3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords LinA
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
source organism Uncultured organism
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
2YFJB 3NV0A 2F86B 4HKVB 4HM0B 4HM7B 3BB9A 2QIYA 5CF1A 5KP3A 3EC9A 1NU3A 1E3RA 1ISKA 5IG3A 4L8OA 3FGYA 1UUWB 4XBYA 3DM8A 4N3VA 3KKGA 3FF2A 4LGQA 3JUMA 3RGRA 2PZVA 2HMNB 2GBWB 4K1VA 5AIFA 3T8NA 3NBRA 1TP6A 2R4IA 4HZ9B 1U5OA 1AR0A 1EA2A 5IF6A 3STDA 1O7HB 3JUOA 4ORLA 3FLJA 1ZX2A 3T8UA 3EN8A 2I9WA 3FSDA 3GZBA 1GY7A 2BMRB 1Z1SA 1E3VA 3MYTA 4OVMA 3IPTA 3F40A 5JPPA 1OHPA 2HMKB 3OXAA 1QJGA 5TGNA 3Q90A 4X2OA 5CXOA 4X2HA 5AIHA 3M8CA 2XRXB 6STDA 3EHCA 3DMCA 2YFIB 1ASKA 1O7PB 3EJVA 3FKAA 4WWUC 5CK6A 5KP4A 3MHEA 3B7CA 3G0KA 2OWPA 1O7NB 3MSOA 1ULIB 5EVHA 1JB5A 2A15A 4CDLA 4XDVA 2B24B 4KVHA 2BMQB 3LYGA 2XSHB 2JQ5A 3H3HA 4WP5A 3CU3A 5IG5A 2CKFB 1Q40B 1SJWA 1JKGB 1OGZA 5BVBA 3CPOA 1STDA 1TUHA 3CNMA 4HM4B 8CHOA 1E97A 3MG3A 1Q40A 3LZAA 4HM2B 1JKGA 4HZBB 1GY6A 1DMMA 5G2GA 2GEXA 4RZMA 7STDA 3ECFA 2IMJA 3ER7A 3BLZA 3F9SA 4U13A 3JUNA 3EF8A 1VZZA 3I0YA 3UJMA 5AIIA 2GBXB 3F7XA 3VSYA 4HM5B 1OH0A 1K41A 2STDA 4XB5A 4WYKB 4HM8B 1JB4A 4LMIA 4R9KA 1JN5B 2BNGA 1A2KA 1HKXA 5DRVA 2YFLB 3NUVA 1S5AA 2BMOB 3GWRA 4HM3B 1ULJB 3WMDA 3G8ZA 5KP1A 4WYKA 3JUQA 1O7MB 1JN5A 3KE7A 3F8XA 5D83A 4STDA 4OUQA 1GS3A 3OWUA 4HM6B 4J8TA 1W6YA 3F7SA 1DMQA 5IEOA 5IEPA 3EQQB 3DZLA 4I4KA 1OUNA 3EBYA 2GXFA 3HX8A 3SOYA 1O7GB 3VGNA 1CQSA 5JPUA 1W01A 5IERA 2HMJB 5IENA 3OWYA 3NXJA 4IIAA 1IDPA 3KZTA 4L7KA 5FW5A 3FF0A 4XDWA 5BXQA 2QGUA 4H3UA 3OWSA 1BUQA 3GZXB 3F14A 3K7CA 5CLKA 2RFRA 1OF5B 3EX9A 3FZWA 3H51A 4HJLB 3NHXA 1OGXA 5AIGA 1QMAA 4L8PA 1DMNA 5DREA 5AEWB 1Q42A 3DUKA 1OF5A 5AI1A 3GZRA 4XBTA 2UX0A 3K0ZA 3B4PA 2K54A 3MG1A 1O7WB 1OHSA 3A76A 3D9RA 5D82A 1UUVB 5D81A 3GRDA 3ROBA 3HZPA 3B8LA 4K1UA 4MJDA 3GZYB 1OHOA 2Z77A 1W02A 2HMLB 3KSPA 4R9LA 3SOAA 1JB2A 2W2CA 1NWWA 2B1XB 4R1KA 5AEUB 5IG0A 2Z7AA 4J9AA 1C7HA 4FCJA 1OCVA 4GB5A 2RCDA 1WQLB 4XBXA 3EN1B 5IG4A 1EG9B 2HMOB 4XM4A 3EBTA 2CHCA 3S5CA 3G16A 3JUPA 1ZO2A 3E99A 4PEJA 3RGAA 3MG2A 3MKIA 3B4OA 2GEYA 1W00A 3SEDA 4HVNA 3F8HA 3FH1A 1GY5A 4Q53A 2RGQA 2Z76A 2F98A 1OPYA 3NM2A 1GYBA 2XSOB 5STDA 5CF2A 2INXA 2XR8B 2HMMB 4LEHA 1NDOB 3CNXA 3HK4A 3NV0B 3UNLA 4HM1B 3OX9A 4FCMA 5HGRA 2F99A 3DXOA 3OV4A
chains in the Genus database with same CATH superfamily
1Y4KA 2YFJB 3NV0A 1JZOA 2F86B 2W9PA 3Q3FA 2PNCA 4HKVB 3SX1A 4LZIA 1K28A 1LOXA 1JBRA 4O3VA 3CCJ3 4HM0B 1IT7A 4HM7B 5AYRB 3FG3A 2BO9B 3BB9A 3WA3A 3CC43 2QIYA 2WGQA 3AMOB 2E2VA 1MOLA 4ZM8A 2O3OA 5CF1A 2GSPA 5KP3A 3CCL3 5AYSC 3EC9A 1JZDA 1HZ1A 1A2PA 1ZS7A 2BIRA 1NU3A 1E3RA 3Q2PA 1ISKA 5IG3A 1TFKA 1EQKA 4L8OA 3SYUA 1I2GA 3FGYA 3AMOA 1MWTA 1UUWB 1W6GA 4IPBA 1VQ83 4XBYA 2CG0A 3DM8A 4N3VA 3KKGA 2MF7A 3SVAA 3V98A 2OTJ3 3CME3 3NQZA 3FF2A 4OK0A 2H0HA 1B2SA 3KCHA 1B2UA 4LGQA 1VQK3 3JUMA 3RGRA 4N6UA 2PZVA 2KCDA 4KFDA 1KD14 1IVXA 1RCLA 2HMNB 5JBSA 1UCIA 4J5GA 2GBWB 1N9EA 1ROVA 1WNHA 5EQLA 1MGRA 4K1VA 5AIFA 3EB8A 3T8NA 2Y73A 1BUJA 3NBRA 2K3DA 3SXXA 2ZL8A 5A0OB 1TP6A 2C11A 3NBJA 3LXUX 1LQMB 2WOFA 1FA3A 3BNEA 2W03A 2F5WA 2R4IA 4HZ9B 5G1KA 3FCSB 1FYSA 1U5OA 1AR0A 1F8NA 1VQO3 1EA2A 1WTHA 1DVCA 3STDA 1O7HB 5IF6A 1GD4A 1FGQA 1N9JA 1RGAA 2E2TA 3JUOA 1KQS2 1RN7A 1EKMA 3ZG5A 1BANA 4ORLA 3FLJA 3DGOA 7RNTA 1TFOA 1ZX2A 1QALA 3T8UA 3EN8A 4N6MA 2I9WA 3FSDA 2CH9A 4MMYB 3GZBA 1GY7A 2BMRB 4O8SA 1Z1SA 3WOFB 2D42A 3ZFZA 4EV5A 1BU4A 1YIT3 1E3VA 2WGOA 1Q7Y4 1X1WA 3AHSA 2CFLA 3MYTA 3L0RA 3HI7A 4OVMA 2OCTA 3F40A 3IPTA 3D5IA 1D6YA 5JPPA 1BNEA 1LVNA 1OHPA 1WMOA 2HMKB 2KF4A 3D5GA 3X42A 3LTBA 3OXAA 4K61A 1RHLA 4N6OB 1QJGA 3LT8A 1FUWA 1RRLA 5CXOA 3Q90A 4X2OA 5TGNA 2FNQA 3AGOA 2CFKA 2GU1A 4X2HA 1YIJ3 5AIHA 3M8CA 1RGFA 4FMCA 2XRXB 4K90B 1M1K4 6STDA 3EHCA 3DMCA 7GSPA 1NNVA 1TTOA 1JJ22 2YFIB 1UCJA 4CCVA 4EC6A 1DYUA 3DGNA 1W5ZA 3QRDA 2WOHA 1BNGA 1ASKA 2XH9A 1O7PB 4RNTA 3EJVA 4AKZA 3FKAA 2E2UA 1T2HA 4WWUC 4H61A 1Q7HA 3X41A 1GD3A 5CK6A 1NJI4 2SBLA 5KP4A 1OACA 3PYJA 3MHEA 1FGMA 2IUKA 3B7CA 3G0KA 2OWPA 1O7NB 1RGGA 3MSOA 2BHMA 2JDIH 1BRKA 1RGCA 4EYCA 1JRQA 3X3ZA 1ULIB 1LNHA 1JB5A 5EVHA 3BNBA 5FGOA 1MWRA 2A15A 2KF6A 1N5PA 4R4KA 1VQ43 4CDLA 4XDVA 2FGTA 3PCSA 4CJNA 2OTL3 1AVLA 2B24B 3NQYA 2BMQB 4KVHA 5LC7A 1YNVX 2ML5A 4WFOA 1V57A 3HIIA 5GSPA 1JBSA 5M1AA 3LYGA 2XSHB 3DGYA 2JQ5A 4FMAA 4GL6A 1HYFA 3O8YA 4N6TA 3H3HA 3MPHA 4WP5A 4DKIA 3I563 4BTWA 1D6ZA 1SARA 2BT3A 1WMNA 2CKFB 3CU3A 5IG5A 3AHWA 1Q864 1TJDA 3BNCA 1VQ93 1CYVA 1Q40B 9RNTA 1UDII 1SJWA 1JBTA 1JKGB 4QWTA 1YJ93 1OGZA 2XGLA 2L4VA 3D3LA 5BVBA 3CPOA 4N6LA 3SLUA 4R80A 3K63A 1STDA 1MWSA 1NB3I 1PYLA 1TUHA 1US1A 1V74A 3CNMA 3D79A 2CWUA 3A5EA 3LTDA 4HM4B 3V92A 3TDGA 1E97A 3MG3A 4BL3A 3PGBA 8CHOA 1W6CA 3HIGA 3LMLA 1M9GA 4AEQA 1Q40A 2H0GA 3UL6A 3CCR3 3LZAA 4HM2B 1JKGA 3GAXA 2KF3A 4HZBB 3CMA3 1BSDA 5IW9A 1GY6A 1R4CA 1Q814 1DMMA 1QAKA 3ALAA 2GEXA 4RZMA 5G2GA 7STDA 1IYYA 1ROAA 3ECFA 2IMJA 3ER7A 1U8CB 2O9UX 1BRJA 3BLZA 5HOHA 3X3YA 3F9SA 4U13A 1G02A 3JUNA 1IU7A 1EEJA 1AV4A 2KRTA 1BSAA 3EF8A 1VQP3 2W9QA 3WDGB 3QK9A 1RNBA 3KSED 5EEOA 3CCQ3 1VZZA 1BAOA 3I0YA 1LNIA 3UJMA 1PU4A 1YHQ3 1IVVA 5AIIA 2GBXB 3F7XA 4MMZB 2CIUA 4MMXB 3S29A 4O02B 4RNYA 3VSYA 3X40A 4HM5B 3K5TA 1OH0A 2P09A 2XEPA 1BSCA 4HBRA 2CW9A 3HOHA 1K41A 3CPW2 2STDA 1B27A 1GMQA 2OQEC 4XB5A 2CFGA 5ELJA 1HU9A 1G96A 1RN1A 1T2IA 1VQL3 4WYKB 1FGRA 3N8BA 4HM8B 1JB4A 1IQ8A 4LMIA 1JN5B 4R9KA 3WHOA 2BNGA 1KWIA 1A2KA 1HKXA 1BNFA 1UGIA 3WOEB 5DRVA 2YFLB 2F56A 3NUVA 2OQEA 3S28A 1S5AA 2BMOB 3GWRA 4IT7A 4HM3B 1LOYA 1ULJB 3WMDA 1G0TA 1BRGA 1I2EA 2C10A 1GSPA 3G8ZA 5KP1A 1I2FA 4WYKA 3Q1CA 3JUQA 1S723 3N9HA 1O7MB 1IVWA 1JN5A 1TIJA 2SARA 2H0IA 2QA43 3KE7A 3F8XA 5D83A 2CG1A 4STDA 1B2MA 4OUQA 4LSOA 1GS3A 1DVDA 1NB5I 1BOXA 1TRQA 2BU4A 1BRNL 3OWUA 1SQWA 4HM6B 4LYLB 4J8TA 1W6YA 1BNSA 1WMPA 3F7SA 1DMQA 1SIHA 5IEOA 1I0VA 1M904 5IEPA 4CPKA 1AVKA 3EQQB 4BTYA 1GMPA 1RGEA 3DZLA 3KFQC 1N5HA 3JVCA 4I4KA 4BU4A 1LRAA 1OUNA 1YI23 2W6JH 3EBYA 2Y74A 2GXFA 2J8XB 4GHOA 3KN4A 2Q07A 3LTAA 3HX8A 4HYZA 1YVBI 1RJOA 1ZGXA 1Q9EA 3UL5A 1CYUA 1MNLA 3SOYA 4I5QA 1CEWI 1O7GB 2ZHXB 1BNRA 1DE3A 4KFEA 3VGNA 1CQSA 1RGHA 5JPUA 1W01A 2UGIA 2RNTA 5IERA 3CD63 1W4NA 3U1WA 2ML6A 4J5KA 3CCM3 3D4AA 2XGNA 2HMJB 3WA2X 1RLSA 3DGMA 1UW1A 2C4BA 2KAAA 3OWYA 5IENA 2LYXA 4BTXA 1I70A 4FR9A 1IV9A 3NM7A 2IUJA 2YX9A 2AADA 3NXJA 3BNDA 4IIAA 1IDPA 3KZTA 1FZUA 1IV7A 4L7KA 1B2ZA 2RSXA 1J2BA 1I3FA 4GSPA 1RDSA 3FF0A 5FW5A 2MC8A 1IT8A 1RRHA 4XDWA 1BRIA 5BXQA 1QVF2 2QGUA 5BU4A 4H3UA 1BGSA 3S67A 3G713 3OWSA 3CC73 1BRHA 3BIRA 1BUQA 1FGOA 2CC3A 2HOHA 1UCKA 2M7OA 4BL2A 4BIRA 1D6UA 3GZXB 3F14A 2P05A 3NBBA 1BIRA 3K7CA 5CLKA 3FG4A 1UI8A 5I97A 5RNTA 1YGEA 2RFRA 1OF5B 3EX9A 3FZWA 3H51A 1B3SA 1BNJA 1W2ZA 4EW5A 1PY3A 4HJLB 3NHXA 5LC6A 1OGXA 5AIGA 2KF5A 4EV2A 1QMAA 5M19A 3DY5A 3PZWA 4L8PA 1DMNA 1W2B2 5DREA 2XFTA 1RSNA 5AEWB 1Q42A 1QVG2 1RGLA 2CWVA 1SPUA 3IJEB 3DUKA 1BRSA 3CCE3 1OF5A 5AI1A 4O2HA 3GZRA 4XBTA 1LOVA 3U97A 2UX0A 2F5MA 1R4YA 3K0ZA 3B4PA 2F4YA 2K54A 3MG1A 1I0XA 4FMDA 4N6V0 2ZA4A 1BVIA 1K9M4 1FGTA 1A2VA 1STFI 2GU3A 1IK3A 1O7WB 2P38A 1OHSA 4KFFA 3A76A 3D9RA 1B21A 2P0XA 5D82A 4EXRA 1YVSA 1UUVB 2CX1A 3N54B 5D81A 4EBGA 1EUIC 2FXTA 3CCV3 1QAFA 2XF3A 1BNIA 3GRDA 1UCLA 3ROBA 4HAAA 2IY2A 1GOYA 1VQN3 5M18A 3HZPA 1YJW3 3B8LA 3V99A 1RKYA 1K8A4 1PFPA 2AAEA 2W04A 5ELUA 4K1UA 3RDEA 2CWTA 3X3XA 1GOVA 3WR2A 3I553 2V1LA 4MJDA 1C54A 3GZYB 1N8QA 3WODG 1OHOA 5G1LA 2Z77A 1KC84 1AY7A 3OW22 4MEIA 1UGHI 1RMSA 1T3BA 1W02A 2P0MA 2Z6BA 1VQ53 2LQVA 2HMLB 3KSPA 3LOYA 4R9LA 2OOVC 4NPBA 3SOAA 1JB2A 2R41A 3MWZA 2W2CA 1NWWA 1K734 1DETA 4NREA 1YJN3 3BU4A 1LQGC 1V58A 1RGKA 5BIRA 4N6NB 1RCKA 2B1XB 2OOVA 4AKYA 1FUTA 4KT3B 4R1KA 3RNTA 1MGWA 5AEUB 2UUGC 2XFSA 3FG1A 5IG0A 6RNTA 2QEX3 1FUSA 2Z7AA 2W0QA 4J9AA 1B2XA 1RN4A 1C7HA 1GOUA 1VQQA 3ZG0A 4FCJA 2L1SA 1OCVA 1IQXA 4GB5A 2RCDA 2IYJA 1IVUA 1W7CA 1WQLB 1LOWA 2CX0A 3IMAB 1RTUA 4FMBA 4ILFA 1UUGB 4XBXA 3EN1B 3DH2A 5IG4A 1EG9B 1M1XB 1BSEA 2HMOB 4XM4A 3EBTA 6GSPA 4FCZA 2CHCA 4JRFA 4KZ1A 3S5CA 3G16A 3G4S3 2KXGA 2ZDJA 1UI7A 2CFWA 3JUPA 3T0UA 1ZO2A 3E99A 1JV2B 1NO3A 4PEJA 1VQ73 1FW7A 3GSPA 3DGLA 3PCRA 1Q824 2W56B 3RGAA 1A90A 3MG2A 1X1UA 3MKIA 1TRPA 3J7Yd 4RNZA 2CFDA 4NHFA 1MWUA 1GMRA 2D1WA 2K0MA 3B4OA 3LTCA 3LT9A 3LH4A 2GEYA 1W00A 3SEDA 2WO0A 3G6E3 3S27A 4HVNA 3F8HA 3UB1A 3FH1A 4WHAA 8RNTA 2W56A 1GY5A 3VF1A 4Q53A 2RGQA 2Z76A 3K9MC 1VQ63 2F98A 1TU5A 3CCS3 1B20A 1OPYA 1I8VA 3URPA 3NM2A 1AQZA 1RNTA 3AGNA 1I3IA 1GYBA 2RBIA 2XSOB 1KSIA 4RBNA 2IA7A 5STDA 5CF2A 3EE1A 1T5YA 2INXA 2XR8B 2CK3H 1L5GB 3CXC2 2HMMB 4LEHA 1A67A 1NDOB 3CNXA 3OV4A 1VQM3 3PS8A 4TX4A 3NX0A 1BSBA 3HK4A 3NV0B 3UNLA 4G1MB 3OX9A 4HM1B 1JNQA 4FCMA 1LXEA 1X1XA 3KIIA 5HGRA 1IQYA 1SIIA 4HOHA 4JF8A 1YGWA 2F99A 3DXOA 3CCU3 3CC23 1X1YA 1N8R4 1CH0A 3PXMA
chains in the Genus database with same CATH topology
1Y4KA 2YFJB 3NV0A 2F86B 2W9PA 2PNCA 4HKVB 3SX1A 4LZIA 1K28A 1LOXA 4O3VA 3CCJ3 4HM0B 1IT7A 4HM7B 5AYRB 3FG3A 2BO9B 3BB9A 3WA3A 3CC43 2QIYA 2WGQA 3AMOB 2E2VA 1MOLA 4ZM8A 2O3OA 5CF1A 3CCL3 5KP3A 5AYSC 3EC9A 1NU3A 1E3RA 3Q2PA 1ISKA 5IG3A 1TFKA 1EQKA 4L8OA 3FGYA 3AMOA 1UUWB 1W6GA 4IPBA 1VQ83 4XBYA 2CG0A 3DM8A 4N3VA 3KKGA 2MF7A 3SVAA 3V98A 2OTJ3 3CME3 3NQZA 3FF2A 4OK0A 1VQK3 4LGQA 3JUMA 3RGRA 4N6UA 2PZVA 2KCDA 4KFDA 1KD14 1IVXA 5JBSA 2HMNB 2GBWB 1N9EA 1ROVA 1WNHA 5EQLA 4K1VA 5AIFA 3EB8A 3T8NA 2Y73A 3NBRA 3SXXA 5A0OB 2ZL8A 1TP6A 2C11A 3NBJA 3LXUX 2WOFA 1FA3A 3BNEA 2W03A 2R4IA 4HZ9B 3FCSB 1U5OA 1AR0A 1F8NA 1VQO3 1EA2A 1WTHA 1DVCA 3STDA 1O7HB 5IF6A 1GD4A 1FGQA 1N9JA 2E2TA 1KQS2 3JUOA 1RN7A 1EKMA 4ORLA 3FLJA 3DGOA 1TFOA 1ZX2A 1QALA 3T8UA 3EN8A 4N6MA 2I9WA 3FSDA 2CH9A 4MMYB 3GZBA 1GY7A 2BMRB 4O8SA 1Z1SA 3WOFB 2D42A 4EV5A 1YIT3 1E3VA 2WGOA 1Q7Y4 2CFLA 3MYTA 3L0RA 3HI7A 4OVMA 2OCTA 3F40A 3IPTA 1D6YA 5JPPA 1LVNA 1OHPA 1WMOA 2HMKB 3X42A 3LTBA 3OXAA 4K61A 4N6OB 1QJGA 3LT8A 1FUWA 1RRLA 5CXOA 3Q90A 4X2OA 5TGNA 2FNQA 2CFKA 2GU1A 4X2HA 1YIJ3 5AIHA 3M8CA 4FMCA 2XRXB 4K90B 1M1K4 6STDA 3EHCA 3DMCA 1JJ22 2YFIB 4CCVA 4EC6A 1DYUA 3DGNA 1W5ZA 3QRDA 2WOHA 2XH9A 1ASKA 1O7PB 3EJVA 4AKZA 3FKAA 2E2UA 4WWUC 4H61A 3X41A 1GD3A 5CK6A 1NJI4 2SBLA 5KP4A 1OACA 3PYJA 3MHEA 1FGMA 2IUKA 3B7CA 3G0KA 2OWPA 1O7NB 3MSOA 4EYCA 2BHMA 2JDIH 1JRQA 3X3ZA 1ULIB 1LNHA 1JB5A 5EVHA 3BNBA 5FGOA 4R4KA 2A15A 1N5PA 1VQ43 4CDLA 4XDVA 2FGTA 3PCSA 2OTL3 1AVLA 2B24B 3NQYA 2BMQB 4KVHA 5LC7A 1M904 4WFOA 3HIIA 3LYGA 2XSHB 2JQ5A 4FMAA 4GL6A 3O8YA 4N6TA 3H3HA 3MPHA 4WP5A 3I563 4BTWA 1D6ZA 2BT3A 3CU3A 1WMNA 2CKFB 5IG5A 1Q864 3BNCA 1VQ93 1CYVA 1Q40B 1SJWA 1JKGB 4QWTA 1YJ93 1OGZA 2XGLA 2L4VA 3D3LA 5BVBA 3CPOA 4N6LA 3SLUA 4R80A 3K63A 1STDA 1NB3I 1TUHA 1US1A 1V74A 3CNMA 3LTDA 2CWUA 4HM4B 3V92A 3CCQ3 8CHOA 3TDGA 1E97A 3MG3A 3PGBA 1W6CA 3HIGA 3LMLA 1M9GA 4AEQA 1Q40A 3UL6A 3CCR3 3LZAA 4HM2B 1JKGA 3GAXA 4HZBB 3CMA3 5IW9A 1GY6A 1R4CA 1Q814 1DMMA 3ALAA 1QAKA 2GEXA 4RZMA 5G2GA 7STDA 1ROAA 3ECFA 2IMJA 3ER7A 1U8CB 2O9UX 3BLZA 3X3YA 3F9SA 4U13A 3JUNA 1IU7A 1AV4A 2KRTA 3EF8A 1VQP3 2W9QA 3WDGB 3QK9A 3KSED 5EEOA 1VZZA 1YHQ3 3I0YA 3UJMA 1PU4A 1IVVA 5AIIA 2GBXB 3F7XA 4MMZB 2CIUA 4MMXB 3S29A 4O02B 4RNYA 3VSYA 3X40A 4HM5B 3K5TA 1OH0A 2P09A 2XEPA 4HBRA 2CW9A 1K41A 3CPW2 2STDA 2OQEC 4XB5A 2CFGA 5ELJA 1HU9A 1G96A 1VQL3 4WYKB 1FGRA 3N8BA 4HM8B 1JB4A 1IQ8A 4LMIA 1JN5B 4R9KA 2BNGA 1KWIA 1A2KA 1HKXA 3WOEB 5DRVA 2YFLB 3NUVA 2OQEA 3S28A 1S5AA 2BMOB 3GWRA 4IT7A 4HM3B 1ULJB 3WMDA 3G8ZA 2C10A 5KP1A 4WYKA 3Q1CA 3JUQA 1S723 3N9HA 1O7MB 1IVWA 1JN5A 1TIJA 2QA43 3KE7A 3F8XA 5D83A 2CG1A 4STDA 4OUQA 4LSOA 1GS3A 1DVDA 1NB5I 3OWUA 1SQWA 4HM6B 4J8TA 1W6YA 1WMPA 3F7SA 1DMQA 1SIHA 5IEOA 5IEPA 1AVKA 3EQQB 4BTYA 3KFQC 3DZLA 1N5HA 3JVCA 4I4KA 1OUNA 1YI23 2W6JH 3EBYA 2Y74A 2GXFA 3KN4A 2Q07A 3LTAA 3HX8A 4HYZA 1YVBI 1RJOA 3UL5A 1CYUA 1MNLA 3SOYA 1CEWI 1O7GB 4KFEA 3VGNA 1CQSA 5JPUA 1W01A 5IERA 3CD63 1W4NA 3U1WA 2ML6A 3CCM3 2XGNA 2HMJB 3WA2X 5IENA 3DGMA 1UW1A 3OWYA 2LYXA 4BTXA 4FR9A 1IV9A 3NM7A 2IUJA 2YX9A 3NXJA 3BNDA 4IIAA 1IDPA 3KZTA 4L7KA 1IV7A 2RSXA 1J2BA 5FW5A 2MC8A 3FF0A 1IT8A 1RRHA 4XDWA 5BXQA 1QVF2 2QGUA 4H3UA 3S67A 3G713 3OWSA 3CC73 1BUQA 1FGOA 2CC3A 2M7OA 1D6UA 3GZXB 3F14A 2P05A 3NBBA 3K7CA 5CLKA 3FG4A 1UI8A 5I97A 1YGEA 2RFRA 1OF5B 3EX9A 3FZWA 3H51A 1W2ZA 4HJLB 3NHXA 5LC6A 1OGXA 5AIGA 4EV2A 1QMAA 3DY5A 3PZWA 4L8PA 1DMNA 1W2B2 5DREA 2XFTA 5AEWB 1Q42A 1QVG2 2CWVA 1SPUA 3IJEB 3DUKA 3CCE3 1OF5A 5AI1A 4O2HA 3GZRA 4XBTA 3U97A 2UX0A 3K0ZA 3B4PA 2K54A 3MG1A 4FMDA 4N6V0 1K9M4 1FGTA 1A2VA 1STFI 2GU3A 1IK3A 1O7WB 2P38A 1OHSA 4KFFA 3A76A 3D9RA 2P0XA 5D82A 4EXRA 1UUVB 3N54B 5D81A 4EBGA 2FXTA 3CCV3 1QAFA 2XF3A 3GRDA 3ROBA 1VQN3 3HZPA 1YJW3 3B8LA 3V99A 1RKYA 1K8A4 2W04A 1PFPA 5ELUA 3RDEA 4K1UA 3X3XA 2CWTA 3I553 2V1LA 4MJDA 3GZYB 1N8QA 3WODG 1OHOA 2Z77A 1KC84 3OW22 4MEIA 1W02A 2P0MA 2Z6BA 1VQ53 2LQVA 2HMLB 3KSPA 3LOYA 4R9LA 2OOVC 3SOAA 1JB2A 3MWZA 2W2CA 1NWWA 1K734 4NREA 1YJN3 4N6NB 2B1XB 2OOVA 4AKYA 4R1KA 5AEUB 2XFSA 3FG1A 5IG0A 2QEX3 2Z7AA 2W0QA 4J9AA 1C7HA 4FCJA 1OCVA 1IQXA 4GB5A 2RCDA 1IVUA 1W7CA 1WQLB 3IMAB 4FMBA 4XBXA 3EN1B 5IG4A 1EG9B 1M1XB 2HMOB 4XM4A 3EBTA 4FCZA 2CHCA 4JRFA 4KZ1A 3S5CA 3G16A 3G4S3 2KXGA 2ZDJA 1UI7A 2CFWA 3JUPA 3T0UA 1ZO2A 3E99A 1JV2B 1NO3A 4PEJA 1VQ73 3DGLA 3PCRA 1Q824 2W56B 3RGAA 1A90A 3MG2A 3MKIA 3J7Yd 4RNZA 2CFDA 4NHFA 2D1WA 2K0MA 3B4OA 3LTCA 3LT9A 3LH4A 2GEYA 1W00A 3SEDA 2WO0A 3G6E3 3S27A 4HVNA 3F8HA 3UB1A 3FH1A 4WHAA 2W56A 1GY5A 3VF1A 4Q53A 2RGQA 2Z76A 3K9MC 1VQ63 2F98A 1TU5A 3CCS3 1OPYA 3NM2A 1GYBA 2XSOB 1KSIA 4RBNA 2IA7A 5STDA 5CF2A 3EE1A 1T5YA 2INXA 2XR8B 2CK3H 1L5GB 3CXC2 2HMMB 4LEHA 1A67A 1NDOB 3CNXA 1VQM3 3PS8A 4TX4A 3NX0A 3HK4A 3NV0B 3UNLA 4G1MB 3OX9A 4HM1B 1JNQA 4FCMA 1LXEA 3KIIA 5HGRA 1IQYA 1SIIA 4JF8A 2F99A 3DXOA 3CCU3 3CC23 2ML5A 1N8R4 3OV4A 3PXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YFJ B;  3NV0 A;  2F86 B;  4HKV B;  4HM0 B;  4HM7 B;  3BB9 A;  2QIY A;  5CF1 A;  5KP3 A;  3EC9 A;  1NU3 A;  1E3R A;  1ISK A;  5IG3 A;  4L8O A;  3FGY A;  1UUW B;  4XBY A;  3DM8 A;  4N3V A;  3KKG A;  3FF2 A;  4LGQ A;  3JUM A;  3RGR A;  2PZV A;  2HMN B;  2GBW B;  4K1V A;  5AIF A;  3T8N A;  3NBR A;  1TP6 A;  2R4I A;  4HZ9 B;  1U5O A;  1AR0 A;  1EA2 A;  5IF6 A;  3STD A;  1O7H B;  3JUO A;  4ORL A;  3FLJ A;  1ZX2 A;  3T8U A;  3EN8 A;  2I9W A;  3FSD A;  3GZB A;  1GY7 A;  2BMR B;  1Z1S A;  1E3V A;  3MYT A;  4OVM A;  3IPT A;  3F40 A;  5JPP A;  1OHP A;  2HMK B;  3OXA A;  1QJG A;  5TGN A;  3Q90 A;  4X2O A;  5CXO A;  4X2H A;  5AIH A;  3M8C A;  2XRX B;  6STD A;  3EHC A;  3DMC A;  2YFI B;  1ASK A;  1O7P B;  3EJV A;  3FKA A;  4WWU C;  5CK6 A;  5KP4 A;  3MHE A;  3B7C A;  3G0K A;  2OWP A;  1O7N B;  3MSO A;  1ULI B;  5EVH A;  1JB5 A;  2A15 A;  4CDL A;  4XDV A;  2B24 B;  4KVH A;  2BMQ B;  3LYG A;  2XSH B;  2JQ5 A;  3H3H A;  4WP5 A;  3CU3 A;  5IG5 A;  2CKF B;  1Q40 B;  1SJW A;  1JKG B;  1OGZ A;  5BVB A;  3CPO A;  1STD A;  1TUH A;  3CNM A;  4HM4 B;  8CHO A;  1E97 A;  3MG3 A;  1Q40 A;  3LZA A;  4HM2 B;  1JKG A;  4HZB B;  1GY6 A;  1DMM A;  5G2G A;  2GEX A;  4RZM A;  7STD A;  3ECF A;  2IMJ A;  3ER7 A;  3BLZ A;  3F9S A;  4U13 A;  3JUN A;  3EF8 A;  1VZZ A;  3I0Y A;  3UJM A;  5AII A;  2GBX B;  3F7X A;  3VSY A;  4HM5 B;  1OH0 A;  1K41 A;  2STD A;  4XB5 A;  4WYK B;  4HM8 B;  1JB4 A;  4LMI A;  4R9K A;  1JN5 B;  2BNG A;  1A2K A;  1HKX A;  5DRV A;  2YFL B;  3NUV A;  1S5A A;  2BMO B;  3GWR A;  4HM3 B;  1ULJ B;  3WMD A;  3G8Z A;  5KP1 A;  4WYK A;  3JUQ A;  1O7M B;  1JN5 A;  3KE7 A;  3F8X A;  5D83 A;  4STD A;  4OUQ A;  1GS3 A;  3OWU A;  4HM6 B;  4J8T A;  1W6Y A;  3F7S A;  1DMQ A;  5IEO A;  5IEP A;  3EQQ B;  3DZL A;  4I4K A;  1OUN A;  3EBY A;  2GXF A;  3HX8 A;  3SOY A;  1O7G B;  3VGN A;  1CQS A;  5JPU A;  1W01 A;  5IER A;  2HMJ B;  5IEN A;  3OWY A;  3NXJ A;  4IIA A;  1IDP A;  3KZT A;  4L7K A;  5FW5 A;  3FF0 A;  4XDW A;  5BXQ A;  2QGU A;  4H3U A;  3OWS A;  1BUQ A;  3GZX B;  3F14 A;  3K7C A;  5CLK A;  2RFR A;  1OF5 B;  3EX9 A;  3FZW A;  3H51 A;  4HJL B;  3NHX A;  1OGX A;  5AIG A;  1QMA A;  4L8P A;  1DMN A;  5DRE A;  5AEW B;  1Q42 A;  3DUK A;  1OF5 A;  5AI1 A;  3GZR A;  4XBT A;  2UX0 A;  3K0Z A;  3B4P A;  2K54 A;  3MG1 A;  1O7W B;  1OHS A;  3A76 A;  3D9R A;  5D82 A;  1UUV B;  5D81 A;  3GRD A;  3ROB A;  3HZP A;  3B8L A;  4K1U A;  4MJD A;  3GZY B;  1OHO A;  2Z77 A;  1W02 A;  2HML B;  3KSP A;  4R9L A;  3SOA A;  1JB2 A;  2W2C A;  1NWW A;  2B1X B;  4R1K A;  5AEU B;  5IG0 A;  2Z7A A;  4J9A A;  1C7H A;  4FCJ A;  1OCV A;  4GB5 A;  2RCD A;  1WQL B;  4XBX A;  3EN1 B;  5IG4 A;  1EG9 B;  2HMO B;  4XM4 A;  3EBT A;  2CHC A;  3S5C A;  3G16 A;  3JUP A;  1ZO2 A;  3E99 A;  4PEJ A;  3RGA A;  3MG2 A;  3MKI A;  3B4O A;  2GEY A;  1W00 A;  3SED A;  4HVN A;  3F8H A;  3FH1 A;  1GY5 A;  4Q53 A;  2RGQ A;  2Z76 A;  2F98 A;  1OPY A;  3NM2 A;  1GYB A;  2XSO B;  5STD A;  5CF2 A;  2INX A;  2XR8 B;  2HMM B;  4LEH A;  1NDO B;  3CNX A;  3HK4 A;  3NV0 B;  3UNL A;  4HM1 B;  3OX9 A;  4FCM A;  5HGR A;  2F99 A;  3DXO A;  3OV4 A; 
#chains in the Genus database with same CATH topology
 1Y4K A;  2YFJ B;  3NV0 A;  1JZO A;  2F86 B;  2W9P A;  3Q3F A;  2PNC A;  4HKV B;  3SX1 A;  4LZI A;  1K28 A;  1LOX A;  1JBR A;  4O3V A;  3CCJ 3;  4HM0 B;  1IT7 A;  4HM7 B;  5AYR B;  3FG3 A;  2BO9 B;  3BB9 A;  3WA3 A;  3CC4 3;  2QIY A;  2WGQ A;  3AMO B;  2E2V A;  1MOL A;  4ZM8 A;  2O3O A;  5CF1 A;  2GSP A;  5KP3 A;  3CCL 3;  5AYS C;  3EC9 A;  1JZD A;  1HZ1 A;  1A2P A;  1ZS7 A;  2BIR A;  1NU3 A;  1E3R A;  3Q2P A;  1ISK A;  5IG3 A;  1TFK A;  1EQK A;  4L8O A;  3SYU A;  1I2G A;  3FGY A;  3AMO A;  1MWT A;  1UUW B;  1W6G A;  4IPB A;  1VQ8 3;  4XBY A;  2CG0 A;  3DM8 A;  4N3V A;  3KKG A;  2MF7 A;  3SVA A;  3V98 A;  2OTJ 3;  3CME 3;  3NQZ A;  3FF2 A;  4OK0 A;  2H0H A;  1B2S A;  3KCH A;  1B2U A;  4LGQ A;  1VQK 3;  3JUM A;  3RGR A;  4N6U A;  2PZV A;  2KCD A;  4KFD A;  1KD1 4;  1IVX A;  1RCL A;  2HMN B;  5JBS A;  1UCI A;  4J5G A;  2GBW B;  1N9E A;  1ROV A;  1WNH A;  5EQL A;  1MGR A;  4K1V A;  5AIF A;  3EB8 A;  3T8N A;  2Y73 A;  1BUJ A;  3NBR A;  2K3D A;  3SXX A;  2ZL8 A;  5A0O B;  1TP6 A;  2C11 A;  3NBJ A;  3LXU X;  1LQM B;  2WOF A;  1FA3 A;  3BNE A;  2W03 A;  2F5W A;  2R4I A;  4HZ9 B;  5G1K A;  3FCS B;  1FYS A;  1U5O A;  1AR0 A;  1F8N A;  1VQO 3;  1EA2 A;  1WTH A;  1DVC A;  3STD A;  1O7H B;  5IF6 A;  1GD4 A;  1FGQ A;  1N9J A;  1RGA A;  2E2T A;  3JUO A;  1KQS 2;  1RN7 A;  1EKM A;  3ZG5 A;  1BAN A;  4ORL A;  3FLJ A;  3DGO A;  7RNT A;  1TFO A;  1ZX2 A;  1QAL A;  3T8U A;  3EN8 A;  4N6M A;  2I9W A;  3FSD A;  2CH9 A;  4MMY B;  3GZB A;  1GY7 A;  2BMR B;  4O8S A;  1Z1S A;  3WOF B;  2D42 A;  3ZFZ A;  4EV5 A;  1BU4 A;  1YIT 3;  1E3V A;  2WGO A;  1Q7Y 4;  1X1W A;  3AHS A;  2CFL A;  3MYT A;  3L0R A;  3HI7 A;  4OVM A;  2OCT A;  3F40 A;  3IPT A;  3D5I A;  1D6Y A;  5JPP A;  1BNE A;  1LVN A;  1OHP A;  1WMO A;  2HMK B;  2KF4 A;  3D5G A;  3X42 A;  3LTB A;  3OXA A;  4K61 A;  1RHL A;  4N6O B;  1QJG A;  3LT8 A;  1FUW A;  1RRL A;  5CXO A;  3Q90 A;  4X2O A;  5TGN A;  2FNQ A;  3AGO A;  2CFK A;  2GU1 A;  4X2H A;  1YIJ 3;  5AIH A;  3M8C A;  1RGF A;  4FMC A;  2XRX B;  4K90 B;  1M1K 4;  6STD A;  3EHC A;  3DMC A;  7GSP A;  1NNV A;  1TTO A;  1JJ2 2;  2YFI B;  1UCJ A;  4CCV A;  4EC6 A;  1DYU A;  3DGN A;  1W5Z A;  3QRD A;  2WOH A;  1BNG A;  1ASK A;  2XH9 A;  1O7P B;  4RNT A;  3EJV A;  4AKZ A;  3FKA A;  2E2U A;  1T2H A;  4WWU C;  4H61 A;  1Q7H A;  3X41 A;  1GD3 A;  5CK6 A;  1NJI 4;  2SBL A;  5KP4 A;  1OAC A;  3PYJ A;  3MHE A;  1FGM A;  2IUK A;  3B7C A;  3G0K A;  2OWP A;  1O7N B;  1RGG A;  3MSO A;  2BHM A;  2JDI H;  1BRK A;  1RGC A;  4EYC A;  1JRQ A;  3X3Z A;  1ULI B;  1LNH A;  1JB5 A;  5EVH A;  3BNB A;  5FGO A;  1MWR A;  2A15 A;  2KF6 A;  1N5P A;  4R4K A;  1VQ4 3;  4CDL A;  4XDV A;  2FGT A;  3PCS A;  4CJN A;  2OTL 3;  1AVL A;  2B24 B;  3NQY A;  2BMQ B;  4KVH A;  5LC7 A;  1YNV X;  2ML5 A;  4WFO A;  1V57 A;  3HII A;  5GSP A;  1JBS A;  5M1A A;  3LYG A;  2XSH B;  3DGY A;  2JQ5 A;  4FMA A;  4GL6 A;  1HYF A;  3O8Y A;  4N6T A;  3H3H A;  3MPH A;  4WP5 A;  4DKI A;  3I56 3;  4BTW A;  1D6Z A;  1SAR A;  2BT3 A;  1WMN A;  2CKF B;  3CU3 A;  5IG5 A;  3AHW A;  1Q86 4;  1TJD A;  3BNC A;  1VQ9 3;  1CYV A;  1Q40 B;  9RNT A;  1UDI I;  1SJW A;  1JBT A;  1JKG B;  4QWT A;  1YJ9 3;  1OGZ A;  2XGL A;  2L4V A;  3D3L A;  5BVB A;  3CPO A;  4N6L A;  3SLU A;  4R80 A;  3K63 A;  1STD A;  1MWS A;  1NB3 I;  1PYL A;  1TUH A;  1US1 A;  1V74 A;  3CNM A;  3D79 A;  2CWU A;  3A5E A;  3LTD A;  4HM4 B;  3V92 A;  3TDG A;  1E97 A;  3MG3 A;  4BL3 A;  3PGB A;  8CHO A;  1W6C A;  3HIG A;  3LML A;  1M9G A;  4AEQ A;  1Q40 A;  2H0G A;  3UL6 A;  3CCR 3;  3LZA A;  4HM2 B;  1JKG A;  3GAX A;  2KF3 A;  4HZB B;  3CMA 3;  1BSD A;  5IW9 A;  1GY6 A;  1R4C A;  1Q81 4;  1DMM A;  1QAK A;  3ALA A;  2GEX A;  4RZM A;  5G2G A;  7STD A;  1IYY A;  1ROA A;  3ECF A;  2IMJ A;  3ER7 A;  1U8C B;  2O9U X;  1BRJ A;  3BLZ A;  5HOH A;  3X3Y A;  3F9S A;  4U13 A;  1G02 A;  3JUN A;  1IU7 A;  1EEJ A;  1AV4 A;  2KRT A;  1BSA A;  3EF8 A;  1VQP 3;  2W9Q A;  3WDG B;  3QK9 A;  1RNB A;  3KSE D;  5EEO A;  3CCQ 3;  1VZZ A;  1BAO A;  3I0Y A;  1LNI A;  3UJM A;  1PU4 A;  1YHQ 3;  1IVV A;  5AII A;  2GBX B;  3F7X A;  4MMZ B;  2CIU A;  4MMX B;  3S29 A;  4O02 B;  4RNY A;  3VSY A;  3X40 A;  4HM5 B;  3K5T A;  1OH0 A;  2P09 A;  2XEP A;  1BSC A;  4HBR A;  2CW9 A;  3HOH A;  1K41 A;  3CPW 2;  2STD A;  1B27 A;  1GMQ A;  2OQE C;  4XB5 A;  2CFG A;  5ELJ A;  1HU9 A;  1G96 A;  1RN1 A;  1T2I A;  1VQL 3;  4WYK B;  1FGR A;  3N8B A;  4HM8 B;  1JB4 A;  1IQ8 A;  4LMI A;  1JN5 B;  4R9K A;  3WHO A;  2BNG A;  1KWI A;  1A2K A;  1HKX A;  1BNF A;  1UGI A;  3WOE B;  5DRV A;  2YFL B;  2F56 A;  3NUV A;  2OQE A;  3S28 A;  1S5A A;  2BMO B;  3GWR A;  4IT7 A;  4HM3 B;  1LOY A;  1ULJ B;  3WMD A;  1G0T A;  1BRG A;  1I2E A;  2C10 A;  1GSP A;  3G8Z A;  5KP1 A;  1I2F A;  4WYK A;  3Q1C A;  3JUQ A;  1S72 3;  3N9H A;  1O7M B;  1IVW A;  1JN5 A;  1TIJ A;  2SAR A;  2H0I A;  2QA4 3;  3KE7 A;  3F8X A;  5D83 A;  2CG1 A;  4STD A;  1B2M A;  4OUQ A;  4LSO A;  1GS3 A;  1DVD A;  1NB5 I;  1BOX A;  1TRQ A;  2BU4 A;  1BRN L;  3OWU A;  1SQW A;  4HM6 B;  4LYL B;  4J8T A;  1W6Y A;  1BNS A;  1WMP A;  3F7S A;  1DMQ A;  1SIH A;  5IEO A;  1I0V A;  1M90 4;  5IEP A;  4CPK A;  1AVK A;  3EQQ B;  4BTY A;  1GMP A;  1RGE A;  3DZL A;  3KFQ C;  1N5H A;  3JVC A;  4I4K A;  4BU4 A;  1LRA A;  1OUN A;  1YI2 3;  2W6J H;  3EBY A;  2Y74 A;  2GXF A;  2J8X B;  4GHO A;  3KN4 A;  2Q07 A;  3LTA A;  3HX8 A;  4HYZ A;  1YVB I;  1RJO A;  1ZGX A;  1Q9E A;  3UL5 A;  1CYU A;  1MNL A;  3SOY A;  4I5Q A;  1CEW I;  1O7G B;  2ZHX B;  1BNR A;  1DE3 A;  4KFE A;  3VGN A;  1CQS A;  1RGH A;  5JPU A;  1W01 A;  2UGI A;  2RNT A;  5IER A;  3CD6 3;  1W4N A;  3U1W A;  2ML6 A;  4J5K A;  3CCM 3;  3D4A A;  2XGN A;  2HMJ B;  3WA2 X;  1RLS A;  3DGM A;  1UW1 A;  2C4B A;  2KAA A;  3OWY A;  5IEN A;  2LYX A;  4BTX A;  1I70 A;  4FR9 A;  1IV9 A;  3NM7 A;  2IUJ A;  2YX9 A;  2AAD A;  3NXJ A;  3BND A;  4IIA A;  1IDP A;  3KZT A;  1FZU A;  1IV7 A;  4L7K A;  1B2Z A;  2RSX A;  1J2B A;  1I3F A;  4GSP A;  1RDS A;  3FF0 A;  5FW5 A;  2MC8 A;  1IT8 A;  1RRH A;  4XDW A;  1BRI A;  5BXQ A;  1QVF 2;  2QGU A;  5BU4 A;  4H3U A;  1BGS A;  3S67 A;  3G71 3;  3OWS A;  3CC7 3;  1BRH A;  3BIR A;  1BUQ A;  1FGO A;  2CC3 A;  2HOH A;  1UCK A;  2M7O A;  4BL2 A;  4BIR A;  1D6U A;  3GZX B;  3F14 A;  2P05 A;  3NBB A;  1BIR A;  3K7C A;  5CLK A;  3FG4 A;  1UI8 A;  5I97 A;  5RNT A;  1YGE A;  2RFR A;  1OF5 B;  3EX9 A;  3FZW A;  3H51 A;  1B3S A;  1BNJ A;  1W2Z A;  4EW5 A;  1PY3 A;  4HJL B;  3NHX A;  5LC6 A;  1OGX A;  5AIG A;  2KF5 A;  4EV2 A;  1QMA A;  5M19 A;  3DY5 A;  3PZW A;  4L8P A;  1DMN A;  1W2B 2;  5DRE A;  2XFT A;  1RSN A;  5AEW B;  1Q42 A;  1QVG 2;  1RGL A;  2CWV A;  1SPU A;  3IJE B;  3DUK A;  1BRS A;  3CCE 3;  1OF5 A;  5AI1 A;  4O2H A;  3GZR A;  4XBT A;  1LOV A;  3U97 A;  2UX0 A;  2F5M A;  1R4Y A;  3K0Z A;  3B4P A;  2F4Y A;  2K54 A;  3MG1 A;  1I0X A;  4FMD A;  4N6V 0;  2ZA4 A;  1BVI A;  1K9M 4;  1FGT A;  1A2V A;  1STF I;  2GU3 A;  1IK3 A;  1O7W B;  2P38 A;  1OHS A;  4KFF A;  3A76 A;  3D9R A;  1B21 A;  2P0X A;  5D82 A;  4EXR A;  1YVS A;  1UUV B;  2CX1 A;  3N54 B;  5D81 A;  4EBG A;  1EUI C;  2FXT A;  3CCV 3;  1QAF A;  2XF3 A;  1BNI A;  3GRD A;  1UCL A;  3ROB A;  4HAA A;  2IY2 A;  1GOY A;  1VQN 3;  5M18 A;  3HZP A;  1YJW 3;  3B8L A;  3V99 A;  1RKY A;  1K8A 4;  1PFP A;  2AAE A;  2W04 A;  5ELU A;  4K1U A;  3RDE A;  2CWT A;  3X3X A;  1GOV A;  3WR2 A;  3I55 3;  2V1L A;  4MJD A;  1C54 A;  3GZY B;  1N8Q A;  3WOD G;  1OHO A;  5G1L A;  2Z77 A;  1KC8 4;  1AY7 A;  3OW2 2;  4MEI A;  1UGH I;  1RMS A;  1T3B A;  1W02 A;  2P0M A;  2Z6B A;  1VQ5 3;  2LQV A;  2HML B;  3KSP A;  3LOY A;  4R9L A;  2OOV C;  4NPB A;  3SOA A;  1JB2 A;  2R41 A;  3MWZ A;  2W2C A;  1NWW A;  1K73 4;  1DET A;  4NRE A;  1YJN 3;  3BU4 A;  1LQG C;  1V58 A;  1RGK A;  5BIR A;  4N6N B;  1RCK A;  2B1X B;  2OOV A;  4AKY A;  1FUT A;  4KT3 B;  4R1K A;  3RNT A;  1MGW A;  5AEU B;  2UUG C;  2XFS A;  3FG1 A;  5IG0 A;  6RNT A;  2QEX 3;  1FUS A;  2Z7A A;  2W0Q A;  4J9A A;  1B2X A;  1RN4 A;  1C7H A;  1GOU A;  1VQQ A;  3ZG0 A;  4FCJ A;  2L1S A;  1OCV A;  1IQX A;  4GB5 A;  2RCD A;  2IYJ A;  1IVU A;  1W7C A;  1WQL B;  1LOW A;  2CX0 A;  3IMA B;  1RTU A;  4FMB A;  4ILF A;  1UUG B;  4XBX A;  3EN1 B;  3DH2 A;  5IG4 A;  1EG9 B;  1M1X B;  1BSE A;  2HMO B;  4XM4 A;  3EBT A;  6GSP A;  4FCZ A;  2CHC A;  4JRF A;  4KZ1 A;  3S5C A;  3G16 A;  3G4S 3;  2KXG A;  2ZDJ A;  1UI7 A;  2CFW A;  3JUP A;  3T0U A;  1ZO2 A;  3E99 A;  1JV2 B;  1NO3 A;  4PEJ A;  1VQ7 3;  1FW7 A;  3GSP A;  3DGL A;  3PCR A;  1Q82 4;  2W56 B;  3RGA A;  1A90 A;  3MG2 A;  1X1U A;  3MKI A;  1TRP A;  3J7Y d;  4RNZ A;  2CFD A;  4NHF A;  1MWU A;  1GMR A;  2D1W A;  2K0M A;  3B4O A;  3LTC A;  3LT9 A;  3LH4 A;  2GEY A;  1W00 A;  3SED A;  2WO0 A;  3G6E 3;  3S27 A;  4HVN A;  3F8H A;  3UB1 A;  3FH1 A;  4WHA A;  8RNT A;  2W56 A;  1GY5 A;  3VF1 A;  4Q53 A;  2RGQ A;  2Z76 A;  3K9M C;  1VQ6 3;  2F98 A;  1TU5 A;  3CCS 3;  1B20 A;  1OPY A;  1I8V A;  3URP A;  3NM2 A;  1AQZ A;  1RNT A;  3AGN A;  1I3I A;  1GYB A;  2RBI A;  2XSO B;  1KSI A;  4RBN A;  2IA7 A;  5STD A;  5CF2 A;  3EE1 A;  1T5Y A;  2INX A;  2XR8 B;  2CK3 H;  1L5G B;  3CXC 2;  2HMM B;  4LEH A;  1A67 A;  1NDO B;  3CNX A;  3OV4 A;  1VQM 3;  3PS8 A;  4TX4 A;  3NX0 A;  1BSB A;  3HK4 A;  3NV0 B;  3UNL A;  4G1M B;  3OX9 A;  4HM1 B;  1JNQ A;  4FCM A;  1LXE A;  1X1X A;  3KII A;  5HGR A;  1IQY A;  1SII A;  4HOH A;  4JF8 A;  1YGW A;  2F99 A;  3DXO A;  3CCU 3;  3CC2 3;  1X1Y A;  1N8R 4;  1CH0 A;  3PXM A; 
#chains in the Genus database with same CATH homology
 1Y4K A;  2YFJ B;  3NV0 A;  2F86 B;  2W9P A;  2PNC A;  4HKV B;  3SX1 A;  4LZI A;  1K28 A;  1LOX A;  4O3V A;  3CCJ 3;  4HM0 B;  1IT7 A;  4HM7 B;  5AYR B;  3FG3 A;  2BO9 B;  3BB9 A;  3WA3 A;  3CC4 3;  2QIY A;  2WGQ A;  3AMO B;  2E2V A;  1MOL A;  4ZM8 A;  2O3O A;  5CF1 A;  3CCL 3;  5KP3 A;  5AYS C;  3EC9 A;  1NU3 A;  1E3R A;  3Q2P A;  1ISK A;  5IG3 A;  1TFK A;  1EQK A;  4L8O A;  3FGY A;  3AMO A;  1UUW B;  1W6G A;  4IPB A;  1VQ8 3;  4XBY A;  2CG0 A;  3DM8 A;  4N3V A;  3KKG A;  2MF7 A;  3SVA A;  3V98 A;  2OTJ 3;  3CME 3;  3NQZ A;  3FF2 A;  4OK0 A;  1VQK 3;  4LGQ A;  3JUM A;  3RGR A;  4N6U A;  2PZV A;  2KCD A;  4KFD A;  1KD1 4;  1IVX A;  5JBS A;  2HMN B;  2GBW B;  1N9E A;  1ROV A;  1WNH A;  5EQL A;  4K1V A;  5AIF A;  3EB8 A;  3T8N A;  2Y73 A;  3NBR A;  3SXX A;  5A0O B;  2ZL8 A;  1TP6 A;  2C11 A;  3NBJ A;  3LXU X;  2WOF A;  1FA3 A;  3BNE A;  2W03 A;  2R4I A;  4HZ9 B;  3FCS B;  1U5O A;  1AR0 A;  1F8N A;  1VQO 3;  1EA2 A;  1WTH A;  1DVC A;  3STD A;  1O7H B;  5IF6 A;  1GD4 A;  1FGQ A;  1N9J A;  2E2T A;  1KQS 2;  3JUO A;  1RN7 A;  1EKM A;  4ORL A;  3FLJ A;  3DGO A;  1TFO A;  1ZX2 A;  1QAL A;  3T8U A;  3EN8 A;  4N6M A;  2I9W A;  3FSD A;  2CH9 A;  4MMY B;  3GZB A;  1GY7 A;  2BMR B;  4O8S A;  1Z1S A;  3WOF B;  2D42 A;  4EV5 A;  1YIT 3;  1E3V A;  2WGO A;  1Q7Y 4;  2CFL A;  3MYT A;  3L0R A;  3HI7 A;  4OVM A;  2OCT A;  3F40 A;  3IPT A;  1D6Y A;  5JPP A;  1LVN A;  1OHP A;  1WMO A;  2HMK B;  3X42 A;  3LTB A;  3OXA A;  4K61 A;  4N6O B;  1QJG A;  3LT8 A;  1FUW A;  1RRL A;  5CXO A;  3Q90 A;  4X2O A;  5TGN A;  2FNQ A;  2CFK A;  2GU1 A;  4X2H A;  1YIJ 3;  5AIH A;  3M8C A;  4FMC A;  2XRX B;  4K90 B;  1M1K 4;  6STD A;  3EHC A;  3DMC A;  1JJ2 2;  2YFI B;  4CCV A;  4EC6 A;  1DYU A;  3DGN A;  1W5Z A;  3QRD A;  2WOH A;  2XH9 A;  1ASK A;  1O7P B;  3EJV A;  4AKZ A;  3FKA A;  2E2U A;  4WWU C;  4H61 A;  3X41 A;  1GD3 A;  5CK6 A;  1NJI 4;  2SBL A;  5KP4 A;  1OAC A;  3PYJ A;  3MHE A;  1FGM A;  2IUK A;  3B7C A;  3G0K A;  2OWP A;  1O7N B;  3MSO A;  4EYC A;  2BHM A;  2JDI H;  1JRQ A;  3X3Z A;  1ULI B;  1LNH A;  1JB5 A;  5EVH A;  3BNB A;  5FGO A;  4R4K A;  2A15 A;  1N5P A;  1VQ4 3;  4CDL A;  4XDV A;  2FGT A;  3PCS A;  2OTL 3;  1AVL A;  2B24 B;  3NQY A;  2BMQ B;  4KVH A;  5LC7 A;  1M90 4;  4WFO A;  3HII A;  3LYG A;  2XSH B;  2JQ5 A;  4FMA A;  4GL6 A;  3O8Y A;  4N6T A;  3H3H A;  3MPH A;  4WP5 A;  3I56 3;  4BTW A;  1D6Z A;  2BT3 A;  3CU3 A;  1WMN A;  2CKF B;  5IG5 A;  1Q86 4;  3BNC A;  1VQ9 3;  1CYV A;  1Q40 B;  1SJW A;  1JKG B;  4QWT A;  1YJ9 3;  1OGZ A;  2XGL A;  2L4V A;  3D3L A;  5BVB A;  3CPO A;  4N6L A;  3SLU A;  4R80 A;  3K63 A;  1STD A;  1NB3 I;  1TUH A;  1US1 A;  1V74 A;  3CNM A;  3LTD A;  2CWU A;  4HM4 B;  3V92 A;  3CCQ 3;  8CHO A;  3TDG A;  1E97 A;  3MG3 A;  3PGB A;  1W6C A;  3HIG A;  3LML A;  1M9G A;  4AEQ A;  1Q40 A;  3UL6 A;  3CCR 3;  3LZA A;  4HM2 B;  1JKG A;  3GAX A;  4HZB B;  3CMA 3;  5IW9 A;  1GY6 A;  1R4C A;  1Q81 4;  1DMM A;  3ALA A;  1QAK A;  2GEX A;  4RZM A;  5G2G A;  7STD A;  1ROA A;  3ECF A;  2IMJ A;  3ER7 A;  1U8C B;  2O9U X;  3BLZ A;  3X3Y A;  3F9S A;  4U13 A;  3JUN A;  1IU7 A;  1AV4 A;  2KRT A;  3EF8 A;  1VQP 3;  2W9Q A;  3WDG B;  3QK9 A;  3KSE D;  5EEO A;  1VZZ A;  1YHQ 3;  3I0Y A;  3UJM A;  1PU4 A;  1IVV A;  5AII A;  2GBX B;  3F7X A;  4MMZ B;  2CIU A;  4MMX B;  3S29 A;  4O02 B;  4RNY A;  3VSY A;  3X40 A;  4HM5 B;  3K5T A;  1OH0 A;  2P09 A;  2XEP A;  4HBR A;  2CW9 A;  1K41 A;  3CPW 2;  2STD A;  2OQE C;  4XB5 A;  2CFG A;  5ELJ A;  1HU9 A;  1G96 A;  1VQL 3;  4WYK B;  1FGR A;  3N8B A;  4HM8 B;  1JB4 A;  1IQ8 A;  4LMI A;  1JN5 B;  4R9K A;  2BNG A;  1KWI A;  1A2K A;  1HKX A;  3WOE B;  5DRV A;  2YFL B;  3NUV A;  2OQE A;  3S28 A;  1S5A A;  2BMO B;  3GWR A;  4IT7 A;  4HM3 B;  1ULJ B;  3WMD A;  3G8Z A;  2C10 A;  5KP1 A;  4WYK A;  3Q1C A;  3JUQ A;  1S72 3;  3N9H A;  1O7M B;  1IVW A;  1JN5 A;  1TIJ A;  2QA4 3;  3KE7 A;  3F8X A;  5D83 A;  2CG1 A;  4STD A;  4OUQ A;  4LSO A;  1GS3 A;  1DVD A;  1NB5 I;  3OWU A;  1SQW A;  4HM6 B;  4J8T A;  1W6Y A;  1WMP A;  3F7S A;  1DMQ A;  1SIH A;  5IEO A;  5IEP A;  1AVK A;  3EQQ B;  4BTY A;  3KFQ C;  3DZL A;  1N5H A;  3JVC A;  4I4K A;  1OUN A;  1YI2 3;  2W6J H;  3EBY A;  2Y74 A;  2GXF A;  3KN4 A;  2Q07 A;  3LTA A;  3HX8 A;  4HYZ A;  1YVB I;  1RJO A;  3UL5 A;  1CYU A;  1MNL A;  3SOY A;  1CEW I;  1O7G B;  4KFE A;  3VGN A;  1CQS A;  5JPU A;  1W01 A;  5IER A;  3CD6 3;  1W4N A;  3U1W A;  2ML6 A;  3CCM 3;  2XGN A;  2HMJ B;  3WA2 X;  5IEN A;  3DGM A;  1UW1 A;  3OWY A;  2LYX A;  4BTX A;  4FR9 A;  1IV9 A;  3NM7 A;  2IUJ A;  2YX9 A;  3NXJ A;  3BND A;  4IIA A;  1IDP A;  3KZT A;  4L7K A;  1IV7 A;  2RSX A;  1J2B A;  5FW5 A;  2MC8 A;  3FF0 A;  1IT8 A;  1RRH A;  4XDW A;  5BXQ A;  1QVF 2;  2QGU A;  4H3U A;  3S67 A;  3G71 3;  3OWS A;  3CC7 3;  1BUQ A;  1FGO A;  2CC3 A;  2M7O A;  1D6U A;  3GZX B;  3F14 A;  2P05 A;  3NBB A;  3K7C A;  5CLK A;  3FG4 A;  1UI8 A;  5I97 A;  1YGE A;  2RFR A;  1OF5 B;  3EX9 A;  3FZW A;  3H51 A;  1W2Z A;  4HJL B;  3NHX A;  5LC6 A;  1OGX A;  5AIG A;  4EV2 A;  1QMA A;  3DY5 A;  3PZW A;  4L8P A;  1DMN A;  1W2B 2;  5DRE A;  2XFT A;  5AEW B;  1Q42 A;  1QVG 2;  2CWV A;  1SPU A;  3IJE B;  3DUK A;  3CCE 3;  1OF5 A;  5AI1 A;  4O2H A;  3GZR A;  4XBT A;  3U97 A;  2UX0 A;  3K0Z A;  3B4P A;  2K54 A;  3MG1 A;  4FMD A;  4N6V 0;  1K9M 4;  1FGT A;  1A2V A;  1STF I;  2GU3 A;  1IK3 A;  1O7W B;  2P38 A;  1OHS A;  4KFF A;  3A76 A;  3D9R A;  2P0X A;  5D82 A;  4EXR A;  1UUV B;  3N54 B;  5D81 A;  4EBG A;  2FXT A;  3CCV 3;  1QAF A;  2XF3 A;  3GRD A;  3ROB A;  1VQN 3;  3HZP A;  1YJW 3;  3B8L A;  3V99 A;  1RKY A;  1K8A 4;  2W04 A;  1PFP A;  5ELU A;  3RDE A;  4K1U A;  3X3X A;  2CWT A;  3I55 3;  2V1L A;  4MJD A;  3GZY B;  1N8Q A;  3WOD G;  1OHO A;  2Z77 A;  1KC8 4;  3OW2 2;  4MEI A;  1W02 A;  2P0M A;  2Z6B A;  1VQ5 3;  2LQV A;  2HML B;  3KSP A;  3LOY A;  4R9L A;  2OOV C;  3SOA A;  1JB2 A;  3MWZ A;  2W2C A;  1NWW A;  1K73 4;  4NRE A;  1YJN 3;  4N6N B;  2B1X B;  2OOV A;  4AKY A;  4R1K A;  5AEU B;  2XFS A;  3FG1 A;  5IG0 A;  2QEX 3;  2Z7A A;  2W0Q A;  4J9A A;  1C7H A;  4FCJ A;  1OCV A;  1IQX A;  4GB5 A;  2RCD A;  1IVU A;  1W7C A;  1WQL B;  3IMA B;  4FMB A;  4XBX A;  3EN1 B;  5IG4 A;  1EG9 B;  1M1X B;  2HMO B;  4XM4 A;  3EBT A;  4FCZ A;  2CHC A;  4JRF A;  4KZ1 A;  3S5C A;  3G16 A;  3G4S 3;  2KXG A;  2ZDJ A;  1UI7 A;  2CFW A;  3JUP A;  3T0U A;  1ZO2 A;  3E99 A;  1JV2 B;  1NO3 A;  4PEJ A;  1VQ7 3;  3DGL A;  3PCR A;  1Q82 4;  2W56 B;  3RGA A;  1A90 A;  3MG2 A;  3MKI A;  3J7Y d;  4RNZ A;  2CFD A;  4NHF A;  2D1W A;  2K0M A;  3B4O A;  3LTC A;  3LT9 A;  3LH4 A;  2GEY A;  1W00 A;  3SED A;  2WO0 A;  3G6E 3;  3S27 A;  4HVN A;  3F8H A;  3UB1 A;  3FH1 A;  4WHA A;  2W56 A;  1GY5 A;  3VF1 A;  4Q53 A;  2RGQ A;  2Z76 A;  3K9M C;  1VQ6 3;  2F98 A;  1TU5 A;  3CCS 3;  1OPY A;  3NM2 A;  1GYB A;  2XSO B;  1KSI A;  4RBN A;  2IA7 A;  5STD A;  5CF2 A;  3EE1 A;  1T5Y A;  2INX A;  2XR8 B;  2CK3 H;  1L5G B;  3CXC 2;  2HMM B;  4LEH A;  1A67 A;  1NDO B;  3CNX A;  1VQM 3;  3PS8 A;  4TX4 A;  3NX0 A;  3HK4 A;  3NV0 B;  3UNL A;  4G1M B;  3OX9 A;  4HM1 B;  1JNQ A;  4FCM A;  1LXE A;  3KII A;  5HGR A;  1IQY A;  1SII A;  4JF8 A;  2F99 A;  3DXO A;  3CCU 3;  3CC2 3;  2ML5 A;  1N8R 4;  3OV4 A;  3PXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...