GZX B;  4L8O A;  2E2T A;  4RNZ A;  1UUG B;  1QMA A;  2W9Q A;  3SED A;  3WMD A;  2UGI A;  1BNG A;  1LOX A;  2KF5 A;  1BOX A;  2IMJ A;  6STD A;  2K3D A;  1RJO A;  2Y73 A;  2HMM B;  3LH4 A;  1RSN A;  3Q1C A;  4HM1 B;  5G2G A;  4QWT A;  1YHQ 3;  2I9W A;  2CFD A;  4HM4 B;  3D4A A;  4FR9 A;  3IMA B;  4HBR A;  3CMA 3;  1CH0 A;  1GMQ A;  1OF5 B;  2GBX B;  1B27 A;  4HOH A;  1A90 A;  5ELJ A;  3LT9 A;  2BIR A;  3OWY A;  3S27 A;  1TFK A;  1WQL B;  4TX4 A;  1RRL A;  5IW9 A;  2F56 A;  3LTA A;  4L7K A;  3G71 3;  5BXQ A;  2AAD A;  5I97 A;  4CCV A;  3BLZ A;  1LNI A;  3CC7 3;  1T5Y A;  3PXM A;  4RBN A;  7RNT A;  1CYV A;  1GY5 A;  5EVH A;  2FGT A;  1YVS A;  3DM8 A;  2BT3 A;  2M7O A;  1FZU A;  4J9A A;  1JBS A;  3WDG B;  2KF4 A;  1STD A;  3MHE A;  1N5P A;  4N6U A;  1YI2 3;  4OUQ A;  2HMK B;  2C11 A;  3F40 A;  3TDG A;  1T3B A;  1TRQ A;  1E97 A;  5LC7 A;  1GY6 A;  1RGF A;  1RLS A;  2ZHX B;  1BAO A;  1E3V A;  2F5W A;  3EC9 A;  3GWR A;  3IJE B;  4HVN A;  1W5Z A;  3KE7 A;  3X3Z A;  1VQ9 3;  3ER7 A;  3FG1 A;  3T0U A;  1OGX A;  1MWU A;  2CWV A;  2INX A;  3NUV A;  4N6L A;  3CCU 3;  1PFP A;  1UUV B;  4HM0 B;  3F9S A;  4O02 B;  2A15 A;  3K9M C;  2O9U X;  3T8U A;  2OQE C;  1OCV A;  2D1W A;  2FNQ A;  2STD A;  2GSP A;  4XBY A;  4KVH A;  1VQ5 3;  1W6C A;  5DRV A;  2KXG A;  1F8N A;  3FKA A;  3O8Y A;  4AKY A;  3MWZ A;  1M90 4;  1MNL A;  2W04 A;  4R9L A;  2F4Y A;  1NWW A;  2KCD A;  3Q3F A;  2CWU A;  1OHO A;  3HOH A;  2Z76 A;  3EN8 A;  3V98 A;  1CEW I;  1BSE A;  1GOU A;  2RNT A;  2GEY A;  3FH1 A;  3LTD A;  4MMX B;  3RGR A;  4O2H A;  4N6V 0;  4N6N B;  2GU3 A;  4X2H A;  3KZT A;  3OV4 A;  1O7G B;  4IIA A;  1K73 4;  1IT7 A;  1IK3 A;  5G1K A;  3PZW A;  3DGY A;  4AKZ A;  3OWS A;  1Q86 4;  3CCM 3;  5LC6 A;  1RNB A;  2MC8 A;  1IDP A;  5A0O B;  5KP1 A;  1RCK A;  2PZV A;  1TU5 A;  3PGB A;  1OUN A;  1EUI C;  1GMP A;  2CHC A;  2W56 B;  1OAC A;  3BB9 A;  1T2I A;  3CC4 3;  1X1W A;  3UB1 A;  3CD6 3;  3N8B A;  1TJD A;  2XFT A;  3LTC A;  3BU4 A;  1BSD A;  2QEX 3;  1VQL 3;  1LNH A;  2RBI A;  4WWU C;  1K9M 4;  1L5G B;  1V74 A;  4WFO A;  1BNF A;  1JKG B;  2CFW A;  3NV0 A;  2LYX A;  3PYJ A;  4HJL B;  4BTY A;  3QRD A;  5AEU B;  1RCL A;  4HYZ A;  3SOA A;  1I0X A;  3G4S 3;  2E2V A;  1AVL A;  4HZ9 B;  1WNH A;  1W6Y A;  1RN1 A;  2IY2 A;  3DH2 A;  1OHP A;  3EF8 A;  4K61 A;  5AIF A;  2JQ5 A;  5AIG A;  1RGH A;  4BL2 A;  3UJM A;  2WO0 A;  6GSP A;  1AQZ A;  3ECF A;  1B2U A;  2RFR A;  3MKI A;  4MMY B;  1LOW A;  2KRT A;  1VQN 3;  2KF3 A;  3GZY B;  2OTJ 3;  3DGO A;  3EQQ B;  3F7X A;  3EHC A;  3X3X A;  3LZA A;  5IER A;  5IG4 A;  1PY3 A;  3CPO A;  3JUQ A;  1GS3 A;  1GD3 A;  1K28 A;  1UCI A;  4NHF A;  1VZZ A;  4U13 A;  3NX0 A;  1BSC A;  2JDI H;  1ZX2 A;  4X2O A;  1YNV X;  1ULI B;  1ULJ B;  3G8Z A;  2Y74 A;  3DGN A;  3VF1 A;  1BRK A;  1W2Z A;  1JB4 A;  1EA2 A;  4Q53 A;  3JUO A;  1W2B 2;  2L4V A;  3A5E A;  2AAE A;  1KSI A;  1RGL A;  2KF6 A;  1VQP 3;  1FUS A;  1W00 A;  1OGZ A;  1RN7 A;  1UI8 A;  1X1U A;  2W0Q A;  2ZDJ A;  3EN1 B;  4N6M A;  4XB5 A;  1A2K A;  3KSE D;  4L8P A;  3S67 A;  3AHW A;  2XR8 B;  2XH9 A;  1G0T A;  1HYF A;  2RCD A;  3D3L A;  2Q07 A;  5KP3 A;  2OQE A;  5BVB A;  3G6E 3;  3WOF B;  1O7W B;  2GXF A;  3EJV A;  3WA3 A;  1B21 A;  1WMP A;  3NQY A;  1ZO2 A;  3DGL A;  1TTO A;  5CF1 A;  1I3F A;  3S5C A;  3FF0 A;  1ISK A;  1BSB A;  2ML6 A;  4IPB A;  1BNR A;  2B1X B;  3B8L A;  3U1W A;  1DMN A;  2F5M A;  4HAA A;  4KFF A;  1NB3 I;  3NHX A;  1X1X A;  4XM4 A;  5TGN A;  2WGO A;  4XBX A;  1BRJ A;  3BIR A;  4MJD A;  8CHO A;  4GHO A;  1C7H A;  3KII A;  1T2H A;  1STF I;  3DUK A;  4G1M B;  5AIH A;  1VQ6 3;  4EXR A;  1EEJ A;  1WTH A;  4H61 A;  1NB5 I;  4FMA A;  1JNQ A;  3NBR A;  4XBT A;  3K7C A;  5G1L A;  1US1 A;  3A76 A;  4EW5 A;  1VQ8 3;  1FUW A;  4FCZ A;  2IYJ A;  1IT8 A;  2LQV A;  3GRD A;  1BSA A;  3L0R A;  4OVM A;  3ROB A;  1SQW A;  3SX1 A;  4KFE A;  4KFD A;  4N6T A;  5D81 A;  1JJ2 2;  1B2X A;  1BRH A;  1MWR A;  1RGK A;  2XRX B;  1I70 A;  2H0I A;  5AI1 A;  1CQS A;  1D6U A;  2OWP A;  1DVC A;  2P0M A;  4STD A;  2WOF A;  1YVB I;  1EG9 B;  1KD1 4;  2XFS A;  3MSO A;  4HM6 B;  3FF2 A;  3URP A;  2YFL B;  1W4N A;  2CK3 H;  1IVV A;  2CH9 A;  3KCH A;  1BVI A;  1ZS7 A;  1QAF A;  3AHS A;  3WOE B;  1MWT A;  3BNB A;  3FG4 A;  1B2S A;  3EBT A;  2RGQ A;  2HMO B;  3ZFZ A;  2GU1 A;  2WOH A;  1LXE A;  3LOY A;  4HKV B;  2HML B;  1I2E A;  1MGW A;  2P05 A;  1VQM 3;  4LYL B;  3RGA A;  5IG3 A;  4GSP A;  5AEW B;  1GY7 A;  1DVD A;  3CCE 3;  4WYK A;  1GD4 A;  3RDE A;  3MPH A;  2KAA A;  3BND A;  3EB8 A;  1E3R A;  4CDL A;  1NNV A;  3H51 A;  4BIR A;  3CCS 3;  3NBJ A;  4N6O B;  1GOV A;  1OHS A;  4CJN A;  3PCS A;  1QAL A;  1W02 A;  2P38 A;  3AMO A;  4MEI A;  2XF3 A;  3GZB A;  3KKG A;  1YGW A;  4J5K A;  3CC2 3;  4KZ1 A;  1FGM A;  1UCL A;  3DMC A;  1LOY A;  3EBY A;  2WGQ A;  1W6G A;  3JUP A;  1AY7 A;  3UNL A;  3U97 A;  1RGA A;  1QVF 2;  5IEP A;  3X42 A;  3KN4 A;  1FYS A;  5CK6 A;  1JV2 B;  1VQO 3;  3NXJ A;  5D83 A;  2XSO B;  2CW9 A;  3K5T A;  5IF6 A;  3CCQ 3;  2CX1 A;  1NDO B;  1R4Y A;  2D42 A;  2O3O A;  1JN5 A;  3JVC A;  3NM7 A;  2F99 A;  3H3H A;  4RNT A;  4FCM A;  1BNJ A;  5D82 A;  5CLK A;  1N5H A;  1JBR A;  2QIY A;  2W6J H;  3KSP A;  3NQZ A;  1FGQ A;  3LT8 A;  1BIR A;  2SAR A;  2CFK A;  1IQX A;  1O7H B;  1O7P B;  2BO9 B;  2YFJ B;  3BNC A;  3HK4 A;  1QVG 2;  1D6Z A;  3SYU A;  4DKI A;  1RHL A;  1JBT A;  3LXU X;  5JPU A;  1DE3 A;  1BRS A;  2CG0 A;  1IV9 A;  1HU9 A;  1WMN A;  2V1L A;  4HM3 B;  1AVK A;  2ZA4 A;  4K90 B;  4NRE A;  1TIJ A;  1IU7 A;  1GYB A;  1O7M B;  3AGN A;  1Q81 4;  3FSD A;  2XEP A;  3OX9 A;  1Q40 A;  1TRP A;  3WA2 X;  4FCJ A;  5AYR B;  1BRI A;  4CPK A;  2C4B A;  1PYL A;  1WMO A;  5IG0 A;  1C54 A;  2CC3 A;  1BUJ A;  1NU3 A;  5EQL A;  1BGS A;  1A67 A;  1K41 A;  3CPW 2;  2BU4 A;  2XGN A;  3CCL 3;  3J7Y d;  1Q9E A;  3MG1 A;  3NV0 B;  1FGO A;  2R4I A;  5BU4 A;  5EEO A;  5IG5 A;  1BRG A;  3S29 A;  2H0G A;  1SJW A;  5CXO A;  3E99 A;  1I2F A;  1NO3 A;  4J8T A;  3UL6 A;  5CF2 A;  4R80 A;  2XGL A;  1N9E A;  1OF5 A;  5IEO A;  4BU4 A;  4EYC A;  3LTB A;  1NJI 4;  5DRE A;  2IUK A;  5IEN A;  3SVA A;  4ILF A;  3AGO A;  4OK0 A;  1MOL A;  1YIT 3;  1V58 A;  3PS8 A;  1LQG C;  3RNT A;  3WOD G;  1ZGX A;  4BL3 A;  2CIU A;  3B4O A;  4ZM8 A;  2SBL A;  2RSX A;  3MG2 A;  2HOH A;  4O3V A;  5AII A;  3V92 A;  1CYU A;  4RNY A;  1N8R 4;  4LMI A;  1AR0 A;  3X3Y A;  3N54 B;  1EQK A;  1UI7 A;  3K63 A;  1D6Y A;  3VGN A;  3GZR A;  1UDI I;  2Z77 A;  3B7C A;  3FCS B;  3CXC 2;  1RDS A;  4HM5 B;  2GEX A;  4IT7 A;  2XSH B;  1DET A;  1YGE A;  3ZG0 A;  3F7S A;  5HGR A;  3DZL A;  2F86 B;  5RNT A;  1V57 A;  4FMC A;  1DMM A;  2CG1 A;  1B3S A;  1R4C A;  4EV2 A;  1YIJ 3;  3CCV 3;  1U8C B;  4FMD A;  2HMN B;  5M18 A;  3I56 3;  2UUG C;  2W2C A;  3N9H A;  5STD A;  4BTW A;  3FG3 A;  2K0M A;  1LRA A;  2F98 A;  4R9K A;  1ROA A;  1RRH A;  3ALA A;  2OOV C;  1G96 A;  1IVW A;  3X41 A;  1RNT A;  3T8N A;  2Z7A A;  3HII A;  2ML5 A;  3NM2 A;  4H3U A;  3PCR A;  4MMZ B;  3OWU A;  3EX9 A;  3D9R A;  3LYG A;  3I55 3;  1BNS A;  1UUW B;  1Z1S A;  3V99 A;  1UGH I;  1LOV A;  3VSY A;  3CNM A;  1A2P A;  3G0K A;  3G16 A;  4LSO A;  8RNT A;  1IVU A;  1FA3 A;  1RGE A;  2B24 B;  3DGM A;  1RN4 A;  3ZG5 A;  3D5I A;  2GBW B;  1HZ1 A;  3Q2P A;  3NBB A;  4XDW A;  3SXX A;  1I2G A;  2IA7 A;  1UCK A;  4PEJ A;  1IQ8 A;  4WP5 A;  1K8A 4;  2Z6B A;  1M1K 4;  3WR2 A;  2OCT A;  1JZO A;  1Q7Y 4;  1O7N B;  4N3V A;  5FGO A;  1VQQ A;  1B2M A;  2CFG A;  2CX0 A;  3HX8 A;  3FLJ A;  2W56 A;  1BNE A;  4K1V A;  4NPB A;  3S28 A;  1BAN A;  3KFQ C;  1VQ7 3;  1IV7 A;  1RMS A;  7STD A;  3HI7 A;  1FUT A;  2HMJ B;  1GOY A;  2K54 A;  4I4K A;  1M1X B;  1MGR A;  2L1S A;  2YX9 A;  4LEH A;  5BIR A;  3FZW A;  1Q82 4;  3D5G A;  1BNI A;  1JKG A;  3CU3 A;  3OXA A;  5JPP A;  1G02 A;  1N9J A;  3K0Z A;  4HZB B;  6RNT A;  4HM7 B;  1SPU A;  2BMQ B;  4WYK B;  5KP4 A;  2FXT A;  1AV4 A;  1YJN 3;  2P09 A;  2CFL A;  3FGY A;  3CME 3;  4EV5 A;  1BRN L;  2YFI B;  1KWI A;  1S72 3;  3SLU A;  5GSP A;  1VQ4 3;  4HM8 B;  1W01 A;  1EKM A;  3UL5 A;  4GL6 A;  1A2V A;  7GSP A;  1I3I A;  1SIH A;  1PU4 A;  4LZI A;  3AMO B;  3B4P A;  4LGQ A;  1TP6 A;  1OPY A;  4ORL A;  1JB2 A;  3CNX A;  5M1A A;  4EBG A;  4RZM A;  3JUN A;  5AYS C;  3QK9 A;  3SOY A;  1HKX A;  1BU4 A;  1LVN A;  3GAX A;  3D79 A;  2PNC A;  2OTL 3;  3DXO A;  3CCR 3;  2QA4 3;  1JRQ A;  1I0V A;  1X1Y A;  5HOH A;  3GSP A;  1LQM B;  1Q42 A;  4EC6 A;  1YJW 3;  3X40 A;  1IYY A;  2H0H A;  1Y4K A;  3IPT A;  1UW1 A;  2BNG A;  1TUH A;  5FW5 A;  1I8V A;  1QAK A;  1GSP A;  3MYT A;  1M9G A;  3OW2 2;  2CKF B;  1KQS 2;  1JN5 B;  2E2U A;  3F8H A;  4KT3 B;  1RGG A;  1IQY A;  1UCJ A;  3M8C A; 
#chains in the Genus database with same CATH homology
 2W9P A;  1JB5 A;  2ZL8 A;  5JBS A;  1ASK A;  4R4K A;  2OOV A;  4AEQ A;  1RKY A;  3I0Y A;  1N8Q A;  3HZP A;  3MG3 A;  2W03 A;  3Q90 A;  1QJG A;  4O8S A;  3CCJ 3;  3EE1 A;  4K1U A;  1DMQ A;  2MF7 A;  4JF8 A;  5ELU A;  1YJ9 3;  1TFO A;  1W7C A;  3HIG A;  4XDV A;  2CWT A;  4R1K A;  1BUQ A;  4GB5 A;  2BMO B;  3STD A;  1FGR A;  1IVX A;  2IUJ A;  1OH0 A;  4FMB A;  4WHA A;  1ROV A;  4HM2 B;  1VQK 3;  3F8X A;  1SII A;  2C10 A;  2QGU A;  1Q40 B;  3BNE A;  1J2B A;  3F14 A;  3JUM A;  4BTX A;  2UX0 A;  1U5O A;  2BMR B;  1DYU A;  1FGT A;  4JRF A;  1S5A A;  3LML A;  2BHM A;  2P0X A;  1KC8 4;  4RNZ A;  3DY5 A;  3GZX B;  4L8O A;  2E2T A;  1QMA A;  2W9Q A;  3SED A;  3WMD A;  1LOX A;  2IMJ A;  6STD A;  1RJO A;  2Y73 A;  2HMM B;  3LH4 A;  3Q1C A;  4HM1 B;  5G2G A;  4QWT A;  1YHQ 3;  2I9W A;  2CFD A;  4HM4 B;  4FR9 A;  3IMA B;  4HBR A;  3CMA 3;  2GBX B;  1OF5 B;  1A90 A;  5ELJ A;  3LT9 A;  3OWY A;  3S27 A;  1TFK A;  1WQL B;  4TX4 A;  1RRL A;  5IW9 A;  3LTA A;  4L7K A;  3G71 3;  5BXQ A;  5I97 A;  4CCV A;  3BLZ A;  3CC7 3;  1T5Y A;  3PXM A;  4RBN A;  1CYV A;  1GY5 A;  5EVH A;  2FGT A;  3DM8 A;  2BT3 A;  2M7O A;  4J9A A;  3WDG B;  1STD A;  3MHE A;  1N5P A;  4N6U A;  1YI2 3;  4OUQ A;  2HMK B;  2C11 A;  3F40 A;  3TDG A;  1E97 A;  5LC7 A;  1GY6 A;  3IJE B;  3GWR A;  1E3V A;  3EC9 A;  3X3Z A;  4HVN A;  1W5Z A;  3KE7 A;  1VQ9 3;  3ER7 A;  3FG1 A;  3T0U A;  1OGX A;  2CWV A;  2INX A;  4N6L A;  3NUV A;  3CCU 3;  1PFP A;  1UUV B;  4HM0 B;  3F9S A;  4O02 B;  2A15 A;  3K9M C;  2O9U X;  3T8U A;  2OQE C;  1OCV A;  2D1W A;  2FNQ A;  2STD A;  4XBY A;  1VQ5 3;  4KVH A;  1W6C A;  5DRV A;  2KXG A;  1F8N A;  3FKA A;  3O8Y A;  4AKY A;  3MWZ A;  1M90 4;  1MNL A;  2W04 A;  4R9L A;  1NWW A;  2KCD A;  2CWU A;  1OHO A;  2Z76 A;  3EN8 A;  3V98 A;  1CEW I;  3FH1 A;  3LTD A;  3RGR A;  2GEY A;  4MMX B;  4O2H A;  4N6V 0;  4N6N B;  2GU3 A;  4X2H A;  3KZT A;  3OV4 A;  1O7G B;  4IIA A;  1K73 4;  1IT7 A;  1IK3 A;  3PZW A;  4AKZ A;  3OWS A;  1Q86 4;  3CCM 3;  5LC6 A;  2MC8 A;  1IDP A;  5A0O B;  5KP1 A;  2PZV A;  1TU5 A;  3PGB A;  1OUN A;  2CHC A;  2W56 B;  1OAC A;  3BB9 A;  3CC4 3;  3UB1 A;  3CD6 3;  3N8B A;  2XFT A;  3LTC A;  2QEX 3;  1VQL 3;  1LNH A;  4WWU C;  1K9M 4;  1L5G B;  1V74 A;  4WFO A;  1JKG B;  3PYJ A;  2CFW A;  3NV0 A;  2LYX A;  4HJL B;  4BTY A;  3QRD A;  5AEU B;  3SOA A;  4HYZ A;  3G4S 3;  2E2V A;  1AVL A;  4HZ9 B;  1WNH A;  1W6Y A;  5AIF A;  1OHP A;  3EF8 A;  4K61 A;  2JQ5 A;  5AIG A;  3UJM A;  2WO0 A;  3ECF A;  2RFR A;  3MKI A;  4MMY B;  2KRT A;  1VQN 3;  3GZY B;  2OTJ 3;  3DGO A;  3EQQ B;  3F7X A;  3EHC A;  3X3X A;  3LZA A;  5IER A;  5IG4 A;  3CPO A;  3JUQ A;  1GS3 A;  1GD3 A;  1K28 A;  4NHF A;  1VZZ A;  4U13 A;  3NX0 A;  2JDI H;  1ZX2 A;  4X2O A;  1ULI B;  1ULJ B;  3G8Z A;  2Y74 A;  3DGN A;  3VF1 A;  1W2Z A;  1JB4 A;  1EA2 A;  4Q53 A;  3JUO A;  1W2B 2;  2L4V A;  1KSI A;  1VQP 3;  1W00 A;  2ZDJ A;  1OGZ A;  1RN7 A;  1UI8 A;  3EN1 B;  2W0Q A;  4N6M A;  4XB5 A;  1A2K A;  3KSE D;  4L8P A;  3S67 A;  2XR8 B;  2XH9 A;  2RCD A;  3D3L A;  2Q07 A;  5KP3 A;  2OQE A;  5BVB A;  3G6E 3;  3WOF B;  1O7W B;  2GXF A;  3EJV A;  3WA3 A;  1WMP A;  3NQY A;  1ZO2 A;  3DGL A;  5CF1 A;  1ISK A;  3S5C A;  3FF0 A;  2ML6 A;  4IPB A;  2B1X B;  3B8L A;  3U1W A;  1DMN A;  4KFF A;  1NB3 I;  3NHX A;  4XM4 A;  5TGN A;  2WGO A;  4XBX A;  4MJD A;  8CHO A;  1C7H A;  3KII A;  4G1M B;  1STF I;  3DUK A;  5AIH A;  1VQ6 3;  4EXR A;  1WTH A;  4H61 A;  1NB5 I;  4FMA A;  1JNQ A;  3NBR A;  4XBT A;  3K7C A;  1US1 A;  3A76 A;  1VQ8 3;  1FUW A;  4FCZ A;  1IT8 A;  2LQV A;  3GRD A;  3L0R A;  4OVM A;  3ROB A;  3SX1 A;  1SQW A;  4KFE A;  4KFD A;  4N6T A;  5D81 A;  1JJ2 2;  2XRX B;  5AI1 A;  1CQS A;  1D6U A;  2OWP A;  1DVC A;  2P0M A;  4STD A;  2WOF A;  1YVB I;  1EG9 B;  1KD1 4;  2XFS A;  3MSO A;  4HM6 B;  3FF2 A;  2YFL B;  1W4N A;  2CK3 H;  1IVV A;  2CH9 A;  1QAF A;  3WOE B;  3BNB A;  3FG4 A;  3EBT A;  2RGQ A;  2HMO B;  2GU1 A;  2WOH A;  1LXE A;  3LOY A;  4HKV B;  2HML B;  2P05 A;  1VQM 3;  3RGA A;  5IG3 A;  5AEW B;  1GY7 A;  1DVD A;  3CCE 3;  4WYK A;  1GD4 A;  3RDE A;  3MPH A;  3BND A;  3EB8 A;  1E3R A;  4CDL A;  3H51 A;  3CCS 3;  3NBJ A;  4N6O B;  1OHS A;  3PCS A;  1QAL A;  1W02 A;  2P38 A;  3AMO A;  4MEI A;  2XF3 A;  3GZB A;  3KKG A;  3CC2 3;  4KZ1 A;  1FGM A;  3DMC A;  3EBY A;  2WGQ A;  1W6G A;  3JUP A;  3UNL A;  3U97 A;  1QVF 2;  5IEP A;  3X42 A;  3KN4 A;  5CK6 A;  1JV2 B;  1VQO 3;  3NXJ A;  5D83 A;  2XSO B;  2CW9 A;  3K5T A;  5IF6 A;  3CCQ 3;  1NDO B;  2D42 A;  2O3O A;  1JN5 A;  3JVC A;  3NM7 A;  2F99 A;  3H3H A;  4FCM A;  5D82 A;  5CLK A;  1N5H A;  2QIY A;  2W6J H;  3KSP A;  3NQZ A;  1FGQ A;  3LT8 A;  2CFK A;  1IQX A;  1O7H B;  1O7P B;  2BO9 B;  2YFJ B;  3BNC A;  3HK4 A;  1QVG 2;  1D6Z A;  3LXU X;  5JPU A;  2CG0 A;  1IV9 A;  1HU9 A;  1WMN A;  2V1L A;  4HM3 B;  1AVK A;  4K90 B;  4NRE A;  1TIJ A;  1IU7 A;  1GYB A;  1O7M B;  1Q81 4;  3FSD A;  2XEP A;  3OX9 A;  1Q40 A;  3WA2 X;  4FCJ A;  5AYR B;  1WMO A;  5IG0 A;  2CC3 A;  1NU3 A;  5EQL A;  1A67 A;  1K41 A;  3CPW 2;  2XGN A;  3CCL 3;  3J7Y d;  3MG1 A;  3NV0 B;  1FGO A;  2R4I A;  5EEO A;  5IG5 A;  3S29 A;  1SJW A;  5CXO A;  3E99 A;  1NO3 A;  4J8T A;  3UL6 A;  5CF2 A;  4R80 A;  2XGL A;  1N9E A;  1OF5 A;  5IEO A;  4EYC A;  3LTB A;  1NJI 4;  5DRE A;  2IUK A;  5IEN A;  3SVA A;  4OK0 A;  1MOL A;  1YIT 3;  3PS8 A;  3WOD G;  2CIU A;  3B4O A;  4ZM8 A;  2SBL A;  2RSX A;  3MG2 A;  4O3V A;  5AII A;  3V92 A;  1CYU A;  4RNY A;  1N8R 4;  4LMI A;  1AR0 A;  3X3Y A;  3N54 B;  1EQK A;  1UI7 A;  3K63 A;  1D6Y A;  3VGN A;  3GZR A;  2Z77 A;  3B7C A;  3FCS B;  3CXC 2;  4HM5 B;  2GEX A;  4IT7 A;  2XSH B;  1YGE A;  3F7S A;  5HGR A;  3DZL A;  2F86 B;  4FMC A;  1DMM A;  2CG1 A;  1R4C A;  4EV2 A;  1YIJ 3;  3CCV 3;  1U8C B;  4FMD A;  2HMN B;  3I56 3;  2W2C A;  3N9H A;  5STD A;  4BTW A;  3FG3 A;  2K0M A;  2F98 A;  4R9K A;  1ROA A;  1RRH A;  3ALA A;  2OOV C;  1G96 A;  1IVW A;  3X41 A;  3T8N A;  2Z7A A;  3HII A;  2ML5 A;  3NM2 A;  4H3U A;  3PCR A;  4MMZ B;  3OWU A;  3EX9 A;  3D9R A;  3LYG A;  3I55 3;  1Z1S A;  1UUW B;  3V99 A;  3VSY A;  3CNM A;  3G0K A;  3G16 A;  4LSO A;  1IVU A;  1FA3 A;  2B24 B;  3DGM A;  2GBW B;  3Q2P A;  3NBB A;  4XDW A;  3SXX A;  2IA7 A;  4PEJ A;  4WP5 A;  1IQ8 A;  1K8A 4;  2Z6B A;  1M1K 4;  2OCT A;  1Q7Y 4;  1O7N B;  4N3V A;  5FGO A;  2CFG A;  3HX8 A;  3FLJ A;  2W56 A;  4K1V A;  3S28 A;  3KFQ C;  1VQ7 3;  1IV7 A;  7STD A;  3HI7 A;  2HMJ B;  2K54 A;  4I4K A;  1M1X B;  2YX9 A;  4LEH A;  3FZW A;  1Q82 4;  1JKG A;  3CU3 A;  3OXA A;  5JPP A;  3K0Z A;  1N9J A;  4HZB B;  4HM7 B;  1SPU A;  2BMQ B;  4WYK B;  5KP4 A;  2FXT A;  1AV4 A;  1YJN 3;  2P09 A;  2CFL A;  3FGY A;  3CME 3;  4EV5 A;  2YFI B;  1KWI A;  1S72 3;  3SLU A;  4HM8 B;  1W01 A;  1EKM A;  3UL5 A;  4GL6 A;  1A2V A;  1SIH A;  1PU4 A;  4LZI A;  3AMO B;  3B4P A;  4LGQ A;  1TP6 A;  1OPY A;  4ORL A;  1JB2 A;  3CNX A;  4EBG A;  4RZM A;  3JUN A;  5AYS C;  3QK9 A;  3SOY A;  1HKX A;  1LVN A;  3GAX A;  2PNC A;  2OTL 3;  3DXO A;  3CCR 3;  2QA4 3;  1JRQ A;  1YJW 3;  1Q42 A;  4EC6 A;  3X40 A;  1Y4K A;  3IPT A;  1UW1 A;  2BNG A;  1TUH A;  5FW5 A;  3MYT A;  1QAK A;  1KQS 2;  1VQ4 3;  1M9G A;  3OW2 2;  2CKF B;  1JN5 B;  2E2U A;  3F8H A;  1IQY A;  3M8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...