3T8UA

Crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'MNTPEHMTAVVQRAVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIAHFRFNGAGKVVSMRALFGEKNIHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8uA00
4HVNA 2K54A 2CHCA 3EBTA 4HM4B 1VZZA 4CDLA 1O7PB 3NUVA 5AI1A 3RGRA 2HMMB 7STDA 2Z76A 1OH0A 4HM0B 5IEOA 1GY6A 5CK6A 4HM8B 5BVBA 1K41A 3F8XA 2F86B 3KE7A 3OWYA 1OGZA 3T8UA 5IEPA 2HMKB 2RCDA 4HM6B 1JB5A 5AIFA 2UX0A 5DRVA 3B7CA 1ASKA 2HMNB 1IDPA 3JUPA 3B4OA 3ECFA 5BXQA 4L8PA 3NXJA 4XBXA 3SEDA 3GZBA 1OF5A 3NV0B 3SOYA 3KSPA 4HM3B 3FZWA 3NHXA 4R1KA 2BMRB 5G2GA 3KKGA 1JN5A 2QIYA 5CF1A 2IMJA 2XR8B 2B24B 4N3VA 1NWWA 1U5OA 3EN8A 5CLKA 2HMJB 5D81A 5STDA 1ULIB 5DREA 3B8LA 1EA2A 2F99A 1S5AA 4WYKB 1JKGB 3DXOA 5CF2A 4IIAA 3VGNA 4X2HA 4FCJA 2Z77A 4STDA 3H3HA 5KP3A 3I0YA 1O7GB 3EN1B 1OHPA 3F9SA 3T8NA 3K7CA 1ZX2A 1Q40A 5HGRA 1SJWA 3HK4A 4XM4A 3HZPA 1Z1SA 3FSDA 1W00A 3G16A 6STDA 2GEXA 3FF2A 1E3VA 4MJDA 1JB4A 4I4KA 5IG3A 1GYBA 3M8CA 1ULJB 2F98A 1W02A 5IF6A 3MKIA 3EF8A 3JUQA 3ROBA 4HM2B 1C7HA 3ER7A 1NDOB 1O7NB 4R9KA 5KP4A 1STDA 4OUQA 1OPYA 2W2CA 2JQ5A 3EBYA 2INXA 3FLJA 3GWRA 3JUMA 5AIGA 3JUNA 3FF0A 4J8TA 5CXOA 3EC9A 3NBRA 3NM2A 3BB9A 3OWSA 3LZAA 4RZMA 5JPUA 4LEHA 1ZO2A 1JB2A 3OX9A 1NU3A 2A15A 4FCMA 2I9WA 3F7XA 4L8OA 1E97A 3RGAA 3MHEA 2R4IA 3OWUA 4WYKA 2HMLB 1W6YA 4K1UA 4XB5A 4R9LA 1A2KA 4H3UA 1OF5B 2CKFB 3UJMA 1JN5B 1AR0A 3CNMA 4HM7B 2QGUA 2YFLB 5AIHA 1ISKA 5AEUB 1OGXA 3MSOA 3K0ZA 4LMIA 3SOAA 3G8ZA 2GBXB 3F7SA 1GY7A 1UUWB 5D83A 3MG1A 4WP5A 4XBYA 1DMQA 1O7MB 3GZYB 3EX9A 3STDA 3E99A 4X2OA 5AIIA 1BUQA 2GXFA 3B4PA 2HMOB 2BNGA 2STDA 1GY5A 3DM8A 3D9RA 4KVHA 4U13A 1DMMA 1CQSA 1UUVB 3UNLA 1HKXA 2RGQA 1TUHA 4ORLA 3GRDA 4PEJA 5KP1A 4OVMA 3OV4A 1OUNA 4XBTA 4J9AA 3S5CA 3Q90A 4L7KA 5IENA 1O7WB 3H51A 1QMAA 4WWUC 4HM1B 5AEWB 4HM5B 1OCVA 2XSOB 3FH1A 1GS3A 3DMCA 2B1XB 3OXAA 3LYGA 3GZRA 5FW5A 3CU3A 3NV0A 2XSHB 4LGQA 2YFJB 2OWPA 8CHOA 3IPTA 3CPOA 4XDVA 3MG2A 3FKAA 4HZ9B 3WMDA 2GBWB 1QJGA 1JKGA 3A76A 3BLZA 4Q53A 3DUKA 3G0KA 3JUOA 1WQLB 4HJLB 3KZTA 3FGYA 2YFIB 4HKVB 3EQQB 1EG9B 2PZVA 5EVHA 2GEYA 1E3RA 5IG0A 5IG4A 3CNXA 1TP6A 3F8HA 5D82A 3EHCA 3F40A 1DMNA 1W01A 1OHSA 4GB5A 5IERA 3MG3A 2RFRA 3HX8A 1O7HB 3DZLA 2BMOB 3VSYA 5JPPA 2Z7AA 4XDWA 3EJVA 4K1VA 5IG5A 2XRXB 4HZBB 1OHOA 1Q40B 3F14A 5TGNA 1Q42A 2BMQB 3MYTA 3GZXB
chains in the Genus database with same CATH superfamily
1UI7A 2Y74A 4J5GA 1T2IA 4HVNA 1BGSA 1LQGC 3AHWA 2K54A 1KD14 1WNHA 3N54B 1B20A 1RGFA 1FYSA 1ZGXA 2CHCA 1F8NA 3EBTA 3FG4A 4GL6A 4HM4B 2CWTA 1VZZA 1UCLA 2ZDJA 3CCJ3 4MMXB 4TX4A 4CDLA 1O7PB 2CG0A 1K734 3CCS3 4EW5A 3NUVA 5AI1A 3RGRA 2HMMB 1RGKA 2L4VA 1N9EA 7STDA 2Z76A 1YIJ3 2L1SA 1OH0A 4HM0B 1I3IA 1D6UA 8RNTA 3J7Yd 5IEOA 5A0OB 1GY6A 3LOYA 2CX1A 1B2UA 5CK6A 1VQO3 1IV9A 3Q1CA 4HM8B 3JVCA 2GU1A 1CEWI 3HIGA 1CYUA 1HU9A 2RSXA 5BVBA 1B21A 1K41A 3F8XA 2F86B 3KE7A 1TJDA 2QA43 1QVF2 3OWYA 1Q9EA 2PNCA 2QEX3 1I3FA 1OGZA 3UB1A 4J5KA 3T8UA 5IEPA 1IVXA 4HOHA 2HMKB 2RCDA 2W03A 4HM6B 1JB5A 5AIFA 1EKMA 3MWZA 1BRKA 2UX0A 5LC7A 1RKYA 1QAKA 5DRVA 1LOXA 3B7CA 1QVG2 4JRFA 1IQ8A 1LQMB 4ZM8A 2WGQA 3G4S3 1ASKA 4MEIA 4BU4A 2HMNB 5M18A 1IDPA 3JUPA 3B4OA 3ECFA 5BXQA 4L8PA 1LOWA 3NXJA 2IY2A 1FW7A 1FA3A 4NHFA 3WA3A 1Q864 2IYJA 4N6UA 4XBXA 2C4BA 3SEDA 3GZBA 1OF5A 2W04A 1BNGA 3NV0B 3SOYA 1B2ZA 3KSPA 4HM3B 2OTL3 3FZWA 3NHXA 3EE1A 2BMRB 4R1KA 3KKGA 1JN5A 5G2GA 2QIYA 3QRDA 2OOVA 3SVAA 1L5GB 5CF1A 1RDSA 2CFGA 2XEPA 2IMJA 3LH4A 1IU7A 3CMA3 1BSAA 3DGYA 3WOEB 4EYCA 1RHLA 3Q2PA 1LRAA 2E2VA 2XR8B 3KIIA 3X3XA 2B24B 7RNTA 1KWIA 3D3LA 3URPA 6GSPA 1WMPA 2W56B 4BL2A 3NBBA 1W4NA 1HZ1A 1RRLA 1V57A 4N3VA 3VF1A 1M1K4 2C10A 2UGIA 3I553 1BSCA 1NWWA 1U5OA 3EN8A 5CLKA 5M1AA 2HMJB 4HAAA 1A90A 5D81A 5FGOA 5STDA 1ULIB 5I97A 3N8BA 1Q814 1TIJA 5DREA 1MGRA 1KC84 2BO9B 2KF5A 5EQLA 2CFWA 3B8LA 4NREA 1EA2A 3DGNA 1BRIA 2F99A 1S5AA 1X1WA 2SARA 4WYKB 1JKGB 3DXOA 5CF2A 1MWRA 4IIAA 1UCJA 2CH9A 3UL5A 3VGNA 3PZWA 3CCV3 4X2HA 4FCJA 1FGRA 2Z77A 4STDA 3H3HA 4LSOA 1GOUA 1IV7A 2E2TA 2WGOA 3N9HA 5KP3A 1PFPA 3I0YA 1TU5A 4EXRA 1RGLA 1O7GB 4N6NB 1GMPA 1X1YA 4N6V0 1BUJA 4LZIA 2ZA4A 1NB3I 1SIHA 3QK9A 3EN1B 1JZDA 1OHPA 3F9SA 3T8NA 1LNHA 2KCDA 2WOFA 3RDEA 2ML5A 3K7CA 1ZX2A 4GSPA 2RBIA 3CC43 1Q40A 3SYUA 1BVIA 4KFDA 5EEOA 2D42A 2LQVA 1N8QA 1BNFA 1RRHA 1TFOA 3CC23 5HGRA 1SARA 1SJWA 2JDIH 4CJNA 3IJEB 3WDGB 3DY5A 3HK4A 1JZOA 4XM4A 3HZPA 3NX0A 1Z1SA 3HOHA 3FSDA 1W00A 3G16A 4DKIA 6STDA 3CPW2 2XFTA 2GEXA 3FG3A 3FF2A 3LTDA 1E3VA 1RN1A 4MJDA 4AKZA 1JB4A 1FUTA 4I4KA 1K8A4 3GSPA 5IG3A 1B2XA 2H0HA 4N6OB 3SXXA 4KFFA 1MNLA 4FMBA 1FGOA 3DGLA 4K61A 3WOFB 3CCQ3 1GYBA 1RLSA 2Q07A 3M8CA 1PYLA 1I0XA 1ULJB 2F98A 1M1XB 1W02A 2CFLA 5IF6A 1BOXA 3MKIA 1W6CA 3EF8A 2CFDA 3JUQA 3ROBA 1Q7Y4 1IT7A 4HM2B 3CME3 1C7HA 3ER7A 1FZUA 2ML6A 1NDOB 1O7NB 3X3YA 3AHSA 3G6E3 1JBRA 1X1UA 3LTCA 4R9KA 5KP4A 1LVNA 1NO3A 1STDA 1YJN3 4BTXA 3PXMA 4LYLB 4OUQA 1IT8A 3LT9A 5AYRB 1AQZA 1OPYA 1PU4A 2W2CA 2IUKA 4ILFA 3NBJA 1NNVA 3CCM3 1B3SA 1DVCA 3S29A 2JQ5A 3X3ZA 3D79A 1YVBI 3ALAA 2BT3A 1AY7A 2INXA 2AADA 3AMOA 3EBYA 3FLJA 3GWRA 3MPHA 3T0UA 3ZG0A 1DVDA 3JUMA 1CH0A 5AIGA 1G02A 1RMSA 3WHOA 1K9M4 2K0MA 3LMLA 3Q3FA 1R4YA 4O2HA 3JUNA 3HIIA 2M7OA 1A2PA 1LOYA 3UL6A 1VQP3 2BU4A 4O02B 1GMRA 2F5WA 1B2MA 1SQWA 3FF0A 4J8TA 2XGLA 1N8R4 3CCL3 5HOHA 3CCR3 1WMOA 5CXOA 1UGHI 1RN4A 1R4CA 1D6ZA 1TRPA 3EC9A 3KN4A 3NBRA 3S27A 1BNJA 3NM2A 3BB9A 3OWSA 3LZAA 4RZMA 1GD3A 2XH9A 5JPUA 6RNTA 1GOYA 1YGWA 1ZO2A 4LEHA 1JB2A 1J2BA 3BNCA 1NU3A 3OX9A 4RBNA 1AV4A 1G0TA 1EEJA 4AKYA 2A15A 1EQKA 2CFKA 2GSPA 2I9WA 3F7XA 4FCMA 4IPBA 4L8OA 3KCHA 4EC6A 1VQ73 1E97A 3K63A 3RGAA 1IQYA 3MHEA 1YGEA 1U8CB 2R4IA 1FGTA 3OWUA 4WYKA 1MWUA 1W6YA 2HMLB 4K1UA 4R9LA 4XB5A 1UW1A 1A2KA 1Y4KA 5BU4A 3PCSA 1ROAA 4H3UA 1V58A 3ZG5A 2W9PA 3I563 1OF5B 1QALA 1I70A 3KSED 2SBLA 1VQ63 2CWUA 2IUJA 1MWTA 2CKFB 1GSPA 3UJMA 2CG1A 1JN5B 1IYYA 1AR0A 3CNMA 1N5HA 4HM7B 1FUWA 2QGUA 2FGTA 5M19A 2YFLB 5AIHA 3X42A 1ISKA 2R41A 4EV5A 5AEUB 1OGXA 1RGAA 1MOLA 1W7CA 3CC73 1VQN3 3MSOA 3K0ZA 4LMIA 1JBTA 4I5QA 2OOVC 1FGMA 3SOAA 1NB5I 4MMZB 1M9GA 1ZS7A 1RCLA 1BRJA 3DH2A 1RNTA 1I2FA 1K28A 2FNQA 3V98A 1TTOA 1I2EA 3G8ZA 2GBXB 3PCRA 1TRQA 1GOVA 3F7SA 1IVWA 2HOHA 3U97A 1RGEA 2OTJ3 1GY7A 1UUWB 1US1A 2C11A 1CYVA 3BNEA 3MG1A 5D83A 2OQEA 9RNTA 3L0RA 4WP5A 1GMQA 4XBYA 3WR2A 2XFSA 1DMQA 2P0MA 1O7MB 3GZYB 2KAAA 3NQYA 1VQ83 1DE3A 1VQQA 3PS8A 3EX9A 2CIUA 3STDA 4CPKA 1C54A 2H0IA 3LTAA 1LXEA 4K90B 3E99A 1BRHA 4KT3B 1A2VA 4X2OA 5AIIA 5ELUA 1DYUA 1BUQA 2GXFA 3SX1A 2BHMA 3GAXA 1SIIA 2CWVA 1RSNA 3SLUA 1WMNA 1BRNL 3U1WA 1YNVX 3AGNA 1BSDA 1BNRA 2GU3A 3B4PA 1EUIC 2KXGA 1VQ93 4BTWA 5LC6A 4OK0A 1UUGB 2HMOB 1RCKA 2BNGA 2STDA 1GY5A 3V92A 1LOVA 3DM8A 1TFKA 4N6TA 1WTHA 1BSBA 3D9RA 2UUGC 2V1LA 3PYJA 4KVHA 3X41A 3G713 4U13A 1DMMA 2K3DA 1CQSA 1UUVB 1JNQA 3UNLA 2H0GA 2Z6BA 1HKXA 1N9JA 1TUHA 2RGQA 4IT7A 3X40A 3WA2X 4ORLA 3GRDA 2MC8A 2P09A 3LTBA 2OQEC 3LXUX 4PEJA 1MWSA 1VQ53 5KP1A 1UDII 4OVMA 3OV4A 2CX0A 3D5IA 4O8SA 1OUNA 4XBTA 4J9AA 1Q7HA 2F5MA 3S5CA 3Q90A 4L7KA 5IENA 4H61A 1O7WB 3H51A 3BU4A 4HBRA 1QMAA 2W9QA 4EV2A 3CCU3 4WWUC 1A67A 4HM1B 5AEWB 7GSPA 3AGOA 3K9MC 3NM7A 1T2HA 2ZHXB 2E2UA 4HM5B 1OCVA 2XSOB 1YJW3 3FH1A 1IVVA 1BRSA 1GS3A 4N6MA 3DMCA 2B1XB 2KF4A 3LYGA 3OXAA 3GZRA 5FW5A 1JV2B 3CU3A 2OCTA 5ELJA 1BSEA 1BU4A 2W6JH 3NV0A 2XSHB 4LGQA 2YFJB 3TDGA 5RNTA 3DGOA 1G96A 4WHAA 1IVUA 1UCKA 1JBSA 4FR9A 1AVKA 2P0XA 1UGIA 2XGNA 4KZ1A 1RTUA 3FCSB 1AVLA 3ZFZA 1KQS2 2OWPA 1BAOA 2F56A 4MMYB 1YI23 1N5PA 2WOHA 8CHOA 2W56A 2KF6A 1RN7A 3EB8A 3CCE3 3CXC2 4HYZA 1RGGA 3IPTA 3PGBA 3AMOB 1BNIA 3CPOA 1JJ22 2KF3A 1BNSA 1YJ93 4XDVA 3S67A 4FCZA 2ZL8A 1FUSA 3MG2A 3FKAA 1VQL3 4HZ9B 5GSPA 1Q824 5G1LA 3WMDA 4O3VA 1V74A 2GBWB 1QJGA 2IA7A 4BIRA 1JKGA 1SPUA 2MF7A 2O9UX 2W0QA 3BIRA 3A76A 3BLZA 1RJOA 4Q53A 1LNIA 3DUKA 4BTYA 3G0KA 2J8XB 3JUOA 1WQLB 4HJLB 3KZTA 3FGYA 2YFIB 4KFEA 3RNTA 1B27A 1W6GA 4HKVB 2LYXA 3EQQB 4N6LA 3V99A 1EG9B 1RGHA 3DGMA 5AYSC 3D5GA 1M904 2PZVA 5EVHA 1VQM3 4G1MB 2GEYA 2Y73A 1NJI4 4EBGA 1E3RA 3S28A 1PY3A 5IG0A 4AEQA 3A5EA 5IG4A 2FXTA 3K5TA 3OW22 3CNXA 1TP6A 2RNTA 2YX9A 1T3BA 2O3OA 4FMDA 3BNDA 3F8HA 3O8YA 1B2SA 1DETA 1GD4A 1UI8A 5D82A 1IQXA 3EHCA 3F40A 3LT8A 1DMNA 1W01A 1OHSA 4GB5A 5IERA 1VQK3 5G1KA 3FG1A 2BIRA 1VQ43 3D4AA 2CK3H 3MG3A 1KSIA 2CW9A 2RFRA 3HX8A 1IK3A 4WFOA 1BNEA 1O7HB 3DZLA 2P05A 4NPBA 2BMOB 3IMAB 1BANA 4QWTA 3VSYA 4R4KA 5JPPA 1W2ZA 1UCIA 2Z7AA 1YVSA 4GHOA 4RNTA 5IW9A 1STFI 1OACA 1BIRA 1I0VA 1RGCA 2WO0A 2F4YA 1T5YA 1I8VA 4XDWA 1YHQ3 5BIRA 3EJVA 4K1VA 1D6YA 1ROVA 1HYFA 5IG5A 1YIT3 2XRXB 3KFQC 4HZBB 4CCVA 5JBSA 1QAFA 2P38A 3NQZA 2AAEA 1MGWA 3HI7A 1OHOA 4JF8A 4R80A 4BL3A 1Q40B 4FMCA 3F14A 3CD63 2CC3A 1W5ZA 5TGNA 1Q42A 1RNBA 1FGQA 1JRQA 2D1WA 4RNZA 4FMAA 2BMQB 3MYTA 4RNYA 1W2B2 1X1XA 3BNBA 3GZXB 3WODG 1I2GA 2XF3A 1S723 2KRTA 1BRGA
chains in the Genus database with same CATH topology
1UI7A 2Y74A 4HVNA 2K54A 1KD14 1WNHA 3N54B 1A90A 2CHCA 3EBTA 1F8NA 3FG4A 4GL6A 4HM4B 2CWTA 1VZZA 2ZDJA 4MMXB 4TX4A 4CDLA 1O7PB 2CG0A 1K734 3CCS3 3NUVA 5AI1A 3RGRA 2HMMB 2L4VA 1N9EA 7STDA 2Z76A 1YIJ3 1OH0A 4HM0B 1D6UA 3J7Yd 5IEOA 5A0OB 1GY6A 3LOYA 5CK6A 1VQO3 1IV9A 3Q1CA 4HM8B 3JVCA 2GU1A 1CEWI 3HIGA 1CYUA 1HU9A 2RSXA 5BVBA 1K41A 3F8XA 2F86B 3KE7A 2QA43 1QVF2 3OWYA 2PNCA 2QEX3 1OGZA 3UB1A 3T8UA 5IEPA 1IVXA 2HMKB 2RCDA 2W03A 4HM6B 1JB5A 5AIFA 1EKMA 3MWZA 2UX0A 5LC7A 1RKYA 1QAKA 5DRVA 1LOXA 3B7CA 1QVG2 4JRFA 1IQ8A 4ZM8A 2WGQA 3G4S3 1ASKA 4MEIA 2HMNB 1IDPA 3JUPA 3B4OA 3ECFA 5BXQA 4L8PA 3NXJA 1FA3A 4NHFA 3WA3A 1Q864 4N6UA 4XBXA 3SEDA 3GZBA 1OF5A 2W04A 3NV0B 3SOYA 3KSPA 4HM3B 2OTL3 3FZWA 3NHXA 3EE1A 2BMRB 4R1KA 3KKGA 1JN5A 5G2GA 2QIYA 3QRDA 2OOVA 3SVAA 1L5GB 5CF1A 2CFGA 2XEPA 2IMJA 3LH4A 1IU7A 3CMA3 4EYCA 3WOEB 3Q2PA 2E2VA 2XR8B 3KIIA 3X3XA 2B24B 1KWIA 3D3LA 1WMPA 2W56B 3NBBA 1W4NA 1RRLA 4N3VA 3VF1A 1M1K4 2C10A 3I553 1NWWA 1U5OA 3EN8A 5CLKA 2HMJB 5D81A 5FGOA 5STDA 1ULIB 5I97A 3N8BA 1Q814 1TIJA 5DREA 1KC84 2BO9B 5EQLA 2CFWA 3B8LA 4NREA 1EA2A 3DGNA 2F99A 1S5AA 4WYKB 1JKGB 3DXOA 5CF2A 4IIAA 2CH9A 3UL5A 3VGNA 3PZWA 3CCV3 4X2HA 4FCJA 1FGRA 2Z77A 4STDA 3H3HA 4LSOA 1IV7A 2E2TA 2WGOA 3N9HA 5KP3A 1PFPA 3I0YA 1TU5A 4EXRA 1O7GB 4N6NB 4N6V0 4LZIA 1NB3I 1SIHA 3QK9A 3EN1B 1OHPA 3F9SA 3T8NA 1LNHA 2KCDA 2WOFA 3RDEA 2ML5A 3K7CA 1ZX2A 3CC43 1Q40A 4KFDA 5EEOA 2D42A 2LQVA 1N8QA 1RRHA 1TFOA 3CC23 5HGRA 1SJWA 2JDIH 3IJEB 3WDGB 3DY5A 3HK4A 4XM4A 3HZPA 3NX0A 1Z1SA 3FSDA 1W00A 3G16A 6STDA 3CPW2 2XFTA 2GEXA 3FG3A 3FF2A 3LTDA 1E3VA 4MJDA 4AKZA 1JB4A 4I4KA 1K8A4 5IG3A 4N6OB 3SXXA 4KFFA 1MNLA 4FMBA 1FGOA 3DGLA 4K61A 3WOFB 3CCQ3 1GYBA 2Q07A 3M8CA 1ULJB 2F98A 1M1XB 1W02A 2CFLA 5IF6A 3MKIA 1W6CA 3EF8A 2CFDA 3JUQA 3ROBA 1Q7Y4 1IT7A 4HM2B 3CME3 1C7HA 3ER7A 2ML6A 1NDOB 1O7NB 3X3YA 3G6E3 3LTCA 4R9KA 5KP4A 1LVNA 1NO3A 1STDA 1YJN3 4BTXA 3PXMA 4OUQA 1IT8A 3LT9A 5AYRB 1OPYA 1PU4A 2W2CA 2IUKA 3NBJA 3CCM3 1DVCA 3S29A 2JQ5A 3X3ZA 1YVBI 3ALAA 2BT3A 3AMOA 2INXA 3EBYA 3FLJA 3GWRA 3T0UA 3MPHA 1DVDA 3JUMA 5AIGA 1K9M4 2K0MA 3LMLA 4O2HA 3JUNA 3HIIA 2M7OA 1VQP3 3UL6A 4O02B 1SQWA 3FF0A 4J8TA 2XGLA 1N8R4 3CCL3 3CCR3 1WMOA 5CXOA 1R4CA 1D6ZA 3KN4A 3EC9A 3NBRA 3S27A 3NM2A 3BB9A 3OWSA 3LZAA 4RZMA 1GD3A 2XH9A 5JPUA 4LEHA 1ZO2A 1JB2A 1J2BA 3BNCA 1NU3A 3OX9A 4RBNA 1AV4A 4AKYA 2A15A 1EQKA 2CFKA 2I9WA 3F7XA 4FCMA 4IPBA 4L8OA 4EC6A 1VQ73 1E97A 3K63A 3RGAA 1IQYA 3MHEA 1YGEA 1U8CB 2R4IA 1FGTA 3OWUA 4WYKA 2HMLB 1W6YA 4K1UA 4XB5A 4R9LA 1UW1A 1A2KA 1Y4KA 3PCSA 1ROAA 4H3UA 2W9PA 3I563 1OF5B 1QALA 3KSED 2SBLA 1VQ63 2CWUA 2IUJA 2CKFB 3UJMA 2CG1A 1JN5B 1AR0A 3CNMA 1N5HA 4HM7B 1FUWA 2QGUA 2FGTA 2YFLB 5AIHA 3X42A 1ISKA 4EV5A 5AEUB 1OGXA 1MOLA 1W7CA 3CC73 1VQN3 3MSOA 3K0ZA 4LMIA 2OOVC 1FGMA 3SOAA 1NB5I 4MMZB 1M9GA 1K28A 2FNQA 3V98A 3G8ZA 2GBXB 3PCRA 3F7SA 1IVWA 3U97A 2OTJ3 1GY7A 1UUWB 1US1A 2C11A 1CYVA 3BNEA 3MG1A 5D83A 2OQEA 3L0RA 4WP5A 4XBYA 2XFSA 1DMQA 2P0MA 1O7MB 3GZYB 3NQYA 1VQ83 3PS8A 3EX9A 2CIUA 3STDA 3LTAA 1LXEA 4K90B 3E99A 4X2OA 5AIIA 1A2VA 5ELUA 1DYUA 1BUQA 2GXFA 3SX1A 2BHMA 3GAXA 1SIIA 2CWVA 3SLUA 1WMNA 3U1WA 2GU3A 3B4PA 1VQ93 4BTWA 5LC6A 4OK0A 2HMOB 2BNGA 2STDA 1GY5A 3V92A 3DM8A 4N6TA 1TFKA 1WTHA 3D9RA 4KVHA 2V1LA 3PYJA 3X41A 3G713 4U13A 1DMMA 1CQSA 1UUVB 1JNQA 3UNLA 2Z6BA 1HKXA 1N9JA 1TUHA 2RGQA 4IT7A 3X40A 3WA2X 4ORLA 3GRDA 2MC8A 2P09A 3LTBA 2OQEC 3LXUX 4PEJA 1VQ53 5KP1A 4OVMA 3OV4A 4O8SA 1OUNA 4XBTA 4J9AA 3S5CA 3Q90A 4L7KA 5IENA 4H61A 1O7WB 3H51A 4HBRA 1QMAA 2W9QA 4EV2A 3CCU3 4WWUC 1A67A 4HM1B 5AEWB 3K9MC 3NM7A 2E2UA 4HM5B 1OCVA 2XSOB 1YJW3 3FH1A 1IVVA 1GS3A 4N6MA 3DMCA 2B1XB 3OXAA 3LYGA 3GZRA 5FW5A 1JV2B 3CU3A 2OCTA 5ELJA 2W6JH 3NV0A 2XSHB 4LGQA 2YFJB 3TDGA 3DGOA 1G96A 4WHAA 1IVUA 4FR9A 1AVKA 2P0XA 2XGNA 4KZ1A 3FCSB 1AVLA 1KQS2 2OWPA 4MMYB 1YI23 1N5PA 2WOHA 8CHOA 2W56A 1RN7A 3EB8A 3CCE3 3CXC2 4HYZA 3IPTA 3PGBA 3AMOB 3CPOA 1JJ22 1YJ93 4XDVA 3S67A 4FCZA 2ZL8A 3MG2A 3FKAA 1VQL3 4HZ9B 1Q824 3WMDA 4O3VA 1V74A 2GBWB 1QJGA 2IA7A 1JKGA 1SPUA 2MF7A 2O9UX 2W0QA 3A76A 3BLZA 1RJOA 4Q53A 3DUKA 4BTYA 3G0KA 3JUOA 1WQLB 4HJLB 3KZTA 3FGYA 2YFIB 4KFEA 1W6GA 4HKVB 2LYXA 3EQQB 4N6LA 3V99A 1EG9B 3DGMA 5AYSC 1M904 2PZVA 5EVHA 1VQM3 4G1MB 2GEYA 2Y73A 1NJI4 4EBGA 1E3RA 3S28A 4AEQA 5IG0A 5IG4A 2FXTA 3K5TA 3OW22 3CNXA 1TP6A 2YX9A 2O3OA 4FMDA 3BNDA 3F8HA 3O8YA 1GD4A 1UI8A 5D82A 1IQXA 3EHCA 3F40A 3LT8A 1DMNA 1W01A 1OHSA 4GB5A 5IERA 1VQK3 3FG1A 1VQ43 2CK3H 3MG3A 1KSIA 2CW9A 2RFRA 3HX8A 1IK3A 4WFOA 1O7HB 3DZLA 2P05A 2BMOB 3IMAB 4QWTA 3VSYA 4R4KA 5JPPA 1W2ZA 5IW9A 2Z7AA 1OACA 1STFI 4XDWA 3CCJ3 2WO0A 1T5YA 1YHQ3 3EJVA 4K1VA 1D6YA 1ROVA 5IG5A 1YIT3 2XRXB 3KFQC 4HZBB 4CCVA 5JBSA 1QAFA 2P38A 3NQZA 3HI7A 1OHOA 4JF8A 4R80A 1Q40B 4FMCA 3F14A 3CD63 2CC3A 1W5ZA 5TGNA 1Q42A 1FGQA 1JRQA 2D1WA 4RNZA 4FMAA 2BMQB 3MYTA 4RNYA 1W2B2 3WODG 3BNBA 3GZXB 2XF3A 1S723 2KRTA 2KXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVN A;  2K54 A;  2CHC A;  3EBT A;  4HM4 B;  1VZZ A;  4CDL A;  1O7P B;  3NUV A;  5AI1 A;  3RGR A;  2HMM B;  7STD A;  2Z76 A;  1OH0 A;  4HM0 B;  5IEO A;  1GY6 A;  5CK6 A;  4HM8 B;  5BVB A;  1K41 A;  3F8X A;  2F86 B;  3KE7 A;  3OWY A;  1OGZ A;  3T8U A;  5IEP A;  2HMK B;  2RCD A;  4HM6 B;  1JB5 A;  5AIF A;  2UX0 A;  5DRV A;  3B7C A;  1ASK A;  2HMN B;  1IDP A;  3JUP A;  3B4O A;  3ECF A;  5BXQ A;  4L8P A;  3NXJ A;  4XBX A;  3SED A;  3GZB A;  1OF5 A;  3NV0 B;  3SOY A;  3KSP A;  4HM3 B;  3FZW A;  3NHX A;  4R1K A;  2BMR B;  5G2G A;  3KKG A;  1JN5 A;  2QIY A;  5CF1 A;  2IMJ A;  2XR8 B;  2B24 B;  4N3V A;  1NWW A;  1U5O A;  3EN8 A;  5CLK A;  2HMJ B;  5D81 A;  5STD A;  1ULI B;  5DRE A;  3B8L A;  1EA2 A;  2F99 A;  1S5A A;  4WYK B;  1JKG B;  3DXO A;  5CF2 A;  4IIA A;  3VGN A;  4X2H A;  4FCJ A;  2Z77 A;  4STD A;  3H3H A;  5KP3 A;  3I0Y A;  1O7G B;  3EN1 B;  1OHP A;  3F9S A;  3T8N A;  3K7C A;  1ZX2 A;  1Q40 A;  5HGR A;  1SJW A;  3HK4 A;  4XM4 A;  3HZP A;  1Z1S A;  3FSD A;  1W00 A;  3G16 A;  6STD A;  2GEX A;  3FF2 A;  1E3V A;  4MJD A;  1JB4 A;  4I4K A;  5IG3 A;  1GYB A;  3M8C A;  1ULJ B;  2F98 A;  1W02 A;  5IF6 A;  3MKI A;  3EF8 A;  3JUQ A;  3ROB A;  4HM2 B;  1C7H A;  3ER7 A;  1NDO B;  1O7N B;  4R9K A;  5KP4 A;  1STD A;  4OUQ A;  1OPY A;  2W2C A;  2JQ5 A;  3EBY A;  2INX A;  3FLJ A;  3GWR A;  3JUM A;  5AIG A;  3JUN A;  3FF0 A;  4J8T A;  5CXO A;  3EC9 A;  3NBR A;  3NM2 A;  3BB9 A;  3OWS A;  3LZA A;  4RZM A;  5JPU A;  4LEH A;  1ZO2 A;  1JB2 A;  3OX9 A;  1NU3 A;  2A15 A;  4FCM A;  2I9W A;  3F7X A;  4L8O A;  1E97 A;  3RGA A;  3MHE A;  2R4I A;  3OWU A;  4WYK A;  2HML B;  1W6Y A;  4K1U A;  4XB5 A;  4R9L A;  1A2K A;  4H3U A;  1OF5 B;  2CKF B;  3UJM A;  1JN5 B;  1AR0 A;  3CNM A;  4HM7 B;  2QGU A;  2YFL B;  5AIH A;  1ISK A;  5AEU B;  1OGX A;  3MSO A;  3K0Z A;  4LMI A;  3SOA A;  3G8Z A;  2GBX B;  3F7S A;  1GY7 A;  1UUW B;  5D83 A;  3MG1 A;  4WP5 A;  4XBY A;  1DMQ A;  1O7M B;  3GZY B;  3EX9 A;  3STD A;  3E99 A;  4X2O A;  5AII A;  1BUQ A;  2GXF A;  3B4P A;  2HMO B;  2BNG A;  2STD A;  1GY5 A;  3DM8 A;  3D9R A;  4KVH A;  4U13 A;  1DMM A;  1CQS A;  1UUV B;  3UNL A;  1HKX A;  2RGQ A;  1TUH A;  4ORL A;  3GRD A;  4PEJ A;  5KP1 A;  4OVM A;  3OV4 A;  1OUN A;  4XBT A;  4J9A A;  3S5C A;  3Q90 A;  4L7K A;  5IEN A;  1O7W B;  3H51 A;  1QMA A;  4WWU C;  4HM1 B;  5AEW B;  4HM5 B;  1OCV A;  2XSO B;  3FH1 A;  1GS3 A;  3DMC A;  2B1X B;  3OXA A;  3LYG A;  3GZR A;  5FW5 A;  3CU3 A;  3NV0 A;  2XSH B;  4LGQ A;  2YFJ B;  2OWP A;  8CHO A;  3IPT A;  3CPO A;  4XDV A;  3MG2 A;  3FKA A;  4HZ9 B;  3WMD A;  2GBW B;  1QJG A;  1JKG A;  3A76 A;  3BLZ A;  4Q53 A;  3DUK A;  3G0K A;  3JUO A;  1WQL B;  4HJL B;  3KZT A;  3FGY A;  2YFI B;  4HKV B;  3EQQ B;  1EG9 B;  2PZV A;  5EVH A;  2GEY A;  1E3R A;  5IG0 A;  5IG4 A;  3CNX A;  1TP6 A;  3F8H A;  5D82 A;  3EHC A;  3F40 A;  1DMN A;  1W01 A;  1OHS A;  4GB5 A;  5IER A;  3MG3 A;  2RFR A;  3HX8 A;  1O7H B;  3DZL A;  2BMO B;  3VSY A;  5JPP A;  2Z7A A;  4XDW A;  3EJV A;  4K1V A;  5IG5 A;  2XRX B;  4HZB B;  1OHO A;  1Q40 B;  3F14 A;  5TGN A;  1Q42 A;  2BMQ B;  3MYT A;  3GZX B; 
#chains in the Genus database with same CATH topology
 1UI7 A;  2Y74 A;  4J5G A;  1T2I A;  4HVN A;  1BGS A;  1LQG C;  3AHW A;  2K54 A;  1KD1 4;  1WNH A;  3N54 B;  1B20 A;  1RGF A;  1FYS A;  1ZGX A;  2CHC A;  1F8N A;  3EBT A;  3FG4 A;  4GL6 A;  4HM4 B;  2CWT A;  1VZZ A;  1UCL A;  2ZDJ A;  3CCJ 3;  4MMX B;  4TX4 A;  4CDL A;  1O7P B;  2CG0 A;  1K73 4;  3CCS 3;  4EW5 A;  3NUV A;  5AI1 A;  3RGR A;  2HMM B;  1RGK A;  2L4V A;  1N9E A;  7STD A;  2Z76 A;  1YIJ 3;  2L1S A;  1OH0 A;  4HM0 B;  1I3I A;  1D6U A;  8RNT A;  3J7Y d;  5IEO A;  5A0O B;  1GY6 A;  3LOY A;  2CX1 A;  1B2U A;  5CK6 A;  1VQO 3;  1IV9 A;  3Q1C A;  4HM8 B;  3JVC A;  2GU1 A;  1CEW I;  3HIG A;  1CYU A;  1HU9 A;  2RSX A;  5BVB A;  1B21 A;  1K41 A;  3F8X A;  2F86 B;  3KE7 A;  1TJD A;  2QA4 3;  1QVF 2;  3OWY A;  1Q9E A;  2PNC A;  2QEX 3;  1I3F A;  1OGZ A;  3UB1 A;  4J5K A;  3T8U A;  5IEP A;  1IVX A;  4HOH A;  2HMK B;  2RCD A;  2W03 A;  4HM6 B;  1JB5 A;  5AIF A;  1EKM A;  3MWZ A;  1BRK A;  2UX0 A;  5LC7 A;  1RKY A;  1QAK A;  5DRV A;  1LOX A;  3B7C A;  1QVG 2;  4JRF A;  1IQ8 A;  1LQM B;  4ZM8 A;  2WGQ A;  3G4S 3;  1ASK A;  4MEI A;  4BU4 A;  2HMN B;  5M18 A;  1IDP A;  3JUP A;  3B4O A;  3ECF A;  5BXQ A;  4L8P A;  1LOW A;  3NXJ A;  2IY2 A;  1FW7 A;  1FA3 A;  4NHF A;  3WA3 A;  1Q86 4;  2IYJ A;  4N6U A;  4XBX A;  2C4B A;  3SED A;  3GZB A;  1OF5 A;  2W04 A;  1BNG A;  3NV0 B;  3SOY A;  1B2Z A;  3KSP A;  4HM3 B;  2OTL 3;  3FZW A;  3NHX A;  3EE1 A;  2BMR B;  4R1K A;  3KKG A;  1JN5 A;  5G2G A;  2QIY A;  3QRD A;  2OOV A;  3SVA A;  1L5G B;  5CF1 A;  1RDS A;  2CFG A;  2XEP A;  2IMJ A;  3LH4 A;  1IU7 A;  3CMA 3;  1BSA A;  3DGY A;  3WOE B;  4EYC A;  1RHL A;  3Q2P A;  1LRA A;  2E2V A;  2XR8 B;  3KII A;  3X3X A;  2B24 B;  7RNT A;  1KWI A;  3D3L A;  3URP A;  6GSP A;  1WMP A;  2W56 B;  4BL2 A;  3NBB A;  1W4N A;  1HZ1 A;  1RRL A;  1V57 A;  4N3V A;  3VF1 A;  1M1K 4;  2C10 A;  2UGI A;  3I55 3;  1BSC A;  1NWW A;  1U5O A;  3EN8 A;  5CLK A;  5M1A A;  2HMJ B;  4HAA A;  1A90 A;  5D81 A;  5FGO A;  5STD A;  1ULI B;  5I97 A;  3N8B A;  1Q81 4;  1TIJ A;  5DRE A;  1MGR A;  1KC8 4;  2BO9 B;  2KF5 A;  5EQL A;  2CFW A;  3B8L A;  4NRE A;  1EA2 A;  3DGN A;  1BRI A;  2F99 A;  1S5A A;  1X1W A;  2SAR A;  4WYK B;  1JKG B;  3DXO A;  5CF2 A;  1MWR A;  4IIA A;  1UCJ A;  2CH9 A;  3UL5 A;  3VGN A;  3PZW A;  3CCV 3;  4X2H A;  4FCJ A;  1FGR A;  2Z77 A;  4STD A;  3H3H A;  4LSO A;  1GOU A;  1IV7 A;  2E2T A;  2WGO A;  3N9H A;  5KP3 A;  1PFP A;  3I0Y A;  1TU5 A;  4EXR A;  1RGL A;  1O7G B;  4N6N B;  1GMP A;  1X1Y A;  4N6V 0;  1BUJ A;  4LZI A;  2ZA4 A;  1NB3 I;  1SIH A;  3QK9 A;  3EN1 B;  1JZD A;  1OHP A;  3F9S A;  3T8N A;  1LNH A;  2KCD A;  2WOF A;  3RDE A;  2ML5 A;  3K7C A;  1ZX2 A;  4GSP A;  2RBI A;  3CC4 3;  1Q40 A;  3SYU A;  1BVI A;  4KFD A;  5EEO A;  2D42 A;  2LQV A;  1N8Q A;  1BNF A;  1RRH A;  1TFO A;  3CC2 3;  5HGR A;  1SAR A;  1SJW A;  2JDI H;  4CJN A;  3IJE B;  3WDG B;  3DY5 A;  3HK4 A;  1JZO A;  4XM4 A;  3HZP A;  3NX0 A;  1Z1S A;  3HOH A;  3FSD A;  1W00 A;  3G16 A;  4DKI A;  6STD A;  3CPW 2;  2XFT A;  2GEX A;  3FG3 A;  3FF2 A;  3LTD A;  1E3V A;  1RN1 A;  4MJD A;  4AKZ A;  1JB4 A;  1FUT A;  4I4K A;  1K8A 4;  3GSP A;  5IG3 A;  1B2X A;  2H0H A;  4N6O B;  3SXX A;  4KFF A;  1MNL A;  4FMB A;  1FGO A;  3DGL A;  4K61 A;  3WOF B;  3CCQ 3;  1GYB A;  1RLS A;  2Q07 A;  3M8C A;  1PYL A;  1I0X A;  1ULJ B;  2F98 A;  1M1X B;  1W02 A;  2CFL A;  5IF6 A;  1BOX A;  3MKI A;  1W6C A;  3EF8 A;  2CFD A;  3JUQ A;  3ROB A;  1Q7Y 4;  1IT7 A;  4HM2 B;  3CME 3;  1C7H A;  3ER7 A;  1FZU A;  2ML6 A;  1NDO B;  1O7N B;  3X3Y A;  3AHS A;  3G6E 3;  1JBR A;  1X1U A;  3LTC A;  4R9K A;  5KP4 A;  1LVN A;  1NO3 A;  1STD A;  1YJN 3;  4BTX A;  3PXM A;  4LYL B;  4OUQ A;  1IT8 A;  3LT9 A;  5AYR B;  1AQZ A;  1OPY A;  1PU4 A;  2W2C A;  2IUK A;  4ILF A;  3NBJ A;  1NNV A;  3CCM 3;  1B3S A;  1DVC A;  3S29 A;  2JQ5 A;  3X3Z A;  3D79 A;  1YVB I;  3ALA A;  2BT3 A;  1AY7 A;  2INX A;  2AAD A;  3AMO A;  3EBY A;  3FLJ A;  3GWR A;  3MPH A;  3T0U A;  3ZG0 A;  1DVD A;  3JUM A;  1CH0 A;  5AIG A;  1G02 A;  1RMS A;  3WHO A;  1K9M 4;  2K0M A;  3LML A;  3Q3F A;  1R4Y A;  4O2H A;  3JUN A;  3HII A;  2M7O A;  1A2P A;  1LOY A;  3UL6 A;  1VQP 3;  2BU4 A;  4O02 B;  1GMR A;  2F5W A;  1B2M A;  1SQW A;  3FF0 A;  4J8T A;  2XGL A;  1N8R 4;  3CCL 3;  5HOH A;  3CCR 3;  1WMO A;  5CXO A;  1UGH I;  1RN4 A;  1R4C A;  1D6Z A;  1TRP A;  3EC9 A;  3KN4 A;  3NBR A;  3S27 A;  1BNJ A;  3NM2 A;  3BB9 A;  3OWS A;  3LZA A;  4RZM A;  1GD3 A;  2XH9 A;  5JPU A;  6RNT A;  1GOY A;  1YGW A;  1ZO2 A;  4LEH A;  1JB2 A;  1J2B A;  3BNC A;  1NU3 A;  3OX9 A;  4RBN A;  1AV4 A;  1G0T A;  1EEJ A;  4AKY A;  2A15 A;  1EQK A;  2CFK A;  2GSP A;  2I9W A;  3F7X A;  4FCM A;  4IPB A;  4L8O A;  3KCH A;  4EC6 A;  1VQ7 3;  1E97 A;  3K63 A;  3RGA A;  1IQY A;  3MHE A;  1YGE A;  1U8C B;  2R4I A;  1FGT A;  3OWU A;  4WYK A;  1MWU A;  1W6Y A;  2HML B;  4K1U A;  4R9L A;  4XB5 A;  1UW1 A;  1A2K A;  1Y4K A;  5BU4 A;  3PCS A;  1ROA A;  4H3U A;  1V58 A;  3ZG5 A;  2W9P A;  3I56 3;  1OF5 B;  1QAL A;  1I70 A;  3KSE D;  2SBL A;  1VQ6 3;  2CWU A;  2IUJ A;  1MWT A;  2CKF B;  1GSP A;  3UJM A;  2CG1 A;  1JN5 B;  1IYY A;  1AR0 A;  3CNM A;  1N5H A;  4HM7 B;  1FUW A;  2QGU A;  2FGT A;  5M19 A;  2YFL B;  5AIH A;  3X42 A;  1ISK A;  2R41 A;  4EV5 A;  5AEU B;  1OGX A;  1RGA A;  1MOL A;  1W7C A;  3CC7 3;  1VQN 3;  3MSO A;  3K0Z A;  4LMI A;  1JBT A;  4I5Q A;  2OOV C;  1FGM A;  3SOA A;  1NB5 I;  4MMZ B;  1M9G A;  1ZS7 A;  1RCL A;  1BRJ A;  3DH2 A;  1RNT A;  1I2F A;  1K28 A;  2FNQ A;  3V98 A;  1TTO A;  1I2E A;  3G8Z A;  2GBX B;  3PCR A;  1TRQ A;  1GOV A;  3F7S A;  1IVW A;  2HOH A;  3U97 A;  1RGE A;  2OTJ 3;  1GY7 A;  1UUW B;  1US1 A;  2C11 A;  1CYV A;  3BNE A;  3MG1 A;  5D83 A;  2OQE A;  9RNT A;  3L0R A;  4WP5 A;  1GMQ A;  4XBY A;  3WR2 A;  2XFS A;  1DMQ A;  2P0M A;  1O7M B;  3GZY B;  2KAA A;  3NQY A;  1VQ8 3;  1DE3 A;  1VQQ A;  3PS8 A;  3EX9 A;  2CIU A;  3STD A;  4CPK A;  1C54 A;  2H0I A;  3LTA A;  1LXE A;  4K90 B;  3E99 A;  1BRH A;  4KT3 B;  1A2V A;  4X2O A;  5AII A;  5ELU A;  1DYU A;  1BUQ A;  2GXF A;  3SX1 A;  2BHM A;  3GAX A;  1SII A;  2CWV A;  1RSN A;  3SLU A;  1WMN A;  1BRN L;  3U1W A;  1YNV X;  3AGN A;  1BSD A;  1BNR A;  2GU3 A;  3B4P A;  1EUI C;  2KXG A;  1VQ9 3;  4BTW A;  5LC6 A;  4OK0 A;  1UUG B;  2HMO B;  1RCK A;  2BNG A;  2STD A;  1GY5 A;  3V92 A;  1LOV A;  3DM8 A;  1TFK A;  4N6T A;  1WTH A;  1BSB A;  3D9R A;  2UUG C;  2V1L A;  3PYJ A;  4KVH A;  3X41 A;  3G71 3;  4U13 A;  1DMM A;  2K3D A;  1CQS A;  1UUV B;  1JNQ A;  3UNL A;  2H0G A;  2Z6B A;  1HKX A;  1N9J A;  1TUH A;  2RGQ A;  4IT7 A;  3X40 A;  3WA2 X;  4ORL A;  3GRD A;  2MC8 A;  2P09 A;  3LTB A;  2OQE C;  3LXU X;  4PEJ A;  1MWS A;  1VQ5 3;  5KP1 A;  1UDI I;  4OVM A;  3OV4 A;  2CX0 A;  3D5I A;  4O8S A;  1OUN A;  4XBT A;  4J9A A;  1Q7H A;  2F5M A;  3S5C A;  3Q90 A;  4L7K A;  5IEN A;  4H61 A;  1O7W B;  3H51 A;  3BU4 A;  4HBR A;  1QMA A;  2W9Q A;  4EV2 A;  3CCU 3;  4WWU C;  1A67 A;  4HM1 B;  5AEW B;  7GSP A;  3AGO A;  3K9M C;  3NM7 A;  1T2H A;  2ZHX B;  2E2U A;  4HM5 B;  1OCV A;  2XSO B;  1YJW 3;  3FH1 A;  1IVV A;  1BRS A;  1GS3 A;  4N6M A;  3DMC A;  2B1X B;  2KF4 A;  3LYG A;  3OXA A;  3GZR A;  5FW5 A;  1JV2 B;  3CU3 A;  2OCT A;  5ELJ A;  1BSE A;  1BU4 A;  2W6J H;  3NV0 A;  2XSH B;  4LGQ A;  2YFJ B;  3TDG A;  5RNT A;  3DGO A;  1G96 A;  4WHA A;  1IVU A;  1UCK A;  1JBS A;  4FR9 A;  1AVK A;  2P0X A;  1UGI A;  2XGN A;  4KZ1 A;  1RTU A;  3FCS B;  1AVL A;  3ZFZ A;  1KQS 2;  2OWP A;  1BAO A;  2F56 A;  4MMY B;  1YI2 3;  1N5P A;  2WOH A;  8CHO A;  2W56 A;  2KF6 A;  1RN7 A;  3EB8 A;  3CCE 3;  3CXC 2;  4HYZ A;  1RGG A;  3IPT A;  3PGB A;  3AMO B;  1BNI A;  3CPO A;  1JJ2 2;  2KF3 A;  1BNS A;  1YJ9 3;  4XDV A;  3S67 A;  4FCZ A;  2ZL8 A;  1FUS A;  3MG2 A;  3FKA A;  1VQL 3;  4HZ9 B;  5GSP A;  1Q82 4;  5G1L A;  3WMD A;  4O3V A;  1V74 A;  2GBW B;  1QJG A;  2IA7 A;  4BIR A;  1JKG A;  1SPU A;  2MF7 A;  2O9U X;  2W0Q A;  3BIR A;  3A76 A;  3BLZ A;  1RJO A;  4Q53 A;  1LNI A;  3DUK A;  4BTY A;  3G0K A;  2J8X B;  3JUO A;  1WQL B;  4HJL B;  3KZT A;  3FGY A;  2YFI B;  4KFE A;  3RNT A;  1B27 A;  1W6G A;  4HKV B;  2LYX A;  3EQQ B;  4N6L A;  3V99 A;  1EG9 B;  1RGH A;  3DGM A;  5AYS C;  3D5G A;  1M90 4;  2PZV A;  5EVH A;  1VQM 3;  4G1M B;  2GEY A;  2Y73 A;  1NJI 4;  4EBG A;  1E3R A;  3S28 A;  1PY3 A;  5IG0 A;  4AEQ A;  3A5E A;  5IG4 A;  2FXT A;  3K5T A;  3OW2 2;  3CNX A;  1TP6 A;  2RNT A;  2YX9 A;  1T3B A;  2O3O A;  4FMD A;  3BND A;  3F8H A;  3O8Y A;  1B2S A;  1DET A;  1GD4 A;  1UI8 A;  5D82 A;  1IQX A;  3EHC A;  3F40 A;  3LT8 A;  1DMN A;  1W01 A;  1OHS A;  4GB5 A;  5IER A;  1VQK 3;  5G1K A;  3FG1 A;  2BIR A;  1VQ4 3;  3D4A A;  2CK3 H;  3MG3 A;  1KSI A;  2CW9 A;  2RFR A;  3HX8 A;  1IK3 A;  4WFO A;  1BNE A;  1O7H B;  3DZL A;  2P05 A;  4NPB A;  2BMO B;  3IMA B;  1BAN A;  4QWT A;  3VSY A;  4R4K A;  5JPP A;  1W2Z A;  1UCI A;  2Z7A A;  1YVS A;  4GHO A;  4RNT A;  5IW9 A;  1STF I;  1OAC A;  1BIR A;  1I0V A;  1RGC A;  2WO0 A;  2F4Y A;  1T5Y A;  1I8V A;  4XDW A;  1YHQ 3;  5BIR A;  3EJV A;  4K1V A;  1D6Y A;  1ROV A;  1HYF A;  5IG5 A;  1YIT 3;  2XRX B;  3KFQ C;  4HZB B;  4CCV A;  5JBS A;  1QAF A;  2P38 A;  3NQZ A;  2AAE A;  1MGW A;  3HI7 A;  1OHO A;  4JF8 A;  4R80 A;  4BL3 A;  1Q40 B;  4FMC A;  3F14 A;  3CD6 3;  2CC3 A;  1W5Z A;  5TGN A;  1Q42 A;  1RNB A;  1FGQ A;  1JRQ A;  2D1W A;  4RNZ A;  4FMA A;  2BMQ B;  3MYT A;  4RNY A;  1W2B 2;  1X1X A;  3BNB A;  3GZX B;  3WOD G;  1I2G A;  2XF3 A;  1S72 3;  2KRT A;  1BRG A; 
#chains in the Genus database with same CATH homology
 1UI7 A;  2Y74 A;  4HVN A;  2K54 A;  1KD1 4;  1WNH A;  3N54 B;  1A90 A;  2CHC A;  3EBT A;  1F8N A;  3FG4 A;  4GL6 A;  4HM4 B;  2CWT A;  1VZZ A;  2ZDJ A;  4MMX B;  4TX4 A;  4CDL A;  1O7P B;  2CG0 A;  1K73 4;  3CCS 3;  3NUV A;  5AI1 A;  3RGR A;  2HMM B;  2L4V A;  1N9E A;  7STD A;  2Z76 A;  1YIJ 3;  1OH0 A;  4HM0 B;  1D6U A;  3J7Y d;  5IEO A;  5A0O B;  1GY6 A;  3LOY A;  5CK6 A;  1VQO 3;  1IV9 A;  3Q1C A;  4HM8 B;  3JVC A;  2GU1 A;  1CEW I;  3HIG A;  1CYU A;  1HU9 A;  2RSX A;  5BVB A;  1K41 A;  3F8X A;  2F86 B;  3KE7 A;  2QA4 3;  1QVF 2;  3OWY A;  2PNC A;  2QEX 3;  1OGZ A;  3UB1 A;  3T8U A;  5IEP A;  1IVX A;  2HMK B;  2RCD A;  2W03 A;  4HM6 B;  1JB5 A;  5AIF A;  1EKM A;  3MWZ A;  2UX0 A;  5LC7 A;  1RKY A;  1QAK A;  5DRV A;  1LOX A;  3B7C A;  1QVG 2;  4JRF A;  1IQ8 A;  4ZM8 A;  2WGQ A;  3G4S 3;  1ASK A;  4MEI A;  2HMN B;  1IDP A;  3JUP A;  3B4O A;  3ECF A;  5BXQ A;  4L8P A;  3NXJ A;  1FA3 A;  4NHF A;  3WA3 A;  1Q86 4;  4N6U A;  4XBX A;  3SED A;  3GZB A;  1OF5 A;  2W04 A;  3NV0 B;  3SOY A;  3KSP A;  4HM3 B;  2OTL 3;  3FZW A;  3NHX A;  3EE1 A;  2BMR B;  4R1K A;  3KKG A;  1JN5 A;  5G2G A;  2QIY A;  3QRD A;  2OOV A;  3SVA A;  1L5G B;  5CF1 A;  2CFG A;  2XEP A;  2IMJ A;  3LH4 A;  1IU7 A;  3CMA 3;  4EYC A;  3WOE B;  3Q2P A;  2E2V A;  2XR8 B;  3KII A;  3X3X A;  2B24 B;  1KWI A;  3D3L A;  1WMP A;  2W56 B;  3NBB A;  1W4N A;  1RRL A;  4N3V A;  3VF1 A;  1M1K 4;  2C10 A;  3I55 3;  1NWW A;  1U5O A;  3EN8 A;  5CLK A;  2HMJ B;  5D81 A;  5FGO A;  5STD A;  1ULI B;  5I97 A;  3N8B A;  1Q81 4;  1TIJ A;  5DRE A;  1KC8 4;  2BO9 B;  5EQL A;  2CFW A;  3B8L A;  4NRE A;  1EA2 A;  3DGN A;  2F99 A;  1S5A A;  4WYK B;  1JKG B;  3DXO A;  5CF2 A;  4IIA A;  2CH9 A;  3UL5 A;  3VGN A;  3PZW A;  3CCV 3;  4X2H A;  4FCJ A;  1FGR A;  2Z77 A;  4STD A;  3H3H A;  4LSO A;  1IV7 A;  2E2T A;  2WGO A;  3N9H A;  5KP3 A;  1PFP A;  3I0Y A;  1TU5 A;  4EXR A;  1O7G B;  4N6N B;  4N6V 0;  4LZI A;  1NB3 I;  1SIH A;  3QK9 A;  3EN1 B;  1OHP A;  3F9S A;  3T8N A;  1LNH A;  2KCD A;  2WOF A;  3RDE A;  2ML5 A;  3K7C A;  1ZX2 A;  3CC4 3;  1Q40 A;  4KFD A;  5EEO A;  2D42 A;  2LQV A;  1N8Q A;  1RRH A;  1TFO A;  3CC2 3;  5HGR A;  1SJW A;  2JDI H;  3IJE B;  3WDG B;  3DY5 A;  3HK4 A;  4XM4 A;  3HZP A;  3NX0 A;  1Z1S A;  3FSD A;  1W00 A;  3G16 A;  6STD A;  3CPW 2;  2XFT A;  2GEX A;  3FG3 A;  3FF2 A;  3LTD A;  1E3V A;  4MJD A;  4AKZ A;  1JB4 A;  4I4K A;  1K8A 4;  5IG3 A;  4N6O B;  3SXX A;  4KFF A;  1MNL A;  4FMB A;  1FGO A;  3DGL A;  4K61 A;  3WOF B;  3CCQ 3;  1GYB A;  2Q07 A;  3M8C A;  1ULJ B;  2F98 A;  1M1X B;  1W02 A;  2CFL A;  5IF6 A;  3MKI A;  1W6C A;  3EF8 A;  2CFD A;  3JUQ A;  3ROB A;  1Q7Y 4;  1IT7 A;  4HM2 B;  3CME 3;  1C7H A;  3ER7 A;  2ML6 A;  1NDO B;  1O7N B;  3X3Y A;  3G6E 3;  3LTC A;  4R9K A;  5KP4 A;  1LVN A;  1NO3 A;  1STD A;  1YJN 3;  4BTX A;  3PXM A;  4OUQ A;  1IT8 A;  3LT9 A;  5AYR B;  1OPY A;  1PU4 A;  2W2C A;  2IUK A;  3NBJ A;  3CCM 3;  1DVC A;  3S29 A;  2JQ5 A;  3X3Z A;  1YVB I;  3ALA A;  2BT3 A;  3AMO A;  2INX A;  3EBY A;  3FLJ A;  3GWR A;  3T0U A;  3MPH A;  1DVD A;  3JUM A;  5AIG A;  1K9M 4;  2K0M A;  3LML A;  4O2H A;  3JUN A;  3HII A;  2M7O A;  1VQP 3;  3UL6 A;  4O02 B;  1SQW A;  3FF0 A;  4J8T A;  2XGL A;  1N8R 4;  3CCL 3;  3CCR 3;  1WMO A;  5CXO A;  1R4C A;  1D6Z A;  3KN4 A;  3EC9 A;  3NBR A;  3S27 A;  3NM2 A;  3BB9 A;  3OWS A;  3LZA A;  4RZM A;  1GD3 A;  2XH9 A;  5JPU A;  4LEH A;  1ZO2 A;  1JB2 A;  1J2B A;  3BNC A;  1NU3 A;  3OX9 A;  4RBN A;  1AV4 A;  4AKY A;  2A15 A;  1EQK A;  2CFK A;  2I9W A;  3F7X A;  4FCM A;  4IPB A;  4L8O A;  4EC6 A;  1VQ7 3;  1E97 A;  3K63 A;  3RGA A;  1IQY A;  3MHE A;  1YGE A;  1U8C B;  2R4I A;  1FGT A;  3OWU A;  4WYK A;  2HML B;  1W6Y A;  4K1U A;  4XB5 A;  4R9L A;  1UW1 A;  1A2K A;  1Y4K A;  3PCS A;  1ROA A;  4H3U A;  2W9P A;  3I56 3;  1OF5 B;  1QAL A;  3KSE D;  2SBL A;  1VQ6 3;  2CWU A;  2IUJ A;  2CKF B;  3UJM A;  2CG1 A;  1JN5 B;  1AR0 A;  3CNM A;  1N5H A;  4HM7 B;  1FUW A;  2QGU A;  2FGT A;  2YFL B;  5AIH A;  3X42 A;  1ISK A;  4EV5 A;  5AEU B;  1OGX A;  1MOL A;  1W7C A;  3CC7 3;  1VQN 3;  3MSO A;  3K0Z A;  4LMI A;  2OOV C;  1FGM A;  3SOA A;  1NB5 I;  4MMZ B;  1M9G A;  1K28 A;  2FNQ A;  3V98 A;  3G8Z A;  2GBX B;  3PCR A;  3F7S A;  1IVW A;  3U97 A;  2OTJ 3;  1GY7 A;  1UUW B;  1US1 A;  2C11 A;  1CYV A;  3BNE A;  3MG1 A;  5D83 A;  2OQE A;  3L0R A;  4WP5 A;  4XBY A;  2XFS A;  1DMQ A;  2P0M A;  1O7M B;  3GZY B;  3NQY A;  1VQ8 3;  3PS8 A;  3EX9 A;  2CIU A;  3STD A;  3LTA A;  1LXE A;  4K90 B;  3E99 A;  4X2O A;  5AII A;  1A2V A;  5ELU A;  1DYU A;  1BUQ A;  2GXF A;  3SX1 A;  2BHM A;  3GAX A;  1SII A;  2CWV A;  3SLU A;  1WMN A;  3U1W A;  2GU3 A;  3B4P A;  1VQ9 3;  4BTW A;  5LC6 A;  4OK0 A;  2HMO B;  2BNG A;  2STD A;  1GY5 A;  3V92 A;  3DM8 A;  4N6T A;  1TFK A;  1WTH A;  3D9R A;  4KVH A;  2V1L A;  3PYJ A;  3X41 A;  3G71 3;  4U13 A;  1DMM A;  1CQS A;  1UUV B;  1JNQ A;  3UNL A;  2Z6B A;  1HKX A;  1N9J A;  1TUH A;  2RGQ A;  4IT7 A;  3X40 A;  3WA2 X;  4ORL A;  3GRD A;  2MC8 A;  2P09 A;  3LTB A;  2OQE C;  3LXU X;  4PEJ A;  1VQ5 3;  5KP1 A;  4OVM A;  3OV4 A;  4O8S A;  1OUN A;  4XBT A;  4J9A A;  3S5C A;  3Q90 A;  4L7K A;  5IEN A;  4H61 A;  1O7W B;  3H51 A;  4HBR A;  1QMA A;  2W9Q A;  4EV2 A;  3CCU 3;  4WWU C;  1A67 A;  4HM1 B;  5AEW B;  3K9M C;  3NM7 A;  2E2U A;  4HM5 B;  1OCV A;  2XSO B;  1YJW 3;  3FH1 A;  1IVV A;  1GS3 A;  4N6M A;  3DMC A;  2B1X B;  3OXA A;  3LYG A;  3GZR A;  5FW5 A;  1JV2 B;  3CU3 A;  2OCT A;  5ELJ A;  2W6J H;  3NV0 A;  2XSH B;  4LGQ A;  2YFJ B;  3TDG A;  3DGO A;  1G96 A;  4WHA A;  1IVU A;  4FR9 A;  1AVK A;  2P0X A;  2XGN A;  4KZ1 A;  3FCS B;  1AVL A;  1KQS 2;  2OWP A;  4MMY B;  1YI2 3;  1N5P A;  2WOH A;  8CHO A;  2W56 A;  1RN7 A;  3EB8 A;  3CCE 3;  3CXC 2;  4HYZ A;  3IPT A;  3PGB A;  3AMO B;  3CPO A;  1JJ2 2;  1YJ9 3;  4XDV A;  3S67 A;  4FCZ A;  2ZL8 A;  3MG2 A;  3FKA A;  1VQL 3;  4HZ9 B;  1Q82 4;  3WMD A;  4O3V A;  1V74 A;  2GBW B;  1QJG A;  2IA7 A;  1JKG A;  1SPU A;  2MF7 A;  2O9U X;  2W0Q A;  3A76 A;  3BLZ A;  1RJO A;  4Q53 A;  3DUK A;  4BTY A;  3G0K A;  3JUO A;  1WQL B;  4HJL B;  3KZT A;  3FGY A;  2YFI B;  4KFE A;  1W6G A;  4HKV B;  2LYX A;  3EQQ B;  4N6L A;  3V99 A;  1EG9 B;  3DGM A;  5AYS C;  1M90 4;  2PZV A;  5EVH A;  1VQM 3;  4G1M B;  2GEY A;  2Y73 A;  1NJI 4;  4EBG A;  1E3R A;  3S28 A;  4AEQ A;  5IG0 A;  5IG4 A;  2FXT A;  3K5T A;  3OW2 2;  3CNX A;  1TP6 A;  2YX9 A;  2O3O A;  4FMD A;  3BND A;  3F8H A;  3O8Y A;  1GD4 A;  1UI8 A;  5D82 A;  1IQX A;  3EHC A;  3F40 A;  3LT8 A;  1DMN A;  1W01 A;  1OHS A;  4GB5 A;  5IER A;  1VQK 3;  3FG1 A;  1VQ4 3;  2CK3 H;  3MG3 A;  1KSI A;  2CW9 A;  2RFR A;  3HX8 A;  1IK3 A;  4WFO A;  1O7H B;  3DZL A;  2P05 A;  2BMO B;  3IMA B;  4QWT A;  3VSY A;  4R4K A;  5JPP A;  1W2Z A;  5IW9 A;  2Z7A A;  1OAC A;  1STF I;  4XDW A;  3CCJ 3;  2WO0 A;  1T5Y A;  1YHQ 3;  3EJV A;  4K1V A;  1D6Y A;  1ROV A;  5IG5 A;  1YIT 3;  2XRX B;  3KFQ C;  4HZB B;  4CCV A;  5JBS A;  1QAF A;  2P38 A;  3NQZ A;  3HI7 A;  1OHO A;  4JF8 A;  4R80 A;  1Q40 B;  4FMC A;  3F14 A;  3CD6 3;  2CC3 A;  1W5Z A;  5TGN A;  1Q42 A;  1FGQ A;  1JRQ A;  2D1W A;  4RNZ A;  4FMA A;  2BMQ B;  3MYT A;  4RNY A;  1W2B 2;  3WOD G;  3BNB A;  3GZX B;  2XF3 A;  1S72 3;  2KRT A;  2KXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...