3S5CA

Crystal structure of a hexachlorocyclohexane dehydrochlorinase (lina) type2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
SDLDRLASRAAIQDLYSDQLIGVDKRQEGRLASIWWDDAEWTIEGIGTYKGPEGALDLANNVLWPMYHETIHYGTNLRLEFVSADKVNGIGDVLCLGNLVEGNQSILIAAVYTNEYERRDGVWKFSKLNGCMNYFTPLAGIHFAPPGIHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hexachlorocyclohexane dehydrochlorinase (LinA-type2): mutational analysis, thermostability and enantioselectivity
pubmed doi rcsb
source organism Uncultured organism
molecule tags Transferase
molecule keywords LinA
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 4.5.1.-:
pdb deposition date 2011-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13577 SnoaL_4 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3s5cA01
4XBTA 1ULIB 3MG2A 2OWPA 1NWWA 1TUHA 1VZZA 2R4IA 5FW5A 3NV0A 1OHPA 3MSOA 8CHOA 3FF0A 2PZVA 4KVHA 4HVNA 4HM3B 5D81A 3MG3A 3G0KA 5KP4A 3F7SA 4XB5A 1QJGA 1W6YA 4X2OA 5IG3A 2XR8B 1WQLB 1CQSA 4XDWA 3OWUA 3RGRA 3NM2A 3A76A 3VGNA 5IF6A 2JQ5A 3FF2A 1IDPA 3NXJA 5AIIA 3FLJA 3F8HA 4LEHA 4STDA 5JPUA 1O7WB 4RZMA 2QGUA 1OHOA 2GBXB 1ZX2A 3CNXA 2YFLB 3E99A 3GZYB 3OWSA 3I0YA 1Q40A 3GZBA 2HMNB 1JB4A 2STDA 2F99A 4ORLA 5BXQA 5EVHA 2A15A 1GS3A 6STDA 1OHSA 1Q40B 3JUQA 4OVMA 4HM7B 1ULJB 2HMKB 4K1VA 1O7NB 4FCJA 3F8XA 3JUOA 4HKVB 2BMOB 4HM6B 2F98A 5KP1A 3LZAA 2XSOB 3LYGA 4XBXA 1QMAA 4WWUC 3HZPA 3DXOA 1OGZA 3FZWA 1C7HA 3D9RA 3T8UA 5DREA 5IG4A 2BMQB 3DUKA 3JUPA 3SOYA 1EG9B 1O7MB 2B24B 4R9KA 3EC9A 3NUVA 1NU3A 2HMOB 3NBRA 1ASKA 1W00A 2IMJA 1E97A 1DMMA 4K1UA 4L8PA 4PEJA 3STDA 5IERA 1OF5A 1GY7A 1OUNA 1DMQA 2Z77A 3IPTA 3EBYA 3CNMA 4XDVA 4XBYA 3ER7A 1OCVA 4R1KA 1U5OA 4GB5A 5D83A 1OGXA 5IEPA 2UX0A 4HZ9B 4CDLA 3F7XA 3KZTA 4J9AA 7STDA 2GXFA 1SJWA 3M8CA 1JB5A 3CPOA 1JKGB 5AIFA 1O7GB 3FH1A 3EN8A 5CF2A 2RCDA 1JN5A 5AIGA 5KP3A 3UJMA 2YFJB 2Z7AA 3EN1B 5AIHA 3Q90A 1JN5B 1ZO2A 1NDOB 3B4PA 3EF8A 1A2KA 3DZLA 5CXOA 3FKAA 5DRVA 3GWRA 2YFIB 3FGYA 3K7CA 3CU3A 3H51A 3NV0B 4H3UA 2QIYA 3EX9A 3GZXB 1E3RA 3DMCA 4HM8B 3JUMA 3ROBA 3B7CA 3EQQB 3G16A 5TGNA 3SEDA 3UNLA 4HM2B 4LGQA 1ISKA 4OUQA 1UUVB 1JB2A 1S5AA 3EHCA 1Q42A 3HX8A 4LMIA 4WYKA 5AEUB 3MHEA 3HK4A 2GEYA 1W01A 4I4KA 1GY5A 4WYKB 2Z76A 4L8OA 4WP5A 5IENA 2XSHB 3VSYA 2HMJB 3WMDA 4Q53A 5AI1A 2F86B 2CHCA 1AR0A 2BMRB 3F40A 4J8TA 1DMNA 5CF1A 4HM0B 4HM1B 5IG0A 5CLKA 2RFRA 3OV4A 3KSPA 1GYBA 4HM4B 5STDA 4HJLB 3GZRA 1EA2A 5BVBA 3H3HA 4R9LA 1OH0A 1OPYA 1BUQA 3OWYA 3BB9A 3FSDA 3EBTA 3S5CA 4FCMA 2I9WA 2RGQA 5CK6A 2XRXB 4X2HA 3SOAA 2B1XB 3B4OA 5IG5A 1E3VA 3B8LA 5JPPA 3MKIA 4XM4A 1STDA 3BLZA 3EJVA 4HM5B 3F9SA 4IIAA 3G8ZA 2HMLB 1O7HB 1W02A 2INXA 3OX9A 5AEWB 1UUWB 1Z1SA 2GEXA 1O7PB 3KKGA 4N3VA 5G2GA 4HZBB 2BNGA 2HMMB 3F14A 5IEOA 1OF5B 3ECFA 2W2CA 3OXAA 1TP6A 5HGRA 3JUNA 3T8NA 3MYTA 1JKGA 1K41A 2GBWB 3GRDA 4L7KA 2K54A 4MJDA 4U13A 3RGAA 1GY6A 3DM8A 3K0ZA 3NHXA 5D82A 1HKXA 2CKFB 3MG1A 3KE7A
chains in the Genus database with same CATH superfamily
4XBTA 1QVG2 1MOLA 1TUHA 3BNCA 1YIJ3 3LTDA 1VQ63 3FF0A 2W04A 1BOXA 2PZVA 1RGCA 1LQGC 3MG3A 1SPUA 2OCTA 3G0KA 2CC3A 4O3VA 2SBLA 1VQM3 1CQSA 2KF6A 1FGOA 1K734 3QRDA 1TFOA 4RNTA 2BIRA 3S27A 5RNTA 1BRJA 1SARA 3FG3A 3S28A 1K28A 4N6OB 5I97A 4RZMA 3N9HA 5ELUA 1RLSA 3D5IA 3GZYB 1VQ73 1I0XA 5BXQA 5EVHA 2A15A 2WGOA 2Y73A 1OHSA 1Q40B 1LXEA 1TJDA 3AMOA 4HM7B 4OVMA 5EQLA 1I0VA 2XGLA 3T0UA 1RMSA 1O7NB 4FMAA 1LVNA 1YJW3 1FUSA 3F8XA 3JUOA 2BMOB 2E2UA 3LZAA 3LYGA 3PYJA 1QMAA 1DVDA 2OOVC 3DXOA 1OGZA 4CCVA 1Q864 3A5EA 2E2VA 3KCHA 2P0MA 2B24B 2XF3A 3SYUA 4BU4A 1US1A 2K0MA 3NBRA 1ASKA 2IMJA 4K1UA 3HOHA 4KZ1A 4PEJA 3STDA 3CCR3 1GY7A 2Z77A 2QEX3 5EEOA 3UL6A 3I553 1QAKA 1ROVA 5IEPA 3WDGB 2W0QA 3KZTA 7STDA 1SJWA 2D42A 1WTHA 3CCE3 3FH1A 5CF2A 1AVLA 3HI7A 1TU5A 1DETA 2YFJB 1KSIA 2W6JH 5AIHA 3RDEA 3DY5A 3Q90A 1LRAA 1A2KA 4H61A 4K61A 3FKAA 5DRVA 2QA43 1CH0A 1NNVA 2FGTA 3K7CA 3CCS3 1FUWA 3H51A 2QIYA 3EX9A 3GZXB 1E3RA 2CX1A 3DMCA 3B7CA 2CFLA 3UNLA 2GSPA 4NPBA 3RNTA 1ISKA 1QAFA 5AEUB 3N54B 3MHEA 2GEYA 1FUTA 4WYKB 1UGIA 2Z76A 4L8OA 3NM7A 2E2TA 2KAAA 3VSYA 1JBTA 2HMJB 2CH9A 5AI1A 2P38A 3F40A 4HM0B 5IG0A 2KF3A 1IYYA 5BIRA 2IUKA 2ML6A 1B21A 1W6CA 1IV9A 2L4VA 5FGOA 1OH0A 5LC7A 1OPYA 2CFDA 3OWYA 2F5MA 5M19A 4BIRA 4GHOA 2RGQA 4J5GA 4N6TA 4X2HA 1YGWA 3CD63 5IG5A 2CK3H 3SLUA 2J8XB 3CPW2 3FG1A 4XM4A 3K63A 2ML5A 2Q07A 2KF5A 1KQS2 4HM5B 1V74A 1VQ43 3IJEB 1O7HB 3OX9A 4HAAA 6STDA 1QALA 3WODG 1RRLA 2W03A 5G2GA 1IV7A 2BNGA 3F14A 4MMXB 1MGRA 1HYFA 1Q9EA 3LH4A 1B2MA 4BTYA 2LYXA 3GSPA 3CC73 3OW22 1UW1A 2GBWB 4L7KA 3K5TA 4U13A 1IK3A 3CCQ3 1YJN3 1YHQ3 2UGIA 3NHXA 1HKXA 2WOFA 3MG1A 3PCRA 1PFPA 2K3DA 4G1MB 1IT8A 5M1AA 1BRNL 4N6MA 5FW5A 1I2GA 1MWTA 4KVHA 4HVNA 5D81A 1NB3I 1JRQA 3F7SA 1RGKA 1W6YA 4X2OA 1D6UA 2ZDJA 1WQLB 3HIIA 4XDWA 3CXC2 3G713 1V57A 3NM2A 3A76A 4EXRA 1RGAA 1IDPA 3MPHA 1W6GA 2MC8A 4NREA 2C11A 3LXUX 3F8HA 4STDA 2OQEA 3DGMA 3S67A 5JPUA 3VF1A 4O8SA 3G6E3 2YFLB 3NX0A 3X42A 3I0YA 4OK0A 1Q824 2STDA 1GS3A 2AAEA 1ULJB 3PGBA 5ELJA 1W4NA 1V58A 2H0GA 3DGNA 1LQMB 1A90A 2CWUA 1MWRA 3N8BA 5JBSA 3EB8A 1VQ83 3S29A 4FMBA 3HZPA 3LTCA 1K9M4 1BRKA 3D9RA 1QVF2 5DREA 3Q2PA 4TX4A 4BTXA 7RNTA 3IMAB 1HZ1A 3AGNA 2AADA 3PS8A 1N5HA 3EC9A 3NUVA 5M18A 1BNSA 3LT9A 1B27A 2XGNA 4MMYB 1DYUA 1TRQA 3X3XA 4XBYA 5HOHA 1OCVA 4R1KA 1LOXA 1OGXA 1BSEA 2LQVA 4HZ9B 4CDLA 3QK9A 1YVSA 2GXFA 3ZG5A 4EV2A 3M8CA 1VQP3 1O7GB 1D6YA 8RNTA 1RGHA 9RNTA 1IQXA 3UJMA 2Z7AA 1WMNA 2CIUA 1JN5B 2RBIA 3EF8A 4GSPA 1RCKA 1Y4KA 1GMPA 3SVAA 2YFIB 3EE1A 1BNGA 4I5QA 4HM8B 4EYCA 1MWUA 2CFGA 3EQQB 5TGNA 3SEDA 3CCV3 1UUVB 5G1KA 2KXGA 3EHCA 4HBRA 4LMIA 1EQKA 3BU4A 3HK4A 1B2SA 1W01A 2WOHA 2XSHB 4HYZA 3AGOA 3WMDA 4EW5A 1AR0A 2CHCA 1FGTA 4GL6A 1YGEA 2IA7A 1UDII 4J8TA 1RSNA 2CWVA 4HM1B 1VQN3 5CLKA 4BTWA 3OV4A 1PY3A 1GYBA 3LMLA 1BNRA 3U97A 2F4YA 1KWIA 2W9PA 3KIIA 2CG1A 3H3HA 5BVBA 1FGRA 1TFKA 2BO9B 2PNCA 1RDSA 3EBTA 1RJOA 4FCMA 2BT3A 2Z6BA 4N6NB 3NQYA 1X1UA 3B8LA 1X1WA 1AVKA 1IVVA 2XH9A 3J7Yd 2KCDA 1LNHA 3BNDA 4IIAA 2HMLB 4O2HA 1KD14 1EEJA 2SARA 3NBBA 1UUGB 4N3VA 2YX9A 4HZBB 1UCIA 4HOHA 1AY7A 5IEOA 1BUJA 3AHWA 2CG0A 1BSBA 1YNVX 5BU4A 1JKGA 4LSOA 1CYUA 3RGAA 1GY6A 3DM8A 3DGOA 4N6UA 5D82A 1M9GA 1IVUA 3URPA 3DH2A 3KE7A 1B3SA 3MG2A 1NWWA 1OHPA 8CHOA 1NB5I 4HM3B 4IT7A 5KP4A 2C4BA 1QJGA 1W2ZA 1Q7Y4 2XR8B 1W7CA 2BU4A 1L5GB 3RGRA 4RBNA 3TDGA 4N6V0 3FF2A 4RNZA 5IF6A 1FW7A 3FLJA 1LOWA 4FCZA 1O7WB 2QGUA 1OHOA 1BU4A 1RNTA 1ZX2A 3CNXA 3E99A 3OWSA 2BHMA 1Q40A 3GZBA 4FMDA 1TTOA 4ORLA 2R41A 3LTBA 5IW9A 3JUQA 5GSPA 3X3ZA 3DGYA 1EUIC 4JF8A 3AMOB 1PU4A 4FCJA 4BL2A 3Q1CA 1VQ93 1N5PA 1G0TA 4HKVB 2F98A 4HM6B 1I3FA 2W56B 5A0OB 1GOVA 4KT3B 1B2UA 4WWUC 1C7HA 1TRPA 2H0IA 1A67A 2CFWA 2BMQB 1IVXA 1RHLA 1ZGXA 3X3YA 1R4CA 1UI7A 4JRFA 1AV4A 4R9KA 2HMOB 4QWTA 6GSPA 1E97A 1DMMA 1GMRA 3UL5A 1Q814 1OUNA 3EBYA 3CNMA 5D83A 3ER7A 1U5OA 4GB5A 1G96A 2UX0A 3F7XA 3V98A 3GAXA 1GOUA 2F56A 2OOVA 3CPOA 1JKGB 1M1XB 1RN1A 1JZOA 4K90B 1B2ZA 3EN8A 5AIGA 3D3LA 5KP3A 1K8A4 1JBSA 3EN1B 2CW9A 1ZO2A 3B4PA 3D79A 3DZLA 5CXOA 1B2XA 3PCSA 3FGYA 3CU3A 3NV0B 4H3UA 1IQYA 1BAOA 3ROBA 1I3IA 1PYLA 2XEPA 1N8QA 3LOYA 4OUQA 1HU9A 3HX8A 2P09A 1MWSA 1MGWA 2ZHXB 2IY2A 2P05A 1WMPA 2FNQA 2M7OA 4WP5A 1RTUA 3LTAA 1U8CB 4RNYA 3SXXA 1IQ8A 4Q53A 3D4AA 2F86B 1D6ZA 1FZUA 2BMRB 2RNTA 3JVCA 1DMNA 3ZG0A 5CF1A 1M904 4EC6A 1RNBA 1VQO3 5STDA 1CYVA 2KRTA 3GZRA 1EA2A 1BSAA 3K9MC 3PZWA 4KFFA 4R9LA 1BUQA 3BB9A 1MNLA 3S5CA 1DVCA 1JNQA 2XRXB 3PXMA 3SOAA 3B4OA 1T5YA 4LZIA 5JPPA 3LT8A 3MKIA 1F8NA 3CC43 3KFQC 5G1LA 3EJVA 2UUGC 1LOVA 3F9SA 1RN7A 1W02A 2WGQA 3MWZA 1UUWB 3WA2X 5AEWB 1J2BA 1O7PB 1M1K4 3X41A 2HMMB 2W2CA 4NHFA 4J5KA 5HGRA 3MYTA 3GRDA 4MEIA 2O3OA 2XFSA 2K54A 3BIRA 4MJDA 4DKIA 3K0ZA 1JZDA 1BSCA 1W5ZA 1T2HA 1ULIB 2ZA4A 2OWPA 2OQEC 1VZZA 3DGLA 1SQWA 2R4IA 3NV0A 1RN4A 1G02A 3MSOA 3NBJA 1N9JA 1JBRA 1BIRA 2L1SA 2WO0A 2D1WA 3FG4A 4XB5A 2CX0A 1C54A 3FCSB 1BRIA 4AKYA 5IG3A 1FA3A 1BRHA 1Q7HA 3OWUA 1IT7A 4WHAA 1I2EA 1VQQA 3VGNA 1WNHA 1A2PA 2JQ5A 3NXJA 1I70A 2ZL8A 5AIIA 2OTL3 4LEHA 1FGQA 3UB1A 1BRSA 1STFI 1GD3A 1BNFA 1BANA 2GBXB 2GU1A 3D5GA 1VQL3 2HMNB 1JB4A 2FXTA 2F99A 1KC84 1NJI4 2JDIH 4R4KA 4LYLB 5LC6A 2HMKB 1X1YA 1T2IA 4K1VA 3HIGA 2CFKA 4WFOA 3L0RA 3U1WA 5KP1A 3I563 4FR9A 2XSOB 4XBXA 4BL3A 1S723 2W56A 1IVWA 1SIHA 3FZWA 1RRHA 3T8UA 3CCU3 3WOFB 1BNJA 4AEQA 1BRGA 5IG4A 3DUKA 3AHSA 3JUPA 3SOYA 1RGLA 1EG9B 1O7MB 3KN4A 2CWTA 1NU3A 4EBGA 1W00A 4L8PA 1ZS7A 4CJNA 5IERA 1OF5A 3IPTA 5AYRB 4XDVA 7GSPA 3WOEB 1YVBI 2OTJ3 1FGMA 2C10A 1GMQA 2IYJA 1B20A 4J9AA 1CEWI 1EKMA 3CC23 1JB5A 1RGFA 5AIFA 1RGEA 5AYSC 2RCDA 1JN5A 1LNIA 1UGHI 1VQK3 1UCKA 1NDOB 1UCLA 1I2FA 4CPKA 3G4S3 3GWRA 1BSDA 2GU3A 4N6LA 2W9QA 1YJ93 3JUMA 2P0XA 3G16A 2RSXA 3WA3A 4HM2B 4LGQA 3ALAA 1JB2A 1RCLA 1S5AA 1Q42A 4FMCA 4KFDA 4WYKA 3V92A 1DE3A 4I4KA 2KF4A 1GY5A 1RKYA 2F5WA 5IENA 1GSPA 3WHOA 3X40A 1JJ22 1BVIA 3BNBA 1NO3A 4IPBA 1GOYA 4R80A 3SX1A 2RFRA 3CMA3 1UI8A 3KSPA 2V1LA 4AKZA 4HM4B 1IU7A 2H0HA 4HJLB 1I8VA 2XFTA 1BNEA 2MF7A 3FSDA 1GD4A 2IUJA 3NQZA 1LOYA 1N9EA 2I9WA 3CCL3 5CK6A 4EV5A 1W2B2 4ZM8A 1VQ53 2B1XB 1E3VA 1R4YA 3CME3 1JV2B 1A2VA 3WR2A 1STDA 3KSED 3CCM3 4O02B 3BLZA 3Q3FA 2HOHA 3BNEA 6RNTA 1BGSA 4ILFA 3G8ZA 2INXA 1TIJA 2O9UX 1BNIA 4MMZB 1AQZA 1RGGA 1Z1SA 1FYSA 2GEXA 3KKGA 1YIT3 1WMOA 4KFEA 3CCJ3 1OF5B 3ECFA 3OXAA 1TP6A 3V99A 1X1XA 3JUNA 3T8NA 1OACA 1K41A 1ROAA 1UCJA 3O8YA 1T3BA 1SIIA 1YI23 1DMQA 2CKFB 1N8R4 2Y74A 3ZFZA
chains in the Genus database with same CATH topology
4XBTA 1QVG2 1MOLA 1TUHA 3BNCA 1YIJ3 3LTDA 1VQ63 3FF0A 2W04A 2PZVA 3MG3A 1SPUA 2OCTA 3G0KA 2CC3A 4O3VA 2SBLA 1VQM3 1CQSA 1FGOA 1K734 3QRDA 1TFOA 3S27A 3FG3A 3S28A 1K28A 4N6OB 5I97A 4RZMA 3N9HA 5ELUA 3GZYB 1VQ73 5BXQA 5EVHA 2A15A 2WGOA 2Y73A 1OHSA 1Q40B 1LXEA 3AMOA 4HM7B 4OVMA 5EQLA 3T0UA 2XGLA 1O7NB 4FMAA 1LVNA 1YJW3 3F8XA 3JUOA 2BMOB 2E2UA 3LZAA 3LYGA 3PYJA 1QMAA 1DVDA 2OOVC 3DXOA 1OGZA 4CCVA 1Q864 2E2VA 2P0MA 2B24B 2XF3A 1US1A 2K0MA 3NBRA 1ASKA 2IMJA 4K1UA 4KZ1A 3CCR3 4PEJA 3STDA 1GY7A 2Z77A 2QEX3 5EEOA 3UL6A 3I553 1QAKA 1ROVA 5IEPA 3WDGB 2W0QA 3KZTA 7STDA 1SJWA 2D42A 1WTHA 3CCE3 3FH1A 5CF2A 1AVLA 3HI7A 1TU5A 2YFJB 1KSIA 2W6JH 5AIHA 3RDEA 3DY5A 3Q90A 1A2KA 4H61A 4K61A 3FKAA 5DRVA 2QA43 1FUWA 2FGTA 3K7CA 3CCS3 3H51A 2QIYA 3EX9A 3GZXB 1E3RA 3DMCA 3B7CA 2CFLA 3UNLA 1ISKA 1QAFA 5AEUB 3N54B 3MHEA 2GEYA 4WYKB 2Z76A 4L8OA 3NM7A 2E2TA 3VSYA 2HMJB 2CH9A 5AI1A 2P38A 3F40A 4HM0B 5IG0A 2IUKA 2ML6A 1W6CA 1IV9A 2L4VA 5FGOA 1OH0A 5LC7A 1OPYA 2CFDA 3OWYA 2RGQA 4N6TA 4X2HA 3CD63 5IG5A 2CK3H 3SLUA 3CPW2 3FG1A 4XM4A 3K63A 2ML5A 2Q07A 1KQS2 4HM5B 1V74A 1VQ43 3IJEB 1O7HB 3OX9A 6STDA 1QALA 3WODG 1RRLA 2W03A 5G2GA 1IV7A 2BNGA 3F14A 4MMXB 3LH4A 4BTYA 2LYXA 3CC73 3OW22 1UW1A 2GBWB 4L7KA 3K5TA 4U13A 1IK3A 3CCQ3 1YJN3 1YHQ3 3NHXA 3PCRA 2WOFA 1HKXA 3MG1A 1PFPA 4G1MB 1IT8A 4N6MA 5FW5A 4KVHA 4HVNA 5D81A 1NB3I 1JRQA 3F7SA 1W6YA 4X2OA 1D6UA 2ZDJA 1WQLB 3HIIA 4XDWA 3CXC2 3G713 3NM2A 3A76A 4EXRA 1IDPA 3MPHA 1W6GA 2MC8A 4NREA 2C11A 3LXUX 3F8HA 4STDA 2OQEA 3DGMA 3S67A 5JPUA 3VF1A 4O8SA 3G6E3 2YFLB 3NX0A 3X42A 3I0YA 4OK0A 1Q824 2STDA 1GS3A 1ULJB 3PGBA 5ELJA 1W4NA 3DGNA 1A90A 2CWUA 3N8BA 5JBSA 3EB8A 1VQ83 3S29A 4FMBA 3HZPA 3LTCA 1K9M4 3D9RA 1QVF2 5DREA 3Q2PA 4TX4A 4BTXA 3IMAB 3PS8A 1N5HA 3EC9A 3NUVA 3LT9A 2XGNA 4MMYB 1DYUA 3X3XA 4XBYA 1OCVA 4R1KA 1LOXA 1OGXA 2LQVA 4HZ9B 4CDLA 3QK9A 2GXFA 4EV2A 3M8CA 1VQP3 1O7GB 1D6YA 1IQXA 3UJMA 2Z7AA 1WMNA 2CIUA 1JN5B 3EF8A 1Y4KA 3SVAA 2YFIB 3EE1A 4HM8B 4EYCA 2CFGA 3EQQB 5TGNA 3SEDA 3CCV3 1UUVB 2KXGA 3EHCA 4HBRA 4LMIA 1EQKA 3HK4A 1W01A 2WOHA 2XSHB 4HYZA 3WMDA 1AR0A 2CHCA 1FGTA 4GL6A 1YGEA 2IA7A 4J8TA 2CWVA 4HM1B 1VQN3 5CLKA 4BTWA 3OV4A 1GYBA 3LMLA 3U97A 1KWIA 2W9PA 3KIIA 2CG1A 3H3HA 5BVBA 1FGRA 1TFKA 2BO9B 2PNCA 3EBTA 1RJOA 4FCMA 2BT3A 2Z6BA 4N6NB 3NQYA 3B8LA 1AVKA 1IVVA 2XH9A 3J7Yd 2KCDA 1LNHA 3BNDA 4IIAA 2HMLB 4O2HA 1KD14 3NBBA 4N3VA 2YX9A 4HZBB 5IEOA 2CG0A 1JKGA 4LSOA 1CYUA 3RGAA 1GY6A 3DM8A 3DGOA 4N6UA 5D82A 1IVUA 1M9GA 3KE7A 3MG2A 1NWWA 1OHPA 8CHOA 1NB5I 4HM3B 4IT7A 5KP4A 1QJGA 1W2ZA 1Q7Y4 2XR8B 1W7CA 1L5GB 3RGRA 4RBNA 3TDGA 4N6V0 3FF2A 4RNZA 5IF6A 3FLJA 4FCZA 1O7WB 2QGUA 1OHOA 1ZX2A 3CNXA 3E99A 3OWSA 2BHMA 1Q40A 3GZBA 4FMDA 4ORLA 3LTBA 5IW9A 3JUQA 3X3ZA 4JF8A 3AMOB 1PU4A 4FCJA 3Q1CA 1VQ93 1N5PA 4HKVB 4HM6B 2F98A 2W56B 5A0OB 4WWUC 1C7HA 1A67A 2CFWA 2BMQB 1IVXA 3X3YA 1R4CA 1UI7A 4JRFA 1AV4A 4R9KA 2HMOB 4QWTA 1E97A 1DMMA 3UL5A 1Q814 1OUNA 3EBYA 3CNMA 5D83A 3ER7A 1U5OA 4GB5A 1G96A 2UX0A 3F7XA 3V98A 3GAXA 2OOVA 3CPOA 1JKGB 1M1XB 4K90B 3EN8A 5AIGA 3D3LA 5KP3A 1K8A4 3EN1B 2CW9A 1ZO2A 3B4PA 3DZLA 5CXOA 3PCSA 3FGYA 3CU3A 3NV0B 4H3UA 1IQYA 3ROBA 2XEPA 1N8QA 3LOYA 4OUQA 1HU9A 3HX8A 2P09A 2P05A 1WMPA 2FNQA 2M7OA 4WP5A 3LTAA 1U8CB 4RNYA 3SXXA 1IQ8A 4Q53A 2F86B 1D6ZA 2BMRB 3JVCA 5CF1A 1DMNA 1M904 4EC6A 1VQO3 5STDA 1CYVA 2KRTA 3GZRA 1EA2A 3K9MC 3PZWA 4KFFA 4R9LA 1BUQA 3BB9A 1MNLA 3S5CA 1DVCA 1JNQA 2XRXB 3PXMA 3SOAA 3B4OA 1T5YA 4LZIA 5JPPA 3LT8A 3MKIA 1F8NA 3CC43 3KFQC 3EJVA 3F9SA 1RN7A 1W02A 2WGQA 3MWZA 1UUWB 3WA2X 5AEWB 1J2BA 1O7PB 1M1K4 3X41A 2HMMB 2W2CA 4NHFA 5HGRA 3MYTA 3GRDA 4MEIA 2O3OA 2XFSA 2K54A 4MJDA 3K0ZA 1W5ZA 1ULIB 2OWPA 2OQEC 1VZZA 3DGLA 1SQWA 2R4IA 3NV0A 3NBJA 3MSOA 1N9JA 3FG4A 2WO0A 2D1WA 4XB5A 3FCSB 4AKYA 5IG3A 1FA3A 3OWUA 1IT7A 4WHAA 3VGNA 1WNHA 2JQ5A 3NXJA 2ZL8A 5AIIA 2OTL3 4LEHA 1FGQA 3UB1A 1STFI 1GD3A 2GBXB 2GU1A 1VQL3 2HMNB 1JB4A 2FXTA 2F99A 1KC84 1NJI4 2JDIH 4R4KA 5LC6A 2HMKB 4K1VA 3HIGA 2CFKA 4WFOA 3L0RA 3U1WA 5KP1A 3I563 4FR9A 2XSOB 4XBXA 1S723 2W56A 1IVWA 1SIHA 3FZWA 1RRHA 3T8UA 3CCU3 3WOFB 4AEQA 5IG4A 3DUKA 3JUPA 3SOYA 1EG9B 1O7MB 3KN4A 2CWTA 1NU3A 4EBGA 1W00A 4L8PA 5IERA 1OF5A 3IPTA 5AYRB 4XDVA 3WOEB 1YVBI 2OTJ3 1FGMA 2C10A 4J9AA 1CEWI 1EKMA 3CC23 1JB5A 5AIFA 5AYSC 2RCDA 1JN5A 1VQK3 1NDOB 3G4S3 3GWRA 2GU3A 4N6LA 2W9QA 1YJ93 3JUMA 2P0XA 3G16A 2RSXA 3WA3A 4HM2B 4LGQA 3ALAA 1JB2A 1S5AA 4FMCA 1Q42A 4WYKA 4KFDA 3V92A 4I4KA 1GY5A 1RKYA 5IENA 3X40A 1JJ22 3BNBA 1NO3A 4IPBA 3SX1A 4R80A 3CMA3 2RFRA 1UI8A 3KSPA 2V1LA 4AKZA 4HM4B 1IU7A 4HJLB 2XFTA 2MF7A 3FSDA 1GD4A 2IUJA 3NQZA 1N9EA 2I9WA 3CCL3 5CK6A 4EV5A 1W2B2 4ZM8A 1VQ53 2B1XB 1E3VA 3CME3 1JV2B 1A2VA 1STDA 3KSED 3CCM3 4O02B 3BLZA 3BNEA 3G8ZA 2INXA 1TIJA 2O9UX 4MMZB 1Z1SA 2GEXA 3KKGA 1YIT3 1WMOA 4KFEA 3CCJ3 1OF5B 3ECFA 3OXAA 1TP6A 3V99A 3JUNA 3T8NA 1OACA 1K41A 1ROAA 3O8YA 1SIIA 1YI23 1DMQA 2CKFB 1N8R4 2Y74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBT A;  1ULI B;  3MG2 A;  2OWP A;  1NWW A;  1TUH A;  1VZZ A;  2R4I A;  5FW5 A;  3NV0 A;  1OHP A;  3MSO A;  8CHO A;  3FF0 A;  2PZV A;  4KVH A;  4HVN A;  4HM3 B;  5D81 A;  3MG3 A;  3G0K A;  5KP4 A;  3F7S A;  4XB5 A;  1QJG A;  1W6Y A;  4X2O A;  5IG3 A;  2XR8 B;  1WQL B;  1CQS A;  4XDW A;  3OWU A;  3RGR A;  3NM2 A;  3A76 A;  3VGN A;  5IF6 A;  2JQ5 A;  3FF2 A;  1IDP A;  3NXJ A;  5AII A;  3FLJ A;  3F8H A;  4LEH A;  4STD A;  5JPU A;  1O7W B;  4RZM A;  2QGU A;  1OHO A;  2GBX B;  1ZX2 A;  3CNX A;  2YFL B;  3E99 A;  3GZY B;  3OWS A;  3I0Y A;  1Q40 A;  3GZB A;  2HMN B;  1JB4 A;  2STD A;  2F99 A;  4ORL A;  5BXQ A;  5EVH A;  2A15 A;  1GS3 A;  6STD A;  1OHS A;  1Q40 B;  3JUQ A;  4OVM A;  4HM7 B;  1ULJ B;  2HMK B;  4K1V A;  1O7N B;  4FCJ A;  3F8X A;  3JUO A;  4HKV B;  2BMO B;  4HM6 B;  2F98 A;  5KP1 A;  3LZA A;  2XSO B;  3LYG A;  4XBX A;  1QMA A;  4WWU C;  3HZP A;  3DXO A;  1OGZ A;  3FZW A;  1C7H A;  3D9R A;  3T8U A;  5DRE A;  5IG4 A;  2BMQ B;  3DUK A;  3JUP A;  3SOY A;  1EG9 B;  1O7M B;  2B24 B;  4R9K A;  3EC9 A;  3NUV A;  1NU3 A;  2HMO B;  3NBR A;  1ASK A;  1W00 A;  2IMJ A;  1E97 A;  1DMM A;  4K1U A;  4L8P A;  4PEJ A;  3STD A;  5IER A;  1OF5 A;  1GY7 A;  1OUN A;  1DMQ A;  2Z77 A;  3IPT A;  3EBY A;  3CNM A;  4XDV A;  4XBY A;  3ER7 A;  1OCV A;  4R1K A;  1U5O A;  4GB5 A;  5D83 A;  1OGX A;  5IEP A;  2UX0 A;  4HZ9 B;  4CDL A;  3F7X A;  3KZT A;  4J9A A;  7STD A;  2GXF A;  1SJW A;  3M8C A;  1JB5 A;  3CPO A;  1JKG B;  5AIF A;  1O7G B;  3FH1 A;  3EN8 A;  5CF2 A;  2RCD A;  1JN5 A;  5AIG A;  5KP3 A;  3UJM A;  2YFJ B;  2Z7A A;  3EN1 B;  5AIH A;  3Q90 A;  1JN5 B;  1ZO2 A;  1NDO B;  3B4P A;  3EF8 A;  1A2K A;  3DZL A;  5CXO A;  3FKA A;  5DRV A;  3GWR A;  2YFI B;  3FGY A;  3K7C A;  3CU3 A;  3H51 A;  3NV0 B;  4H3U A;  2QIY A;  3EX9 A;  3GZX B;  1E3R A;  3DMC A;  4HM8 B;  3JUM A;  3ROB A;  3B7C A;  3EQQ B;  3G16 A;  5TGN A;  3SED A;  3UNL A;  4HM2 B;  4LGQ A;  1ISK A;  4OUQ A;  1UUV B;  1JB2 A;  1S5A A;  3EHC A;  1Q42 A;  3HX8 A;  4LMI A;  4WYK A;  5AEU B;  3MHE A;  3HK4 A;  2GEY A;  1W01 A;  4I4K A;  1GY5 A;  4WYK B;  2Z76 A;  4L8O A;  4WP5 A;  5IEN A;  2XSH B;  3VSY A;  2HMJ B;  3WMD A;  4Q53 A;  5AI1 A;  2F86 B;  2CHC A;  1AR0 A;  2BMR B;  3F40 A;  4J8T A;  1DMN A;  5CF1 A;  4HM0 B;  4HM1 B;  5IG0 A;  5CLK A;  2RFR A;  3OV4 A;  3KSP A;  1GYB A;  4HM4 B;  5STD A;  4HJL B;  3GZR A;  1EA2 A;  5BVB A;  3H3H A;  4R9L A;  1OH0 A;  1OPY A;  1BUQ A;  3OWY A;  3BB9 A;  3FSD A;  3EBT A;  3S5C A;  4FCM A;  2I9W A;  2RGQ A;  5CK6 A;  2XRX B;  4X2H A;  3SOA A;  2B1X B;  3B4O A;  5IG5 A;  1E3V A;  3B8L A;  5JPP A;  3MKI A;  4XM4 A;  1STD A;  3BLZ A;  3EJV A;  4HM5 B;  3F9S A;  4IIA A;  3G8Z A;  2HML B;  1O7H B;  1W02 A;  2INX A;  3OX9 A;  5AEW B;  1UUW B;  1Z1S A;  2GEX A;  1O7P B;  3KKG A;  4N3V A;  5G2G A;  4HZB B;  2BNG A;  2HMM B;  3F14 A;  5IEO A;  1OF5 B;  3ECF A;  2W2C A;  3OXA A;  1TP6 A;  5HGR A;  3JUN A;  3T8N A;  3MYT A;  1JKG A;  1K41 A;  2GBW B;  3GRD A;  4L7K A;  2K54 A;  4MJD A;  4U13 A;  3RGA A;  1GY6 A;  3DM8 A;  3K0Z A;  3NHX A;  5D82 A;  1HKX A;  2CKF B;  3MG1 A;  3KE7 A; 
#chains in the Genus database with same CATH topology
 4XBT A;  1QVG 2;  1MOL A;  1TUH A;  3BNC A;  1YIJ 3;  3LTD A;  1VQ6 3;  3FF0 A;  2W04 A;  1BOX A;  2PZV A;  1RGC A;  1LQG C;  3MG3 A;  1SPU A;  2OCT A;  3G0K A;  2CC3 A;  4O3V A;  2SBL A;  1VQM 3;  1CQS A;  2KF6 A;  1FGO A;  1K73 4;  3QRD A;  1TFO A;  4RNT A;  2BIR A;  3S27 A;  5RNT A;  1BRJ A;  1SAR A;  3FG3 A;  3S28 A;  1K28 A;  4N6O B;  5I97 A;  4RZM A;  3N9H A;  5ELU A;  1RLS A;  3D5I A;  3GZY B;  1VQ7 3;  1I0X A;  5BXQ A;  5EVH A;  2A15 A;  2WGO A;  2Y73 A;  1OHS A;  1Q40 B;  1LXE A;  1TJD A;  3AMO A;  4HM7 B;  4OVM A;  5EQL A;  1I0V A;  2XGL A;  3T0U A;  1RMS A;  1O7N B;  4FMA A;  1LVN A;  1YJW 3;  1FUS A;  3F8X A;  3JUO A;  2BMO B;  2E2U A;  3LZA A;  3LYG A;  3PYJ A;  1QMA A;  1DVD A;  2OOV C;  3DXO A;  1OGZ A;  4CCV A;  1Q86 4;  3A5E A;  2E2V A;  3KCH A;  2P0M A;  2B24 B;  2XF3 A;  3SYU A;  4BU4 A;  1US1 A;  2K0M A;  3NBR A;  1ASK A;  2IMJ A;  4K1U A;  3HOH A;  4KZ1 A;  4PEJ A;  3STD A;  3CCR 3;  1GY7 A;  2Z77 A;  2QEX 3;  5EEO A;  3UL6 A;  3I55 3;  1QAK A;  1ROV A;  5IEP A;  3WDG B;  2W0Q A;  3KZT A;  7STD A;  1SJW A;  2D42 A;  1WTH A;  3CCE 3;  3FH1 A;  5CF2 A;  1AVL A;  3HI7 A;  1TU5 A;  1DET A;  2YFJ B;  1KSI A;  2W6J H;  5AIH A;  3RDE A;  3DY5 A;  3Q90 A;  1LRA A;  1A2K A;  4H61 A;  4K61 A;  3FKA A;  5DRV A;  2QA4 3;  1CH0 A;  1NNV A;  2FGT A;  3K7C A;  3CCS 3;  1FUW A;  3H51 A;  2QIY A;  3EX9 A;  3GZX B;  1E3R A;  2CX1 A;  3DMC A;  3B7C A;  2CFL A;  3UNL A;  2GSP A;  4NPB A;  3RNT A;  1ISK A;  1QAF A;  5AEU B;  3N54 B;  3MHE A;  2GEY A;  1FUT A;  4WYK B;  1UGI A;  2Z76 A;  4L8O A;  3NM7 A;  2E2T A;  2KAA A;  3VSY A;  1JBT A;  2HMJ B;  2CH9 A;  5AI1 A;  2P38 A;  3F40 A;  4HM0 B;  5IG0 A;  2KF3 A;  1IYY A;  5BIR A;  2IUK A;  2ML6 A;  1B21 A;  1W6C A;  1IV9 A;  2L4V A;  5FGO A;  1OH0 A;  5LC7 A;  1OPY A;  2CFD A;  3OWY A;  2F5M A;  5M19 A;  4BIR A;  4GHO A;  2RGQ A;  4J5G A;  4N6T A;  4X2H A;  1YGW A;  3CD6 3;  5IG5 A;  2CK3 H;  3SLU A;  2J8X B;  3CPW 2;  3FG1 A;  4XM4 A;  3K63 A;  2ML5 A;  2Q07 A;  2KF5 A;  1KQS 2;  4HM5 B;  1V74 A;  1VQ4 3;  3IJE B;  1O7H B;  3OX9 A;  4HAA A;  6STD A;  1QAL A;  3WOD G;  1RRL A;  2W03 A;  5G2G A;  1IV7 A;  2BNG A;  3F14 A;  4MMX B;  1MGR A;  1HYF A;  1Q9E A;  3LH4 A;  1B2M A;  4BTY A;  2LYX A;  3GSP A;  3CC7 3;  3OW2 2;  1UW1 A;  2GBW B;  4L7K A;  3K5T A;  4U13 A;  1IK3 A;  3CCQ 3;  1YJN 3;  1YHQ 3;  2UGI A;  3NHX A;  1HKX A;  2WOF A;  3MG1 A;  3PCR A;  1PFP A;  2K3D A;  4G1M B;  1IT8 A;  5M1A A;  1BRN L;  4N6M A;  5FW5 A;  1I2G A;  1MWT A;  4KVH A;  4HVN A;  5D81 A;  1NB3 I;  1JRQ A;  3F7S A;  1RGK A;  1W6Y A;  4X2O A;  1D6U A;  2ZDJ A;  1WQL B;  3HII A;  4XDW A;  3CXC 2;  3G71 3;  1V57 A;  3NM2 A;  3A76 A;  4EXR A;  1RGA A;  1IDP A;  3MPH A;  1W6G A;  2MC8 A;  4NRE A;  2C11 A;  3LXU X;  3F8H A;  4STD A;  2OQE A;  3DGM A;  3S67 A;  5JPU A;  3VF1 A;  4O8S A;  3G6E 3;  2YFL B;  3NX0 A;  3X42 A;  3I0Y A;  4OK0 A;  1Q82 4;  2STD A;  1GS3 A;  2AAE A;  1ULJ B;  3PGB A;  5ELJ A;  1W4N A;  1V58 A;  2H0G A;  3DGN A;  1LQM B;  1A90 A;  2CWU A;  1MWR A;  3N8B A;  5JBS A;  3EB8 A;  1VQ8 3;  3S29 A;  4FMB A;  3HZP A;  3LTC A;  1K9M 4;  1BRK A;  3D9R A;  1QVF 2;  5DRE A;  3Q2P A;  4TX4 A;  4BTX A;  7RNT A;  3IMA B;  1HZ1 A;  3AGN A;  2AAD A;  3PS8 A;  1N5H A;  3EC9 A;  3NUV A;  5M18 A;  1BNS A;  3LT9 A;  1B27 A;  2XGN A;  4MMY B;  1DYU A;  1TRQ A;  3X3X A;  4XBY A;  5HOH A;  1OCV A;  4R1K A;  1LOX A;  1OGX A;  1BSE A;  2LQV A;  4HZ9 B;  4CDL A;  3QK9 A;  1YVS A;  2GXF A;  3ZG5 A;  4EV2 A;  3M8C A;  1VQP 3;  1O7G B;  1D6Y A;  8RNT A;  1RGH A;  9RNT A;  1IQX A;  3UJM A;  2Z7A A;  1WMN A;  2CIU A;  1JN5 B;  2RBI A;  3EF8 A;  4GSP A;  1RCK A;  1Y4K A;  1GMP A;  3SVA A;  2YFI B;  3EE1 A;  1BNG A;  4I5Q A;  4HM8 B;  4EYC A;  1MWU A;  2CFG A;  3EQQ B;  5TGN A;  3SED A;  3CCV 3;  1UUV B;  5G1K A;  2KXG A;  3EHC A;  4HBR A;  4LMI A;  1EQK A;  3BU4 A;  3HK4 A;  1B2S A;  1W01 A;  2WOH A;  2XSH B;  4HYZ A;  3AGO A;  3WMD A;  4EW5 A;  1AR0 A;  2CHC A;  1FGT A;  4GL6 A;  1YGE A;  2IA7 A;  1UDI I;  4J8T A;  1RSN A;  2CWV A;  4HM1 B;  1VQN 3;  5CLK A;  4BTW A;  3OV4 A;  1PY3 A;  1GYB A;  3LML A;  1BNR A;  3U97 A;  2F4Y A;  1KWI A;  2W9P A;  3KII A;  2CG1 A;  3H3H A;  5BVB A;  1FGR A;  1TFK A;  2BO9 B;  2PNC A;  1RDS A;  3EBT A;  1RJO A;  4FCM A;  2BT3 A;  2Z6B A;  4N6N B;  3NQY A;  1X1U A;  3B8L A;  1X1W A;  1AVK A;  1IVV A;  2XH9 A;  3J7Y d;  2KCD A;  1LNH A;  3BND A;  4IIA A;  2HML B;  4O2H A;  1KD1 4;  1EEJ A;  2SAR A;  3NBB A;  1UUG B;  4N3V A;  2YX9 A;  4HZB B;  1UCI A;  4HOH A;  1AY7 A;  5IEO A;  1BUJ A;  3AHW A;  2CG0 A;  1BSB A;  1YNV X;  5BU4 A;  1JKG A;  4LSO A;  1CYU A;  3RGA A;  1GY6 A;  3DM8 A;  3DGO A;  4N6U A;  5D82 A;  1M9G A;  1IVU A;  3URP A;  3DH2 A;  3KE7 A;  1B3S A;  3MG2 A;  1NWW A;  1OHP A;  8CHO A;  1NB5 I;  4HM3 B;  4IT7 A;  5KP4 A;  2C4B A;  1QJG A;  1W2Z A;  1Q7Y 4;  2XR8 B;  1W7C A;  2BU4 A;  1L5G B;  3RGR A;  4RBN A;  3TDG A;  4N6V 0;  3FF2 A;  4RNZ A;  5IF6 A;  1FW7 A;  3FLJ A;  1LOW A;  4FCZ A;  1O7W B;  2QGU A;  1OHO A;  1BU4 A;  1RNT A;  1ZX2 A;  3CNX A;  3E99 A;  3OWS A;  2BHM A;  1Q40 A;  3GZB A;  4FMD A;  1TTO A;  4ORL A;  2R41 A;  3LTB A;  5IW9 A;  3JUQ A;  5GSP A;  3X3Z A;  3DGY A;  1EUI C;  4JF8 A;  3AMO B;  1PU4 A;  4FCJ A;  4BL2 A;  3Q1C A;  1VQ9 3;  1N5P A;  1G0T A;  4HKV B;  2F98 A;  4HM6 B;  1I3F A;  2W56 B;  5A0O B;  1GOV A;  4KT3 B;  1B2U A;  4WWU C;  1C7H A;  1TRP A;  2H0I A;  1A67 A;  2CFW A;  2BMQ B;  1IVX A;  1RHL A;  1ZGX A;  3X3Y A;  1R4C A;  1UI7 A;  4JRF A;  1AV4 A;  4R9K A;  2HMO B;  4QWT A;  6GSP A;  1E97 A;  1DMM A;  1GMR A;  3UL5 A;  1Q81 4;  1OUN A;  3EBY A;  3CNM A;  5D83 A;  3ER7 A;  1U5O A;  4GB5 A;  1G96 A;  2UX0 A;  3F7X A;  3V98 A;  3GAX A;  1GOU A;  2F56 A;  2OOV A;  3CPO A;  1JKG B;  1M1X B;  1RN1 A;  1JZO A;  4K90 B;  1B2Z A;  3EN8 A;  5AIG A;  3D3L A;  5KP3 A;  1K8A 4;  1JBS A;  3EN1 B;  2CW9 A;  1ZO2 A;  3B4P A;  3D79 A;  3DZL A;  5CXO A;  1B2X A;  3PCS A;  3FGY A;  3CU3 A;  3NV0 B;  4H3U A;  1IQY A;  1BAO A;  3ROB A;  1I3I A;  1PYL A;  2XEP A;  1N8Q A;  3LOY A;  4OUQ A;  1HU9 A;  3HX8 A;  2P09 A;  1MWS A;  1MGW A;  2ZHX B;  2IY2 A;  2P05 A;  1WMP A;  2FNQ A;  2M7O A;  4WP5 A;  1RTU A;  3LTA A;  1U8C B;  4RNY A;  3SXX A;  1IQ8 A;  4Q53 A;  3D4A A;  2F86 B;  1D6Z A;  1FZU A;  2BMR B;  2RNT A;  3JVC A;  1DMN A;  3ZG0 A;  5CF1 A;  1M90 4;  4EC6 A;  1RNB A;  1VQO 3;  5STD A;  1CYV A;  2KRT A;  3GZR A;  1EA2 A;  1BSA A;  3K9M C;  3PZW A;  4KFF A;  4R9L A;  1BUQ A;  3BB9 A;  1MNL A;  3S5C A;  1DVC A;  1JNQ A;  2XRX B;  3PXM A;  3SOA A;  3B4O A;  1T5Y A;  4LZI A;  5JPP A;  3LT8 A;  3MKI A;  1F8N A;  3CC4 3;  3KFQ C;  5G1L A;  3EJV A;  2UUG C;  1LOV A;  3F9S A;  1RN7 A;  1W02 A;  2WGQ A;  3MWZ A;  1UUW B;  3WA2 X;  5AEW B;  1J2B A;  1O7P B;  1M1K 4;  3X41 A;  2HMM B;  2W2C A;  4NHF A;  4J5K A;  5HGR A;  3MYT A;  3GRD A;  4MEI A;  2O3O A;  2XFS A;  2K54 A;  3BIR A;  4MJD A;  4DKI A;  3K0Z A;  1JZD A;  1BSC A;  1W5Z A;  1T2H A;  1ULI B;  2ZA4 A;  2OWP A;  2OQE C;  1VZZ A;  3DGL A;  1SQW A;  2R4I A;  3NV0 A;  1RN4 A;  1G02 A;  3MSO A;  3NBJ A;  1N9J A;  1JBR A;  1BIR A;  2L1S A;  2WO0 A;  2D1W A;  3FG4 A;  4XB5 A;  2CX0 A;  1C54 A;  3FCS B;  1BRI A;  4AKY A;  5IG3 A;  1FA3 A;  1BRH A;  1Q7H A;  3OWU A;  1IT7 A;  4WHA A;  1I2E A;  1VQQ A;  3VGN A;  1WNH A;  1A2P A;  2JQ5 A;  3NXJ A;  1I70 A;  2ZL8 A;  5AII A;  2OTL 3;  4LEH A;  1FGQ A;  3UB1 A;  1BRS A;  1STF I;  1GD3 A;  1BNF A;  1BAN A;  2GBX B;  2GU1 A;  3D5G A;  1VQL 3;  2HMN B;  1JB4 A;  2FXT A;  2F99 A;  1KC8 4;  1NJI 4;  2JDI H;  4R4K A;  4LYL B;  5LC6 A;  2HMK B;  1X1Y A;  1T2I A;  4K1V A;  3HIG A;  2CFK A;  4WFO A;  3L0R A;  3U1W A;  5KP1 A;  3I56 3;  4FR9 A;  2XSO B;  4XBX A;  4BL3 A;  1S72 3;  2W56 A;  1IVW A;  1SIH A;  3FZW A;  1RRH A;  3T8U A;  3CCU 3;  3WOF B;  1BNJ A;  4AEQ A;  1BRG A;  5IG4 A;  3DUK A;  3AHS A;  3JUP A;  3SOY A;  1RGL A;  1EG9 B;  1O7M B;  3KN4 A;  2CWT A;  1NU3 A;  4EBG A;  1W00 A;  4L8P A;  1ZS7 A;  4CJN A;  5IER A;  1OF5 A;  3IPT A;  5AYR B;  4XDV A;  7GSP A;  3WOE B;  1YVB I;  2OTJ 3;  1FGM A;  2C10 A;  1GMQ A;  2IYJ A;  1B20 A;  4J9A A;  1CEW I;  1EKM A;  3CC2 3;  1JB5 A;  1RGF A;  5AIF A;  1RGE A;  5AYS C;  2RCD A;  1JN5 A;  1LNI A;  1UGH I;  1VQK 3;  1UCK A;  1NDO B;  1UCL A;  1I2F A;  4CPK A;  3G4S 3;  3GWR A;  1BSD A;  2GU3 A;  4N6L A;  2W9Q A;  1YJ9 3;  3JUM A;  2P0X A;  3G16 A;  2RSX A;  3WA3 A;  4HM2 B;  4LGQ A;  3ALA A;  1JB2 A;  1RCL A;  1S5A A;  1Q42 A;  4FMC A;  4KFD A;  4WYK A;  3V92 A;  1DE3 A;  4I4K A;  2KF4 A;  1GY5 A;  1RKY A;  2F5W A;  5IEN A;  1GSP A;  3WHO A;  3X40 A;  1JJ2 2;  1BVI A;  3BNB A;  1NO3 A;  4IPB A;  1GOY A;  4R80 A;  3SX1 A;  2RFR A;  3CMA 3;  1UI8 A;  3KSP A;  2V1L A;  4AKZ A;  4HM4 B;  1IU7 A;  2H0H A;  4HJL B;  1I8V A;  2XFT A;  1BNE A;  2MF7 A;  3FSD A;  1GD4 A;  2IUJ A;  3NQZ A;  1LOY A;  1N9E A;  2I9W A;  3CCL 3;  5CK6 A;  4EV5 A;  1W2B 2;  4ZM8 A;  1VQ5 3;  2B1X B;  1E3V A;  1R4Y A;  3CME 3;  1JV2 B;  1A2V A;  3WR2 A;  1STD A;  3KSE D;  3CCM 3;  4O02 B;  3BLZ A;  3Q3F A;  2HOH A;  3BNE A;  6RNT A;  1BGS A;  4ILF A;  3G8Z A;  2INX A;  1TIJ A;  2O9U X;  1BNI A;  4MMZ B;  1AQZ A;  1RGG A;  1Z1S A;  1FYS A;  2GEX A;  3KKG A;  1YIT 3;  1WMO A;  4KFE A;  3CCJ 3;  1OF5 B;  3ECF A;  3OXA A;  1TP6 A;  3V99 A;  1X1X A;  3JUN A;  3T8N A;  1OAC A;  1K41 A;  1ROA A;  1UCJ A;  3O8Y A;  1T3B A;  1SII A;  1YI2 3;  1DMQ A;  2CKF B;  1N8R 4;  2Y74 A;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 4XBT A;  1QVG 2;  1MOL A;  1TUH A;  3BNC A;  1YIJ 3;  3LTD A;  1VQ6 3;  3FF0 A;  2W04 A;  2PZV A;  3MG3 A;  1SPU A;  2OCT A;  3G0K A;  2CC3 A;  4O3V A;  2SBL A;  1VQM 3;  1CQS A;  1FGO A;  1K73 4;  3QRD A;  1TFO A;  3S27 A;  3FG3 A;  3S28 A;  1K28 A;  4N6O B;  5I97 A;  4RZM A;  3N9H A;  5ELU A;  3GZY B;  1VQ7 3;  5BXQ A;  5EVH A;  2A15 A;  2WGO A;  2Y73 A;  1OHS A;  1Q40 B;  1LXE A;  3AMO A;  4HM7 B;  4OVM A;  5EQL A;  3T0U A;  2XGL A;  1O7N B;  4FMA A;  1LVN A;  1YJW 3;  3F8X A;  3JUO A;  2BMO B;  2E2U A;  3LZA A;  3LYG A;  3PYJ A;  1QMA A;  1DVD A;  2OOV C;  3DXO A;  1OGZ A;  4CCV A;  1Q86 4;  2E2V A;  2P0M A;  2B24 B;  2XF3 A;  1US1 A;  2K0M A;  3NBR A;  1ASK A;  2IMJ A;  4K1U A;  4KZ1 A;  3CCR 3;  4PEJ A;  3STD A;  1GY7 A;  2Z77 A;  2QEX 3;  5EEO A;  3UL6 A;  3I55 3;  1QAK A;  1ROV A;  5IEP A;  3WDG B;  2W0Q A;  3KZT A;  7STD A;  1SJW A;  2D42 A;  1WTH A;  3CCE 3;  3FH1 A;  5CF2 A;  1AVL A;  3HI7 A;  1TU5 A;  2YFJ B;  1KSI A;  2W6J H;  5AIH A;  3RDE A;  3DY5 A;  3Q90 A;  1A2K A;  4H61 A;  4K61 A;  3FKA A;  5DRV A;  2QA4 3;  1FUW A;  2FGT A;  3K7C A;  3CCS 3;  3H51 A;  2QIY A;  3EX9 A;  3GZX B;  1E3R A;  3DMC A;  3B7C A;  2CFL A;  3UNL A;  1ISK A;  1QAF A;  5AEU B;  3N54 B;  3MHE A;  2GEY A;  4WYK B;  2Z76 A;  4L8O A;  3NM7 A;  2E2T A;  3VSY A;  2HMJ B;  2CH9 A;  5AI1 A;  2P38 A;  3F40 A;  4HM0 B;  5IG0 A;  2IUK A;  2ML6 A;  1W6C A;  1IV9 A;  2L4V A;  5FGO A;  1OH0 A;  5LC7 A;  1OPY A;  2CFD A;  3OWY A;  2RGQ A;  4N6T A;  4X2H A;  3CD6 3;  5IG5 A;  2CK3 H;  3SLU A;  3CPW 2;  3FG1 A;  4XM4 A;  3K63 A;  2ML5 A;  2Q07 A;  1KQS 2;  4HM5 B;  1V74 A;  1VQ4 3;  3IJE B;  1O7H B;  3OX9 A;  6STD A;  1QAL A;  3WOD G;  1RRL A;  2W03 A;  5G2G A;  1IV7 A;  2BNG A;  3F14 A;  4MMX B;  3LH4 A;  4BTY A;  2LYX A;  3CC7 3;  3OW2 2;  1UW1 A;  2GBW B;  4L7K A;  3K5T A;  4U13 A;  1IK3 A;  3CCQ 3;  1YJN 3;  1YHQ 3;  3NHX A;  3PCR A;  2WOF A;  1HKX A;  3MG1 A;  1PFP A;  4G1M B;  1IT8 A;  4N6M A;  5FW5 A;  4KVH A;  4HVN A;  5D81 A;  1NB3 I;  1JRQ A;  3F7S A;  1W6Y A;  4X2O A;  1D6U A;  2ZDJ A;  1WQL B;  3HII A;  4XDW A;  3CXC 2;  3G71 3;  3NM2 A;  3A76 A;  4EXR A;  1IDP A;  3MPH A;  1W6G A;  2MC8 A;  4NRE A;  2C11 A;  3LXU X;  3F8H A;  4STD A;  2OQE A;  3DGM A;  3S67 A;  5JPU A;  3VF1 A;  4O8S A;  3G6E 3;  2YFL B;  3NX0 A;  3X42 A;  3I0Y A;  4OK0 A;  1Q82 4;  2STD A;  1GS3 A;  1ULJ B;  3PGB A;  5ELJ A;  1W4N A;  3DGN A;  1A90 A;  2CWU A;  3N8B A;  5JBS A;  3EB8 A;  1VQ8 3;  3S29 A;  4FMB A;  3HZP A;  3LTC A;  1K9M 4;  3D9R A;  1QVF 2;  5DRE A;  3Q2P A;  4TX4 A;  4BTX A;  3IMA B;  3PS8 A;  1N5H A;  3EC9 A;  3NUV A;  3LT9 A;  2XGN A;  4MMY B;  1DYU A;  3X3X A;  4XBY A;  1OCV A;  4R1K A;  1LOX A;  1OGX A;  2LQV A;  4HZ9 B;  4CDL A;  3QK9 A;  2GXF A;  4EV2 A;  3M8C A;  1VQP 3;  1O7G B;  1D6Y A;  1IQX A;  3UJM A;  2Z7A A;  1WMN A;  2CIU A;  1JN5 B;  3EF8 A;  1Y4K A;  3SVA A;  2YFI B;  3EE1 A;  4HM8 B;  4EYC A;  2CFG A;  3EQQ B;  5TGN A;  3SED A;  3CCV 3;  1UUV B;  2KXG A;  3EHC A;  4HBR A;  4LMI A;  1EQK A;  3HK4 A;  1W01 A;  2WOH A;  2XSH B;  4HYZ A;  3WMD A;  1AR0 A;  2CHC A;  1FGT A;  4GL6 A;  1YGE A;  2IA7 A;  4J8T A;  2CWV A;  4HM1 B;  1VQN 3;  5CLK A;  4BTW A;  3OV4 A;  1GYB A;  3LML A;  3U97 A;  1KWI A;  2W9P A;  3KII A;  2CG1 A;  3H3H A;  5BVB A;  1FGR A;  1TFK A;  2BO9 B;  2PNC A;  3EBT A;  1RJO A;  4FCM A;  2BT3 A;  2Z6B A;  4N6N B;  3NQY A;  3B8L A;  1AVK A;  1IVV A;  2XH9 A;  3J7Y d;  2KCD A;  1LNH A;  3BND A;  4IIA A;  2HML B;  4O2H A;  1KD1 4;  3NBB A;  4N3V A;  2YX9 A;  4HZB B;  5IEO A;  2CG0 A;  1JKG A;  4LSO A;  1CYU A;  3RGA A;  1GY6 A;  3DM8 A;  3DGO A;  4N6U A;  5D82 A;  1IVU A;  1M9G A;  3KE7 A;  3MG2 A;  1NWW A;  1OHP A;  8CHO A;  1NB5 I;  4HM3 B;  4IT7 A;  5KP4 A;  1QJG A;  1W2Z A;  1Q7Y 4;  2XR8 B;  1W7C A;  1L5G B;  3RGR A;  4RBN A;  3TDG A;  4N6V 0;  3FF2 A;  4RNZ A;  5IF6 A;  3FLJ A;  4FCZ A;  1O7W B;  2QGU A;  1OHO A;  1ZX2 A;  3CNX A;  3E99 A;  3OWS A;  2BHM A;  1Q40 A;  3GZB A;  4FMD A;  4ORL A;  3LTB A;  5IW9 A;  3JUQ A;  3X3Z A;  4JF8 A;  3AMO B;  1PU4 A;  4FCJ A;  3Q1C A;  1VQ9 3;  1N5P A;  4HKV B;  4HM6 B;  2F98 A;  2W56 B;  5A0O B;  4WWU C;  1C7H A;  1A67 A;  2CFW A;  2BMQ B;  1IVX A;  3X3Y A;  1R4C A;  1UI7 A;  4JRF A;  1AV4 A;  4R9K A;  2HMO B;  4QWT A;  1E97 A;  1DMM A;  3UL5 A;  1Q81 4;  1OUN A;  3EBY A;  3CNM A;  5D83 A;  3ER7 A;  1U5O A;  4GB5 A;  1G96 A;  2UX0 A;  3F7X A;  3V98 A;  3GAX A;  2OOV A;  3CPO A;  1JKG B;  1M1X B;  4K90 B;  3EN8 A;  5AIG A;  3D3L A;  5KP3 A;  1K8A 4;  3EN1 B;  2CW9 A;  1ZO2 A;  3B4P A;  3DZL A;  5CXO A;  3PCS A;  3FGY A;  3CU3 A;  3NV0 B;  4H3U A;  1IQY A;  3ROB A;  2XEP A;  1N8Q A;  3LOY A;  4OUQ A;  1HU9 A;  3HX8 A;  2P09 A;  2P05 A;  1WMP A;  2FNQ A;  2M7O A;  4WP5 A;  3LTA A;  1U8C B;  4RNY A;  3SXX A;  1IQ8 A;  4Q53 A;  2F86 B;  1D6Z A;  2BMR B;  3JVC A;  5CF1 A;  1DMN A;  1M90 4;  4EC6 A;  1VQO 3;  5STD A;  1CYV A;  2KRT A;  3GZR A;  1EA2 A;  3K9M C;  3PZW A;  4KFF A;  4R9L A;  1BUQ A;  3BB9 A;  1MNL A;  3S5C A;  1DVC A;  1JNQ A;  2XRX B;  3PXM A;  3SOA A;  3B4O A;  1T5Y A;  4LZI A;  5JPP A;  3LT8 A;  3MKI A;  1F8N A;  3CC4 3;  3KFQ C;  3EJV A;  3F9S A;  1RN7 A;  1W02 A;  2WGQ A;  3MWZ A;  1UUW B;  3WA2 X;  5AEW B;  1J2B A;  1O7P B;  1M1K 4;  3X41 A;  2HMM B;  2W2C A;  4NHF A;  5HGR A;  3MYT A;  3GRD A;  4MEI A;  2O3O A;  2XFS A;  2K54 A;  4MJD A;  3K0Z A;  1W5Z A;  1ULI B;  2OWP A;  2OQE C;  1VZZ A;  3DGL A;  1SQW A;  2R4I A;  3NV0 A;  3NBJ A;  3MSO A;  1N9J A;  3FG4 A;  2WO0 A;  2D1W A;  4XB5 A;  3FCS B;  4AKY A;  5IG3 A;  1FA3 A;  3OWU A;  1IT7 A;  4WHA A;  3VGN A;  1WNH A;  2JQ5 A;  3NXJ A;  2ZL8 A;  5AII A;  2OTL 3;  4LEH A;  1FGQ A;  3UB1 A;  1STF I;  1GD3 A;  2GBX B;  2GU1 A;  1VQL 3;  2HMN B;  1JB4 A;  2FXT A;  2F99 A;  1KC8 4;  1NJI 4;  2JDI H;  4R4K A;  5LC6 A;  2HMK B;  4K1V A;  3HIG A;  2CFK A;  4WFO A;  3L0R A;  3U1W A;  5KP1 A;  3I56 3;  4FR9 A;  2XSO B;  4XBX A;  1S72 3;  2W56 A;  1IVW A;  1SIH A;  3FZW A;  1RRH A;  3T8U A;  3CCU 3;  3WOF B;  4AEQ A;  5IG4 A;  3DUK A;  3JUP A;  3SOY A;  1EG9 B;  1O7M B;  3KN4 A;  2CWT A;  1NU3 A;  4EBG A;  1W00 A;  4L8P A;  5IER A;  1OF5 A;  3IPT A;  5AYR B;  4XDV A;  3WOE B;  1YVB I;  2OTJ 3;  1FGM A;  2C10 A;  4J9A A;  1CEW I;  1EKM A;  3CC2 3;  1JB5 A;  5AIF A;  5AYS C;  2RCD A;  1JN5 A;  1VQK 3;  1NDO B;  3G4S 3;  3GWR A;  2GU3 A;  4N6L A;  2W9Q A;  1YJ9 3;  3JUM A;  2P0X A;  3G16 A;  2RSX A;  3WA3 A;  4HM2 B;  4LGQ A;  3ALA A;  1JB2 A;  1S5A A;  4FMC A;  1Q42 A;  4WYK A;  4KFD A;  3V92 A;  4I4K A;  1GY5 A;  1RKY A;  5IEN A;  3X40 A;  1JJ2 2;  3BNB A;  1NO3 A;  4IPB A;  3SX1 A;  4R80 A;  3CMA 3;  2RFR A;  1UI8 A;  3KSP A;  2V1L A;  4AKZ A;  4HM4 B;  1IU7 A;  4HJL B;  2XFT A;  2MF7 A;  3FSD A;  1GD4 A;  2IUJ A;  3NQZ A;  1N9E A;  2I9W A;  3CCL 3;  5CK6 A;  4EV5 A;  1W2B 2;  4ZM8 A;  1VQ5 3;  2B1X B;  1E3V A;  3CME 3;  1JV2 B;  1A2V A;  1STD A;  3KSE D;  3CCM 3;  4O02 B;  3BLZ A;  3BNE A;  3G8Z A;  2INX A;  1TIJ A;  2O9U X;  4MMZ B;  1Z1S A;  2GEX A;  3KKG A;  1YIT 3;  1WMO A;  4KFE A;  3CCJ 3;  1OF5 B;  3ECF A;  3OXA A;  1TP6 A;  3V99 A;  3JUN A;  3T8N A;  1OAC A;  1K41 A;  1ROA A;  3O8Y A;  1SII A;  1YI2 3;  1DMQ A;  2CKF B;  1N8R 4;  2Y74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...