3T8UA

Crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
MNTPEHMTAVVQRAVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIAHFRFNGAGKVVSMRALFGEKNIHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8uA00
4HZBB 4HVNA 5AI1A 3FZWA 4K1VA 3NV0B 3KZTA 4FCJA 3F40A 2QIYA 4GB5A 4X2HA 3KE7A 1OF5A 1JN5A 2OWPA 4HM5B 4PEJA 4WWUC 5AIGA 3HK4A 3CPOA 3CNMA 5DREA 1AR0A 1ULIB 2BMRB 2HMNB 1OUNA 3FSDA 1W6YA 4MJDA 1OF5B 5EVHA 3DM8A 3WMDA 3GZBA 1TP6A 3OV4A 3F14A 3B7CA 3EC9A 2W2CA 1EG9B 1OGXA 1Q42A 5IENA 2BMOB 1GY7A 1OCVA 1STDA 4OVMA 4KVHA 3JUOA 1OHSA 3LYGA 3I0YA 3SEDA 1A2KA 2XR8B 1OH0A 4XB5A 3UNLA 4XDWA 2HMKB 1NDOB 2GBWB 4HM8B 3OXAA 4XBXA 3STDA 1QJGA 2GBXB 3HX8A 1DMQA 1SJWA 4WYKA 5IG4A 3NBRA 4R9LA 3DUKA 4HM4B 2HMOB 1ISKA 1EA2A 2XRXB 4HM2B 4LGQA 1JB4A 1W01A 2PZVA 3B8LA 2YFIB 2STDA 3DXOA 2CKFB 1O7MB 5AEUB 4WYKB 5AIIA 3GZYB 2XSHB 3NV0A 5KP4A 1S5AA 4Q53A 7STDA 1VZZA 3OWYA 4U13A 3NM2A 3NUVA 4XBYA 3ER7A 3Q90A 5IG3A 2YFJB 3BLZA 1O7PB 3FF0A 3EBTA 1DMMA 4ORLA 2F86B 3EN1B 3GRDA 1IDPA 1OGZA 2GXFA 3B4OA 3BB9A 3FF2A 5IF6A 4HM1B 3CNXA 4CDLA 3F8HA 1JB5A 2XSOB 5KP1A 2JQ5A 5BVBA 5AEWB 3GWRA 1NU3A 1WQLB 2GEXA 3FLJA 3H3HA 1GYBA 3DZLA 5IEPA 5HGRA 3F8XA 4IIAA 3EQQB 4RZMA 2A15A 3JUQA 1K41A 1NWWA 3EX9A 2F98A 3ECFA 3JUPA 4L8OA 3G8ZA 3OWSA 1E3RA 3G0KA 4K1UA 2HMMB 2RFRA 3EF8A 3FGYA 5DRVA 4OUQA 3EJVA 2Z76A 3VGNA 3EBYA 1GY6A 1ULJB 3A76A 3K7CA 1GS3A 5CF1A 3E99A 4XBTA 1O7NB 2RGQA 4STDA 3MHEA 5G2GA 5CF2A 3UJMA 1UUVB 3EHCA 5FW5A 3SOYA 5TGNA 5IG0A 3SOAA 3MG3A 2CHCA 2BNGA 4LMIA 1C7HA 1O7HB 3MG1A 5CXOA 3KSPA 1JB2A 3MKIA 8CHOA 1O7WB 3NHXA 3OX9A 3NXJA 1JKGB 3D9RA 4HKVB 3RGAA 4LEHA 3S5CA 1W02A 1GY5A 2BMQB 3EN8A 3T8UA 3MG2A 1ZX2A 4H3UA 4HJLB 4J9AA 2IMJA 5JPPA 5D81A 3K0ZA 3DMCA 4XM4A 2QGUA 2B1XB 4J8TA 5AIHA 4HM6B 1DMNA 4HM0B 5AIFA 1CQSA 5STDA 1ZO2A 4I4KA 3KKGA 1JN5B 1OPYA 3IPTA 2I9WA 1QMAA 3MYTA 3F9SA 3HZPA 4XDVA 2K54A 1Z1SA 2Z77A 4HM7B 6STDA 3FH1A 5CK6A 2HMLB 1ASKA 4FCMA 1UUWB 3OWUA 5D82A 3H51A 5IEOA 1BUQA 5CLKA 1OHPA 3JUMA 4L7KA 3GZXB 3RGRA 2RCDA 3F7XA 2GEYA 3T8NA 2F99A 4HM3B 1OHOA 3M8CA 3B4PA 1E3VA 2B24B 3GZRA 4WP5A 5IG5A 2INXA 3VSYA 4R9KA 3ROBA 1JKGA 4HZ9B 1Q40A 5BXQA 4R1KA 1U5OA 3G16A 5IERA 2UX0A 1W00A 1E97A 3LZAA 3FKAA 4N3VA 3JUNA 5JPUA 3F7SA 3CU3A 2R4IA 5KP3A 4X2OA 1Q40B 1O7GB 2HMJB 2YFLB 3MSOA 4L8PA 1TUHA 1HKXA 5D83A 2Z7AA
chains in the Genus database with same CATH superfamily
1R4CA 3BNEA 2H0IA 1V57A 3AGOA 4HZBB 1UCJA 4HVNA 2AADA 5AI1A 3FZWA 3MWZA 1SARA 2IUKA 1VQ93 4O02B 4K1VA 3NV0B 1M904 1LQGC 1RN7A 3KZTA 4CPKA 4FCJA 1BNIA 1IQYA 1NO3A 3F40A 2QIYA 4GB5A 1JZOA 2XF3A 4X2HA 3KE7A 1N8R4 1KD14 1OF5A 3LT9A 2L4VA 1WNHA 3LTAA 2BT3A 2W56B 3EB8A 1JN5A 2OWPA 1B21A 4NREA 1BRNL 1LVNA 2CWVA 3AMOB 4AKZA 4MEIA 4HM5B 4PEJA 4WWUC 5AIGA 2IY2A 2O9UX 3HK4A 3KCHA 3CPOA 3CNMA 3PXMA 5DREA 4FMBA 1AR0A 1BRKA 3WDGB 3FG1A 1ULIB 1IQ8A 2BMRB 2HMNB 1OUNA 3FSDA 2QEX3 1W6YA 1NB5I 1NB3I 3VF1A 4MJDA 1NJI4 3V92A 3LXUX 3D79A 1OF5B 5M19A 1IVWA 1UCIA 2KRTA 1RRHA 5EVHA 3DM8A 2CFKA 3WMDA 2J8XB 3CCM3 3GZBA 1TP6A 1ROVA 3OV4A 1W7CA 2CC3A 2IA7A 3F14A 4FR9A 1RGCA 3B7CA 3X3XA 3NQYA 4KFFA 1B2SA 1RGEA 3EC9A 1M9GA 3D5GA 5LC7A 2W2CA 1EG9B 1OGXA 2F5WA 3DGNA 1Q42A 1BNGA 5IENA 2BMOB 1BRHA 1GY7A 3CCR3 1OCVA 1VQ73 3ALAA 2CH9A 2W03A 1I3IA 2W6JH 1STDA 1PFPA 4OVMA 1UI7A 3JUOA 4KVHA 3CME3 3CCL3 1OHSA 1STFI 1YJW3 1GMRA 1VQ53 1UGHI 1LRAA 3LYGA 3I0YA 5EEOA 3SEDA 2H0HA 2XH9A 2CX1A 1A2VA 3NBBA 1RN1A 2BO9B 2XEPA 1A2KA 2XR8B 1OH0A 1LOXA 4XB5A 1T5YA 3NBJA 4BU4A 3UNLA 3DH2A 1MGRA 5EQLA 4XDWA 3U1WA 1RJOA 1BAOA 2HMKB 3D3LA 1NDOB 1Q9EA 1U8CB 2GBWB 3OXAA 4HM8B 4XBXA 5ELJA 3STDA 1QJGA 2GU3A 2RSXA 2GBXB 3HX8A 3LTCA 2ZA4A 1DMQA 4EXRA 1SJWA 4NHFA 1DE3A 1LOWA 4WYKA 1IU7A 5IG4A 2OCTA 5IW9A 1S723 5JBSA 3GAXA 1Q864 1DYUA 3NBRA 4R9LA 3K63A 3CD63 3DUKA 1CEWI 4N6V0 3FG4A 6RNTA 1IVXA 4HM4B 4LZIA 1FUTA 2HMOB 1ISKA 1EA2A 3HIIA 2XRXB 1KSIA 4HM2B 1I3FA 4LGQA 3V98A 4AEQA 1YIJ3 3K9MC 1YJ93 1LQMB 1JB4A 3I553 1W01A 1W5ZA 2PZVA 3B8LA 2YFIB 1D6UA 1EEJA 2KCDA 2STDA 1BIRA 2O3OA 3DXOA 2MC8A 1T2IA 1VQO3 2CKFB 3S29A 1O7MB 5AEUB 4N6LA 4WYKB 1A90A 5AIIA 3GZYB 1BNJA 2XSHB 3NV0A 5KP4A 3SYUA 1S5AA 1PU4A 1WTHA 1UCKA 4Q53A 1VZZA 2C11A 1AVLA 3OWYA 4U13A 4BL3A 7STDA 3CC43 4MMZB 3NM2A 4JRFA 3BNDA 3OW22 3NUVA 1K734 2W56A 3FG3A 4XBYA 2F56A 1RGLA 3G713 3AMOA 1Q824 3S28A 4AKYA 1I0XA 3RNTA 1IV9A 4EBGA 3X40A 3ER7A 3Q90A 1US1A 4FMAA 2UGIA 3WA2X 4IPBA 2FNQA 5IG3A 1SQWA 2CFLA 2YFJB 3NQZA 3BLZA 2W9QA 1O7PB 1BU4A 2H0GA 3RDEA 2ZHXB 2BHMA 3FF0A 3EBTA 2L1SA 2IYJA 1DMMA 4N6TA 2P09A 4ORLA 1JV2B 2CWTA 1BSCA 1KWIA 3JVCA 2WOHA 2OOVA 1JBSA 2P38A 4G1MB 3SX1A 2KXGA 1Q7HA 2F86B 4WHAA 2JDIH 2ML5A 4CJNA 4FMCA 1N5PA 2LYXA 4N6MA 7GSPA 1JBRA 1IYYA 4O2HA 1BGSA 3EN1B 3GRDA 3Q1CA 1KQS2 2D42A 2OTL3 1C54A 1IDPA 1OGZA 2GXFA 5GSPA 2ML6A 3B4OA 2Q07A 3BB9A 5M1AA 4MMYB 3FF2A 2WGOA 1LNIA 4HM1B 4WFOA 5IF6A 3HIGA 4K90B 3CNXA 1IQXA 2BIRA 4RNTA 3DGLA 4N6UA 2Y74A 3UL5A 1FW7A 4CDLA 1I8VA 1TRPA 2YX9A 1D6YA 3F8HA 1JB5A 2SARA 2XSOB 5KP1A 2JQ5A 3KN4A 1R4YA 2Y73A 3CMA3 5BVBA 5AEWB 4ZM8A 1JJ22 1VQL3 3GWRA 5RNTA 1BNSA 1B2UA 2UUGC 1NU3A 3O8YA 1MWRA 3CCU3 1WQLB 2GEXA 3FLJA 4J5KA 5HOHA 1VQ63 5BIRA 1W6CA 2OTJ3 1YI23 3H3HA 1GYBA 3DZLA 5IEPA 1UUGB 5HGRA 3F8XA 3V99A 1M1XB 3LMLA 4IIAA 3EQQB 3FCSB 1IVVA 4RZMA 1BNEA 1CH0A 2CFWA 1B2XA 2A15A 2WO0A 3JUQA 3HOHA 1K41A 3HI7A 1NWWA 4JF8A 4KFEA 1OACA 4R80A 3TDGA 1BRSA 3DGYA 3UL6A 1B27A 3EX9A 3PCSA 2F98A 2CK3H 2F5MA 3AHSA 3ECFA 3JUPA 3X41A 5BU4A 1G0TA 3N8BA 2KF6A 2W9PA 3D5IA 2W04A 4EV5A 1W6GA 2SBLA 4L8OA 1WMNA 3G8ZA 2BU4A 2CG0A 3WA3A 3OWSA 1E3RA 2HOHA 3NX0A 5G1KA 1GMPA 3G0KA 1VQQA 3PCRA 4K1UA 1BRJA 2HMMB 3ZG5A 1QALA 2RFRA 1QVF2 3EF8A 3MPHA 1VQP3 2D1WA 3BNCA 4EV2A 1BANA 3FGYA 1RGKA 2XGNA 3LTDA 4OUQA 4R4KA 5DRVA 4QWTA 3EJVA 4FMDA 2Z76A 4O8SA 3VGNA 1I0VA 1X1XA 3BU4A 1GY6A 3EBYA 4OK0A 1ULJB 1BRIA 3A76A 3LH4A 1BSAA 1EQKA 1YGEA 1K28A 1TU5A 2RBIA 4LSOA 4HAAA 1BSEA 3URPA 2C10A 1N9JA 3CPW2 1BOXA 3K7CA 1GS3A 4GSPA 5CF1A 1B2MA 1B3SA 3E99A 4EYCA 4DKIA 4XBTA 1BRGA 1GD4A 3WOEB 4EC6A 8RNTA 4BIRA 1O7NB 4BTYA 2RGQA 3LTBA 4STDA 3MHEA 1JZDA 1N8QA 4K61A 5G2GA 3S67A 1N9EA 1YVBI 3Q2PA 5CF2A 1YJN3 3UJMA 1UUVB 1J2BA 1GD3A 1FUWA 3EHCA 3AHWA 3SLUA 4RBNA 4BTXA 5FW5A 1TIJA 3SOYA 1RCKA 3X42A 1Q7Y4 5TGNA 1UCLA 5IG0A 4RNYA 3SOAA 3MG3A 4HBRA 3CXC2 3KFQC 5I97A 1BSDA 1MWSA 1FGQA 2CHCA 3IMAB 2BNGA 1AQZA 1PYLA 1RGHA 1BNFA 4LMIA 1C7HA 1O7HB 1IVUA 1X1WA 1W4NA 3MG1A 1TTOA 1VQ43 5CXOA 3KSPA 2OQEA 2V1LA 3KIIA 1JB2A 3MKIA 1JBTA 3CC73 8CHOA 3UB1A 2OOVC 4FCZA 4GHOA 3G6E3 1BNRA 1PY3A 1G02A 1O7WB 4HOHA 1AV4A 1K9M4 1EUIC 3NHXA 3OX9A 1I2FA 2CG1A 1D6ZA 2QA43 3NXJA 2F4YA 1JKGB 3ZG0A 1VQM3 1B2ZA 1FUSA 1YIT3 3N54B 3D9RA 1RLSA 4N6OB 4HKVB 4MMXB 3RGAA 4LEHA 2KF5A 3D4AA 3QRDA 1CYVA 1SIIA 1WMOA 1VQN3 3S5CA 4BL2A 1RNBA 1W2B2 2ZL8A 1AVKA 1W02A 1RRLA 2FGTA 2E2TA 1MWTA 2GU1A 4KZ1A 1GY5A 2BMQB 2CFDA 1M1K4 1MGWA 1UGIA 3CCE3 1HYFA 1FGRA 3N9HA 1ZGXA 3EN8A 1F8NA 3T8UA 3MG2A 1RMSA 1SPUA 1FZUA 1BVIA 1ZX2A 4H3UA 4HJLB 4J9AA 3Q3FA 2IMJA 5JPPA 2CX0A 1RHLA 5D81A 1VQK3 1K8A4 1UDII 4GL6A 9RNTA 1DVCA 3K0ZA 5M18A 3DMCA 5LC6A 5A0OB 2QGUA 3LT8A 4XM4A 3J7Yd 1RGFA 2B1XB 2E2VA 4J8TA 3IJEB 5AIHA 3WHOA 1JRQA 1DMNA 4HM0B 4HM6B 3S27A 1EKMA 3ZFZA 3PGBA 1X1YA 1CQSA 2WGQA 5AIFA 1ROAA 5STDA 1BUJA 1G96A 3DY5A 1ZO2A 4I4KA 3KKGA 1JN5B 1OPYA 2XGLA 1QAKA 3T0UA 3IPTA 2I9WA 1QMAA 3MYTA 3F9SA 4NPBA 4HYZA 1A67A 1IV7A 1SIHA 1RDSA 2PNCA 1Q814 3K5TA 1RTUA 3GSPA 3PS8A 1GOUA 3AGNA 4IT7A 1RGGA 1IT7A 3HZPA 4XDVA 1DVDA 1NNVA 4BTWA 1MOLA 2CFGA 2K54A 1GOYA 2KF4A 1Z1SA 1QAFA 1I2EA 3BIRA 1X1UA 2Z77A 4HM7B 3CCS3 2Z6BA 5AYSC 6STDA 2WOFA 3FH1A 5CK6A 1YGWA 2HMLB 1A2PA 1HU9A 2W0QA 2IUJA 1ASKA 3SXXA 4FCMA 5FGOA 1FGOA 1RCLA 4H61A 2C4BA 4CCVA 1V74A 1UUWB 2MF7A 1QVG2 1CYUA 1TFKA 1TRQA 2FXTA 3OWUA 4KFDA 5ELUA 1GMQA 5D82A 1YHQ3 3H51A 2ZDJA 5IEOA 4J5GA 1ZS7A 4EW5A 1BUQA 5CLKA 2CIUA 1OHPA 1HZ1A 3EE1A 3JUMA 1LNHA 4L7KA 3GZXB 1RGAA 3RGRA 3CC23 2RCDA 3PZWA 3A5EA 3CCV3 3WR2A 3F7XA 1T2HA 2GEYA 1LXEA 3DGOA 6GSPA 4KT3B 1UW1A 1FGTA 1T3BA 3T8NA 1RKYA 3DGMA 3LOYA 1BSBA 1FA3A 2F99A 4HM3B 3SVAA 4TX4A 1OHOA 3M8CA 3B4PA 1E3VA 1IT8A 3U97A 3L0RA 1GOVA 2B24B 3GZRA 4LYLB 4WP5A 1RN4A 5IG5A 2R41A 1I2GA 2OQEC 2INXA 3VSYA 2P05A 2K0MA 1FYSA 1DETA 4R9KA 1L5GB 1JNQA 3KSED 1VQ83 3ROBA 3QK9A 3CCQ3 2LQVA 1JKGA 1TFOA 3NM7A 4HZ9B 1Q40A 5BXQA 1MWUA 1N5HA 4R1KA 1LOVA 1U5OA 2AAEA 3CCJ3 2P0XA 1FGMA 1W2ZA 1V58A 1I70A 3G16A 5IERA 1GSPA 2P0MA 1MNLA 2UX0A 2GSPA 1YVSA 1UI8A 1TJDA 1W00A 1B20A 1E97A 3LZAA 3FKAA 5G1LA 3WOFB 3X3ZA 3WODG 1RSNA 2KF3A 4ILFA 4N3VA 1KC84 3JUNA 5JPUA 3F7SA 3CU3A 4I5QA 2K3DA 1AY7A 2R4IA 2M7OA 5KP3A 3PYJA 1IK3A 4X2OA 1Q40B 1O7GB 2HMJB 2YFLB 3BNBA 3MSOA 7RNTA 4L8PA 1TUHA 2RNTA 1YNVX 2XFSA 3G4S3 1WMPA 1HKXA 4RNZA 2KAAA 3X3YA 2CWUA 5AYRB 1RNTA 2E2UA 4O3VA 2XFTA 1Y4KA 5D83A 2Z7AA 4N6NB 3I563 2CW9A 1LOYA
chains in the Genus database with same CATH topology
1R4CA 3BNEA 4HZBB 4HVNA 5AI1A 3FZWA 3MWZA 1VQ93 2IUKA 4O02B 4K1VA 3NV0B 1M904 1RN7A 3KZTA 4FCJA 1IQYA 1NO3A 3F40A 2QIYA 4GB5A 2XF3A 4X2HA 1N8R4 3KE7A 1KD14 1OF5A 3LT9A 2L4VA 1WNHA 3LTAA 2BT3A 2W56B 3EB8A 1JN5A 2OWPA 4NREA 1LVNA 2CWVA 3AMOB 4AKZA 4MEIA 4HM5B 4PEJA 4WWUC 5AIGA 2O9UX 3HK4A 3CPOA 3CNMA 3PXMA 5DREA 4FMBA 1AR0A 3WDGB 3FG1A 1ULIB 1IQ8A 2BMRB 2HMNB 1OUNA 3FSDA 2QEX3 1W6YA 1NB5I 1NB3I 3VF1A 4MJDA 1NJI4 3V92A 3LXUX 1OF5B 1IVWA 2KRTA 1RRHA 5EVHA 3DM8A 2CFKA 3WMDA 3CCM3 3GZBA 1TP6A 1ROVA 3OV4A 1W7CA 2CC3A 2IA7A 3F14A 4FR9A 3B7CA 3X3XA 3NQYA 4KFFA 3EC9A 1M9GA 5LC7A 2W2CA 1EG9B 1OGXA 3DGNA 1Q42A 5IENA 2BMOB 1GY7A 3CCR3 1OCVA 1VQ73 3ALAA 2CH9A 2W03A 2W6JH 1STDA 1PFPA 4OVMA 1UI7A 3JUOA 4KVHA 3CME3 3CCL3 1OHSA 1STFI 1YJW3 1VQ53 3LYGA 3I0YA 5EEOA 3SEDA 2XH9A 1A2VA 3NBBA 2BO9B 2XEPA 1A2KA 2XR8B 1OH0A 1LOXA 4XB5A 1T5YA 3NBJA 3UNLA 5EQLA 4XDWA 3U1WA 1RJOA 2HMKB 3D3LA 1NDOB 1U8CB 2GBWB 3OXAA 4HM8B 4XBXA 5ELJA 3STDA 1QJGA 2GU3A 2RSXA 2GBXB 3HX8A 3LTCA 1DMQA 4EXRA 1SJWA 4NHFA 4WYKA 1IU7A 5IG4A 2OCTA 5IW9A 1S723 5JBSA 3GAXA 1Q864 1DYUA 3NBRA 4R9LA 3K63A 3CD63 3DUKA 1CEWI 4N6V0 3FG4A 1IVXA 4HM4B 4LZIA 2HMOB 1ISKA 1EA2A 3HIIA 2XRXB 1KSIA 4HM2B 4LGQA 3V98A 4AEQA 1YIJ3 1YJ93 3K9MC 1JB4A 3I553 1W01A 1W5ZA 2PZVA 3B8LA 2YFIB 1D6UA 2KCDA 2STDA 3DXOA 2O3OA 2MC8A 1VQO3 2CKFB 3S29A 1O7MB 5AEUB 4N6LA 4WYKB 1A90A 5AIIA 3GZYB 2XSHB 3NV0A 5KP4A 1S5AA 1PU4A 1WTHA 4Q53A 7STDA 1VZZA 2C11A 1AVLA 3OWYA 4U13A 3CC43 4MMZB 3NM2A 4JRFA 3BNDA 3OW22 3NUVA 1K734 2W56A 3FG3A 4XBYA 3G713 3AMOA 1Q824 3S28A 4AKYA 1IV9A 4EBGA 3X40A 3ER7A 3Q90A 1US1A 4FMAA 3WA2X 4IPBA 2FNQA 5IG3A 1SQWA 2CFLA 2YFJB 3NQZA 3BLZA 2W9QA 1O7PB 3RDEA 2BHMA 3FF0A 3EBTA 1DMMA 4N6TA 2P09A 4ORLA 1JV2B 2CWTA 3JVCA 1KWIA 2OOVA 2WOHA 2P38A 4G1MB 3SX1A 2KXGA 2F86B 4WHAA 2JDIH 2ML5A 4FMCA 1N5PA 2LYXA 4N6MA 4O2HA 3EN1B 3GRDA 3Q1CA 1KQS2 2D42A 2OTL3 1IDPA 1OGZA 2GXFA 2ML6A 3B4OA 2Q07A 3BB9A 4MMYB 3FF2A 2WGOA 5IF6A 4HM1B 4WFOA 3HIGA 4K90B 3CNXA 1IQXA 3UL5A 3DGLA 4N6UA 2Y74A 4CDLA 2YX9A 1D6YA 3F8HA 2XSOB 1JB5A 5KP1A 2JQ5A 3KN4A 2Y73A 3CMA3 5BVBA 5AEWB 4ZM8A 1JJ22 1VQL3 3GWRA 1NU3A 3O8YA 3CCU3 1VQ63 1WQLB 2GEXA 3FLJA 1W6CA 2OTJ3 1YI23 3H3HA 1GYBA 3DZLA 5IEPA 5HGRA 3F8XA 3V99A 1M1XB 3LMLA 4IIAA 3EQQB 3FCSB 1IVVA 4RZMA 2CFWA 2A15A 2WO0A 3JUQA 1K41A 3HI7A 1NWWA 4JF8A 4KFEA 1OACA 4R80A 3TDGA 3UL6A 3EX9A 3PCSA 2F98A 2CK3H 3ECFA 3JUPA 3X41A 3N8BA 2W9PA 2W04A 4EV5A 2SBLA 1W6GA 4L8OA 1WMNA 3G8ZA 2CG0A 3WA3A 3OWSA 1E3RA 3NX0A 3G0KA 3PCRA 4K1UA 2HMMB 1QALA 2RFRA 1QVF2 3EF8A 3MPHA 1VQP3 2D1WA 3BNCA 4EV2A 3FGYA 5DRVA 2XGNA 3LTDA 4R4KA 4OUQA 4QWTA 3EJVA 4FMDA 2Z76A 4O8SA 3VGNA 3EBYA 1GY6A 4OK0A 1ULJB 3A76A 3LH4A 1EQKA 1YGEA 1K28A 4LSOA 2C10A 1N9JA 3CPW2 3K7CA 1GS3A 5CF1A 4EYCA 3E99A 4XBTA 1GD4A 3WOEB 4EC6A 1O7NB 4BTYA 2RGQA 3LTBA 4STDA 3MHEA 1N8QA 4K61A 5G2GA 3S67A 1N9EA 1YVBI 3Q2PA 5CF2A 1YJN3 3UJMA 1UUVB 1J2BA 1GD3A 1FUWA 3EHCA 3SLUA 4RBNA 4BTXA 5FW5A 1TIJA 3SOYA 3X42A 1Q7Y4 5TGNA 5IG0A 4RNYA 3SOAA 3MG3A 4HBRA 3CXC2 3KFQC 5I97A 2CHCA 1FGQA 3IMAB 2BNGA 4LMIA 1C7HA 1O7HB 1IVUA 1W4NA 3MG1A 1VQ43 5CXOA 3KSPA 2OQEA 2V1LA 3KIIA 1JB2A 3MKIA 3CC73 8CHOA 3UB1A 2OOVC 4FCZA 3G6E3 1O7WB 1AV4A 1K9M4 3NHXA 3OX9A 2CG1A 1D6ZA 2QA43 3NXJA 1JKGB 1VQM3 1YIT3 3N54B 3D9RA 4N6OB 4HKVB 4MMXB 3RGAA 4LEHA 3QRDA 1CYVA 1SIIA 1WMOA 1VQN3 3S5CA 1W2B2 2ZL8A 1AVKA 1W02A 1RRLA 2FGTA 2E2TA 2GU1A 4KZ1A 1GY5A 2BMQB 2CFDA 1M1K4 3CCE3 1FGRA 3N9HA 3EN8A 1F8NA 3T8UA 3MG2A 1SPUA 1ZX2A 4H3UA 4HJLB 4J9AA 2IMJA 5JPPA 5D81A 1K8A4 1VQK3 4GL6A 1DVCA 3K0ZA 3DMCA 5LC6A 5A0OB 2QGUA 3LT8A 4XM4A 3J7Yd 2B1XB 2E2VA 4J8TA 3IJEB 5AIHA 1JRQA 1DMNA 4HM0B 4HM6B 3S27A 1EKMA 3PGBA 2WGQA 1CQSA 5AIFA 1ROAA 5STDA 1G96A 3DY5A 1ZO2A 4I4KA 3KKGA 1JN5B 1OPYA 2XGLA 1QAKA 3T0UA 3IPTA 2I9WA 1QMAA 3MYTA 3F9SA 4HYZA 1A67A 1IV7A 1SIHA 2PNCA 1Q814 3K5TA 3PS8A 4IT7A 1IT7A 3HZPA 4XDVA 1DVDA 4BTWA 1MOLA 2CFGA 2K54A 1Z1SA 1QAFA 2Z77A 4HM7B 3CCS3 2Z6BA 5AYSC 6STDA 2WOFA 3FH1A 5CK6A 2HMLB 2IUJA 1HU9A 2W0QA 1ASKA 3SXXA 4FCMA 5FGOA 1FGOA 4CCVA 4H61A 1V74A 1UUWB 2MF7A 1QVG2 1CYUA 1TFKA 2FXTA 3OWUA 4KFDA 5ELUA 5D82A 1YHQ3 3H51A 2ZDJA 5IEOA 1BUQA 5CLKA 2CIUA 1OHPA 3EE1A 3JUMA 1LNHA 4L7KA 3GZXB 3RGRA 3CC23 2RCDA 3PZWA 3CCV3 3F7XA 2GEYA 1LXEA 3DGOA 1UW1A 1FGTA 3T8NA 1RKYA 3DGMA 3LOYA 1FA3A 2F99A 4HM3B 3SVAA 4TX4A 1OHOA 3M8CA 3B4PA 1E3VA 1IT8A 3U97A 3L0RA 2B24B 3GZRA 4WP5A 5IG5A 2OQEC 2INXA 3VSYA 2P05A 2K0MA 4R9KA 1L5GB 1JNQA 3KSED 1VQ83 3ROBA 3QK9A 3CCQ3 2LQVA 1JKGA 1TFOA 3NM7A 4HZ9B 1Q40A 5BXQA 1N5HA 4R1KA 1U5OA 3CCJ3 2P0XA 1FGMA 1W2ZA 3G16A 5IERA 2P0MA 1MNLA 2UX0A 1UI8A 1W00A 1E97A 3LZAA 3FKAA 3WOFB 3X3ZA 3WODG 1KC84 4N3VA 3JUNA 5JPUA 3F7SA 3CU3A 2R4IA 2M7OA 5KP3A 3PYJA 1IK3A 4X2OA 1Q40B 1O7GB 2HMJB 2YFLB 3BNBA 3MSOA 4L8PA 1TUHA 2XFSA 3G4S3 1WMPA 1HKXA 4RNZA 3X3YA 2CWUA 5AYRB 2E2UA 4O3VA 2XFTA 1Y4KA 5D83A 2Z7AA 4N6NB 3I563 2CW9A 1TU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HZB B;  4HVN A;  5AI1 A;  3FZW A;  4K1V A;  3NV0 B;  3KZT A;  4FCJ A;  3F40 A;  2QIY A;  4GB5 A;  4X2H A;  3KE7 A;  1OF5 A;  1JN5 A;  2OWP A;  4HM5 B;  4PEJ A;  4WWU C;  5AIG A;  3HK4 A;  3CPO A;  3CNM A;  5DRE A;  1AR0 A;  1ULI B;  2BMR B;  2HMN B;  1OUN A;  3FSD A;  1W6Y A;  4MJD A;  1OF5 B;  5EVH A;  3DM8 A;  3WMD A;  3GZB A;  1TP6 A;  3OV4 A;  3F14 A;  3B7C A;  3EC9 A;  2W2C A;  1EG9 B;  1OGX A;  1Q42 A;  5IEN A;  2BMO B;  1GY7 A;  1OCV A;  1STD A;  4OVM A;  4KVH A;  3JUO A;  1OHS A;  3LYG A;  3I0Y A;  3SED A;  1A2K A;  2XR8 B;  1OH0 A;  4XB5 A;  3UNL A;  4XDW A;  2HMK B;  1NDO B;  2GBW B;  4HM8 B;  3OXA A;  4XBX A;  3STD A;  1QJG A;  2GBX B;  3HX8 A;  1DMQ A;  1SJW A;  4WYK A;  5IG4 A;  3NBR A;  4R9L A;  3DUK A;  4HM4 B;  2HMO B;  1ISK A;  1EA2 A;  2XRX B;  4HM2 B;  4LGQ A;  1JB4 A;  1W01 A;  2PZV A;  3B8L A;  2YFI B;  2STD A;  3DXO A;  2CKF B;  1O7M B;  5AEU B;  4WYK B;  5AII A;  3GZY B;  2XSH B;  3NV0 A;  5KP4 A;  1S5A A;  4Q53 A;  7STD A;  1VZZ A;  3OWY A;  4U13 A;  3NM2 A;  3NUV A;  4XBY A;  3ER7 A;  3Q90 A;  5IG3 A;  2YFJ B;  3BLZ A;  1O7P B;  3FF0 A;  3EBT A;  1DMM A;  4ORL A;  2F86 B;  3EN1 B;  3GRD A;  1IDP A;  1OGZ A;  2GXF A;  3B4O A;  3BB9 A;  3FF2 A;  5IF6 A;  4HM1 B;  3CNX A;  4CDL A;  3F8H A;  1JB5 A;  2XSO B;  5KP1 A;  2JQ5 A;  5BVB A;  5AEW B;  3GWR A;  1NU3 A;  1WQL B;  2GEX A;  3FLJ A;  3H3H A;  1GYB A;  3DZL A;  5IEP A;  5HGR A;  3F8X A;  4IIA A;  3EQQ B;  4RZM A;  2A15 A;  3JUQ A;  1K41 A;  1NWW A;  3EX9 A;  2F98 A;  3ECF A;  3JUP A;  4L8O A;  3G8Z A;  3OWS A;  1E3R A;  3G0K A;  4K1U A;  2HMM B;  2RFR A;  3EF8 A;  3FGY A;  5DRV A;  4OUQ A;  3EJV A;  2Z76 A;  3VGN A;  3EBY A;  1GY6 A;  1ULJ B;  3A76 A;  3K7C A;  1GS3 A;  5CF1 A;  3E99 A;  4XBT A;  1O7N B;  2RGQ A;  4STD A;  3MHE A;  5G2G A;  5CF2 A;  3UJM A;  1UUV B;  3EHC A;  5FW5 A;  3SOY A;  5TGN A;  5IG0 A;  3SOA A;  3MG3 A;  2CHC A;  2BNG A;  4LMI A;  1C7H A;  1O7H B;  3MG1 A;  5CXO A;  3KSP A;  1JB2 A;  3MKI A;  8CHO A;  1O7W B;  3NHX A;  3OX9 A;  3NXJ A;  1JKG B;  3D9R A;  4HKV B;  3RGA A;  4LEH A;  3S5C A;  1W02 A;  1GY5 A;  2BMQ B;  3EN8 A;  3T8U A;  3MG2 A;  1ZX2 A;  4H3U A;  4HJL B;  4J9A A;  2IMJ A;  5JPP A;  5D81 A;  3K0Z A;  3DMC A;  4XM4 A;  2QGU A;  2B1X B;  4J8T A;  5AIH A;  4HM6 B;  1DMN A;  4HM0 B;  5AIF A;  1CQS A;  5STD A;  1ZO2 A;  4I4K A;  3KKG A;  1JN5 B;  1OPY A;  3IPT A;  2I9W A;  1QMA A;  3MYT A;  3F9S A;  3HZP A;  4XDV A;  2K54 A;  1Z1S A;  2Z77 A;  4HM7 B;  6STD A;  3FH1 A;  5CK6 A;  2HML B;  1ASK A;  4FCM A;  1UUW B;  3OWU A;  5D82 A;  3H51 A;  5IEO A;  1BUQ A;  5CLK A;  1OHP A;  3JUM A;  4L7K A;  3GZX B;  3RGR A;  2RCD A;  3F7X A;  2GEY A;  3T8N A;  2F99 A;  4HM3 B;  1OHO A;  3M8C A;  3B4P A;  1E3V A;  2B24 B;  3GZR A;  4WP5 A;  5IG5 A;  2INX A;  3VSY A;  4R9K A;  3ROB A;  1JKG A;  4HZ9 B;  1Q40 A;  5BXQ A;  4R1K A;  1U5O A;  3G16 A;  5IER A;  2UX0 A;  1W00 A;  1E97 A;  3LZA A;  3FKA A;  4N3V A;  3JUN A;  5JPU A;  3F7S A;  3CU3 A;  2R4I A;  5KP3 A;  4X2O A;  1Q40 B;  1O7G B;  2HMJ B;  2YFL B;  3MSO A;  4L8P A;  1TUH A;  1HKX A;  5D83 A;  2Z7A A; 
#chains in the Genus database with same CATH topology
 1R4C A;  3BNE A;  2H0I A;  1V57 A;  3AGO A;  4HZB B;  1UCJ A;  4HVN A;  2AAD A;  5AI1 A;  3FZW A;  3MWZ A;  1SAR A;  2IUK A;  1VQ9 3;  4O02 B;  4K1V A;  3NV0 B;  1M90 4;  1LQG C;  1RN7 A;  3KZT A;  4CPK A;  4FCJ A;  1BNI A;  1IQY A;  1NO3 A;  3F40 A;  2QIY A;  4GB5 A;  1JZO A;  2XF3 A;  4X2H A;  3KE7 A;  1N8R 4;  1KD1 4;  1OF5 A;  3LT9 A;  2L4V A;  1WNH A;  3LTA A;  2BT3 A;  2W56 B;  3EB8 A;  1JN5 A;  2OWP A;  1B21 A;  4NRE A;  1BRN L;  1LVN A;  2CWV A;  3AMO B;  4AKZ A;  4MEI A;  4HM5 B;  4PEJ A;  4WWU C;  5AIG A;  2IY2 A;  2O9U X;  3HK4 A;  3KCH A;  3CPO A;  3CNM A;  3PXM A;  5DRE A;  4FMB A;  1AR0 A;  1BRK A;  3WDG B;  3FG1 A;  1ULI B;  1IQ8 A;  2BMR B;  2HMN B;  1OUN A;  3FSD A;  2QEX 3;  1W6Y A;  1NB5 I;  1NB3 I;  3VF1 A;  4MJD A;  1NJI 4;  3V92 A;  3LXU X;  3D79 A;  1OF5 B;  5M19 A;  1IVW A;  1UCI A;  2KRT A;  1RRH A;  5EVH A;  3DM8 A;  2CFK A;  3WMD A;  2J8X B;  3CCM 3;  3GZB A;  1TP6 A;  1ROV A;  3OV4 A;  1W7C A;  2CC3 A;  2IA7 A;  3F14 A;  4FR9 A;  1RGC A;  3B7C A;  3X3X A;  3NQY A;  4KFF A;  1B2S A;  1RGE A;  3EC9 A;  1M9G A;  3D5G A;  5LC7 A;  2W2C A;  1EG9 B;  1OGX A;  2F5W A;  3DGN A;  1Q42 A;  1BNG A;  5IEN A;  2BMO B;  1BRH A;  1GY7 A;  3CCR 3;  1OCV A;  1VQ7 3;  3ALA A;  2CH9 A;  2W03 A;  1I3I A;  2W6J H;  1STD A;  1PFP A;  4OVM A;  1UI7 A;  3JUO A;  4KVH A;  3CME 3;  3CCL 3;  1OHS A;  1STF I;  1YJW 3;  1GMR A;  1VQ5 3;  1UGH I;  1LRA A;  3LYG A;  3I0Y A;  5EEO A;  3SED A;  2H0H A;  2XH9 A;  2CX1 A;  1A2V A;  3NBB A;  1RN1 A;  2BO9 B;  2XEP A;  1A2K A;  2XR8 B;  1OH0 A;  1LOX A;  4XB5 A;  1T5Y A;  3NBJ A;  4BU4 A;  3UNL A;  3DH2 A;  1MGR A;  5EQL A;  4XDW A;  3U1W A;  1RJO A;  1BAO A;  2HMK B;  3D3L A;  1NDO B;  1Q9E A;  1U8C B;  2GBW B;  3OXA A;  4HM8 B;  4XBX A;  5ELJ A;  3STD A;  1QJG A;  2GU3 A;  2RSX A;  2GBX B;  3HX8 A;  3LTC A;  2ZA4 A;  1DMQ A;  4EXR A;  1SJW A;  4NHF A;  1DE3 A;  1LOW A;  4WYK A;  1IU7 A;  5IG4 A;  2OCT A;  5IW9 A;  1S72 3;  5JBS A;  3GAX A;  1Q86 4;  1DYU A;  3NBR A;  4R9L A;  3K63 A;  3CD6 3;  3DUK A;  1CEW I;  4N6V 0;  3FG4 A;  6RNT A;  1IVX A;  4HM4 B;  4LZI A;  1FUT A;  2HMO B;  1ISK A;  1EA2 A;  3HII A;  2XRX B;  1KSI A;  4HM2 B;  1I3F A;  4LGQ A;  3V98 A;  4AEQ A;  1YIJ 3;  3K9M C;  1YJ9 3;  1LQM B;  1JB4 A;  3I55 3;  1W01 A;  1W5Z A;  2PZV A;  3B8L A;  2YFI B;  1D6U A;  1EEJ A;  2KCD A;  2STD A;  1BIR A;  2O3O A;  3DXO A;  2MC8 A;  1T2I A;  1VQO 3;  2CKF B;  3S29 A;  1O7M B;  5AEU B;  4N6L A;  4WYK B;  1A90 A;  5AII A;  3GZY B;  1BNJ A;  2XSH B;  3NV0 A;  5KP4 A;  3SYU A;  1S5A A;  1PU4 A;  1WTH A;  1UCK A;  4Q53 A;  1VZZ A;  2C11 A;  1AVL A;  3OWY A;  4U13 A;  4BL3 A;  7STD A;  3CC4 3;  4MMZ B;  3NM2 A;  4JRF A;  3BND A;  3OW2 2;  3NUV A;  1K73 4;  2W56 A;  3FG3 A;  4XBY A;  2F56 A;  1RGL A;  3G71 3;  3AMO A;  1Q82 4;  3S28 A;  4AKY A;  1I0X A;  3RNT A;  1IV9 A;  4EBG A;  3X40 A;  3ER7 A;  3Q90 A;  1US1 A;  4FMA A;  2UGI A;  3WA2 X;  4IPB A;  2FNQ A;  5IG3 A;  1SQW A;  2CFL A;  2YFJ B;  3NQZ A;  3BLZ A;  2W9Q A;  1O7P B;  1BU4 A;  2H0G A;  3RDE A;  2ZHX B;  2BHM A;  3FF0 A;  3EBT A;  2L1S A;  2IYJ A;  1DMM A;  4N6T A;  2P09 A;  4ORL A;  1JV2 B;  2CWT A;  1BSC A;  1KWI A;  3JVC A;  2WOH A;  2OOV A;  1JBS A;  2P38 A;  4G1M B;  3SX1 A;  2KXG A;  1Q7H A;  2F86 B;  4WHA A;  2JDI H;  2ML5 A;  4CJN A;  4FMC A;  1N5P A;  2LYX A;  4N6M A;  7GSP A;  1JBR A;  1IYY A;  4O2H A;  1BGS A;  3EN1 B;  3GRD A;  3Q1C A;  1KQS 2;  2D42 A;  2OTL 3;  1C54 A;  1IDP A;  1OGZ A;  2GXF A;  5GSP A;  2ML6 A;  3B4O A;  2Q07 A;  3BB9 A;  5M1A A;  4MMY B;  3FF2 A;  2WGO A;  1LNI A;  4HM1 B;  4WFO A;  5IF6 A;  3HIG A;  4K90 B;  3CNX A;  1IQX A;  2BIR A;  4RNT A;  3DGL A;  4N6U A;  2Y74 A;  3UL5 A;  1FW7 A;  4CDL A;  1I8V A;  1TRP A;  2YX9 A;  1D6Y A;  3F8H A;  1JB5 A;  2SAR A;  2XSO B;  5KP1 A;  2JQ5 A;  3KN4 A;  1R4Y A;  2Y73 A;  3CMA 3;  5BVB A;  5AEW B;  4ZM8 A;  1JJ2 2;  1VQL 3;  3GWR A;  5RNT A;  1BNS A;  1B2U A;  2UUG C;  1NU3 A;  3O8Y A;  1MWR A;  3CCU 3;  1WQL B;  2GEX A;  3FLJ A;  4J5K A;  5HOH A;  1VQ6 3;  5BIR A;  1W6C A;  2OTJ 3;  1YI2 3;  3H3H A;  1GYB A;  3DZL A;  5IEP A;  1UUG B;  5HGR A;  3F8X A;  3V99 A;  1M1X B;  3LML A;  4IIA A;  3EQQ B;  3FCS B;  1IVV A;  4RZM A;  1BNE A;  1CH0 A;  2CFW A;  1B2X A;  2A15 A;  2WO0 A;  3JUQ A;  3HOH A;  1K41 A;  3HI7 A;  1NWW A;  4JF8 A;  4KFE A;  1OAC A;  4R80 A;  3TDG A;  1BRS A;  3DGY A;  3UL6 A;  1B27 A;  3EX9 A;  3PCS A;  2F98 A;  2CK3 H;  2F5M A;  3AHS A;  3ECF A;  3JUP A;  3X41 A;  5BU4 A;  1G0T A;  3N8B A;  2KF6 A;  2W9P A;  3D5I A;  2W04 A;  4EV5 A;  1W6G A;  2SBL A;  4L8O A;  1WMN A;  3G8Z A;  2BU4 A;  2CG0 A;  3WA3 A;  3OWS A;  1E3R A;  2HOH A;  3NX0 A;  5G1K A;  1GMP A;  3G0K A;  1VQQ A;  3PCR A;  4K1U A;  1BRJ A;  2HMM B;  3ZG5 A;  1QAL A;  2RFR A;  1QVF 2;  3EF8 A;  3MPH A;  1VQP 3;  2D1W A;  3BNC A;  4EV2 A;  1BAN A;  3FGY A;  1RGK A;  2XGN A;  3LTD A;  4OUQ A;  4R4K A;  5DRV A;  4QWT A;  3EJV A;  4FMD A;  2Z76 A;  4O8S A;  3VGN A;  1I0V A;  1X1X A;  3BU4 A;  1GY6 A;  3EBY A;  4OK0 A;  1ULJ B;  1BRI A;  3A76 A;  3LH4 A;  1BSA A;  1EQK A;  1YGE A;  1K28 A;  1TU5 A;  2RBI A;  4LSO A;  4HAA A;  1BSE A;  3URP A;  2C10 A;  1N9J A;  3CPW 2;  1BOX A;  3K7C A;  1GS3 A;  4GSP A;  5CF1 A;  1B2M A;  1B3S A;  3E99 A;  4EYC A;  4DKI A;  4XBT A;  1BRG A;  1GD4 A;  3WOE B;  4EC6 A;  8RNT A;  4BIR A;  1O7N B;  4BTY A;  2RGQ A;  3LTB A;  4STD A;  3MHE A;  1JZD A;  1N8Q A;  4K61 A;  5G2G A;  3S67 A;  1N9E A;  1YVB I;  3Q2P A;  5CF2 A;  1YJN 3;  3UJM A;  1UUV B;  1J2B A;  1GD3 A;  1FUW A;  3EHC A;  3AHW A;  3SLU A;  4RBN A;  4BTX A;  5FW5 A;  1TIJ A;  3SOY A;  1RCK A;  3X42 A;  1Q7Y 4;  5TGN A;  1UCL A;  5IG0 A;  4RNY A;  3SOA A;  3MG3 A;  4HBR A;  3CXC 2;  3KFQ C;  5I97 A;  1BSD A;  1MWS A;  1FGQ A;  2CHC A;  3IMA B;  2BNG A;  1AQZ A;  1PYL A;  1RGH A;  1BNF A;  4LMI A;  1C7H A;  1O7H B;  1IVU A;  1X1W A;  1W4N A;  3MG1 A;  1TTO A;  1VQ4 3;  5CXO A;  3KSP A;  2OQE A;  2V1L A;  3KII A;  1JB2 A;  3MKI A;  1JBT A;  3CC7 3;  8CHO A;  3UB1 A;  2OOV C;  4FCZ A;  4GHO A;  3G6E 3;  1BNR A;  1PY3 A;  1G02 A;  1O7W B;  4HOH A;  1AV4 A;  1K9M 4;  1EUI C;  3NHX A;  3OX9 A;  1I2F A;  2CG1 A;  1D6Z A;  2QA4 3;  3NXJ A;  2F4Y A;  1JKG B;  3ZG0 A;  1VQM 3;  1B2Z A;  1FUS A;  1YIT 3;  3N54 B;  3D9R A;  1RLS A;  4N6O B;  4HKV B;  4MMX B;  3RGA A;  4LEH A;  2KF5 A;  3D4A A;  3QRD A;  1CYV A;  1SII A;  1WMO A;  1VQN 3;  3S5C A;  4BL2 A;  1RNB A;  1W2B 2;  2ZL8 A;  1AVK A;  1W02 A;  1RRL A;  2FGT A;  2E2T A;  1MWT A;  2GU1 A;  4KZ1 A;  1GY5 A;  2BMQ B;  2CFD A;  1M1K 4;  1MGW A;  1UGI A;  3CCE 3;  1HYF A;  1FGR A;  3N9H A;  1ZGX A;  3EN8 A;  1F8N A;  3T8U A;  3MG2 A;  1RMS A;  1SPU A;  1FZU A;  1BVI A;  1ZX2 A;  4H3U A;  4HJL B;  4J9A A;  3Q3F A;  2IMJ A;  5JPP A;  2CX0 A;  1RHL A;  5D81 A;  1VQK 3;  1K8A 4;  1UDI I;  4GL6 A;  9RNT A;  1DVC A;  3K0Z A;  5M18 A;  3DMC A;  5LC6 A;  5A0O B;  2QGU A;  3LT8 A;  4XM4 A;  3J7Y d;  1RGF A;  2B1X B;  2E2V A;  4J8T A;  3IJE B;  5AIH A;  3WHO A;  1JRQ A;  1DMN A;  4HM0 B;  4HM6 B;  3S27 A;  1EKM A;  3ZFZ A;  3PGB A;  1X1Y A;  1CQS A;  2WGQ A;  5AIF A;  1ROA A;  5STD A;  1BUJ A;  1G96 A;  3DY5 A;  1ZO2 A;  4I4K A;  3KKG A;  1JN5 B;  1OPY A;  2XGL A;  1QAK A;  3T0U A;  3IPT A;  2I9W A;  1QMA A;  3MYT A;  3F9S A;  4NPB A;  4HYZ A;  1A67 A;  1IV7 A;  1SIH A;  1RDS A;  2PNC A;  1Q81 4;  3K5T A;  1RTU A;  3GSP A;  3PS8 A;  1GOU A;  3AGN A;  4IT7 A;  1RGG A;  1IT7 A;  3HZP A;  4XDV A;  1DVD A;  1NNV A;  4BTW A;  1MOL A;  2CFG A;  2K54 A;  1GOY A;  2KF4 A;  1Z1S A;  1QAF A;  1I2E A;  3BIR A;  1X1U A;  2Z77 A;  4HM7 B;  3CCS 3;  2Z6B A;  5AYS C;  6STD A;  2WOF A;  3FH1 A;  5CK6 A;  1YGW A;  2HML B;  1A2P A;  1HU9 A;  2W0Q A;  2IUJ A;  1ASK A;  3SXX A;  4FCM A;  5FGO A;  1FGO A;  1RCL A;  4H61 A;  2C4B A;  4CCV A;  1V74 A;  1UUW B;  2MF7 A;  1QVG 2;  1CYU A;  1TFK A;  1TRQ A;  2FXT A;  3OWU A;  4KFD A;  5ELU A;  1GMQ A;  5D82 A;  1YHQ 3;  3H51 A;  2ZDJ A;  5IEO A;  4J5G A;  1ZS7 A;  4EW5 A;  1BUQ A;  5CLK A;  2CIU A;  1OHP A;  1HZ1 A;  3EE1 A;  3JUM A;  1LNH A;  4L7K A;  3GZX B;  1RGA A;  3RGR A;  3CC2 3;  2RCD A;  3PZW A;  3A5E A;  3CCV 3;  3WR2 A;  3F7X A;  1T2H A;  2GEY A;  1LXE A;  3DGO A;  6GSP A;  4KT3 B;  1UW1 A;  1FGT A;  1T3B A;  3T8N A;  1RKY A;  3DGM A;  3LOY A;  1BSB A;  1FA3 A;  2F99 A;  4HM3 B;  3SVA A;  4TX4 A;  1OHO A;  3M8C A;  3B4P A;  1E3V A;  1IT8 A;  3U97 A;  3L0R A;  1GOV A;  2B24 B;  3GZR A;  4LYL B;  4WP5 A;  1RN4 A;  5IG5 A;  2R41 A;  1I2G A;  2OQE C;  2INX A;  3VSY A;  2P05 A;  2K0M A;  1FYS A;  1DET A;  4R9K A;  1L5G B;  1JNQ A;  3KSE D;  1VQ8 3;  3ROB A;  3QK9 A;  3CCQ 3;  2LQV A;  1JKG A;  1TFO A;  3NM7 A;  4HZ9 B;  1Q40 A;  5BXQ A;  1MWU A;  1N5H A;  4R1K A;  1LOV A;  1U5O A;  2AAE A;  3CCJ 3;  2P0X A;  1FGM A;  1W2Z A;  1V58 A;  1I70 A;  3G16 A;  5IER A;  1GSP A;  2P0M A;  1MNL A;  2UX0 A;  2GSP A;  1YVS A;  1UI8 A;  1TJD A;  1W00 A;  1B20 A;  1E97 A;  3LZA A;  3FKA A;  5G1L A;  3WOF B;  3X3Z A;  3WOD G;  1RSN A;  2KF3 A;  4ILF A;  4N3V A;  1KC8 4;  3JUN A;  5JPU A;  3F7S A;  3CU3 A;  4I5Q A;  2K3D A;  1AY7 A;  2R4I A;  2M7O A;  5KP3 A;  3PYJ A;  1IK3 A;  4X2O A;  1Q40 B;  1O7G B;  2HMJ B;  2YFL B;  3BNB A;  3MSO A;  7RNT A;  4L8P A;  1TUH A;  2RNT A;  1YNV X;  2XFS A;  3G4S 3;  1WMP A;  1HKX A;  4RNZ A;  2KAA A;  3X3Y A;  2CWU A;  5AYR B;  1RNT A;  2E2U A;  4O3V A;  2XFT A;  1Y4K A;  5D83 A;  2Z7A A;  4N6N B;  3I56 3;  2CW9 A;  1LOY A; 
#chains in the Genus database with same CATH homology
 1R4C A;  3BNE A;  4HZB B;  4HVN A;  5AI1 A;  3FZW A;  3MWZ A;  1VQ9 3;  2IUK A;  4O02 B;  4K1V A;  3NV0 B;  1M90 4;  1RN7 A;  3KZT A;  4FCJ A;  1IQY A;  1NO3 A;  3F40 A;  2QIY A;  4GB5 A;  2XF3 A;  4X2H A;  1N8R 4;  3KE7 A;  1KD1 4;  1OF5 A;  3LT9 A;  2L4V A;  1WNH A;  3LTA A;  2BT3 A;  2W56 B;  3EB8 A;  1JN5 A;  2OWP A;  4NRE A;  1LVN A;  2CWV A;  3AMO B;  4AKZ A;  4MEI A;  4HM5 B;  4PEJ A;  4WWU C;  5AIG A;  2O9U X;  3HK4 A;  3CPO A;  3CNM A;  3PXM A;  5DRE A;  4FMB A;  1AR0 A;  3WDG B;  3FG1 A;  1ULI B;  1IQ8 A;  2BMR B;  2HMN B;  1OUN A;  3FSD A;  2QEX 3;  1W6Y A;  1NB5 I;  1NB3 I;  3VF1 A;  4MJD A;  1NJI 4;  3V92 A;  3LXU X;  1OF5 B;  1IVW A;  2KRT A;  1RRH A;  5EVH A;  3DM8 A;  2CFK A;  3WMD A;  3CCM 3;  3GZB A;  1TP6 A;  1ROV A;  3OV4 A;  1W7C A;  2CC3 A;  2IA7 A;  3F14 A;  4FR9 A;  3B7C A;  3X3X A;  3NQY A;  4KFF A;  3EC9 A;  1M9G A;  5LC7 A;  2W2C A;  1EG9 B;  1OGX A;  3DGN A;  1Q42 A;  5IEN A;  2BMO B;  1GY7 A;  3CCR 3;  1OCV A;  1VQ7 3;  3ALA A;  2CH9 A;  2W03 A;  2W6J H;  1STD A;  1PFP A;  4OVM A;  1UI7 A;  3JUO A;  4KVH A;  3CME 3;  3CCL 3;  1OHS A;  1STF I;  1YJW 3;  1VQ5 3;  3LYG A;  3I0Y A;  5EEO A;  3SED A;  2XH9 A;  1A2V A;  3NBB A;  2BO9 B;  2XEP A;  1A2K A;  2XR8 B;  1OH0 A;  1LOX A;  4XB5 A;  1T5Y A;  3NBJ A;  3UNL A;  5EQL A;  4XDW A;  3U1W A;  1RJO A;  2HMK B;  3D3L A;  1NDO B;  1U8C B;  2GBW B;  3OXA A;  4HM8 B;  4XBX A;  5ELJ A;  3STD A;  1QJG A;  2GU3 A;  2RSX A;  2GBX B;  3HX8 A;  3LTC A;  1DMQ A;  4EXR A;  1SJW A;  4NHF A;  4WYK A;  1IU7 A;  5IG4 A;  2OCT A;  5IW9 A;  1S72 3;  5JBS A;  3GAX A;  1Q86 4;  1DYU A;  3NBR A;  4R9L A;  3K63 A;  3CD6 3;  3DUK A;  1CEW I;  4N6V 0;  3FG4 A;  1IVX A;  4HM4 B;  4LZI A;  2HMO B;  1ISK A;  1EA2 A;  3HII A;  2XRX B;  1KSI A;  4HM2 B;  4LGQ A;  3V98 A;  4AEQ A;  1YIJ 3;  1YJ9 3;  3K9M C;  1JB4 A;  3I55 3;  1W01 A;  1W5Z A;  2PZV A;  3B8L A;  2YFI B;  1D6U A;  2KCD A;  2STD A;  3DXO A;  2O3O A;  2MC8 A;  1VQO 3;  2CKF B;  3S29 A;  1O7M B;  5AEU B;  4N6L A;  4WYK B;  1A90 A;  5AII A;  3GZY B;  2XSH B;  3NV0 A;  5KP4 A;  1S5A A;  1PU4 A;  1WTH A;  4Q53 A;  7STD A;  1VZZ A;  2C11 A;  1AVL A;  3OWY A;  4U13 A;  3CC4 3;  4MMZ B;  3NM2 A;  4JRF A;  3BND A;  3OW2 2;  3NUV A;  1K73 4;  2W56 A;  3FG3 A;  4XBY A;  3G71 3;  3AMO A;  1Q82 4;  3S28 A;  4AKY A;  1IV9 A;  4EBG A;  3X40 A;  3ER7 A;  3Q90 A;  1US1 A;  4FMA A;  3WA2 X;  4IPB A;  2FNQ A;  5IG3 A;  1SQW A;  2CFL A;  2YFJ B;  3NQZ A;  3BLZ A;  2W9Q A;  1O7P B;  3RDE A;  2BHM A;  3FF0 A;  3EBT A;  1DMM A;  4N6T A;  2P09 A;  4ORL A;  1JV2 B;  2CWT A;  3JVC A;  1KWI A;  2OOV A;  2WOH A;  2P38 A;  4G1M B;  3SX1 A;  2KXG A;  2F86 B;  4WHA A;  2JDI H;  2ML5 A;  4FMC A;  1N5P A;  2LYX A;  4N6M A;  4O2H A;  3EN1 B;  3GRD A;  3Q1C A;  1KQS 2;  2D42 A;  2OTL 3;  1IDP A;  1OGZ A;  2GXF A;  2ML6 A;  3B4O A;  2Q07 A;  3BB9 A;  4MMY B;  3FF2 A;  2WGO A;  5IF6 A;  4HM1 B;  4WFO A;  3HIG A;  4K90 B;  3CNX A;  1IQX A;  3UL5 A;  3DGL A;  4N6U A;  2Y74 A;  4CDL A;  2YX9 A;  1D6Y A;  3F8H A;  2XSO B;  1JB5 A;  5KP1 A;  2JQ5 A;  3KN4 A;  2Y73 A;  3CMA 3;  5BVB A;  5AEW B;  4ZM8 A;  1JJ2 2;  1VQL 3;  3GWR A;  1NU3 A;  3O8Y A;  3CCU 3;  1VQ6 3;  1WQL B;  2GEX A;  3FLJ A;  1W6C A;  2OTJ 3;  1YI2 3;  3H3H A;  1GYB A;  3DZL A;  5IEP A;  5HGR A;  3F8X A;  3V99 A;  1M1X B;  3LML A;  4IIA A;  3EQQ B;  3FCS B;  1IVV A;  4RZM A;  2CFW A;  2A15 A;  2WO0 A;  3JUQ A;  1K41 A;  3HI7 A;  1NWW A;  4JF8 A;  4KFE A;  1OAC A;  4R80 A;  3TDG A;  3UL6 A;  3EX9 A;  3PCS A;  2F98 A;  2CK3 H;  3ECF A;  3JUP A;  3X41 A;  3N8B A;  2W9P A;  2W04 A;  4EV5 A;  2SBL A;  1W6G A;  4L8O A;  1WMN A;  3G8Z A;  2CG0 A;  3WA3 A;  3OWS A;  1E3R A;  3NX0 A;  3G0K A;  3PCR A;  4K1U A;  2HMM B;  1QAL A;  2RFR A;  1QVF 2;  3EF8 A;  3MPH A;  1VQP 3;  2D1W A;  3BNC A;  4EV2 A;  3FGY A;  5DRV A;  2XGN A;  3LTD A;  4R4K A;  4OUQ A;  4QWT A;  3EJV A;  4FMD A;  2Z76 A;  4O8S A;  3VGN A;  3EBY A;  1GY6 A;  4OK0 A;  1ULJ B;  3A76 A;  3LH4 A;  1EQK A;  1YGE A;  1K28 A;  4LSO A;  2C10 A;  1N9J A;  3CPW 2;  3K7C A;  1GS3 A;  5CF1 A;  4EYC A;  3E99 A;  4XBT A;  1GD4 A;  3WOE B;  4EC6 A;  1O7N B;  4BTY A;  2RGQ A;  3LTB A;  4STD A;  3MHE A;  1N8Q A;  4K61 A;  5G2G A;  3S67 A;  1N9E A;  1YVB I;  3Q2P A;  5CF2 A;  1YJN 3;  3UJM A;  1UUV B;  1J2B A;  1GD3 A;  1FUW A;  3EHC A;  3SLU A;  4RBN A;  4BTX A;  5FW5 A;  1TIJ A;  3SOY A;  3X42 A;  1Q7Y 4;  5TGN A;  5IG0 A;  4RNY A;  3SOA A;  3MG3 A;  4HBR A;  3CXC 2;  3KFQ C;  5I97 A;  2CHC A;  1FGQ A;  3IMA B;  2BNG A;  4LMI A;  1C7H A;  1O7H B;  1IVU A;  1W4N A;  3MG1 A;  1VQ4 3;  5CXO A;  3KSP A;  2OQE A;  2V1L A;  3KII A;  1JB2 A;  3MKI A;  3CC7 3;  8CHO A;  3UB1 A;  2OOV C;  4FCZ A;  3G6E 3;  1O7W B;  1AV4 A;  1K9M 4;  3NHX A;  3OX9 A;  2CG1 A;  1D6Z A;  2QA4 3;  3NXJ A;  1JKG B;  1VQM 3;  1YIT 3;  3N54 B;  3D9R A;  4N6O B;  4HKV B;  4MMX B;  3RGA A;  4LEH A;  3QRD A;  1CYV A;  1SII A;  1WMO A;  1VQN 3;  3S5C A;  1W2B 2;  2ZL8 A;  1AVK A;  1W02 A;  1RRL A;  2FGT A;  2E2T A;  2GU1 A;  4KZ1 A;  1GY5 A;  2BMQ B;  2CFD A;  1M1K 4;  3CCE 3;  1FGR A;  3N9H A;  3EN8 A;  1F8N A;  3T8U A;  3MG2 A;  1SPU A;  1ZX2 A;  4H3U A;  4HJL B;  4J9A A;  2IMJ A;  5JPP A;  5D81 A;  1K8A 4;  1VQK 3;  4GL6 A;  1DVC A;  3K0Z A;  3DMC A;  5LC6 A;  5A0O B;  2QGU A;  3LT8 A;  4XM4 A;  3J7Y d;  2B1X B;  2E2V A;  4J8T A;  3IJE B;  5AIH A;  1JRQ A;  1DMN A;  4HM0 B;  4HM6 B;  3S27 A;  1EKM A;  3PGB A;  2WGQ A;  1CQS A;  5AIF A;  1ROA A;  5STD A;  1G96 A;  3DY5 A;  1ZO2 A;  4I4K A;  3KKG A;  1JN5 B;  1OPY A;  2XGL A;  1QAK A;  3T0U A;  3IPT A;  2I9W A;  1QMA A;  3MYT A;  3F9S A;  4HYZ A;  1A67 A;  1IV7 A;  1SIH A;  2PNC A;  1Q81 4;  3K5T A;  3PS8 A;  4IT7 A;  1IT7 A;  3HZP A;  4XDV A;  1DVD A;  4BTW A;  1MOL A;  2CFG A;  2K54 A;  1Z1S A;  1QAF A;  2Z77 A;  4HM7 B;  3CCS 3;  2Z6B A;  5AYS C;  6STD A;  2WOF A;  3FH1 A;  5CK6 A;  2HML B;  2IUJ A;  1HU9 A;  2W0Q A;  1ASK A;  3SXX A;  4FCM A;  5FGO A;  1FGO A;  4CCV A;  4H61 A;  1V74 A;  1UUW B;  2MF7 A;  1QVG 2;  1CYU A;  1TFK A;  2FXT A;  3OWU A;  4KFD A;  5ELU A;  5D82 A;  1YHQ 3;  3H51 A;  2ZDJ A;  5IEO A;  1BUQ A;  5CLK A;  2CIU A;  1OHP A;  3EE1 A;  3JUM A;  1LNH A;  4L7K A;  3GZX B;  3RGR A;  3CC2 3;  2RCD A;  3PZW A;  3CCV 3;  3F7X A;  2GEY A;  1LXE A;  3DGO A;  1UW1 A;  1FGT A;  3T8N A;  1RKY A;  3DGM A;  3LOY A;  1FA3 A;  2F99 A;  4HM3 B;  3SVA A;  4TX4 A;  1OHO A;  3M8C A;  3B4P A;  1E3V A;  1IT8 A;  3U97 A;  3L0R A;  2B24 B;  3GZR A;  4WP5 A;  5IG5 A;  2OQE C;  2INX A;  3VSY A;  2P05 A;  2K0M A;  4R9K A;  1L5G B;  1JNQ A;  3KSE D;  1VQ8 3;  3ROB A;  3QK9 A;  3CCQ 3;  2LQV A;  1JKG A;  1TFO A;  3NM7 A;  4HZ9 B;  1Q40 A;  5BXQ A;  1N5H A;  4R1K A;  1U5O A;  3CCJ 3;  2P0X A;  1FGM A;  1W2Z A;  3G16 A;  5IER A;  2P0M A;  1MNL A;  2UX0 A;  1UI8 A;  1W00 A;  1E97 A;  3LZA A;  3FKA A;  3WOF B;  3X3Z A;  3WOD G;  1KC8 4;  4N3V A;  3JUN A;  5JPU A;  3F7S A;  3CU3 A;  2R4I A;  2M7O A;  5KP3 A;  3PYJ A;  1IK3 A;  4X2O A;  1Q40 B;  1O7G B;  2HMJ B;  2YFL B;  3BNB A;  3MSO A;  4L8P A;  1TUH A;  2XFS A;  3G4S 3;  1WMP A;  1HKX A;  4RNZ A;  3X3Y A;  2CWU A;  5AYR B;  2E2U A;  4O3V A;  2XFT A;  1Y4K A;  5D83 A;  2Z7A A;  4N6N B;  3I56 3;  2CW9 A;  1TU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...