3T8UA

Crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
MNTPEHMTAVVQRAVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIAHFRFNGAGKVVSMRALFGEKNIHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8uA00
3F7SA 3NXJA 3NUVA 3FSDA 4XBTA 3Q90A 5CLKA 1SJWA 1EG9B 3HK4A 4STDA 4HJLB 4WWUC 3IPTA 3I0YA 3JUQA 3GZYB 3KE7A 3SOYA 2CHCA 1ASKA 3DZLA 3GZRA 1E3VA 5G2GA 3JUNA 3JUOA 2IMJA 5IENA 3EF8A 3H51A 4X2OA 4MJDA 4XDVA 1VZZA 5CF1A 2B24B 3KZTA 5CF2A 4I4KA 1Z1SA 5AIFA 1ZO2A 2GEXA 3FGYA 4LMIA 2HMKB 1W01A 3UJMA 2XSOB 2GBWB 2W2CA 2BMRB 3B7CA 4Q53A 4PEJA 1QMAA 2RCDA 4WYKA 3DXOA 5AIGA 4XBYA 2XRXB 4KVHA 2XR8B 5KP4A 1ULJB 1W02A 5BVBA 3LZAA 1DMNA 5D81A 1CQSA 1O7GB 2PZVA 3MKIA 2QGUA 1ISKA 5IG4A 2JQ5A 3K0ZA 3NV0B 5IG5A 2QIYA 3OWUA 1HKXA 3F40A 5AI1A 3NBRA 3JUMA 1OGXA 1O7NB 1U5OA 5FW5A 1JKGB 4H3UA 1GY6A 2RGQA 5EVHA 1W6YA 3GWRA 2GEYA 3DUKA 3GZBA 2R4IA 4K1VA 3EJVA 4J9AA 3A76A 3NM2A 1JN5B 5STDA 1DMMA 3HX8A 3M8CA 3MG2A 3EN8A 1BUQA 2F99A 4HM0B 3BLZA 3HZPA 2GBXB 5AEUB 2HMNB 5AEWB 4L8PA 3CPOA 3F14A 3LYGA 8CHOA 3B4OA 3F7XA 1WQLB 2CKFB 5IEPA 1TUHA 4HKVB 2YFJB 3CNMA 4HM2B 1Q40A 1GY5A 4HM4B 1S5AA 1AR0A 2F86B 4FCJA 5HGRA 1O7WB 3VSYA 2UX0A 3OWSA 3MG3A 4R9LA 3FKAA 2Z7AA 3EN1B 3CU3A 3B4PA 3UNLA 3D9RA 2B1XB 3OX9A 2YFIB 3G8ZA 1OF5B 3NV0A 1Q42A 2GXFA 3BB9A 2HMLB 4WP5A 3RGAA 3G16A 1ZX2A 1OH0A 1OHPA 4HM1B 5IG0A 3OXAA 1E3RA 1JB5A 1A2KA 5D83A 7STDA 1ULIB 1E97A 1NWWA 4U13A 3NHXA 1TP6A 4R1KA 3GZXB 3F9SA 3E99A 4HZBB 3EBTA 3FF2A 5IERA 5D82A 5CK6A 1EA2A 4RZMA 3GRDA 5IF6A 3FZWA 4FCMA 4XBXA 3EHCA 5KP1A 1STDA 3JUPA 5DREA 4HM8B 3OV4A 3FLJA 4WYKB 5DRVA 1JB2A 3DM8A 4L8OA 3SOAA 6STDA 3G0KA 3B8LA 3OWYA 2YFLB 3ROBA 1C7HA 2Z76A 2I9WA 1OF5A 3RGRA 2XSHB 1O7MB 4HM5B 2BNGA 1QJGA 1OHOA 4X2HA 3T8UA 4HM3B 2A15A 3DMCA 1UUVB 3FH1A 5TGNA 3MG1A 2INXA 3FF0A 4HM6B 3EBYA 5JPPA 2BMQB 5AIHA 3EC9A 1GY7A 3SEDA 2Z77A 1O7PB 4OVMA 1IDPA 1O7HB 3MHEA 3KKGA 3F8XA 4ORLA 1W00A 3MSOA 3VGNA 3K7CA 1OGZA 5IEOA 1JB4A 3MYTA 4LEHA 2HMJB 3S5CA 5CXOA 5JPUA 4HZ9B 3H3HA 4XM4A 5KP3A 1JKGA 4XB5A 3WMDA 2OWPA 1Q40B 4GB5A 5BXQA 2K54A 1NDOB 4CDLA 5AIIA 4XDWA 5IG3A 1JN5A 2F98A 1K41A 1OHSA 3CNXA 4R9KA 2HMOB 2BMOB 4HM7B 3T8NA 2STDA 1NU3A 4HVNA 3EQQB 3KSPA 1UUWB 2HMMB 4L7KA 1OUNA 1OPYA 1DMQA 4OUQA 1GS3A 3ECFA 1GYBA 4IIAA 4K1UA 1OCVA 3STDA 3ER7A 3EX9A 4LGQA 2RFRA 4N3VA 3F8HA 4J8TA
chains in the Genus database with same CATH superfamily
1BNSA 1US1A 3F7SA 2BIRA 3NXJA 4EV2A 3NUVA 1K28A 3AMOB 3FSDA 4XBTA 3Q90A 1BNFA 5CLKA 4WHAA 2ML6A 1SJWA 3CME3 1EG9B 1N9JA 3AGNA 1YGEA 3PZWA 1GD4A 3HK4A 1QALA 1I3FA 4STDA 2M7OA 3LTAA 1KQS2 2IY2A 2IUKA 3PS8A 4HJLB 4WWUC 3IPTA 3WOFB 4O8SA 2CH9A 3N54B 2D42A 1Q824 3I0YA 3JUQA 3GZYB 1FUSA 3LTDA 4ILFA 1M1K4 3KE7A 1B2SA 1B27A 1TTOA 3KN4A 1FUTA 5IW9A 3SOYA 2CHCA 2Q07A 3DY5A 1ASKA 3GAXA 1G02A 2W9QA 3DZLA 1VQL3 1IQXA 3SLUA 1HYFA 3GZRA 1DVDA 1BANA 1GMPA 1BRNL 2O9UX 3N8BA 2GSPA 4EW5A 3WOEB 1SARA 3DGOA 1MGRA 3NM7A 1JBTA 1IYYA 1E3VA 5G2GA 4H61A 3FCSB 3CCV3 3JUNA 3JUOA 3PXMA 1BSDA 1CYUA 1UW1A 2IMJA 2CFWA 1KD14 4RNYA 3EF8A 3FG3A 5IENA 2HOHA 2CX1A 3H51A 1B2UA 4X2OA 4KFDA 3S28A 1DE3A 3PCSA 4MJDA 1JZDA 2CG0A 1J2BA 1RGEA 4XDVA 3I563 1RMSA 3CCR3 1RRHA 1VZZA 2J8XB 5LC7A 5CF1A 1IT8A 2B24B 1BRHA 3KZTA 2KCDA 5CF2A 4QWTA 4I4KA 1Z1SA 3BNCA 5AIFA 1ZO2A 3FG4A 1LNHA 2GEXA 1RHLA 1A67A 3NBJA 1IT7A 3FGYA 3CMA3 4LMIA 1KSIA 1IQYA 1W01A 1MWSA 2HMKB 1K9M4 3UJMA 2XSOB 2GBWB 3DGNA 2H0GA 2W2CA 1CEWI 4WFOA 5JBSA 1LRAA 1STFI 1NNVA 1AVLA 3UL6A 2BMRB 1V57A 1W2ZA 1BRGA 2E2TA 3B7CA 4KFEA 3D4AA 1ZS7A 4PEJA 4Q53A 3V99A 1BSEA 2WGOA 1G0TA 1D6ZA 3RDEA 1QMAA 3CCJ3 1RRLA 2RCDA 3DXOA 4WYKA 5AIGA 5ELUA 1L5GB 3K5TA 3Q1CA 4XBYA 2XRXB 4KVHA 2XR8B 1B2ZA 2V1LA 5G1KA 2SBLA 2BO9B 3BU4A 2Y74A 5KP4A 2IA7A 1ULJB 1W02A 1BSCA 4HAAA 5BVBA 3CXC2 1W5ZA 3LZAA 1DMNA 3CCU3 1WMOA 5D81A 1CQSA 1IVWA 1TRQA 1D6UA 1O7GB 2PZVA 3MKIA 1VQP3 1IVXA 2QGUA 3AHWA 5BU4A 1ISKA 1BRJA 3KFQC 1C54A 1BAOA 5IG4A 1W6GA 1VQ43 1GMRA 2JQ5A 2ZDJA 3K0ZA 3NV0B 5EQLA 4AEQA 1MWUA 5IG5A 1BSAA 1FZUA 2QIYA 2C4BA 5IERA 3OWUA 1QAKA 1YHQ3 1HKXA 2W56B 3F40A 5AI1A 3X41A 3LT9A 1VQ53 2P38A 1MNLA 3NBRA 2FXTA 1OGXA 3JUMA 1IVVA 1O7NB 1U5OA 5FW5A 3OW22 2CWUA 2CK3H 1JKGB 4H3UA 4CPKA 3K63A 1JBRA 2AADA 4G1MB 1GY6A 2RGQA 4O02B 4OK0A 1LOWA 1M1XB 3HIGA 4RNTA 4CCVA 6RNTA 1SQWA 5EVHA 3LTCA 1W6YA 3X42A 1I2GA 1BNIA 3GWRA 2CFKA 2CIUA 2GEYA 1RJOA 1T2IA 1K734 3DUKA 3UB1A 3GZBA 2R4IA 4K1VA 3EJVA 4J9AA 2MF7A 2MC8A 3A76A 3BIRA 3NM2A 1JN5B 4DKIA 1B21A 4KZ1A 1DMMA 5STDA 1I70A 3HX8A 3M8CA 4NPBA 1DYUA 1RGHA 3EN8A 3MG2A 2RNTA 1BUQA 2F99A 4HM0B 3BLZA 3HZPA 2GBXB 1JZOA 5AEUB 2HMNB 5AEWB 2F56A 4FMCA 4L8PA 3WA2X 3CPOA 4KFFA 3DH2A 3F14A 2D1WA 1RGGA 3UL5A 4BIRA 2SARA 3LYGA 3CCE3 4LSOA 2IYJA 3B4OA 8CHOA 1I8VA 2F4YA 3F7XA 5M1AA 3NQZA 1B2MA 1WQLB 3D5GA 3ZFZA 2CKFB 5IEPA 1ROVA 1LQGC 1TUHA 3CD63 4HKVB 2YFJB 1AQZA 3CNMA 1B2XA 4FMDA 4HM2B 1Q40A 3L0RA 1FGMA 3I553 3ZG5A 1GY5A 3QK9A 2E2UA 3IMAB 1BNJA 4GL6A 2OOVA 3Q3FA 4N6UA 2QEX3 4HM4B 1BRIA 1BRKA 1AR0A 1LQMB 1S5AA 1I3IA 3NBBA 2F86B 1FUWA 2CWVA 3PCRA 1RGCA 2BT3A 2CW9A 4FCJA 2GU1A 5HGRA 3SX1A 2FNQA 1A90A 2C11A 1O7WB 1VQ63 1X1XA 2KF3A 3AHSA 1YJ93 2AAEA 2UX0A 2WOFA 3ALAA 3VSYA 1RGAA 1CYVA 1FGRA 1V74A 2WOHA 3MG3A 3OWSA 4R9LA 3V92A 1GD3A 3FKAA 3RNTA 1W6CA 4NHFA 2Z7AA 3EN1B 6GSPA 1RSNA 3CU3A 3B4PA 3LT8A 3UNLA 1N9EA 3D9RA 2B1XB 2CG1A 1BUJA 1NB3I 1M904 3OX9A 1YJW3 4HOHA 1TRPA 2YFIB 3G8ZA 1OF5B 1RTUA 2KF6A 1RKYA 3S27A 1ZGXA 2BHMA 2K3DA 3NV0A 1Q42A 2GXFA 3WODG 2OQEA 1R4CA 1UCIA 5ELJA 3BB9A 2QA43 2KAAA 1MGWA 1UGHI 2HMLB 2R41A 3ZG0A 4BL3A 1VQO3 1NB5I 4WP5A 2XFSA 1RCKA 1FGTA 3GSPA 1LVNA 3RGAA 3G16A 1ZX2A 2OQEC 1MOLA 2UGIA 1OH0A 1UDII 2XEPA 1YI23 1QVF2 1N5HA 2W9PA 4N6V0 1TFKA 5I97A 1OHPA 1BNRA 1BNGA 1Q9EA 1UI7A 4HM1B 1F8NA 1JV2B 1WMPA 4GHOA 1IU7A 4ZM8A 1Q7Y4 2C10A 2P05A 4MMYB 2H0HA 1UUGB 3O8YA 3AMOA 1WMNA 5IG0A 3D3LA 3OXAA 4N6MA 1KC84 1E3RA 1JB5A 1WTHA 2LYXA 4R4KA 3U1WA 1RLSA 1A2KA 1Q864 1TJDA 5D83A 7STDA 1ULIB 4N6NB 1YIT3 1E97A 1NWWA 4U13A 1A2PA 3CC73 4BL2A 1YIJ3 1IV7A 4GSPA 1Q7HA 3HIIA 3CCQ3 4LYLB 3NHXA 1X1WA 1TP6A 4R1KA 1X1UA 3CCM3 3GZXB 2ZL8A 4KT3B 2F5WA 4FCZA 1LNIA 2OTJ3 3F9SA 3JVCA 3U97A 1AV4A 1SIHA 1UCJA 3E99A 3G6E3 4HZBB 1FGOA 3DGLA 1FYSA 1SPUA 1D6YA 1N8QA 2F5MA 2W04A 3EE1A 3Q2PA 3EBTA 3WHOA 1I0XA 3G4S3 2KF5A 1RNBA 4MEIA 1I2EA 3FF2A 1VQ83 1LOYA 3LXUX 1W4NA 1PFPA 4N6TA 4RNZA 5CK6A 1EA2A 4IPBA 5D82A 9RNTA 1T3BA 1YNVX 4RZMA 1VQK3 2O3OA 1K8A4 2JDIH 1UI8A 1IK3A 3GRDA 5IF6A 1AY7A 3FZWA 1I0VA 3N9HA 4FCMA 1OACA 4XBXA 1A2VA 3IJEB 3MWZA 2KXGA 3CCS3 3EHCA 5KP1A 1STDA 2ZA4A 1U8CB 1AVKA 3JUPA 3SYUA 5DREA 2WGQA 1ROAA 3OV4A 3FLJA 4HM8B 1X1YA 1KWIA 4WYKB 5DRVA 1T2HA 1JB2A 1MWRA 1RN4A 2XGNA 2CC3A 3CPW2 4BTXA 1RGLA 3DM8A 4L8OA 1EEJA 3KSED 3S67A 3SOAA 3WDGB 4EV5A 3G0KA 2KF4A 6STDA 3B8LA 4BTWA 2W6JH 3OWYA 1M9GA 2YFLB 3D79A 3J7Yd 3ROBA 1C7HA 3CCL3 2Z76A 1IV9A 1R4YA 3QRDA 3AGOA 2I9WA 4TX4A 3URPA 4O2HA 1YJN3 1OF5A 2IUJA 1CH0A 2CFLA 3RGRA 2XSHB 2XGLA 1O7MB 2H0IA 1Q814 2CFGA 4FMBA 4MMZB 4CJNA 3X3XA 3WA3A 3CC23 3G713 4HM5B 3K9MC 5GSPA 4EYCA 3NX0A 1DETA 2XF3A 4RBNA 4BU4A 2BNGA 1QJGA 1N5PA 2LQVA 1OHOA 3EB8A 4X2HA 5LC6A 1RDSA 1MWTA 2K0MA 2A15A 4HM3B 3T8UA 2OOVC 3VF1A 3DMCA 1GOUA 1RGKA 2RBIA 4HYZA 1YGWA 1JNQA 1S723 1NJI4 1RGFA 1UUVB 1RCLA 1YVBI 3FH1A 5TGNA 4AKZA 1TFOA 3MG1A 1JJ22 1WNHA 1UCLA 2INXA 3FF0A 4BTYA 4HM6B 3EBYA 5JPPA 2BMQB 3NQYA 5AIHA 3EC9A 1BIRA 1GY7A 3HOHA 3SEDA 2Z77A 3A5EA 3X40A 1O7PB 1BNEA 4OVMA 1IDPA 1O7HB 1PY3A 3TDGA 3BNBA 3MHEA 3KKGA 5A0OB 4MMXB 3F8XA 2CWTA 4ORLA 1W00A 4J5KA 3S29A 4AKYA 3MSOA 5AYRB 3VGNA 1W2B2 1JRQA 3T0UA 1VQ93 1BRSA 4JF8A 2PNCA 3K7CA 4N6OB 3SVAA 1OGZA 1UCKA 2BU4A 3X3YA 2W56A 3BNDA 3PGBA 1G96A 5G1LA 5IEOA 1JB4A 3MYTA 4I5QA 4LEHA 7GSPA 2HMJB 4FMAA 3S5CA 5CXOA 4R80A 1YVSA 5JPUA 4HZ9B 5EEOA 1IVUA 1QVG2 3H3HA 4XM4A 3DGMA 5KP3A 1JKGA 2Y73A 1TIJA 5RNTA 3BNEA 1W7CA 3PYJA 4IT7A 1DVCA 1GMQA 2E2VA 4NREA 4EBGA 3FG1A 4XB5A 3WMDA 2OWPA 2W0QA 5BIRA 1EQKA 2OCTA 1EUIC 4N6LA 5FGOA 1N8R4 1FW7A 1BVIA 1BGSA 1GSPA 1Q40B 4GB5A 2K54A 1NDOB 4EC6A 4CDLA 1BU4A 5AIIA 5BXQA 1UGIA 3CC43 1VQN3 1HZ1A 3LOYA 1VQQA 3V98A 4LZIA 8RNTA 1LXEA 1NO3A 2XH9A 4K90B 1FGQA 4XDWA 1PYLA 2RSXA 4JRFA 4EXRA 5IG3A 1BOXA 1JN5A 1PU4A 4K61A 3X3ZA 2F98A 2P0XA 1JBSA 1K41A 3SXXA 1OHSA 1VQM3 3CNXA 1GOVA 1RN7A 1LOVA 1V58A 1IQ8A 1SIIA 1BSBA 1HU9A 5AYSC 2L1SA 7RNTA 2WO0A 2HMOB 2BMOB 4R9KA 5HOHA 2P0MA 4HM7B 1EKMA 1LOXA 5M18A 2L4VA 3T8NA 2STDA 1TU5A 1NU3A 5M19A 2CFDA 2W03A 1RNTA 3LH4A 4HVNA 3HI7A 2ZHXB 3EQQB 4FR9A 1Y4KA 2KRTA 1FA3A 2FGTA 3KIIA 2UUGC 2XFTA 3KSPA 1UUWB 2CX0A 2HMMB 1T5YA 4L7KA 3KCHA 2Z6BA 3DGYA 1OUNA 2YX9A 1OPYA 1QAFA 1DMQA 4OUQA 1GS3A 2P09A 1RN1A 3ECFA 1GYBA 4HBRA 4IIAA 4K1UA 1B3SA 3D5IA 1OCVA 2ML5A 3STDA 3ER7A 3EX9A 2OTL3 2GU3A 4LGQA 3LMLA 3MPHA 3WR2A 1VQ73 1I2FA 2RFRA 4N3VA 4O3VA 1GOYA 4J5GA 3LTBA 3F8HA 1B20A 4J8TA
chains in the Genus database with same CATH topology
1US1A 3F7SA 3NXJA 4EV2A 3NUVA 1K28A 3AMOB 3FSDA 4XBTA 3Q90A 5CLKA 4WHAA 2ML6A 1SJWA 3CME3 1EG9B 1N9JA 1YGEA 3PZWA 1GD4A 3HK4A 1QALA 4STDA 2M7OA 3LTAA 1KQS2 2IUKA 3PS8A 4HJLB 4WWUC 3IPTA 3WOFB 4O8SA 2CH9A 3N54B 2D42A 1Q824 3I0YA 3JUQA 3GZYB 3LTDA 1M1K4 3KE7A 3KN4A 5IW9A 3SOYA 2CHCA 2Q07A 3DY5A 1ASKA 3GAXA 2W9QA 3DZLA 1VQL3 1IQXA 3SLUA 3GZRA 1DVDA 2O9UX 3N8BA 3WOEB 3DGOA 3NM7A 1E3VA 5G2GA 4H61A 3FCSB 3CCV3 3JUNA 3JUOA 3PXMA 1CYUA 1UW1A 2IMJA 2CFWA 1KD14 4RNYA 3EF8A 3FG3A 5IENA 3H51A 4X2OA 4KFDA 3S28A 3PCSA 4MJDA 2CG0A 1J2BA 4XDVA 3I563 3CCR3 1RRHA 1VZZA 5LC7A 5CF1A 1IT8A 2B24B 3KZTA 2KCDA 5CF2A 4QWTA 4I4KA 1Z1SA 3BNCA 5AIFA 1ZO2A 3FG4A 1LNHA 2GEXA 1A67A 3NBJA 1IT7A 3FGYA 3CMA3 4LMIA 1KSIA 1IQYA 1W01A 2HMKB 1K9M4 3UJMA 2XSOB 2GBWB 3DGNA 2W2CA 1CEWI 4WFOA 5JBSA 1STFI 1AVLA 3UL6A 2BMRB 1W2ZA 2E2TA 3B7CA 4KFEA 4Q53A 3V99A 4PEJA 2WGOA 1D6ZA 3RDEA 1QMAA 3CCJ3 1RRLA 2RCDA 3DXOA 4WYKA 5AIGA 5ELUA 1L5GB 3K5TA 3Q1CA 4XBYA 2XRXB 4KVHA 2XR8B 2V1LA 5KP4A 2SBLA 2BO9B 2Y74A 2IA7A 1ULJB 1W02A 5BVBA 3CXC2 1W5ZA 3LZAA 1DMNA 3CCU3 1WMOA 5D81A 1CQSA 1IVWA 1D6UA 1O7GB 2PZVA 3MKIA 1VQP3 1IVXA 2QGUA 1ISKA 3KFQC 5IG4A 1W6GA 1VQ43 5EQLA 2JQ5A 2ZDJA 3K0ZA 3NV0B 4AEQA 5IG5A 2QIYA 3OWUA 1QAKA 1YHQ3 1HKXA 2W56B 3F40A 5AI1A 3X41A 3LT9A 1VQ53 2P38A 1MNLA 3NBRA 2FXTA 1OGXA 3JUMA 1IVVA 1O7NB 1U5OA 5FW5A 3OW22 2CWUA 2CK3H 1JKGB 4H3UA 3K63A 4G1MB 1GY6A 2RGQA 4O02B 4OK0A 1M1XB 3HIGA 1SQWA 5EVHA 3LTCA 1W6YA 3X42A 3GWRA 2CFKA 2CIUA 2GEYA 1RJOA 1K734 3DUKA 3UB1A 3GZBA 2R4IA 4K1VA 3EJVA 4J9AA 2MF7A 2MC8A 3A76A 3NM2A 1JN5B 4KZ1A 5STDA 1DMMA 3HX8A 3M8CA 1DYUA 3MG2A 3EN8A 1BUQA 2F99A 4HM0B 3BLZA 3HZPA 2GBXB 5AEUB 2HMNB 5AEWB 4FMCA 4L8PA 3WA2X 3CPOA 4KFFA 3F14A 2D1WA 3UL5A 3LYGA 3CCE3 4LSOA 3B4OA 8CHOA 3F7XA 3NQZA 1WQLB 2CKFB 5IEPA 1ROVA 3CD63 1TUHA 4HKVB 2YFJB 3CNMA 4FMDA 4HM2B 1Q40A 3L0RA 1FGMA 3I553 1GY5A 3QK9A 2E2UA 3IMAB 4GL6A 2OOVA 4N6UA 2QEX3 4HM4B 1S5AA 3NBBA 1AR0A 2F86B 1FUWA 2CWVA 3PCRA 2BT3A 2CW9A 4FCJA 2GU1A 5HGRA 3SX1A 2FNQA 1A90A 2C11A 1O7WB 1VQ63 1YJ93 3ALAA 2UX0A 2WOFA 3VSYA 4CCVA 1CYVA 1FGRA 1V74A 2WOHA 3MG3A 3OWSA 4R9LA 3V92A 1GD3A 3FKAA 1W6CA 4NHFA 2Z7AA 3EN1B 3CU3A 3B4PA 3LT8A 3UNLA 1N9EA 3D9RA 2B1XB 2CG1A 1NB3I 1M904 3OX9A 1YJW3 2YFIB 3G8ZA 1OF5B 1RKYA 3S27A 2BHMA 3NV0A 1Q42A 2GXFA 3WODG 2OQEA 1R4CA 5ELJA 2QA43 3BB9A 1VQO3 2HMLB 1NB5I 4WP5A 2XFSA 1FGTA 1LVNA 3RGAA 3G16A 1ZX2A 2OQEC 1MOLA 2XEPA 1OH0A 1YI23 1QVF2 1N5HA 2W9PA 4N6V0 1TFKA 5I97A 1OHPA 1UI7A 4HM1B 4ZM8A 1F8NA 1JV2B 1WMPA 1IU7A 1Q7Y4 2C10A 2P05A 4MMYB 3O8YA 3AMOA 1WMNA 5IG0A 3D3LA 3OXAA 4N6MA 1KC84 1E3RA 1JB5A 1WTHA 2LYXA 4R4KA 3U1WA 1A2KA 1Q864 5D83A 7STDA 1ULIB 4N6NB 1YIT3 1E97A 1NWWA 4U13A 3CC73 1YIJ3 1IV7A 3CCQ3 3HIIA 3NHXA 1TP6A 4R1KA 3CCM3 3GZXB 2ZL8A 4FCZA 2OTJ3 3F9SA 3JVCA 3U97A 1AV4A 1SIHA 3E99A 3G6E3 4HZBB 1FGOA 3DGLA 1SPUA 1D6YA 1N8QA 2W04A 3EE1A 3Q2PA 3EBTA 3G4S3 4MEIA 3FF2A 1VQ83 5IERA 3LXUX 1W4NA 1PFPA 4N6TA 4RNZA 5CK6A 1EA2A 4IPBA 5D82A 1K8A4 4RZMA 1VQK3 2O3OA 2JDIH 1UI8A 1IK3A 3GRDA 5IF6A 3FZWA 3N9HA 4FCMA 1OACA 4XBXA 1A2VA 3IJEB 3MWZA 2KXGA 3CCS3 3EHCA 5KP1A 1STDA 1U8CB 1AVKA 3JUPA 5DREA 2WGQA 1ROAA 3OV4A 3FLJA 4HM8B 4WYKB 1KWIA 5DRVA 1JB2A 2XGNA 2CC3A 3CPW2 4BTXA 3DM8A 4L8OA 3KSED 3S67A 3SOAA 3WDGB 4EV5A 3G0KA 6STDA 3B8LA 4BTWA 2W6JH 3OWYA 1M9GA 2YFLB 3J7Yd 3ROBA 1C7HA 3CCL3 2Z76A 1IV9A 3QRDA 2I9WA 4TX4A 4O2HA 1YJN3 1OF5A 2IUJA 2CFLA 3RGRA 2XSHB 2XGLA 1O7MB 1Q814 2CFGA 4FMBA 4MMZB 3X3XA 3WA3A 3CC23 3G713 4HM5B 3K9MC 4EYCA 3NX0A 2XF3A 4RBNA 2BNGA 1QJGA 1N5PA 2LQVA 1OHOA 3EB8A 4X2HA 5LC6A 3T8UA 2K0MA 2A15A 4HM3B 2OOVC 3VF1A 3DMCA 4HYZA 1JNQA 1S723 1NJI4 1YVBI 1UUVB 3FH1A 5TGNA 4AKZA 1TFOA 3MG1A 1JJ22 1WNHA 2INXA 3FF0A 4BTYA 4HM6B 3EBYA 5JPPA 2BMQB 3NQYA 5AIHA 3EC9A 1GY7A 3X40A 3SEDA 2Z77A 1O7PB 4OVMA 1IDPA 1O7HB 3TDGA 3BNBA 3MHEA 3KKGA 5A0OB 4MMXB 3F8XA 2CWTA 4ORLA 1W00A 3S29A 4AKYA 3MSOA 5AYRB 3VGNA 1W2B2 1JRQA 3T0UA 1VQ93 4JF8A 2PNCA 3K7CA 4N6OB 3SVAA 1OGZA 3X3YA 2W56A 3BNDA 3PGBA 1G96A 5IEOA 1JB4A 3MYTA 4LEHA 2HMJB 4FMAA 3S5CA 5CXOA 4R80A 5JPUA 4HZ9B 5EEOA 1IVUA 1QVG2 3H3HA 4XM4A 3DGMA 5KP3A 1JKGA 2Y73A 1TIJA 3BNEA 1W7CA 3PYJA 4IT7A 1DVCA 2E2VA 4NREA 4EBGA 3FG1A 4XB5A 3WMDA 2OWPA 2W0QA 1EQKA 2OCTA 4N6LA 5FGOA 1N8R4 4EC6A 1Q40B 4GB5A 5BXQA 2K54A 1NDOB 1VQN3 4CDLA 3CC43 5AIIA 3LOYA 3V98A 4LZIA 1LXEA 1NO3A 2XH9A 4K90B 1FGQA 4XDWA 2RSXA 4JRFA 4EXRA 5IG3A 1JN5A 1PU4A 4K61A 3X3ZA 2F98A 2P0XA 1K41A 3SXXA 1OHSA 1VQM3 3CNXA 1RN7A 1IQ8A 1SIIA 1HU9A 5AYSC 2WO0A 2HMOB 2BMOB 4R9KA 2P0MA 4HM7B 1EKMA 1LOXA 2L4VA 3T8NA 2STDA 1TU5A 1NU3A 2CFDA 2W03A 3LH4A 4HVNA 3HI7A 3EQQB 4FR9A 1Y4KA 2KRTA 1FA3A 2FGTA 3KIIA 2XFTA 3KSPA 1UUWB 2HMMB 1T5YA 4L7KA 2Z6BA 1OUNA 2YX9A 1OPYA 1QAFA 1DMQA 4OUQA 1GS3A 2P09A 3ECFA 1GYBA 4HBRA 4IIAA 4K1UA 1OCVA 2ML5A 3STDA 3ER7A 3EX9A 2OTL3 2GU3A 4LGQA 3LMLA 3MPHA 1VQ73 2RFRA 4N3VA 4O3VA 3LTBA 3F8HA 4J8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F7S A;  3NXJ A;  3NUV A;  3FSD A;  4XBT A;  3Q90 A;  5CLK A;  1SJW A;  1EG9 B;  3HK4 A;  4STD A;  4HJL B;  4WWU C;  3IPT A;  3I0Y A;  3JUQ A;  3GZY B;  3KE7 A;  3SOY A;  2CHC A;  1ASK A;  3DZL A;  3GZR A;  1E3V A;  5G2G A;  3JUN A;  3JUO A;  2IMJ A;  5IEN A;  3EF8 A;  3H51 A;  4X2O A;  4MJD A;  4XDV A;  1VZZ A;  5CF1 A;  2B24 B;  3KZT A;  5CF2 A;  4I4K A;  1Z1S A;  5AIF A;  1ZO2 A;  2GEX A;  3FGY A;  4LMI A;  2HMK B;  1W01 A;  3UJM A;  2XSO B;  2GBW B;  2W2C A;  2BMR B;  3B7C A;  4Q53 A;  4PEJ A;  1QMA A;  2RCD A;  4WYK A;  3DXO A;  5AIG A;  4XBY A;  2XRX B;  4KVH A;  2XR8 B;  5KP4 A;  1ULJ B;  1W02 A;  5BVB A;  3LZA A;  1DMN A;  5D81 A;  1CQS A;  1O7G B;  2PZV A;  3MKI A;  2QGU A;  1ISK A;  5IG4 A;  2JQ5 A;  3K0Z A;  3NV0 B;  5IG5 A;  2QIY A;  3OWU A;  1HKX A;  3F40 A;  5AI1 A;  3NBR A;  3JUM A;  1OGX A;  1O7N B;  1U5O A;  5FW5 A;  1JKG B;  4H3U A;  1GY6 A;  2RGQ A;  5EVH A;  1W6Y A;  3GWR A;  2GEY A;  3DUK A;  3GZB A;  2R4I A;  4K1V A;  3EJV A;  4J9A A;  3A76 A;  3NM2 A;  1JN5 B;  5STD A;  1DMM A;  3HX8 A;  3M8C A;  3MG2 A;  3EN8 A;  1BUQ A;  2F99 A;  4HM0 B;  3BLZ A;  3HZP A;  2GBX B;  5AEU B;  2HMN B;  5AEW B;  4L8P A;  3CPO A;  3F14 A;  3LYG A;  8CHO A;  3B4O A;  3F7X A;  1WQL B;  2CKF B;  5IEP A;  1TUH A;  4HKV B;  2YFJ B;  3CNM A;  4HM2 B;  1Q40 A;  1GY5 A;  4HM4 B;  1S5A A;  1AR0 A;  2F86 B;  4FCJ A;  5HGR A;  1O7W B;  3VSY A;  2UX0 A;  3OWS A;  3MG3 A;  4R9L A;  3FKA A;  2Z7A A;  3EN1 B;  3CU3 A;  3B4P A;  3UNL A;  3D9R A;  2B1X B;  3OX9 A;  2YFI B;  3G8Z A;  1OF5 B;  3NV0 A;  1Q42 A;  2GXF A;  3BB9 A;  2HML B;  4WP5 A;  3RGA A;  3G16 A;  1ZX2 A;  1OH0 A;  1OHP A;  4HM1 B;  5IG0 A;  3OXA A;  1E3R A;  1JB5 A;  1A2K A;  5D83 A;  7STD A;  1ULI B;  1E97 A;  1NWW A;  4U13 A;  3NHX A;  1TP6 A;  4R1K A;  3GZX B;  3F9S A;  3E99 A;  4HZB B;  3EBT A;  3FF2 A;  5IER A;  5D82 A;  5CK6 A;  1EA2 A;  4RZM A;  3GRD A;  5IF6 A;  3FZW A;  4FCM A;  4XBX A;  3EHC A;  5KP1 A;  1STD A;  3JUP A;  5DRE A;  4HM8 B;  3OV4 A;  3FLJ A;  4WYK B;  5DRV A;  1JB2 A;  3DM8 A;  4L8O A;  3SOA A;  6STD A;  3G0K A;  3B8L A;  3OWY A;  2YFL B;  3ROB A;  1C7H A;  2Z76 A;  2I9W A;  1OF5 A;  3RGR A;  2XSH B;  1O7M B;  4HM5 B;  2BNG A;  1QJG A;  1OHO A;  4X2H A;  3T8U A;  4HM3 B;  2A15 A;  3DMC A;  1UUV B;  3FH1 A;  5TGN A;  3MG1 A;  2INX A;  3FF0 A;  4HM6 B;  3EBY A;  5JPP A;  2BMQ B;  5AIH A;  3EC9 A;  1GY7 A;  3SED A;  2Z77 A;  1O7P B;  4OVM A;  1IDP A;  1O7H B;  3MHE A;  3KKG A;  3F8X A;  4ORL A;  1W00 A;  3MSO A;  3VGN A;  3K7C A;  1OGZ A;  5IEO A;  1JB4 A;  3MYT A;  4LEH A;  2HMJ B;  3S5C A;  5CXO A;  5JPU A;  4HZ9 B;  3H3H A;  4XM4 A;  5KP3 A;  1JKG A;  4XB5 A;  3WMD A;  2OWP A;  1Q40 B;  4GB5 A;  5BXQ A;  2K54 A;  1NDO B;  4CDL A;  5AII A;  4XDW A;  5IG3 A;  1JN5 A;  2F98 A;  1K41 A;  1OHS A;  3CNX A;  4R9K A;  2HMO B;  2BMO B;  4HM7 B;  3T8N A;  2STD A;  1NU3 A;  4HVN A;  3EQQ B;  3KSP A;  1UUW B;  2HMM B;  4L7K A;  1OUN A;  1OPY A;  1DMQ A;  4OUQ A;  1GS3 A;  3ECF A;  1GYB A;  4IIA A;  4K1U A;  1OCV A;  3STD A;  3ER7 A;  3EX9 A;  4LGQ A;  2RFR A;  4N3V A;  3F8H A;  4J8T A; 
#chains in the Genus database with same CATH topology
 1BNS A;  1US1 A;  3F7S A;  2BIR A;  3NXJ A;  4EV2 A;  3NUV A;  1K28 A;  3AMO B;  3FSD A;  4XBT A;  3Q90 A;  1BNF A;  5CLK A;  4WHA A;  2ML6 A;  1SJW A;  3CME 3;  1EG9 B;  1N9J A;  3AGN A;  1YGE A;  3PZW A;  1GD4 A;  3HK4 A;  1QAL A;  1I3F A;  4STD A;  2M7O A;  3LTA A;  1KQS 2;  2IY2 A;  2IUK A;  3PS8 A;  4HJL B;  4WWU C;  3IPT A;  3WOF B;  4O8S A;  2CH9 A;  3N54 B;  2D42 A;  1Q82 4;  3I0Y A;  3JUQ A;  3GZY B;  1FUS A;  3LTD A;  4ILF A;  1M1K 4;  3KE7 A;  1B2S A;  1B27 A;  1TTO A;  3KN4 A;  1FUT A;  5IW9 A;  3SOY A;  2CHC A;  2Q07 A;  3DY5 A;  1ASK A;  3GAX A;  1G02 A;  2W9Q A;  3DZL A;  1VQL 3;  1IQX A;  3SLU A;  1HYF A;  3GZR A;  1DVD A;  1BAN A;  1GMP A;  1BRN L;  2O9U X;  3N8B A;  2GSP A;  4EW5 A;  3WOE B;  1SAR A;  3DGO A;  1MGR A;  3NM7 A;  1JBT A;  1IYY A;  1E3V A;  5G2G A;  4H61 A;  3FCS B;  3CCV 3;  3JUN A;  3JUO A;  3PXM A;  1BSD A;  1CYU A;  1UW1 A;  2IMJ A;  2CFW A;  1KD1 4;  4RNY A;  3EF8 A;  3FG3 A;  5IEN A;  2HOH A;  2CX1 A;  3H51 A;  1B2U A;  4X2O A;  4KFD A;  3S28 A;  1DE3 A;  3PCS A;  4MJD A;  1JZD A;  2CG0 A;  1J2B A;  1RGE A;  4XDV A;  3I56 3;  1RMS A;  3CCR 3;  1RRH A;  1VZZ A;  2J8X B;  5LC7 A;  5CF1 A;  1IT8 A;  2B24 B;  1BRH A;  3KZT A;  2KCD A;  5CF2 A;  4QWT A;  4I4K A;  1Z1S A;  3BNC A;  5AIF A;  1ZO2 A;  3FG4 A;  1LNH A;  2GEX A;  1RHL A;  1A67 A;  3NBJ A;  1IT7 A;  3FGY A;  3CMA 3;  4LMI A;  1KSI A;  1IQY A;  1W01 A;  1MWS A;  2HMK B;  1K9M 4;  3UJM A;  2XSO B;  2GBW B;  3DGN A;  2H0G A;  2W2C A;  1CEW I;  4WFO A;  5JBS A;  1LRA A;  1STF I;  1NNV A;  1AVL A;  3UL6 A;  2BMR B;  1V57 A;  1W2Z A;  1BRG A;  2E2T A;  3B7C A;  4KFE A;  3D4A A;  1ZS7 A;  4PEJ A;  4Q53 A;  3V99 A;  1BSE A;  2WGO A;  1G0T A;  1D6Z A;  3RDE A;  1QMA A;  3CCJ 3;  1RRL A;  2RCD A;  3DXO A;  4WYK A;  5AIG A;  5ELU A;  1L5G B;  3K5T A;  3Q1C A;  4XBY A;  2XRX B;  4KVH A;  2XR8 B;  1B2Z A;  2V1L A;  5G1K A;  2SBL A;  2BO9 B;  3BU4 A;  2Y74 A;  5KP4 A;  2IA7 A;  1ULJ B;  1W02 A;  1BSC A;  4HAA A;  5BVB A;  3CXC 2;  1W5Z A;  3LZA A;  1DMN A;  3CCU 3;  1WMO A;  5D81 A;  1CQS A;  1IVW A;  1TRQ A;  1D6U A;  1O7G B;  2PZV A;  3MKI A;  1VQP 3;  1IVX A;  2QGU A;  3AHW A;  5BU4 A;  1ISK A;  1BRJ A;  3KFQ C;  1C54 A;  1BAO A;  5IG4 A;  1W6G A;  1VQ4 3;  1GMR A;  2JQ5 A;  2ZDJ A;  3K0Z A;  3NV0 B;  5EQL A;  4AEQ A;  1MWU A;  5IG5 A;  1BSA A;  1FZU A;  2QIY A;  2C4B A;  5IER A;  3OWU A;  1QAK A;  1YHQ 3;  1HKX A;  2W56 B;  3F40 A;  5AI1 A;  3X41 A;  3LT9 A;  1VQ5 3;  2P38 A;  1MNL A;  3NBR A;  2FXT A;  1OGX A;  3JUM A;  1IVV A;  1O7N B;  1U5O A;  5FW5 A;  3OW2 2;  2CWU A;  2CK3 H;  1JKG B;  4H3U A;  4CPK A;  3K63 A;  1JBR A;  2AAD A;  4G1M B;  1GY6 A;  2RGQ A;  4O02 B;  4OK0 A;  1LOW A;  1M1X B;  3HIG A;  4RNT A;  4CCV A;  6RNT A;  1SQW A;  5EVH A;  3LTC A;  1W6Y A;  3X42 A;  1I2G A;  1BNI A;  3GWR A;  2CFK A;  2CIU A;  2GEY A;  1RJO A;  1T2I A;  1K73 4;  3DUK A;  3UB1 A;  3GZB A;  2R4I A;  4K1V A;  3EJV A;  4J9A A;  2MF7 A;  2MC8 A;  3A76 A;  3BIR A;  3NM2 A;  1JN5 B;  4DKI A;  1B21 A;  4KZ1 A;  1DMM A;  5STD A;  1I70 A;  3HX8 A;  3M8C A;  4NPB A;  1DYU A;  1RGH A;  3EN8 A;  3MG2 A;  2RNT A;  1BUQ A;  2F99 A;  4HM0 B;  3BLZ A;  3HZP A;  2GBX B;  1JZO A;  5AEU B;  2HMN B;  5AEW B;  2F56 A;  4FMC A;  4L8P A;  3WA2 X;  3CPO A;  4KFF A;  3DH2 A;  3F14 A;  2D1W A;  1RGG A;  3UL5 A;  4BIR A;  2SAR A;  3LYG A;  3CCE 3;  4LSO A;  2IYJ A;  3B4O A;  8CHO A;  1I8V A;  2F4Y A;  3F7X A;  5M1A A;  3NQZ A;  1B2M A;  1WQL B;  3D5G A;  3ZFZ A;  2CKF B;  5IEP A;  1ROV A;  1LQG C;  1TUH A;  3CD6 3;  4HKV B;  2YFJ B;  1AQZ A;  3CNM A;  1B2X A;  4FMD A;  4HM2 B;  1Q40 A;  3L0R A;  1FGM A;  3I55 3;  3ZG5 A;  1GY5 A;  3QK9 A;  2E2U A;  3IMA B;  1BNJ A;  4GL6 A;  2OOV A;  3Q3F A;  4N6U A;  2QEX 3;  4HM4 B;  1BRI A;  1BRK A;  1AR0 A;  1LQM B;  1S5A A;  1I3I A;  3NBB A;  2F86 B;  1FUW A;  2CWV A;  3PCR A;  1RGC A;  2BT3 A;  2CW9 A;  4FCJ A;  2GU1 A;  5HGR A;  3SX1 A;  2FNQ A;  1A90 A;  2C11 A;  1O7W B;  1VQ6 3;  1X1X A;  2KF3 A;  3AHS A;  1YJ9 3;  2AAE A;  2UX0 A;  2WOF A;  3ALA A;  3VSY A;  1RGA A;  1CYV A;  1FGR A;  1V74 A;  2WOH A;  3MG3 A;  3OWS A;  4R9L A;  3V92 A;  1GD3 A;  3FKA A;  3RNT A;  1W6C A;  4NHF A;  2Z7A A;  3EN1 B;  6GSP A;  1RSN A;  3CU3 A;  3B4P A;  3LT8 A;  3UNL A;  1N9E A;  3D9R A;  2B1X B;  2CG1 A;  1BUJ A;  1NB3 I;  1M90 4;  3OX9 A;  1YJW 3;  4HOH A;  1TRP A;  2YFI B;  3G8Z A;  1OF5 B;  1RTU A;  2KF6 A;  1RKY A;  3S27 A;  1ZGX A;  2BHM A;  2K3D A;  3NV0 A;  1Q42 A;  2GXF A;  3WOD G;  2OQE A;  1R4C A;  1UCI A;  5ELJ A;  3BB9 A;  2QA4 3;  2KAA A;  1MGW A;  1UGH I;  2HML B;  2R41 A;  3ZG0 A;  4BL3 A;  1VQO 3;  1NB5 I;  4WP5 A;  2XFS A;  1RCK A;  1FGT A;  3GSP A;  1LVN A;  3RGA A;  3G16 A;  1ZX2 A;  2OQE C;  1MOL A;  2UGI A;  1OH0 A;  1UDI I;  2XEP A;  1YI2 3;  1QVF 2;  1N5H A;  2W9P A;  4N6V 0;  1TFK A;  5I97 A;  1OHP A;  1BNR A;  1BNG A;  1Q9E A;  1UI7 A;  4HM1 B;  1F8N A;  1JV2 B;  1WMP A;  4GHO A;  1IU7 A;  4ZM8 A;  1Q7Y 4;  2C10 A;  2P05 A;  4MMY B;  2H0H A;  1UUG B;  3O8Y A;  3AMO A;  1WMN A;  5IG0 A;  3D3L A;  3OXA A;  4N6M A;  1KC8 4;  1E3R A;  1JB5 A;  1WTH A;  2LYX A;  4R4K A;  3U1W A;  1RLS A;  1A2K A;  1Q86 4;  1TJD A;  5D83 A;  7STD A;  1ULI B;  4N6N B;  1YIT 3;  1E97 A;  1NWW A;  4U13 A;  1A2P A;  3CC7 3;  4BL2 A;  1YIJ 3;  1IV7 A;  4GSP A;  1Q7H A;  3HII A;  3CCQ 3;  4LYL B;  3NHX A;  1X1W A;  1TP6 A;  4R1K A;  1X1U A;  3CCM 3;  3GZX B;  2ZL8 A;  4KT3 B;  2F5W A;  4FCZ A;  1LNI A;  2OTJ 3;  3F9S A;  3JVC A;  3U97 A;  1AV4 A;  1SIH A;  1UCJ A;  3E99 A;  3G6E 3;  4HZB B;  1FGO A;  3DGL A;  1FYS A;  1SPU A;  1D6Y A;  1N8Q A;  2F5M A;  2W04 A;  3EE1 A;  3Q2P A;  3EBT A;  3WHO A;  1I0X A;  3G4S 3;  2KF5 A;  1RNB A;  4MEI A;  1I2E A;  3FF2 A;  1VQ8 3;  1LOY A;  3LXU X;  1W4N A;  1PFP A;  4N6T A;  4RNZ A;  5CK6 A;  1EA2 A;  4IPB A;  5D82 A;  9RNT A;  1T3B A;  1YNV X;  4RZM A;  1VQK 3;  2O3O A;  1K8A 4;  2JDI H;  1UI8 A;  1IK3 A;  3GRD A;  5IF6 A;  1AY7 A;  3FZW A;  1I0V A;  3N9H A;  4FCM A;  1OAC A;  4XBX A;  1A2V A;  3IJE B;  3MWZ A;  2KXG A;  3CCS 3;  3EHC A;  5KP1 A;  1STD A;  2ZA4 A;  1U8C B;  1AVK A;  3JUP A;  3SYU A;  5DRE A;  2WGQ A;  1ROA A;  3OV4 A;  3FLJ A;  4HM8 B;  1X1Y A;  1KWI A;  4WYK B;  5DRV A;  1T2H A;  1JB2 A;  1MWR A;  1RN4 A;  2XGN A;  2CC3 A;  3CPW 2;  4BTX A;  1RGL A;  3DM8 A;  4L8O A;  1EEJ A;  3KSE D;  3S67 A;  3SOA A;  3WDG B;  4EV5 A;  3G0K A;  2KF4 A;  6STD A;  3B8L A;  4BTW A;  2W6J H;  3OWY A;  1M9G A;  2YFL B;  3D79 A;  3J7Y d;  3ROB A;  1C7H A;  3CCL 3;  2Z76 A;  1IV9 A;  1R4Y A;  3QRD A;  3AGO A;  2I9W A;  4TX4 A;  3URP A;  4O2H A;  1YJN 3;  1OF5 A;  2IUJ A;  1CH0 A;  2CFL A;  3RGR A;  2XSH B;  2XGL A;  1O7M B;  2H0I A;  1Q81 4;  2CFG A;  4FMB A;  4MMZ B;  4CJN A;  3X3X A;  3WA3 A;  3CC2 3;  3G71 3;  4HM5 B;  3K9M C;  5GSP A;  4EYC A;  3NX0 A;  1DET A;  2XF3 A;  4RBN A;  4BU4 A;  2BNG A;  1QJG A;  1N5P A;  2LQV A;  1OHO A;  3EB8 A;  4X2H A;  5LC6 A;  1RDS A;  1MWT A;  2K0M A;  2A15 A;  4HM3 B;  3T8U A;  2OOV C;  3VF1 A;  3DMC A;  1GOU A;  1RGK A;  2RBI A;  4HYZ A;  1YGW A;  1JNQ A;  1S72 3;  1NJI 4;  1RGF A;  1UUV B;  1RCL A;  1YVB I;  3FH1 A;  5TGN A;  4AKZ A;  1TFO A;  3MG1 A;  1JJ2 2;  1WNH A;  1UCL A;  2INX A;  3FF0 A;  4BTY A;  4HM6 B;  3EBY A;  5JPP A;  2BMQ B;  3NQY A;  5AIH A;  3EC9 A;  1BIR A;  1GY7 A;  3HOH A;  3SED A;  2Z77 A;  3A5E A;  3X40 A;  1O7P B;  1BNE A;  4OVM A;  1IDP A;  1O7H B;  1PY3 A;  3TDG A;  3BNB A;  3MHE A;  3KKG A;  5A0O B;  4MMX B;  3F8X A;  2CWT A;  4ORL A;  1W00 A;  4J5K A;  3S29 A;  4AKY A;  3MSO A;  5AYR B;  3VGN A;  1W2B 2;  1JRQ A;  3T0U A;  1VQ9 3;  1BRS A;  4JF8 A;  2PNC A;  3K7C A;  4N6O B;  3SVA A;  1OGZ A;  1UCK A;  2BU4 A;  3X3Y A;  2W56 A;  3BND A;  3PGB A;  1G96 A;  5G1L A;  5IEO A;  1JB4 A;  3MYT A;  4I5Q A;  4LEH A;  7GSP A;  2HMJ B;  4FMA A;  3S5C A;  5CXO A;  4R80 A;  1YVS A;  5JPU A;  4HZ9 B;  5EEO A;  1IVU A;  1QVG 2;  3H3H A;  4XM4 A;  3DGM A;  5KP3 A;  1JKG A;  2Y73 A;  1TIJ A;  5RNT A;  3BNE A;  1W7C A;  3PYJ A;  4IT7 A;  1DVC A;  1GMQ A;  2E2V A;  4NRE A;  4EBG A;  3FG1 A;  4XB5 A;  3WMD A;  2OWP A;  2W0Q A;  5BIR A;  1EQK A;  2OCT A;  1EUI C;  4N6L A;  5FGO A;  1N8R 4;  1FW7 A;  1BVI A;  1BGS A;  1GSP A;  1Q40 B;  4GB5 A;  2K54 A;  1NDO B;  4EC6 A;  4CDL A;  1BU4 A;  5AII A;  5BXQ A;  1UGI A;  3CC4 3;  1VQN 3;  1HZ1 A;  3LOY A;  1VQQ A;  3V98 A;  4LZI A;  8RNT A;  1LXE A;  1NO3 A;  2XH9 A;  4K90 B;  1FGQ A;  4XDW A;  1PYL A;  2RSX A;  4JRF A;  4EXR A;  5IG3 A;  1BOX A;  1JN5 A;  1PU4 A;  4K61 A;  3X3Z A;  2F98 A;  2P0X A;  1JBS A;  1K41 A;  3SXX A;  1OHS A;  1VQM 3;  3CNX A;  1GOV A;  1RN7 A;  1LOV A;  1V58 A;  1IQ8 A;  1SII A;  1BSB A;  1HU9 A;  5AYS C;  2L1S A;  7RNT A;  2WO0 A;  2HMO B;  2BMO B;  4R9K A;  5HOH A;  2P0M A;  4HM7 B;  1EKM A;  1LOX A;  5M18 A;  2L4V A;  3T8N A;  2STD A;  1TU5 A;  1NU3 A;  5M19 A;  2CFD A;  2W03 A;  1RNT A;  3LH4 A;  4HVN A;  3HI7 A;  2ZHX B;  3EQQ B;  4FR9 A;  1Y4K A;  2KRT A;  1FA3 A;  2FGT A;  3KII A;  2UUG C;  2XFT A;  3KSP A;  1UUW B;  2CX0 A;  2HMM B;  1T5Y A;  4L7K A;  3KCH A;  2Z6B A;  3DGY A;  1OUN A;  2YX9 A;  1OPY A;  1QAF A;  1DMQ A;  4OUQ A;  1GS3 A;  2P09 A;  1RN1 A;  3ECF A;  1GYB A;  4HBR A;  4IIA A;  4K1U A;  1B3S A;  3D5I A;  1OCV A;  2ML5 A;  3STD A;  3ER7 A;  3EX9 A;  2OTL 3;  2GU3 A;  4LGQ A;  3LML A;  3MPH A;  3WR2 A;  1VQ7 3;  1I2F A;  2RFR A;  4N3V A;  4O3V A;  1GOY A;  4J5G A;  3LTB A;  3F8H A;  1B20 A;  4J8T A; 
#chains in the Genus database with same CATH homology
 1US1 A;  3F7S A;  3NXJ A;  4EV2 A;  3NUV A;  1K28 A;  3AMO B;  3FSD A;  4XBT A;  3Q90 A;  5CLK A;  4WHA A;  2ML6 A;  1SJW A;  3CME 3;  1EG9 B;  1N9J A;  1YGE A;  3PZW A;  1GD4 A;  3HK4 A;  1QAL A;  4STD A;  2M7O A;  3LTA A;  1KQS 2;  2IUK A;  3PS8 A;  4HJL B;  4WWU C;  3IPT A;  3WOF B;  4O8S A;  2CH9 A;  3N54 B;  2D42 A;  1Q82 4;  3I0Y A;  3JUQ A;  3GZY B;  3LTD A;  1M1K 4;  3KE7 A;  3KN4 A;  5IW9 A;  3SOY A;  2CHC A;  2Q07 A;  3DY5 A;  1ASK A;  3GAX A;  2W9Q A;  3DZL A;  1VQL 3;  1IQX A;  3SLU A;  3GZR A;  1DVD A;  2O9U X;  3N8B A;  3WOE B;  3DGO A;  3NM7 A;  1E3V A;  5G2G A;  4H61 A;  3FCS B;  3CCV 3;  3JUN A;  3JUO A;  3PXM A;  1CYU A;  1UW1 A;  2IMJ A;  2CFW A;  1KD1 4;  4RNY A;  3EF8 A;  3FG3 A;  5IEN A;  3H51 A;  4X2O A;  4KFD A;  3S28 A;  3PCS A;  4MJD A;  2CG0 A;  1J2B A;  4XDV A;  3I56 3;  3CCR 3;  1RRH A;  1VZZ A;  5LC7 A;  5CF1 A;  1IT8 A;  2B24 B;  3KZT A;  2KCD A;  5CF2 A;  4QWT A;  4I4K A;  1Z1S A;  3BNC A;  5AIF A;  1ZO2 A;  3FG4 A;  1LNH A;  2GEX A;  1A67 A;  3NBJ A;  1IT7 A;  3FGY A;  3CMA 3;  4LMI A;  1KSI A;  1IQY A;  1W01 A;  2HMK B;  1K9M 4;  3UJM A;  2XSO B;  2GBW B;  3DGN A;  2W2C A;  1CEW I;  4WFO A;  5JBS A;  1STF I;  1AVL A;  3UL6 A;  2BMR B;  1W2Z A;  2E2T A;  3B7C A;  4KFE A;  4Q53 A;  3V99 A;  4PEJ A;  2WGO A;  1D6Z A;  3RDE A;  1QMA A;  3CCJ 3;  1RRL A;  2RCD A;  3DXO A;  4WYK A;  5AIG A;  5ELU A;  1L5G B;  3K5T A;  3Q1C A;  4XBY A;  2XRX B;  4KVH A;  2XR8 B;  2V1L A;  5KP4 A;  2SBL A;  2BO9 B;  2Y74 A;  2IA7 A;  1ULJ B;  1W02 A;  5BVB A;  3CXC 2;  1W5Z A;  3LZA A;  1DMN A;  3CCU 3;  1WMO A;  5D81 A;  1CQS A;  1IVW A;  1D6U A;  1O7G B;  2PZV A;  3MKI A;  1VQP 3;  1IVX A;  2QGU A;  1ISK A;  3KFQ C;  5IG4 A;  1W6G A;  1VQ4 3;  5EQL A;  2JQ5 A;  2ZDJ A;  3K0Z A;  3NV0 B;  4AEQ A;  5IG5 A;  2QIY A;  3OWU A;  1QAK A;  1YHQ 3;  1HKX A;  2W56 B;  3F40 A;  5AI1 A;  3X41 A;  3LT9 A;  1VQ5 3;  2P38 A;  1MNL A;  3NBR A;  2FXT A;  1OGX A;  3JUM A;  1IVV A;  1O7N B;  1U5O A;  5FW5 A;  3OW2 2;  2CWU A;  2CK3 H;  1JKG B;  4H3U A;  3K63 A;  4G1M B;  1GY6 A;  2RGQ A;  4O02 B;  4OK0 A;  1M1X B;  3HIG A;  1SQW A;  5EVH A;  3LTC A;  1W6Y A;  3X42 A;  3GWR A;  2CFK A;  2CIU A;  2GEY A;  1RJO A;  1K73 4;  3DUK A;  3UB1 A;  3GZB A;  2R4I A;  4K1V A;  3EJV A;  4J9A A;  2MF7 A;  2MC8 A;  3A76 A;  3NM2 A;  1JN5 B;  4KZ1 A;  5STD A;  1DMM A;  3HX8 A;  3M8C A;  1DYU A;  3MG2 A;  3EN8 A;  1BUQ A;  2F99 A;  4HM0 B;  3BLZ A;  3HZP A;  2GBX B;  5AEU B;  2HMN B;  5AEW B;  4FMC A;  4L8P A;  3WA2 X;  3CPO A;  4KFF A;  3F14 A;  2D1W A;  3UL5 A;  3LYG A;  3CCE 3;  4LSO A;  3B4O A;  8CHO A;  3F7X A;  3NQZ A;  1WQL B;  2CKF B;  5IEP A;  1ROV A;  3CD6 3;  1TUH A;  4HKV B;  2YFJ B;  3CNM A;  4FMD A;  4HM2 B;  1Q40 A;  3L0R A;  1FGM A;  3I55 3;  1GY5 A;  3QK9 A;  2E2U A;  3IMA B;  4GL6 A;  2OOV A;  4N6U A;  2QEX 3;  4HM4 B;  1S5A A;  3NBB A;  1AR0 A;  2F86 B;  1FUW A;  2CWV A;  3PCR A;  2BT3 A;  2CW9 A;  4FCJ A;  2GU1 A;  5HGR A;  3SX1 A;  2FNQ A;  1A90 A;  2C11 A;  1O7W B;  1VQ6 3;  1YJ9 3;  3ALA A;  2UX0 A;  2WOF A;  3VSY A;  4CCV A;  1CYV A;  1FGR A;  1V74 A;  2WOH A;  3MG3 A;  3OWS A;  4R9L A;  3V92 A;  1GD3 A;  3FKA A;  1W6C A;  4NHF A;  2Z7A A;  3EN1 B;  3CU3 A;  3B4P A;  3LT8 A;  3UNL A;  1N9E A;  3D9R A;  2B1X B;  2CG1 A;  1NB3 I;  1M90 4;  3OX9 A;  1YJW 3;  2YFI B;  3G8Z A;  1OF5 B;  1RKY A;  3S27 A;  2BHM A;  3NV0 A;  1Q42 A;  2GXF A;  3WOD G;  2OQE A;  1R4C A;  5ELJ A;  2QA4 3;  3BB9 A;  1VQO 3;  2HML B;  1NB5 I;  4WP5 A;  2XFS A;  1FGT A;  1LVN A;  3RGA A;  3G16 A;  1ZX2 A;  2OQE C;  1MOL A;  2XEP A;  1OH0 A;  1YI2 3;  1QVF 2;  1N5H A;  2W9P A;  4N6V 0;  1TFK A;  5I97 A;  1OHP A;  1UI7 A;  4HM1 B;  4ZM8 A;  1F8N A;  1JV2 B;  1WMP A;  1IU7 A;  1Q7Y 4;  2C10 A;  2P05 A;  4MMY B;  3O8Y A;  3AMO A;  1WMN A;  5IG0 A;  3D3L A;  3OXA A;  4N6M A;  1KC8 4;  1E3R A;  1JB5 A;  1WTH A;  2LYX A;  4R4K A;  3U1W A;  1A2K A;  1Q86 4;  5D83 A;  7STD A;  1ULI B;  4N6N B;  1YIT 3;  1E97 A;  1NWW A;  4U13 A;  3CC7 3;  1YIJ 3;  1IV7 A;  3CCQ 3;  3HII A;  3NHX A;  1TP6 A;  4R1K A;  3CCM 3;  3GZX B;  2ZL8 A;  4FCZ A;  2OTJ 3;  3F9S A;  3JVC A;  3U97 A;  1AV4 A;  1SIH A;  3E99 A;  3G6E 3;  4HZB B;  1FGO A;  3DGL A;  1SPU A;  1D6Y A;  1N8Q A;  2W04 A;  3EE1 A;  3Q2P A;  3EBT A;  3G4S 3;  4MEI A;  3FF2 A;  1VQ8 3;  5IER A;  3LXU X;  1W4N A;  1PFP A;  4N6T A;  4RNZ A;  5CK6 A;  1EA2 A;  4IPB A;  5D82 A;  1K8A 4;  4RZM A;  1VQK 3;  2O3O A;  2JDI H;  1UI8 A;  1IK3 A;  3GRD A;  5IF6 A;  3FZW A;  3N9H A;  4FCM A;  1OAC A;  4XBX A;  1A2V A;  3IJE B;  3MWZ A;  2KXG A;  3CCS 3;  3EHC A;  5KP1 A;  1STD A;  1U8C B;  1AVK A;  3JUP A;  5DRE A;  2WGQ A;  1ROA A;  3OV4 A;  3FLJ A;  4HM8 B;  4WYK B;  1KWI A;  5DRV A;  1JB2 A;  2XGN A;  2CC3 A;  3CPW 2;  4BTX A;  3DM8 A;  4L8O A;  3KSE D;  3S67 A;  3SOA A;  3WDG B;  4EV5 A;  3G0K A;  6STD A;  3B8L A;  4BTW A;  2W6J H;  3OWY A;  1M9G A;  2YFL B;  3J7Y d;  3ROB A;  1C7H A;  3CCL 3;  2Z76 A;  1IV9 A;  3QRD A;  2I9W A;  4TX4 A;  4O2H A;  1YJN 3;  1OF5 A;  2IUJ A;  2CFL A;  3RGR A;  2XSH B;  2XGL A;  1O7M B;  1Q81 4;  2CFG A;  4FMB A;  4MMZ B;  3X3X A;  3WA3 A;  3CC2 3;  3G71 3;  4HM5 B;  3K9M C;  4EYC A;  3NX0 A;  2XF3 A;  4RBN A;  2BNG A;  1QJG A;  1N5P A;  2LQV A;  1OHO A;  3EB8 A;  4X2H A;  5LC6 A;  3T8U A;  2K0M A;  2A15 A;  4HM3 B;  2OOV C;  3VF1 A;  3DMC A;  4HYZ A;  1JNQ A;  1S72 3;  1NJI 4;  1YVB I;  1UUV B;  3FH1 A;  5TGN A;  4AKZ A;  1TFO A;  3MG1 A;  1JJ2 2;  1WNH A;  2INX A;  3FF0 A;  4BTY A;  4HM6 B;  3EBY A;  5JPP A;  2BMQ B;  3NQY A;  5AIH A;  3EC9 A;  1GY7 A;  3X40 A;  3SED A;  2Z77 A;  1O7P B;  4OVM A;  1IDP A;  1O7H B;  3TDG A;  3BNB A;  3MHE A;  3KKG A;  5A0O B;  4MMX B;  3F8X A;  2CWT A;  4ORL A;  1W00 A;  3S29 A;  4AKY A;  3MSO A;  5AYR B;  3VGN A;  1W2B 2;  1JRQ A;  3T0U A;  1VQ9 3;  4JF8 A;  2PNC A;  3K7C A;  4N6O B;  3SVA A;  1OGZ A;  3X3Y A;  2W56 A;  3BND A;  3PGB A;  1G96 A;  5IEO A;  1JB4 A;  3MYT A;  4LEH A;  2HMJ B;  4FMA A;  3S5C A;  5CXO A;  4R80 A;  5JPU A;  4HZ9 B;  5EEO A;  1IVU A;  1QVG 2;  3H3H A;  4XM4 A;  3DGM A;  5KP3 A;  1JKG A;  2Y73 A;  1TIJ A;  3BNE A;  1W7C A;  3PYJ A;  4IT7 A;  1DVC A;  2E2V A;  4NRE A;  4EBG A;  3FG1 A;  4XB5 A;  3WMD A;  2OWP A;  2W0Q A;  1EQK A;  2OCT A;  4N6L A;  5FGO A;  1N8R 4;  4EC6 A;  1Q40 B;  4GB5 A;  5BXQ A;  2K54 A;  1NDO B;  1VQN 3;  4CDL A;  3CC4 3;  5AII A;  3LOY A;  3V98 A;  4LZI A;  1LXE A;  1NO3 A;  2XH9 A;  4K90 B;  1FGQ A;  4XDW A;  2RSX A;  4JRF A;  4EXR A;  5IG3 A;  1JN5 A;  1PU4 A;  4K61 A;  3X3Z A;  2F98 A;  2P0X A;  1K41 A;  3SXX A;  1OHS A;  1VQM 3;  3CNX A;  1RN7 A;  1IQ8 A;  1SII A;  1HU9 A;  5AYS C;  2WO0 A;  2HMO B;  2BMO B;  4R9K A;  2P0M A;  4HM7 B;  1EKM A;  1LOX A;  2L4V A;  3T8N A;  2STD A;  1TU5 A;  1NU3 A;  2CFD A;  2W03 A;  3LH4 A;  4HVN A;  3HI7 A;  3EQQ B;  4FR9 A;  1Y4K A;  2KRT A;  1FA3 A;  2FGT A;  3KII A;  2XFT A;  3KSP A;  1UUW B;  2HMM B;  1T5Y A;  4L7K A;  2Z6B A;  1OUN A;  2YX9 A;  1OPY A;  1QAF A;  1DMQ A;  4OUQ A;  1GS3 A;  2P09 A;  3ECF A;  1GYB A;  4HBR A;  4IIA A;  4K1U A;  1OCV A;  2ML5 A;  3STD A;  3ER7 A;  3EX9 A;  2OTL 3;  2GU3 A;  4LGQ A;  3LML A;  3MPH A;  1VQ7 3;  2RFR A;  4N3V A;  4O3V A;  3LTB A;  3F8H A;  4J8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...