3T8UA

Crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
MNTPEHMTAVVQRAVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIAHFRFNGAGKVVSMRALFGEKNIHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8uA00
2BNGA 4HKVB 3ROBA 3FSDA 2I9WA 2B1XB 2W2CA 1UUVB 5KP4A 3H3HA 3OX9A 1C7HA 2F98A 4HM3B 3JUPA 3EN1B 3Q90A 4KVHA 3ER7A 3EF8A 4L8PA 3I0YA 5IG3A 3FLJA 4L7KA 1OHSA 4R9LA 3F14A 3MYTA 3FKAA 3OWSA 1OF5A 4FCJA 4HM0B 3GZBA 1NU3A 1GY6A 3HX8A 3IPTA 4J8TA 4J9AA 1O7PB 1VZZA 1JB4A 2HMOB 3E99A 1AR0A 1U5OA 2F86B 2QIYA 3MHEA 1OHPA 3GZXB 2GEXA 5IG0A 4WYKB 5IG5A 4XBYA 5IENA 2YFJB 2Z77A 4H3UA 5AIHA 2XSOB 2BMRB 3KSPA 4LGQA 1UUWB 4XM4A 5D83A 1JKGA 1SJWA 2CHCA 4HM6B 4K1VA 3NV0A 2Z7AA 3UNLA 5KP3A 3G0KA 3NXJA 3OXAA 1JN5B 4HVNA 3SOAA 1S5AA 1TUHA 3M8CA 3DUKA 4N3VA 1W6YA 1EA2A 3MG3A 1TP6A 4XBTA 4K1UA 1O7MB 1ZO2A 2HMLB 1OHOA 2XR8B 3DZLA 5AEUB 3JUNA 3WMDA 8CHOA 1NWWA 2RGQA 3K0ZA 3NM2A 4HJLB 4WP5A 1Q40A 4HZ9B 2GBWB 4LEHA 1QJGA 2HMKB 4HM7B 4STDA 4X2OA 3NHXA 3F8XA 4XBXA 5DRVA 5DREA 2BMOB 4GB5A 3NBRA 1A2KA 2XSHB 4XDWA 3KE7A 7STDA 3UJMA 1ULIB 1ZX2A 3HZPA 3G8ZA 1WQLB 1W00A 1STDA 3DXOA 1OUNA 3RGRA 1E3VA 1IDPA 2STDA 4R9KA 3BB9A 4XDVA 3STDA 5IF6A 1OH0A 4HM5B 3CNXA 1E3RA 1EG9B 2GEYA 3ECFA 3EJVA 2OWPA 3OWUA 1BUQA 1E97A 3MKIA 1DMQA 3EX9A 3LZAA 3CPOA 4HM8B 5G2GA 3F7XA 1O7WB 3K7CA 1ASKA 5IERA 1GYBA 3T8NA 3G16A 3KKGA 5AEWB 3B4OA 1QMAA 5AIIA 2F99A 3JUOA 2GBXB 4I4KA 2R4IA 4IIAA 4L8OA 1W02A 3F8HA 3FF0A 4OVMA 5IEOA 4OUQA 3FF2A 2JQ5A 4X2HA 5KP1A 5CF2A 3B8LA 1OGXA 1OF5B 3EHCA 5IG4A 1DMMA 2YFIB 5TGNA 3CNMA 2A15A 4WWUC 1JB2A 2BMQB 5CLKA 5CF1A 1OCVA 4HZBB 3JUMA 3B4PA 4PEJA 4HM4B 3S5CA 3EC9A 5IEPA 5BXQA 4WYKA 3B7CA 1ULJB 3EN8A 3GZRA 3VSYA 3BLZA 3F7SA 1OPYA 2HMJB 3FH1A 3OV4A 4CDLA 2K54A 3GWRA 3JUQA 1JKGB 3GRDA 5HGRA 2UX0A 3DMCA 3KZTA 1ISKA 4U13A 3DM8A 2B24B 1GY5A 3VGNA 1Q42A 3F9SA 3OWYA 4HM2B 5AIGA 4R1KA 5EVHA 4LMIA 4XB5A 5AI1A 2CKFB 2RCDA 2INXA 5CXOA 1CQSA 1W01A 1GS3A 1Q40B 2IMJA 6STDA 1DMNA 2QGUA 1HKXA 5AIFA 3MG1A 4RZMA 3RGAA 1JB5A 3EBTA 1GY7A 1O7HB 3H51A 3T8UA 2RFRA 5D81A 5STDA 2HMMB 4MJDA 5BVBA 3SEDA 3D9RA 4ORLA 2Z76A 3HK4A 3FGYA 2GXFA 3MSOA 5D82A 1NDOB 3LYGA 4FCMA 1O7GB 1K41A 1Z1SA 1JN5A 2YFLB 3EBYA 3MG2A 3NUVA 4Q53A 5JPUA 2HMNB 3NV0B 3SOYA 3FZWA 4HM1B 1OGZA 2XRXB 3F40A 3EQQB 3A76A 5FW5A 5CK6A 1O7NB 3CU3A 5JPPA 3GZYB 2PZVA
chains in the Genus database with same CATH superfamily
2RBIA 1B2UA 4AKYA 2CK3H 1FW7A 3CCL3 2KCDA 3H3HA 3DGLA 4HM3B 5ELJA 4CJNA 2O9UX 4KVHA 3ER7A 5IG3A 4L7KA 1OHSA 3F14A 2ZDJA 4GL6A 4J8TA 1TRPA 1M1XB 1C54A 1JB4A 1LNHA 3E99A 1U5OA 1S723 2KF5A 4QWTA 1IYYA 4O8SA 1JNQA 3MHEA 5IG0A 1RCKA 7RNTA 1V57A 1I3IA 2YFJB 1BANA 2Z77A 2KXGA 4LZIA 2BMRB 3BNBA 2CG1A 1RLSA 4O3VA 5D83A 4JRFA 4HM6B 1RRHA 3G0KA 1K734 3N9HA 2L1SA 4HAAA 4K1UA 1ZO2A 5AEUB 3DZLA 1AQZA 4CPKA 2O3OA 2OQEA 1RHLA 1MWSA 2RGQA 3GSPA 3K0ZA 4HJLB 4WHAA 4EBGA 3EB8A 1D6ZA 1A2VA 1UGHI 2GBWB 5BU4A 1TTOA 3NHXA 1B2XA 3F8XA 5DREA 1A2KA 2XSHB 2ZHXB 7STDA 5GSPA 3X3XA 3G8ZA 1W00A 1UI7A 4N6NB 3WR2A 3RGRA 1BSCA 5IF6A 3STDA 3UL6A 3ZFZA 2XGLA 3D5IA 3CNXA 1E3RA 3EJVA 4HM5B 4BTXA 1BUQA 1BOXA 1E97A 3MKIA 1D6YA 3LZAA 2CFDA 2CFKA 1R4CA 1O7WB 2IA7A 3PS8A 3SVAA 3T8NA 1Q7Y4 1GD3A 3B4OA 3CC73 1UUGB 2R4IA 1BRJA 1FZUA 1RGLA 2BIRA 3LMLA 4IT7A 4L8OA 1UW1A 4HBRA 3ZG0A 3G4S3 4FMDA 1MNLA 2Z6BA 1OF5B 3EHCA 4BU4A 2OTL3 1WMNA 3CNMA 2A15A 1TFKA 1BSAA 1GMPA 2XFSA 3B4PA 4PEJA 3EC9A 4HYZA 1ZGXA 1W7CA 1FA3A 3CC23 1ULJB 1IVVA 1I0XA 3VSYA 3OV4A 1UDII 5LC7A 1LOYA 1RKYA 1NB5I 2UX0A 4N6V0 1CYVA 4OK0A 4TX4A 3T0UA 1Q42A 1BNFA 1AVKA 1MGWA 3U97A 4HM2B 5AIGA 1BVIA 1ROVA 4LMIA 2GSPA 2CKFB 1YJW3 1IK3A 1LRAA 1MGRA 2CG0A 3EE1A 1A2PA 3WOEB 2W9PA 1YIT3 5FGOA 4CCVA 1WMPA 2QGUA 3S29A 3OW22 3CCJ3 1KC84 4KZ1A 4MMZB 3WHOA 2RFRA 4JF8A 5D81A 3Q2PA 5EQLA 3SEDA 3HK4A 3FGYA 1Q814 1JBRA 2MF7A 1JBTA 1JZDA 1NO3A 1K41A 4Q53A 3SLUA 3X3ZA 1YGEA 3D3LA 1BNJA 2Y73A 1EQKA 1N5HA 3RDEA 2ML6A 2BNGA 2XEPA 4HKVB 2I9WA 2B1XB 1WTHA 2W2CA 1UUVB 1C7HA 2F98A 3FG1A 1VQQA 3EN1B 3Q90A 3G713 3PGBA 3EF8A 4L8PA 1QALA 4FMBA 1LXEA 1FGOA 2KRTA 3MYTA 3A5EA 3OWSA 1OF5A 4FCJA 4HM0B 4RBNA 2XF3A 1PYLA 1B20A 1RTUA 2RSXA 1MOLA 2D1WA 3BIRA 1QAKA 1W4NA 4GSPA 1VQ63 3LXUX 1VZZA 1N5PA 2HMOB 2F86B 2WO0A 3V92A 3I563 2ZL8A 5M1AA 1RN7A 1OHPA 3GZXB 3V99A 3TDGA 4G1MB 5IG5A 1WMOA 2CX1A 2FXTA 2XH9A 3KSPA 1UUWB 1N8R4 3LTCA 1M1K4 2CHCA 3CCS3 2W03A 1FUWA 1BU4A 4KFFA 3ZG5A 2ML5A 4EW5A 4N6OB 2W56A 4N3VA 3DUKA 2AAEA 1W6YA 3MG3A 1US1A 1TP6A 4XDWA 2HMLB 1KD14 2ZA4A 2CIUA 2Q07A 3IJEB 1TU5A 1Q824 3NM2A 1K9M4 1N9EA 4XBYA 1GSPA 4R4KA 4X2OA 1IT7A 3CCU3 5DRVA 3S27A 1NB3I 1YVBI 4BL2A 3HZPA 3WDGB 3LTBA 1STDA 3VF1A 1HU9A 1OUNA 1T2IA 1IDPA 3DXOA 4R9KA 5LC6A 1IU7A 3HIIA 4IPBA 1X1XA 2OQEC 1EG9B 2GEYA 2OCTA 3ECFA 3OWUA 2CW9A 4FMAA 4BIRA 1DMQA 6RNTA 2LQVA 5I97A 1GYBA 1CEWI 3G16A 1CH0A 1DVCA 1QMAA 5AIIA 1Y4KA 4IIAA 4RNTA 1RGGA 2HOHA 5IEOA 3F8HA 3FF0A 3N54B 1VQ83 2JQ5A 1M9GA 2WGQA 4X2HA 5KP1A 4HOHA 5CF2A 1K8A4 3Q3FA 1PU4A 2BMQB 3FG4A 2R41A 1IQ8A 1SIIA 4K61A 3S28A 5BXQA 3B7CA 3GZRA 4K90B 1QAFA 1T2HA 3F7SA 1OPYA 1MWTA 3BNDA 2AADA 1YJN3 1JKGB 4RNZA 1ISKA 4U13A 4I5QA 2B24B 2OOVA 3VGNA 2H0HA 3F9SA 1BRGA 1I8VA 1BSBA 1T3BA 1EEJA 4NPBA 3CMA3 3WOFB 2INXA 1F8NA 1BGSA 2CFLA 3NBBA 1GS3A 1YGWA 2SBLA 3X40A 2H0GA 3NQYA 2IMJA 3MG1A 4RZMA 1W6GA 3I553 1TFOA 1JB5A 3T8UA 1IQYA 3H51A 3PYJA 1BSDA 4ORLA 3DGNA 2BU4A 1FGTA 1LOXA 1IT8A 1VQM3 1BNEA 1NDOB 1GD4A 1JN5A 2YFLB 5JPUA 1SIHA 1VQ43 3NV0B 3SOYA 3L0RA 3HI7A 4HM1B 2XRXB 3FCSB 3A76A 5FW5A 5IW9A 5CK6A 1SQWA 3ROBA 4ZM8A 5KP4A 2IUKA 1BRNL 3JUPA 1RNTA 3K5TA 1G96A 3I0YA 1Q864 1I2EA 3GZBA 3D4AA 3KIIA 3CCV3 3IPTA 2P0XA 3CXC2 1DE3A 1GOUA 1BAOA 1O7PB 3FG3A 2P38A 4MMYB 1AR0A 4BTWA 1J2BA 3G6E3 5G1KA 1FGQA 3S67A 1EUIC 2QIYA 1GOYA 3PCSA 2RNTA 2P05A 2GEXA 4O2HA 1UI8A 1BNGA 5RNTA 4AKZA 2F4YA 1STFI 2XSOB 4LGQA 2E2TA 2E2UA 2YX9A 4K1VA 3NV0A 3CCM3 1DYUA 2IY2A 4HVNA 3SX1A 1JN5B 1TUHA 3M8CA 2PNCA 3K63A 4MMXB 4XBTA 3DGOA 3SXXA 1OHOA 3JUNA 2OTJ3 1IVUA 2M7OA 1SPUA 1V74A 3CPW2 1RGEA 3DY5A 4WP5A 1W2B2 4HZ9B 4LEHA 3NX0A 1FUTA 2HMKB 4HM7B 4STDA 7GSPA 2BMOB 1BRKA 4EXRA 1ULIB 3KSED 1HZ1A 1W5ZA 1VQL3 2STDA 4XDVA 3DGMA 1KWIA 1LOVA 1OH0A 1I2FA 3RNTA 1B21A 4N6MA 2OWPA 1X1YA 3LT9A 2F5WA 1I3FA 1IVWA 2KAAA 1B2ZA 1ASKA 5AEWB 3NM7A 4N6UA 2GBXB 5M18A 1I2GA 1X1WA 1GMQA 1W02A 1JJ22 2CWTA 4OUQA 3FF2A 5EEOA 1BRSA 4EYCA 3Q1CA 1JV2B 1Q7HA 3IMAB 3PCRA 1OGXA 1B2MA 2K0MA 2W9QA 3WA3A 5IG4A 1RDSA 1FGMA 1X1UA 5TGNA 1QVG2 4WWUC 5CF1A 1FUSA 2WGOA 3D5GA 2C11A 1GOVA 2WOFA 3MWZA 4HZBB 3JUMA 4EV2A 1TRQA 3AHWA 9RNTA 5IEPA 1JBSA 1NNVA 2BO9B 1G0TA 3EN8A 4CDLA 3BLZA 3GAXA 2P09A 3AGOA 3GWRA 3JUQA 3GRDA 3DMCA 3KZTA 2E2VA 2W0QA 1BUJA 1GY5A 1PY3A 4LSOA 4ILFA 2CWVA 4N6LA 3UL5A 1AV4A 2W04A 3D79A 4N6TA 1VQK3 5CXOA 2KF6A 1W01A 1BRIA 1CQSA 2SARA 1BIRA 1PFPA 1ROAA 2WOHA 3NBJA 1FYSA 4EC6A 1Q40B 6STDA 1VQ73 1DMNA 3N8BA 1TJDA 3RGAA 1W2ZA 3X42A 2GU1A 1YIJ3 3EBTA 1A90A 1GY7A 3CD63 2CX0A 1VQ93 2IUJA 5BVBA 3D9RA 3QRDA 3AMOB 5A0OB 2W6JH 2JDIH 5D82A 4FCZA 3LYGA 4KFEA 1Z1SA 3EBYA 2KF3A 3JVCA 3NQZA 4EV5A 5BIRA 2HMNB 3LTAA 1UGIA 1LQGC 2KF4A 3KCHA 1BRHA 4WFOA 3F40A 5G1LA 2BT3A 1R4YA 3BNCA 1DETA 3CU3A 3GZYB 3FSDA 1B2SA 3K9MC 1IQXA 1EKMA 3OX9A 1B27A 3HOHA 3HIGA 3CCE3 1YJ93 3FLJA 3ALAA 3KN4A 1ZS7A 4R9LA 3FKAA 2XGNA 1Q9EA 4J5GA 1NU3A 1GY6A 3HX8A 4GHOA 4J9AA 1MWUA 2C10A 2CFWA 1N8QA 3SYUA 3PZWA 2XFTA 1LVNA 4H61A 4NHFA 1UCJA 2V1LA 1YVSA 2CH9A 5M19A 4WYKB 3BNEA 3X3YA 5IENA 5AIHA 4H3UA 1RGKA 4XM4A 3DH2A 1RN4A 3AMOA 1RSNA 2MC8A 1JKGA 1SJWA 3CCQ3 2QEX3 2J8XB 2Z7AA 1QVF2 3UNLA 5KP3A 3OXAA 3NXJA 1K28A 2CFGA 1L5GB 1MWRA 3SOAA 1S5AA 2CWUA 3J7Yd 1EA2A 2Y74A 2IYJA 1O7MB 2XR8B 2LYXA 8CHOA 1BNIA 3WMDA 5HOHA 1RGAA 1NWWA 2L4VA 3U1WA 1Q40A 1QJGA 1UCLA 4XBXA 3WODG 1RMSA 1VQP3 4KFDA 4GB5A 3NBRA 1NJI4 3KE7A 3UJMA 1ZX2A 4DKIA 6GSPA 1WQLB 1E3VA 1RRLA 3LH4A 3BB9A 1I70A 2OOVC 5AYRB 4FMCA 1AY7A 4LYLB 1DVDA 1TIJA 3EX9A 3CC43 3CPOA 4HM8B 1U8CB 5G2GA 3F7XA 3K7CA 1JRQA 1GMRA 5IERA 1KQS2 2UUGC 1M904 3KKGA 1IVXA 1RCLA 2FGTA 3CME3 2P0MA 2F99A 3JUOA 4I4KA 1KSIA 4R80A 1YHQ3 3AHSA 1RJOA 3X41A 4OVMA 2UGIA 2W56B 2F56A 3BU4A 2BHMA 1BNSA 1JZOA 3B8LA 3LT8A 1DMMA 2YFIB 1VQ53 4AEQA 1VQO3 1JB2A 1RNBA 5CLKA 1OCVA 1LNIA 4HM4B 3S5CA 1IV9A 1W6CA 1IV7A 1SARA 2CC3A 4WYKA 3CCR3 3LTDA 1RGFA 4O02B 2HMJB 3FH1A 2D42A 1RN1A 2K54A 4FR9A 3AGNA 5HGRA 1BNRA 4MEIA 4BTYA 5AYSC 1WNHA 3O8YA 3DM8A 1T5YA 1B3SA 8RNTA 3OWYA 2QA43 4R1KA 5EVHA 4XB5A 1HYFA 1OACA 3MPHA 3PXMA 2K3DA 2RCDA 5AI1A 4RNYA 3WA2X 4J5KA 1N9JA 4KT3B 1LOWA 5ELUA 5AIFA 1HKXA 3UB1A 3URPA 2F5MA 1YNVX 2GU3A 3DGYA 1O7HB 1LQMB 1BSEA 3LOYA 5STDA 2HMMB 4MJDA 1G02A 2Z76A 1CYUA 2GXFA 3MSOA 4BL3A 2FNQA 4FCMA 1V58A 1O7GB 1RGHA 3MG2A 3NUVA 1YI23 5JBSA 1A67A 1FGRA 1AVLA 1RGCA 1UCKA 1UCIA 1D6UA 2H0IA 3QK9A 3V98A 3FZWA 1VQN3 1OGZA 3EQQB 3KFQC 4NREA 2C4BA 1O7NB 5JPPA 1I0VA 2PZVA
chains in the Genus database with same CATH topology
4AKYA 2CK3H 3CCL3 2KCDA 3H3HA 3DGLA 4HM3B 5ELJA 2O9UX 4KVHA 3ER7A 5IG3A 4L7KA 1OHSA 3F14A 2ZDJA 4GL6A 4J8TA 1M1XB 1JB4A 1LNHA 3E99A 1U5OA 1S723 4QWTA 4O8SA 1JNQA 3MHEA 5IG0A 4LZIA 2YFJB 2Z77A 2KXGA 2BMRB 3BNBA 2CG1A 4O3VA 5D83A 4JRFA 4HM6B 1RRHA 3G0KA 1K734 3N9HA 4K1UA 1ZO2A 5AEUB 3DZLA 2O3OA 2OQEA 4WHAA 2RGQA 4HJLB 3K0ZA 4EBGA 3EB8A 1D6ZA 1A2VA 2GBWB 3NHXA 3F8XA 5DREA 1A2KA 2XSHB 7STDA 3X3XA 3G8ZA 1W00A 1UI7A 4N6NB 3RGRA 5IF6A 3STDA 3UL6A 2XGLA 4HM5B 3CNXA 1E3RA 3EJVA 4BTXA 1BUQA 1E97A 3MKIA 1D6YA 3LZAA 2CFDA 2CFKA 1R4CA 1O7WB 2IA7A 3PS8A 3SVAA 3T8NA 1Q7Y4 1GD3A 3B4OA 3CC73 2R4IA 3LMLA 4IT7A 4L8OA 1UW1A 4HBRA 3G4S3 4FMDA 1MNLA 2Z6BA 1OF5B 3EHCA 2OTL3 1WMNA 3CNMA 2A15A 1TFKA 2XFSA 3B4PA 4PEJA 3EC9A 4HYZA 1W7CA 1FA3A 3CC23 1ULJB 1IVVA 3VSYA 3OV4A 5LC7A 1RKYA 1NB5I 2UX0A 4N6V0 1CYVA 4OK0A 4TX4A 3T0UA 1Q42A 1AVKA 3U97A 4HM2B 5AIGA 1ROVA 4LMIA 2CKFB 1YJW3 1IK3A 2CG0A 3EE1A 3WOEB 2W9PA 1YIT3 5FGOA 4CCVA 1WMPA 2QGUA 3S29A 3OW22 3CCJ3 1KC84 4KZ1A 4MMZB 2RFRA 4JF8A 5D81A 3Q2PA 5EQLA 3SEDA 3HK4A 3FGYA 1Q814 2MF7A 1NO3A 1K41A 4Q53A 3SLUA 3X3ZA 1YGEA 3D3LA 2Y73A 1EQKA 1N5HA 3RDEA 2ML6A 2BNGA 2XEPA 4HKVB 2I9WA 2B1XB 1WTHA 2W2CA 1UUVB 1C7HA 2F98A 3FG1A 3EN1B 3Q90A 3G713 3PGBA 3EF8A 4L8PA 1QALA 4FMBA 1LXEA 1FGOA 2KRTA 3MYTA 3OWSA 4FCJA 1OF5A 4HM0B 4RBNA 4ZM8A 2XF3A 1M1K4 2RSXA 1MOLA 2D1WA 1QAKA 1W4NA 1VQ63 3LXUX 1VZZA 1N5PA 2HMOB 2F86B 2WO0A 3V92A 3I563 2ZL8A 1RN7A 1OHPA 3GZXB 3V99A 3TDGA 4G1MB 5IG5A 1WMOA 2FXTA 2XH9A 3KSPA 1UUWB 1N8R4 3LTCA 2CHCA 3CCS3 2W03A 1FUWA 4KFFA 2ML5A 4N6OB 2W56A 4N3VA 3DUKA 4XDWA 1W6YA 3MG3A 1US1A 1TP6A 2HMLB 1KD14 2CIUA 2Q07A 3IJEB 1TU5A 1Q824 3NM2A 1K9M4 1N9EA 4XBYA 4R4KA 4X2OA 1IT7A 3CCU3 5DRVA 3S27A 1NB3I 1YVBI 3HZPA 3WDGB 3LTBA 1STDA 3VF1A 1HU9A 1OUNA 3DXOA 1IDPA 4R9KA 5LC6A 1IU7A 3HIIA 4IPBA 2OQEC 1EG9B 2GEYA 2OCTA 3ECFA 3OWUA 2CW9A 4FMAA 1DMQA 2LQVA 5I97A 1GYBA 1CEWI 3G16A 1DVCA 1QMAA 5AIIA 1Y4KA 4IIAA 5IEOA 3F8HA 3FF0A 3N54B 1VQ83 2JQ5A 1M9GA 2WGQA 4X2HA 5KP1A 5CF2A 1K8A4 1PU4A 2BMQB 3FG4A 4K61A 1IQ8A 1SIIA 3S28A 5BXQA 3B7CA 3GZRA 4K90B 1QAFA 3F7SA 1YJN3 1OPYA 3BNDA 1JKGB 4RNZA 1ISKA 4U13A 2B24B 2OOVA 3VGNA 3F9SA 3CMA3 3WOFB 2INXA 1F8NA 2CFLA 3NBBA 1GS3A 2SBLA 3X40A 3NQYA 2IMJA 3MG1A 4RZMA 1W6GA 3I553 1TFOA 1JB5A 3T8UA 1IQYA 3H51A 3PYJA 4ORLA 3DGNA 1FGTA 1LOXA 1IT8A 1VQM3 1NDOB 1GD4A 1JN5A 2YFLB 5JPUA 1SIHA 1VQ43 3NV0B 3SOYA 3L0RA 3HI7A 4HM1B 2XRXB 3FCSB 3A76A 5FW5A 5IW9A 5CK6A 1SQWA 3ROBA 5KP4A 2IUKA 3JUPA 3K5TA 1G96A 3I0YA 1Q864 3GZBA 3KIIA 3CCV3 3IPTA 2P0XA 3CXC2 1O7PB 4BTWA 3FG3A 4MMYB 2P38A 1AR0A 1J2BA 3G6E3 1FGQA 3S67A 2QIYA 3PCSA 2P05A 2GEXA 4O2HA 1UI8A 4AKZA 1STFI 2XSOB 4LGQA 2E2TA 2E2UA 2YX9A 4K1VA 3NV0A 3CCM3 1DYUA 4HVNA 3SX1A 1JN5B 1TUHA 3M8CA 2PNCA 3K63A 4MMXB 4XBTA 3DGOA 3SXXA 1OHOA 3JUNA 2OTJ3 1IVUA 2M7OA 1SPUA 1V74A 3CPW2 4WP5A 3DY5A 1W2B2 4HZ9B 4LEHA 3NX0A 2HMKB 4HM7B 4STDA 2BMOB 4EXRA 1ULIB 3KSED 1W5ZA 1VQL3 2STDA 4XDVA 3DGMA 1KWIA 1OH0A 4N6MA 2OWPA 3LT9A 1IVWA 1ASKA 5AEWB 3NM7A 4N6UA 2GBXB 1W02A 1JJ22 2CWTA 4OUQA 3FF2A 5EEOA 4EYCA 3Q1CA 1JV2B 3IMAB 3PCRA 1OGXA 2K0MA 2W9QA 3WA3A 5IG4A 1FGMA 5TGNA 1QVG2 4WWUC 5CF1A 2WGOA 2C11A 3MWZA 2WOFA 4HZBB 3JUMA 4EV2A 5IEPA 2BO9B 3EN8A 4CDLA 3BLZA 3GAXA 2P09A 3GWRA 3JUQA 3GRDA 3DMCA 3KZTA 2E2VA 2W0QA 1GY5A 4LSOA 4N6LA 2CWVA 3UL5A 1AV4A 2W04A 4N6TA 1VQK3 5CXOA 1CQSA 1W01A 1PFPA 1ROAA 2WOHA 3NBJA 4EC6A 1Q40B 6STDA 1VQ73 1DMNA 3N8BA 3X42A 3RGAA 1W2ZA 1YIJ3 2GU1A 3EBTA 1A90A 1GY7A 3CD63 1VQ93 2IUJA 5BVBA 3D9RA 3QRDA 3AMOB 5A0OB 2W6JH 2JDIH 5D82A 4FCZA 3LYGA 4KFEA 1Z1SA 3EBYA 3JVCA 3NQZA 4EV5A 2HMNB 3LTAA 4WFOA 3F40A 2BT3A 3BNCA 3CU3A 3GZYB 3FSDA 3K9MC 1IQXA 1EKMA 3OX9A 3HIGA 3CCE3 1YJ93 3FLJA 3ALAA 3KN4A 4R9LA 3FKAA 2XGNA 1NU3A 1GY6A 3HX8A 4J9AA 2C10A 2CFWA 1N8QA 3PZWA 2XFTA 1LVNA 4H61A 4NHFA 2V1LA 2CH9A 4WYKB 3BNEA 3X3YA 5IENA 5AIHA 4H3UA 4XM4A 3AMOA 2MC8A 1JKGA 1SJWA 3CCQ3 2QEX3 1QVF2 2Z7AA 3UNLA 5KP3A 3OXAA 3NXJA 1K28A 2CFGA 1L5GB 3SOAA 1S5AA 2CWUA 3J7Yd 1EA2A 2Y74A 1O7MB 2XR8B 2LYXA 8CHOA 3WMDA 1NWWA 2L4VA 3U1WA 1Q40A 1QJGA 4XBXA 3WODG 1VQP3 4KFDA 4GB5A 3NBRA 1NJI4 3KE7A 3UJMA 1ZX2A 1WQLB 1E3VA 1RRLA 3LH4A 3BB9A 2OOVC 5AYRB 4FMCA 1DVDA 1TIJA 3EX9A 3CC43 3CPOA 4HM8B 1U8CB 5G2GA 3F7XA 3K7CA 1JRQA 5IERA 1KQS2 1M904 3KKGA 1IVXA 2FGTA 3CME3 2P0MA 2F99A 3JUOA 4I4KA 1KSIA 4R80A 1YHQ3 1RJOA 3X41A 4OVMA 2W56B 2BHMA 3LT8A 3B8LA 1DMMA 2YFIB 1VQ53 4AEQA 1VQO3 1JB2A 5CLKA 1OCVA 4HM4B 3S5CA 1IV9A 1W6CA 1IV7A 2CC3A 3CCR3 4WYKA 3LTDA 4O02B 2HMJB 3FH1A 2D42A 4FR9A 2K54A 5HGRA 4MEIA 4BTYA 5AYSC 1WNHA 3O8YA 3DM8A 1T5YA 3OWYA 2QA43 4R1KA 5EVHA 4XB5A 1OACA 3MPHA 3PXMA 5AI1A 2RCDA 4RNYA 3WA2X 1N9JA 5ELUA 5AIFA 1HKXA 3UB1A 2GU3A 3LOYA 1O7HB 5STDA 2HMMB 4MJDA 2Z76A 1CYUA 2GXFA 3MSOA 2FNQA 4FCMA 1O7GB 3MG2A 3NUVA 1YI23 5JBSA 1A67A 1FGRA 1AVLA 3V98A 1VQN3 3QK9A 1D6UA 3FZWA 1OGZA 3EQQB 3KFQC 4NREA 1O7NB 5JPPA 2PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BNG A;  4HKV B;  3ROB A;  3FSD A;  2I9W A;  2B1X B;  2W2C A;  1UUV B;  5KP4 A;  3H3H A;  3OX9 A;  1C7H A;  2F98 A;  4HM3 B;  3JUP A;  3EN1 B;  3Q90 A;  4KVH A;  3ER7 A;  3EF8 A;  4L8P A;  3I0Y A;  5IG3 A;  3FLJ A;  4L7K A;  1OHS A;  4R9L A;  3F14 A;  3MYT A;  3FKA A;  3OWS A;  1OF5 A;  4FCJ A;  4HM0 B;  3GZB A;  1NU3 A;  1GY6 A;  3HX8 A;  3IPT A;  4J8T A;  4J9A A;  1O7P B;  1VZZ A;  1JB4 A;  2HMO B;  3E99 A;  1AR0 A;  1U5O A;  2F86 B;  2QIY A;  3MHE A;  1OHP A;  3GZX B;  2GEX A;  5IG0 A;  4WYK B;  5IG5 A;  4XBY A;  5IEN A;  2YFJ B;  2Z77 A;  4H3U A;  5AIH A;  2XSO B;  2BMR B;  3KSP A;  4LGQ A;  1UUW B;  4XM4 A;  5D83 A;  1JKG A;  1SJW A;  2CHC A;  4HM6 B;  4K1V A;  3NV0 A;  2Z7A A;  3UNL A;  5KP3 A;  3G0K A;  3NXJ A;  3OXA A;  1JN5 B;  4HVN A;  3SOA A;  1S5A A;  1TUH A;  3M8C A;  3DUK A;  4N3V A;  1W6Y A;  1EA2 A;  3MG3 A;  1TP6 A;  4XBT A;  4K1U A;  1O7M B;  1ZO2 A;  2HML B;  1OHO A;  2XR8 B;  3DZL A;  5AEU B;  3JUN A;  3WMD A;  8CHO A;  1NWW A;  2RGQ A;  3K0Z A;  3NM2 A;  4HJL B;  4WP5 A;  1Q40 A;  4HZ9 B;  2GBW B;  4LEH A;  1QJG A;  2HMK B;  4HM7 B;  4STD A;  4X2O A;  3NHX A;  3F8X A;  4XBX A;  5DRV A;  5DRE A;  2BMO B;  4GB5 A;  3NBR A;  1A2K A;  2XSH B;  4XDW A;  3KE7 A;  7STD A;  3UJM A;  1ULI B;  1ZX2 A;  3HZP A;  3G8Z A;  1WQL B;  1W00 A;  1STD A;  3DXO A;  1OUN A;  3RGR A;  1E3V A;  1IDP A;  2STD A;  4R9K A;  3BB9 A;  4XDV A;  3STD A;  5IF6 A;  1OH0 A;  4HM5 B;  3CNX A;  1E3R A;  1EG9 B;  2GEY A;  3ECF A;  3EJV A;  2OWP A;  3OWU A;  1BUQ A;  1E97 A;  3MKI A;  1DMQ A;  3EX9 A;  3LZA A;  3CPO A;  4HM8 B;  5G2G A;  3F7X A;  1O7W B;  3K7C A;  1ASK A;  5IER A;  1GYB A;  3T8N A;  3G16 A;  3KKG A;  5AEW B;  3B4O A;  1QMA A;  5AII A;  2F99 A;  3JUO A;  2GBX B;  4I4K A;  2R4I A;  4IIA A;  4L8O A;  1W02 A;  3F8H A;  3FF0 A;  4OVM A;  5IEO A;  4OUQ A;  3FF2 A;  2JQ5 A;  4X2H A;  5KP1 A;  5CF2 A;  3B8L A;  1OGX A;  1OF5 B;  3EHC A;  5IG4 A;  1DMM A;  2YFI B;  5TGN A;  3CNM A;  2A15 A;  4WWU C;  1JB2 A;  2BMQ B;  5CLK A;  5CF1 A;  1OCV A;  4HZB B;  3JUM A;  3B4P A;  4PEJ A;  4HM4 B;  3S5C A;  3EC9 A;  5IEP A;  5BXQ A;  4WYK A;  3B7C A;  1ULJ B;  3EN8 A;  3GZR A;  3VSY A;  3BLZ A;  3F7S A;  1OPY A;  2HMJ B;  3FH1 A;  3OV4 A;  4CDL A;  2K54 A;  3GWR A;  3JUQ A;  1JKG B;  3GRD A;  5HGR A;  2UX0 A;  3DMC A;  3KZT A;  1ISK A;  4U13 A;  3DM8 A;  2B24 B;  1GY5 A;  3VGN A;  1Q42 A;  3F9S A;  3OWY A;  4HM2 B;  5AIG A;  4R1K A;  5EVH A;  4LMI A;  4XB5 A;  5AI1 A;  2CKF B;  2RCD A;  2INX A;  5CXO A;  1CQS A;  1W01 A;  1GS3 A;  1Q40 B;  2IMJ A;  6STD A;  1DMN A;  2QGU A;  1HKX A;  5AIF A;  3MG1 A;  4RZM A;  3RGA A;  1JB5 A;  3EBT A;  1GY7 A;  1O7H B;  3H51 A;  3T8U A;  2RFR A;  5D81 A;  5STD A;  2HMM B;  4MJD A;  5BVB A;  3SED A;  3D9R A;  4ORL A;  2Z76 A;  3HK4 A;  3FGY A;  2GXF A;  3MSO A;  5D82 A;  1NDO B;  3LYG A;  4FCM A;  1O7G B;  1K41 A;  1Z1S A;  1JN5 A;  2YFL B;  3EBY A;  3MG2 A;  3NUV A;  4Q53 A;  5JPU A;  2HMN B;  3NV0 B;  3SOY A;  3FZW A;  4HM1 B;  1OGZ A;  2XRX B;  3F40 A;  3EQQ B;  3A76 A;  5FW5 A;  5CK6 A;  1O7N B;  3CU3 A;  5JPP A;  3GZY B;  2PZV A; 
#chains in the Genus database with same CATH topology
 2RBI A;  1B2U A;  4AKY A;  2CK3 H;  1FW7 A;  3CCL 3;  2KCD A;  3H3H A;  3DGL A;  4HM3 B;  5ELJ A;  4CJN A;  2O9U X;  4KVH A;  3ER7 A;  5IG3 A;  4L7K A;  1OHS A;  3F14 A;  2ZDJ A;  4GL6 A;  4J8T A;  1TRP A;  1M1X B;  1C54 A;  1JB4 A;  1LNH A;  3E99 A;  1U5O A;  1S72 3;  2KF5 A;  4QWT A;  1IYY A;  4O8S A;  1JNQ A;  3MHE A;  5IG0 A;  1RCK A;  7RNT A;  1V57 A;  1I3I A;  2YFJ B;  1BAN A;  2Z77 A;  2KXG A;  4LZI A;  2BMR B;  3BNB A;  2CG1 A;  1RLS A;  4O3V A;  5D83 A;  4JRF A;  4HM6 B;  1RRH A;  3G0K A;  1K73 4;  3N9H A;  2L1S A;  4HAA A;  4K1U A;  1ZO2 A;  5AEU B;  3DZL A;  1AQZ A;  4CPK A;  2O3O A;  2OQE A;  1RHL A;  1MWS A;  2RGQ A;  3GSP A;  3K0Z A;  4HJL B;  4WHA A;  4EBG A;  3EB8 A;  1D6Z A;  1A2V A;  1UGH I;  2GBW B;  5BU4 A;  1TTO A;  3NHX A;  1B2X A;  3F8X A;  5DRE A;  1A2K A;  2XSH B;  2ZHX B;  7STD A;  5GSP A;  3X3X A;  3G8Z A;  1W00 A;  1UI7 A;  4N6N B;  3WR2 A;  3RGR A;  1BSC A;  5IF6 A;  3STD A;  3UL6 A;  3ZFZ A;  2XGL A;  3D5I A;  3CNX A;  1E3R A;  3EJV A;  4HM5 B;  4BTX A;  1BUQ A;  1BOX A;  1E97 A;  3MKI A;  1D6Y A;  3LZA A;  2CFD A;  2CFK A;  1R4C A;  1O7W B;  2IA7 A;  3PS8 A;  3SVA A;  3T8N A;  1Q7Y 4;  1GD3 A;  3B4O A;  3CC7 3;  1UUG B;  2R4I A;  1BRJ A;  1FZU A;  1RGL A;  2BIR A;  3LML A;  4IT7 A;  4L8O A;  1UW1 A;  4HBR A;  3ZG0 A;  3G4S 3;  4FMD A;  1MNL A;  2Z6B A;  1OF5 B;  3EHC A;  4BU4 A;  2OTL 3;  1WMN A;  3CNM A;  2A15 A;  1TFK A;  1BSA A;  1GMP A;  2XFS A;  3B4P A;  4PEJ A;  3EC9 A;  4HYZ A;  1ZGX A;  1W7C A;  1FA3 A;  3CC2 3;  1ULJ B;  1IVV A;  1I0X A;  3VSY A;  3OV4 A;  1UDI I;  5LC7 A;  1LOY A;  1RKY A;  1NB5 I;  2UX0 A;  4N6V 0;  1CYV A;  4OK0 A;  4TX4 A;  3T0U A;  1Q42 A;  1BNF A;  1AVK A;  1MGW A;  3U97 A;  4HM2 B;  5AIG A;  1BVI A;  1ROV A;  4LMI A;  2GSP A;  2CKF B;  1YJW 3;  1IK3 A;  1LRA A;  1MGR A;  2CG0 A;  3EE1 A;  1A2P A;  3WOE B;  2W9P A;  1YIT 3;  5FGO A;  4CCV A;  1WMP A;  2QGU A;  3S29 A;  3OW2 2;  3CCJ 3;  1KC8 4;  4KZ1 A;  4MMZ B;  3WHO A;  2RFR A;  4JF8 A;  5D81 A;  3Q2P A;  5EQL A;  3SED A;  3HK4 A;  3FGY A;  1Q81 4;  1JBR A;  2MF7 A;  1JBT A;  1JZD A;  1NO3 A;  1K41 A;  4Q53 A;  3SLU A;  3X3Z A;  1YGE A;  3D3L A;  1BNJ A;  2Y73 A;  1EQK A;  1N5H A;  3RDE A;  2ML6 A;  2BNG A;  2XEP A;  4HKV B;  2I9W A;  2B1X B;  1WTH A;  2W2C A;  1UUV B;  1C7H A;  2F98 A;  3FG1 A;  1VQQ A;  3EN1 B;  3Q90 A;  3G71 3;  3PGB A;  3EF8 A;  4L8P A;  1QAL A;  4FMB A;  1LXE A;  1FGO A;  2KRT A;  3MYT A;  3A5E A;  3OWS A;  1OF5 A;  4FCJ A;  4HM0 B;  4RBN A;  2XF3 A;  1PYL A;  1B20 A;  1RTU A;  2RSX A;  1MOL A;  2D1W A;  3BIR A;  1QAK A;  1W4N A;  4GSP A;  1VQ6 3;  3LXU X;  1VZZ A;  1N5P A;  2HMO B;  2F86 B;  2WO0 A;  3V92 A;  3I56 3;  2ZL8 A;  5M1A A;  1RN7 A;  1OHP A;  3GZX B;  3V99 A;  3TDG A;  4G1M B;  5IG5 A;  1WMO A;  2CX1 A;  2FXT A;  2XH9 A;  3KSP A;  1UUW B;  1N8R 4;  3LTC A;  1M1K 4;  2CHC A;  3CCS 3;  2W03 A;  1FUW A;  1BU4 A;  4KFF A;  3ZG5 A;  2ML5 A;  4EW5 A;  4N6O B;  2W56 A;  4N3V A;  3DUK A;  2AAE A;  1W6Y A;  3MG3 A;  1US1 A;  1TP6 A;  4XDW A;  2HML B;  1KD1 4;  2ZA4 A;  2CIU A;  2Q07 A;  3IJE B;  1TU5 A;  1Q82 4;  3NM2 A;  1K9M 4;  1N9E A;  4XBY A;  1GSP A;  4R4K A;  4X2O A;  1IT7 A;  3CCU 3;  5DRV A;  3S27 A;  1NB3 I;  1YVB I;  4BL2 A;  3HZP A;  3WDG B;  3LTB A;  1STD A;  3VF1 A;  1HU9 A;  1OUN A;  1T2I A;  1IDP A;  3DXO A;  4R9K A;  5LC6 A;  1IU7 A;  3HII A;  4IPB A;  1X1X A;  2OQE C;  1EG9 B;  2GEY A;  2OCT A;  3ECF A;  3OWU A;  2CW9 A;  4FMA A;  4BIR A;  1DMQ A;  6RNT A;  2LQV A;  5I97 A;  1GYB A;  1CEW I;  3G16 A;  1CH0 A;  1DVC A;  1QMA A;  5AII A;  1Y4K A;  4IIA A;  4RNT A;  1RGG A;  2HOH A;  5IEO A;  3F8H A;  3FF0 A;  3N54 B;  1VQ8 3;  2JQ5 A;  1M9G A;  2WGQ A;  4X2H A;  5KP1 A;  4HOH A;  5CF2 A;  1K8A 4;  3Q3F A;  1PU4 A;  2BMQ B;  3FG4 A;  2R41 A;  1IQ8 A;  1SII A;  4K61 A;  3S28 A;  5BXQ A;  3B7C A;  3GZR A;  4K90 B;  1QAF A;  1T2H A;  3F7S A;  1OPY A;  1MWT A;  3BND A;  2AAD A;  1YJN 3;  1JKG B;  4RNZ A;  1ISK A;  4U13 A;  4I5Q A;  2B24 B;  2OOV A;  3VGN A;  2H0H A;  3F9S A;  1BRG A;  1I8V A;  1BSB A;  1T3B A;  1EEJ A;  4NPB A;  3CMA 3;  3WOF B;  2INX A;  1F8N A;  1BGS A;  2CFL A;  3NBB A;  1GS3 A;  1YGW A;  2SBL A;  3X40 A;  2H0G A;  3NQY A;  2IMJ A;  3MG1 A;  4RZM A;  1W6G A;  3I55 3;  1TFO A;  1JB5 A;  3T8U A;  1IQY A;  3H51 A;  3PYJ A;  1BSD A;  4ORL A;  3DGN A;  2BU4 A;  1FGT A;  1LOX A;  1IT8 A;  1VQM 3;  1BNE A;  1NDO B;  1GD4 A;  1JN5 A;  2YFL B;  5JPU A;  1SIH A;  1VQ4 3;  3NV0 B;  3SOY A;  3L0R A;  3HI7 A;  4HM1 B;  2XRX B;  3FCS B;  3A76 A;  5FW5 A;  5IW9 A;  5CK6 A;  1SQW A;  3ROB A;  4ZM8 A;  5KP4 A;  2IUK A;  1BRN L;  3JUP A;  1RNT A;  3K5T A;  1G96 A;  3I0Y A;  1Q86 4;  1I2E A;  3GZB A;  3D4A A;  3KII A;  3CCV 3;  3IPT A;  2P0X A;  3CXC 2;  1DE3 A;  1GOU A;  1BAO A;  1O7P B;  3FG3 A;  2P38 A;  4MMY B;  1AR0 A;  4BTW A;  1J2B A;  3G6E 3;  5G1K A;  1FGQ A;  3S67 A;  1EUI C;  2QIY A;  1GOY A;  3PCS A;  2RNT A;  2P05 A;  2GEX A;  4O2H A;  1UI8 A;  1BNG A;  5RNT A;  4AKZ A;  2F4Y A;  1STF I;  2XSO B;  4LGQ A;  2E2T A;  2E2U A;  2YX9 A;  4K1V A;  3NV0 A;  3CCM 3;  1DYU A;  2IY2 A;  4HVN A;  3SX1 A;  1JN5 B;  1TUH A;  3M8C A;  2PNC A;  3K63 A;  4MMX B;  4XBT A;  3DGO A;  3SXX A;  1OHO A;  3JUN A;  2OTJ 3;  1IVU A;  2M7O A;  1SPU A;  1V74 A;  3CPW 2;  1RGE A;  3DY5 A;  4WP5 A;  1W2B 2;  4HZ9 B;  4LEH A;  3NX0 A;  1FUT A;  2HMK B;  4HM7 B;  4STD A;  7GSP A;  2BMO B;  1BRK A;  4EXR A;  1ULI B;  3KSE D;  1HZ1 A;  1W5Z A;  1VQL 3;  2STD A;  4XDV A;  3DGM A;  1KWI A;  1LOV A;  1OH0 A;  1I2F A;  3RNT A;  1B21 A;  4N6M A;  2OWP A;  1X1Y A;  3LT9 A;  2F5W A;  1I3F A;  1IVW A;  2KAA A;  1B2Z A;  1ASK A;  5AEW B;  3NM7 A;  4N6U A;  2GBX B;  5M18 A;  1I2G A;  1X1W A;  1GMQ A;  1W02 A;  1JJ2 2;  2CWT A;  4OUQ A;  3FF2 A;  5EEO A;  1BRS A;  4EYC A;  3Q1C A;  1JV2 B;  1Q7H A;  3IMA B;  3PCR A;  1OGX A;  1B2M A;  2K0M A;  2W9Q A;  3WA3 A;  5IG4 A;  1RDS A;  1FGM A;  1X1U A;  5TGN A;  1QVG 2;  4WWU C;  5CF1 A;  1FUS A;  2WGO A;  3D5G A;  2C11 A;  1GOV A;  2WOF A;  3MWZ A;  4HZB B;  3JUM A;  4EV2 A;  1TRQ A;  3AHW A;  9RNT A;  5IEP A;  1JBS A;  1NNV A;  2BO9 B;  1G0T A;  3EN8 A;  4CDL A;  3BLZ A;  3GAX A;  2P09 A;  3AGO A;  3GWR A;  3JUQ A;  3GRD A;  3DMC A;  3KZT A;  2E2V A;  2W0Q A;  1BUJ A;  1GY5 A;  1PY3 A;  4LSO A;  4ILF A;  2CWV A;  4N6L A;  3UL5 A;  1AV4 A;  2W04 A;  3D79 A;  4N6T A;  1VQK 3;  5CXO A;  2KF6 A;  1W01 A;  1BRI A;  1CQS A;  2SAR A;  1BIR A;  1PFP A;  1ROA A;  2WOH A;  3NBJ A;  1FYS A;  4EC6 A;  1Q40 B;  6STD A;  1VQ7 3;  1DMN A;  3N8B A;  1TJD A;  3RGA A;  1W2Z A;  3X42 A;  2GU1 A;  1YIJ 3;  3EBT A;  1A90 A;  1GY7 A;  3CD6 3;  2CX0 A;  1VQ9 3;  2IUJ A;  5BVB A;  3D9R A;  3QRD A;  3AMO B;  5A0O B;  2W6J H;  2JDI H;  5D82 A;  4FCZ A;  3LYG A;  4KFE A;  1Z1S A;  3EBY A;  2KF3 A;  3JVC A;  3NQZ A;  4EV5 A;  5BIR A;  2HMN B;  3LTA A;  1UGI A;  1LQG C;  2KF4 A;  3KCH A;  1BRH A;  4WFO A;  3F40 A;  5G1L A;  2BT3 A;  1R4Y A;  3BNC A;  1DET A;  3CU3 A;  3GZY B;  3FSD A;  1B2S A;  3K9M C;  1IQX A;  1EKM A;  3OX9 A;  1B27 A;  3HOH A;  3HIG A;  3CCE 3;  1YJ9 3;  3FLJ A;  3ALA A;  3KN4 A;  1ZS7 A;  4R9L A;  3FKA A;  2XGN A;  1Q9E A;  4J5G A;  1NU3 A;  1GY6 A;  3HX8 A;  4GHO A;  4J9A A;  1MWU A;  2C10 A;  2CFW A;  1N8Q A;  3SYU A;  3PZW A;  2XFT A;  1LVN A;  4H61 A;  4NHF A;  1UCJ A;  2V1L A;  1YVS A;  2CH9 A;  5M19 A;  4WYK B;  3BNE A;  3X3Y A;  5IEN A;  5AIH A;  4H3U A;  1RGK A;  4XM4 A;  3DH2 A;  1RN4 A;  3AMO A;  1RSN A;  2MC8 A;  1JKG A;  1SJW A;  3CCQ 3;  2QEX 3;  2J8X B;  2Z7A A;  1QVF 2;  3UNL A;  5KP3 A;  3OXA A;  3NXJ A;  1K28 A;  2CFG A;  1L5G B;  1MWR A;  3SOA A;  1S5A A;  2CWU A;  3J7Y d;  1EA2 A;  2Y74 A;  2IYJ A;  1O7M B;  2XR8 B;  2LYX A;  8CHO A;  1BNI A;  3WMD A;  5HOH A;  1RGA A;  1NWW A;  2L4V A;  3U1W A;  1Q40 A;  1QJG A;  1UCL A;  4XBX A;  3WOD G;  1RMS A;  1VQP 3;  4KFD A;  4GB5 A;  3NBR A;  1NJI 4;  3KE7 A;  3UJM A;  1ZX2 A;  4DKI A;  6GSP A;  1WQL B;  1E3V A;  1RRL A;  3LH4 A;  3BB9 A;  1I70 A;  2OOV C;  5AYR B;  4FMC A;  1AY7 A;  4LYL B;  1DVD A;  1TIJ A;  3EX9 A;  3CC4 3;  3CPO A;  4HM8 B;  1U8C B;  5G2G A;  3F7X A;  3K7C A;  1JRQ A;  1GMR A;  5IER A;  1KQS 2;  2UUG C;  1M90 4;  3KKG A;  1IVX A;  1RCL A;  2FGT A;  3CME 3;  2P0M A;  2F99 A;  3JUO A;  4I4K A;  1KSI A;  4R80 A;  1YHQ 3;  3AHS A;  1RJO A;  3X41 A;  4OVM A;  2UGI A;  2W56 B;  2F56 A;  3BU4 A;  2BHM A;  1BNS A;  1JZO A;  3B8L A;  3LT8 A;  1DMM A;  2YFI B;  1VQ5 3;  4AEQ A;  1VQO 3;  1JB2 A;  1RNB A;  5CLK A;  1OCV A;  1LNI A;  4HM4 B;  3S5C A;  1IV9 A;  1W6C A;  1IV7 A;  1SAR A;  2CC3 A;  4WYK A;  3CCR 3;  3LTD A;  1RGF A;  4O02 B;  2HMJ B;  3FH1 A;  2D42 A;  1RN1 A;  2K54 A;  4FR9 A;  3AGN A;  5HGR A;  1BNR A;  4MEI A;  4BTY A;  5AYS C;  1WNH A;  3O8Y A;  3DM8 A;  1T5Y A;  1B3S A;  8RNT A;  3OWY A;  2QA4 3;  4R1K A;  5EVH A;  4XB5 A;  1HYF A;  1OAC A;  3MPH A;  3PXM A;  2K3D A;  2RCD A;  5AI1 A;  4RNY A;  3WA2 X;  4J5K A;  1N9J A;  4KT3 B;  1LOW A;  5ELU A;  5AIF A;  1HKX A;  3UB1 A;  3URP A;  2F5M A;  1YNV X;  2GU3 A;  3DGY A;  1O7H B;  1LQM B;  1BSE A;  3LOY A;  5STD A;  2HMM B;  4MJD A;  1G02 A;  2Z76 A;  1CYU A;  2GXF A;  3MSO A;  4BL3 A;  2FNQ A;  4FCM A;  1V58 A;  1O7G B;  1RGH A;  3MG2 A;  3NUV A;  1YI2 3;  5JBS A;  1A67 A;  1FGR A;  1AVL A;  1RGC A;  1UCK A;  1UCI A;  1D6U A;  2H0I A;  3QK9 A;  3V98 A;  3FZW A;  1VQN 3;  1OGZ A;  3EQQ B;  3KFQ C;  4NRE A;  2C4B A;  1O7N B;  5JPP A;  1I0V A;  2PZV A; 
#chains in the Genus database with same CATH homology
 4AKY A;  2CK3 H;  3CCL 3;  2KCD A;  3H3H A;  3DGL A;  4HM3 B;  5ELJ A;  2O9U X;  4KVH A;  3ER7 A;  5IG3 A;  4L7K A;  1OHS A;  3F14 A;  2ZDJ A;  4GL6 A;  4J8T A;  1M1X B;  1JB4 A;  1LNH A;  3E99 A;  1U5O A;  1S72 3;  4QWT A;  4O8S A;  1JNQ A;  3MHE A;  5IG0 A;  4LZI A;  2YFJ B;  2Z77 A;  2KXG A;  2BMR B;  3BNB A;  2CG1 A;  4O3V A;  5D83 A;  4JRF A;  4HM6 B;  1RRH A;  3G0K A;  1K73 4;  3N9H A;  4K1U A;  1ZO2 A;  5AEU B;  3DZL A;  2O3O A;  2OQE A;  4WHA A;  2RGQ A;  4HJL B;  3K0Z A;  4EBG A;  3EB8 A;  1D6Z A;  1A2V A;  2GBW B;  3NHX A;  3F8X A;  5DRE A;  1A2K A;  2XSH B;  7STD A;  3X3X A;  3G8Z A;  1W00 A;  1UI7 A;  4N6N B;  3RGR A;  5IF6 A;  3STD A;  3UL6 A;  2XGL A;  4HM5 B;  3CNX A;  1E3R A;  3EJV A;  4BTX A;  1BUQ A;  1E97 A;  3MKI A;  1D6Y A;  3LZA A;  2CFD A;  2CFK A;  1R4C A;  1O7W B;  2IA7 A;  3PS8 A;  3SVA A;  3T8N A;  1Q7Y 4;  1GD3 A;  3B4O A;  3CC7 3;  2R4I A;  3LML A;  4IT7 A;  4L8O A;  1UW1 A;  4HBR A;  3G4S 3;  4FMD A;  1MNL A;  2Z6B A;  1OF5 B;  3EHC A;  2OTL 3;  1WMN A;  3CNM A;  2A15 A;  1TFK A;  2XFS A;  3B4P A;  4PEJ A;  3EC9 A;  4HYZ A;  1W7C A;  1FA3 A;  3CC2 3;  1ULJ B;  1IVV A;  3VSY A;  3OV4 A;  5LC7 A;  1RKY A;  1NB5 I;  2UX0 A;  4N6V 0;  1CYV A;  4OK0 A;  4TX4 A;  3T0U A;  1Q42 A;  1AVK A;  3U97 A;  4HM2 B;  5AIG A;  1ROV A;  4LMI A;  2CKF B;  1YJW 3;  1IK3 A;  2CG0 A;  3EE1 A;  3WOE B;  2W9P A;  1YIT 3;  5FGO A;  4CCV A;  1WMP A;  2QGU A;  3S29 A;  3OW2 2;  3CCJ 3;  1KC8 4;  4KZ1 A;  4MMZ B;  2RFR A;  4JF8 A;  5D81 A;  3Q2P A;  5EQL A;  3SED A;  3HK4 A;  3FGY A;  1Q81 4;  2MF7 A;  1NO3 A;  1K41 A;  4Q53 A;  3SLU A;  3X3Z A;  1YGE A;  3D3L A;  2Y73 A;  1EQK A;  1N5H A;  3RDE A;  2ML6 A;  2BNG A;  2XEP A;  4HKV B;  2I9W A;  2B1X B;  1WTH A;  2W2C A;  1UUV B;  1C7H A;  2F98 A;  3FG1 A;  3EN1 B;  3Q90 A;  3G71 3;  3PGB A;  3EF8 A;  4L8P A;  1QAL A;  4FMB A;  1LXE A;  1FGO A;  2KRT A;  3MYT A;  3OWS A;  4FCJ A;  1OF5 A;  4HM0 B;  4RBN A;  4ZM8 A;  2XF3 A;  1M1K 4;  2RSX A;  1MOL A;  2D1W A;  1QAK A;  1W4N A;  1VQ6 3;  3LXU X;  1VZZ A;  1N5P A;  2HMO B;  2F86 B;  2WO0 A;  3V92 A;  3I56 3;  2ZL8 A;  1RN7 A;  1OHP A;  3GZX B;  3V99 A;  3TDG A;  4G1M B;  5IG5 A;  1WMO A;  2FXT A;  2XH9 A;  3KSP A;  1UUW B;  1N8R 4;  3LTC A;  2CHC A;  3CCS 3;  2W03 A;  1FUW A;  4KFF A;  2ML5 A;  4N6O B;  2W56 A;  4N3V A;  3DUK A;  4XDW A;  1W6Y A;  3MG3 A;  1US1 A;  1TP6 A;  2HML B;  1KD1 4;  2CIU A;  2Q07 A;  3IJE B;  1TU5 A;  1Q82 4;  3NM2 A;  1K9M 4;  1N9E A;  4XBY A;  4R4K A;  4X2O A;  1IT7 A;  3CCU 3;  5DRV A;  3S27 A;  1NB3 I;  1YVB I;  3HZP A;  3WDG B;  3LTB A;  1STD A;  3VF1 A;  1HU9 A;  1OUN A;  3DXO A;  1IDP A;  4R9K A;  5LC6 A;  1IU7 A;  3HII A;  4IPB A;  2OQE C;  1EG9 B;  2GEY A;  2OCT A;  3ECF A;  3OWU A;  2CW9 A;  4FMA A;  1DMQ A;  2LQV A;  5I97 A;  1GYB A;  1CEW I;  3G16 A;  1DVC A;  1QMA A;  5AII A;  1Y4K A;  4IIA A;  5IEO A;  3F8H A;  3FF0 A;  3N54 B;  1VQ8 3;  2JQ5 A;  1M9G A;  2WGQ A;  4X2H A;  5KP1 A;  5CF2 A;  1K8A 4;  1PU4 A;  2BMQ B;  3FG4 A;  4K61 A;  1IQ8 A;  1SII A;  3S28 A;  5BXQ A;  3B7C A;  3GZR A;  4K90 B;  1QAF A;  3F7S A;  1YJN 3;  1OPY A;  3BND A;  1JKG B;  4RNZ A;  1ISK A;  4U13 A;  2B24 B;  2OOV A;  3VGN A;  3F9S A;  3CMA 3;  3WOF B;  2INX A;  1F8N A;  2CFL A;  3NBB A;  1GS3 A;  2SBL A;  3X40 A;  3NQY A;  2IMJ A;  3MG1 A;  4RZM A;  1W6G A;  3I55 3;  1TFO A;  1JB5 A;  3T8U A;  1IQY A;  3H51 A;  3PYJ A;  4ORL A;  3DGN A;  1FGT A;  1LOX A;  1IT8 A;  1VQM 3;  1NDO B;  1GD4 A;  1JN5 A;  2YFL B;  5JPU A;  1SIH A;  1VQ4 3;  3NV0 B;  3SOY A;  3L0R A;  3HI7 A;  4HM1 B;  2XRX B;  3FCS B;  3A76 A;  5FW5 A;  5IW9 A;  5CK6 A;  1SQW A;  3ROB A;  5KP4 A;  2IUK A;  3JUP A;  3K5T A;  1G96 A;  3I0Y A;  1Q86 4;  3GZB A;  3KII A;  3CCV 3;  3IPT A;  2P0X A;  3CXC 2;  1O7P B;  4BTW A;  3FG3 A;  4MMY B;  2P38 A;  1AR0 A;  1J2B A;  3G6E 3;  1FGQ A;  3S67 A;  2QIY A;  3PCS A;  2P05 A;  2GEX A;  4O2H A;  1UI8 A;  4AKZ A;  1STF I;  2XSO B;  4LGQ A;  2E2T A;  2E2U A;  2YX9 A;  4K1V A;  3NV0 A;  3CCM 3;  1DYU A;  4HVN A;  3SX1 A;  1JN5 B;  1TUH A;  3M8C A;  2PNC A;  3K63 A;  4MMX B;  4XBT A;  3DGO A;  3SXX A;  1OHO A;  3JUN A;  2OTJ 3;  1IVU A;  2M7O A;  1SPU A;  1V74 A;  3CPW 2;  4WP5 A;  3DY5 A;  1W2B 2;  4HZ9 B;  4LEH A;  3NX0 A;  2HMK B;  4HM7 B;  4STD A;  2BMO B;  4EXR A;  1ULI B;  3KSE D;  1W5Z A;  1VQL 3;  2STD A;  4XDV A;  3DGM A;  1KWI A;  1OH0 A;  4N6M A;  2OWP A;  3LT9 A;  1IVW A;  1ASK A;  5AEW B;  3NM7 A;  4N6U A;  2GBX B;  1W02 A;  1JJ2 2;  2CWT A;  4OUQ A;  3FF2 A;  5EEO A;  4EYC A;  3Q1C A;  1JV2 B;  3IMA B;  3PCR A;  1OGX A;  2K0M A;  2W9Q A;  3WA3 A;  5IG4 A;  1FGM A;  5TGN A;  1QVG 2;  4WWU C;  5CF1 A;  2WGO A;  2C11 A;  3MWZ A;  2WOF A;  4HZB B;  3JUM A;  4EV2 A;  5IEP A;  2BO9 B;  3EN8 A;  4CDL A;  3BLZ A;  3GAX A;  2P09 A;  3GWR A;  3JUQ A;  3GRD A;  3DMC A;  3KZT A;  2E2V A;  2W0Q A;  1GY5 A;  4LSO A;  4N6L A;  2CWV A;  3UL5 A;  1AV4 A;  2W04 A;  4N6T A;  1VQK 3;  5CXO A;  1CQS A;  1W01 A;  1PFP A;  1ROA A;  2WOH A;  3NBJ A;  4EC6 A;  1Q40 B;  6STD A;  1VQ7 3;  1DMN A;  3N8B A;  3X42 A;  3RGA A;  1W2Z A;  1YIJ 3;  2GU1 A;  3EBT A;  1A90 A;  1GY7 A;  3CD6 3;  1VQ9 3;  2IUJ A;  5BVB A;  3D9R A;  3QRD A;  3AMO B;  5A0O B;  2W6J H;  2JDI H;  5D82 A;  4FCZ A;  3LYG A;  4KFE A;  1Z1S A;  3EBY A;  3JVC A;  3NQZ A;  4EV5 A;  2HMN B;  3LTA A;  4WFO A;  3F40 A;  2BT3 A;  3BNC A;  3CU3 A;  3GZY B;  3FSD A;  3K9M C;  1IQX A;  1EKM A;  3OX9 A;  3HIG A;  3CCE 3;  1YJ9 3;  3FLJ A;  3ALA A;  3KN4 A;  4R9L A;  3FKA A;  2XGN A;  1NU3 A;  1GY6 A;  3HX8 A;  4J9A A;  2C10 A;  2CFW A;  1N8Q A;  3PZW A;  2XFT A;  1LVN A;  4H61 A;  4NHF A;  2V1L A;  2CH9 A;  4WYK B;  3BNE A;  3X3Y A;  5IEN A;  5AIH A;  4H3U A;  4XM4 A;  3AMO A;  2MC8 A;  1JKG A;  1SJW A;  3CCQ 3;  2QEX 3;  1QVF 2;  2Z7A A;  3UNL A;  5KP3 A;  3OXA A;  3NXJ A;  1K28 A;  2CFG A;  1L5G B;  3SOA A;  1S5A A;  2CWU A;  3J7Y d;  1EA2 A;  2Y74 A;  1O7M B;  2XR8 B;  2LYX A;  8CHO A;  3WMD A;  1NWW A;  2L4V A;  3U1W A;  1Q40 A;  1QJG A;  4XBX A;  3WOD G;  1VQP 3;  4KFD A;  4GB5 A;  3NBR A;  1NJI 4;  3KE7 A;  3UJM A;  1ZX2 A;  1WQL B;  1E3V A;  1RRL A;  3LH4 A;  3BB9 A;  2OOV C;  5AYR B;  4FMC A;  1DVD A;  1TIJ A;  3EX9 A;  3CC4 3;  3CPO A;  4HM8 B;  1U8C B;  5G2G A;  3F7X A;  3K7C A;  1JRQ A;  5IER A;  1KQS 2;  1M90 4;  3KKG A;  1IVX A;  2FGT A;  3CME 3;  2P0M A;  2F99 A;  3JUO A;  4I4K A;  1KSI A;  4R80 A;  1YHQ 3;  1RJO A;  3X41 A;  4OVM A;  2W56 B;  2BHM A;  3LT8 A;  3B8L A;  1DMM A;  2YFI B;  1VQ5 3;  4AEQ A;  1VQO 3;  1JB2 A;  5CLK A;  1OCV A;  4HM4 B;  3S5C A;  1IV9 A;  1W6C A;  1IV7 A;  2CC3 A;  3CCR 3;  4WYK A;  3LTD A;  4O02 B;  2HMJ B;  3FH1 A;  2D42 A;  4FR9 A;  2K54 A;  5HGR A;  4MEI A;  4BTY A;  5AYS C;  1WNH A;  3O8Y A;  3DM8 A;  1T5Y A;  3OWY A;  2QA4 3;  4R1K A;  5EVH A;  4XB5 A;  1OAC A;  3MPH A;  3PXM A;  5AI1 A;  2RCD A;  4RNY A;  3WA2 X;  1N9J A;  5ELU A;  5AIF A;  1HKX A;  3UB1 A;  2GU3 A;  3LOY A;  1O7H B;  5STD A;  2HMM B;  4MJD A;  2Z76 A;  1CYU A;  2GXF A;  3MSO A;  2FNQ A;  4FCM A;  1O7G B;  3MG2 A;  3NUV A;  1YI2 3;  5JBS A;  1A67 A;  1FGR A;  1AVL A;  3V98 A;  1VQN 3;  3QK9 A;  1D6U A;  3FZW A;  1OGZ A;  3EQQ B;  3KFQ C;  4NRE A;  1O7N B;  5JPP A;  2PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...