3T8UA

Crystal structure of ketosteroid isomerase y14ay55fd99a from pseudomonas testosteroni
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
MNTPEHMTAVVQRAVAALNAGDLDGIVALFADDATVEDPVGSEPRSGTAAIREFFANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPIAHFRFNGAGKVVSMRALFGEKNIHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Evaluating the catalytic contribution from the oxyanion hole in ketosteroid isomerase.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 29
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3t8uA00
3EF8A 1Z1SA 1O7HB 2F98A 1AR0A 1E3RA 3OWYA 3OV4A 2BMOB 3EC9A 3GZXB 5D82A 1JN5B 1QMAA 4WWUC 1OF5A 3CNXA 4XBXA 4XBYA 2HMMB 4HM2B 2IMJA 4X2HA 3T8UA 2QIYA 3FF2A 5HGRA 1SJWA 5IG0A 2CKFB 3RGRA 4STDA 1ZO2A 5JPPA 2K54A 3BLZA 2XRXB 1OH0A 1WQLB 3STDA 4H3UA 3FH1A 3GZYB 3F9SA 1STDA 4MJDA 5DRVA 3MHEA 2STDA 3EHCA 3EJVA 3HX8A 3MG1A 1ASKA 3Q90A 4XM4A 2YFJB 4IIAA 1GY7A 2XR8B 1E3VA 4J9AA 5JPUA 8CHOA 3DXOA 2BMQB 4WP5A 1GYBA 3F40A 3OWUA 1JKGB 3E99A 1O7PB 4HM6B 4XDWA 4HZBB 3GRDA 3CPOA 3FLJA 4OVMA 4LGQA 5AEWB 3EBYA 2JQ5A 3NUVA 1Q40A 1NWWA 5KP4A 2BMRB 3FKAA 3H51A 3T8NA 2A15A 1QJGA 2XSHB 3NHXA 4WYKA 1TP6A 2B24B 5AEUB 3GZBA 4HZ9B 3DMCA 5CF1A 1K41A 2HMOB 4LMIA 3UJMA 3SEDA 3D9RA 2YFIB 1W00A 1W6YA 4HJLB 3FF0A 3F7SA 4FCJA 4U13A 1UUVB 5IEPA 4HM0B 4K1VA 5BXQA 1NU3A 3F8XA 3MSOA 3VGNA 2HMKB 4R9LA 1VZZA 1HKXA 1OHOA 2XSOB 2GEXA 3F7XA 3NV0A 3MYTA 1O7GB 5D83A 1CQSA 3HK4A 1JB4A 4HM4B 1Q42A 3SOAA 3MG3A 4KVHA 5D81A 1O7WB 3OXAA 3B7CA 3F14A 3EN1B 1OHPA 4RZMA 2W2CA 1A2KA 3GZRA 4L7KA 3M8CA 1NDOB 1O7NB 4HM8B 5STDA 2I9WA 3ER7A 2Z7AA 2UX0A 3ECFA 2CHCA 3WMDA 3EX9A 3GWRA 2RGQA 5IEOA 3RGAA 4XDVA 2Z76A 1C7HA 4HM1B 3MKIA 3MG2A 4HM5B 5IG4A 2QGUA 1OCVA 6STDA 3EN8A 4I4KA 1ULJB 4L8OA 3KZTA 2GBXB 1DMMA 1ZX2A 5EVHA 3DZLA 3F8HA 1OF5B 3CU3A 4J8TA 4OUQA 3ROBA 2RFRA 1ISKA 2PZVA 5AIGA 5CLKA 3KKGA 3NXJA 3G0KA 2F86B 1E97A 1UUWB 3IPTA 4HVNA 5KP3A 4LEHA 4X2OA 3B4OA 3LZAA 1JB2A 2HMJB 3K0ZA 1JKGA 3A76A 3NM2A 3OX9A 1DMQA 1OPYA 2YFLB 4Q53A 5CF2A 4CDLA 2HMNB 3B4PA 5CK6A 3JUMA 2INXA 3DUKA 1OHSA 4HM7B 3BB9A 3LYGA 3JUNA 3S5CA 5G2GA 2OWPA 2R4IA 3FSDA 4R9KA 3JUPA 5BVBA 2GEYA 2Z77A 3K7CA 4PEJA 3FZWA 5IERA 3G8ZA 3JUQA 1W01A 3KE7A 1W02A 5AIFA 1Q40B 3KSPA 4XB5A 4FCMA 3SOYA 3I0YA 1GS3A 1ULIB 4GB5A 1JN5A 1OGXA 3FGYA 3H3HA 5AI1A 2GXFA 5AIHA 3JUOA 2GBWB 4XBTA 1GY5A 1OGZA 1GY6A 1OUNA 3DM8A 4WYKB 5TGNA 1O7MB 3NBRA 5AIIA 1BUQA 4L8PA 2HMLB 5IG5A 1U5OA 5DREA 1S5AA 4K1UA 1DMNA 5IG3A 4HM3B 2F99A 7STDA 3OWSA 5IF6A 3VSYA 3G16A 2RCDA 4HKVB 3EQQB 1TUHA 5IENA 3HZPA 2B1XB 5FW5A 1IDPA 4R1KA 3EBTA 1EG9B 3NV0B 5CXOA 5KP1A 4N3VA 1EA2A 3CNMA 2BNGA 3UNLA 4ORLA 1JB5A 3B8LA
chains in the Genus database with same CATH superfamily
1RGKA 1BAOA 1UCKA 1YIT3 3O8YA 1DYUA 4LZIA 2H0IA 3EF8A 2KAAA 4WFOA 3BU4A 7GSPA 1Z1SA 1O7HB 4TX4A 3DGMA 3WHOA 2F98A 2CFLA 1AR0A 1MGRA 1E3RA 1IT8A 3KCHA 2OTL3 3N54B 3OWYA 3OV4A 3V99A 1CYUA 2BMOB 1QVG2 4BTWA 2W0QA 1X1UA 2IA7A 3EC9A 1LNHA 3GZXB 1CEWI 3DH2A 5D82A 1IQXA 3URPA 1JN5B 1NNVA 1QMAA 1BRHA 2L1SA 3D5IA 5BIRA 5I97A 1MNLA 4WWUC 1RGCA 1BNGA 2Y74A 3AHWA 1OF5A 3CNXA 4XBXA 1X1XA 1UGHI 2HMMB 4HM2B 4XBYA 2IMJA 3BNDA 4RNTA 4X2HA 5GSPA 3T8UA 3I553 2XFTA 1L5GB 1RJOA 2QIYA 2Z6BA 4NREA 4HAAA 3FF2A 2OOVC 1GD4A 3WA3A 1JJ22 3AHSA 1U8CB 1KD14 4N6V0 1LOVA 5HGRA 1SJWA 2ML6A 5IG0A 2CKFB 3RGRA 3CCR3 1T2HA 3MPHA 5M19A 4STDA 3NQZA 3QRDA 3ZG0A 1BVIA 1ZO2A 2ML5A 3D5GA 3HIIA 3LT8A 2F4YA 5ELUA 2RNTA 5JPPA 2K54A 1Q814 1VQN3 1D6UA 2P09A 2M7OA 3BLZA 3D3LA 2XGNA 2XRXB 3KIIA 3LXUX 4JF8A 1OH0A 1TTOA 1WQLB 1HU9A 3STDA 1YHQ3 4H3UA 1JZOA 3FH1A 3WR2A 3GZYB 3F9SA 1STDA 4ILFA 4RBNA 3HIGA 4HYZA 1YGWA 4MJDA 5DRVA 4EBGA 3MHEA 2STDA 1KWIA 3EHCA 2CFGA 3SVAA 1VQP3 1UW1A 3EJVA 3HX8A 3MG1A 1DE3A 2D1WA 2J8XB 6RNTA 7RNTA 1ASKA 3Q90A 4XM4A 1FGTA 3BNBA 2YFJB 2KF6A 4IIAA 1BRGA 1GY7A 1X1YA 1Y4KA 2IUKA 1M9GA 4HBRA 2XR8B 1KC84 5LC6A 1G0TA 3IJEB 2CH9A 2HOHA 2W9PA 3LTCA 4BIRA 1E3VA 3DGNA 4J9AA 1A90A 5JPUA 1RGFA 1US1A 4FMBA 1FYSA 1RHLA 3DXOA 4KFDA 8CHOA 1FUWA 1N5PA 2CIUA 2BMQB 4FMCA 3WOEB 2ZDJA 4WP5A 1GYBA 3F40A 2KCDA 3OWUA 1JKGB 4RNYA 2CWVA 1PFPA 2LQVA 2WOFA 3E99A 1LQGC 1O7PB 3NBJA 2LYXA 1HZ1A 2JDIH 5EQLA 1W6CA 2E2UA 3LTAA 1Q7HA 2O9UX 3VF1A 4J5GA 3X42A 4CJNA 1YNVX 4HM6B 4HZBB 4XDWA 3GRDA 3KSED 1JRQA 3CPOA 3FLJA 3V98A 4OVMA 4LGQA 2F5MA 2W9QA 5AEWB 4AEQA 1ZS7A 1RN1A 3EBYA 1K28A 4R80A 4BTYA 1BNSA 2JQ5A 3NUVA 4O8SA 4BU4A 1Q40A 1B2UA 1NWWA 2MC8A 1FGRA 1YJW3 3HOHA 1N8R4 4N6TA 1B2ZA 3CCS3 2C10A 1GOVA 3AMOA 1ROAA 1IVUA 3QK9A 3CPW2 5KP4A 2BMRB 4N6MA 3FKAA 1C54A 1I0VA 2UGIA 3K9MC 1BU4A 1V58A 4N6LA 1YJN3 3H51A 1AVLA 1UI8A 1I2FA 1NB3I 3T8NA 1RDSA 1YJ93 1BRIA 5G1KA 2A15A 2AAEA 3LMLA 1QJGA 2IY2A 2XSHB 2IUJA 1D6YA 3NHXA 1Q864 1B3SA 4WYKA 1TP6A 3S28A 2B24B 1DETA 1UCLA 1TJDA 1G02A 4MEIA 5AEUB 3GZBA 3OW22 2RSXA 4HZ9B 3DMCA 1LRAA 1LQMB 5CF1A 3CCM3 2W56A 1K41A 1WNHA 3CCL3 1RRLA 1BNIA 2HMOB 4K90B 1RRHA 4LMIA 3SEDA 3UJMA 3D9RA 2YFIB 2UUGC 4K61A 1W00A 2BIRA 1W6YA 2BT3A 4HJLB 1M904 4I5QA 4EYCA 3FF0A 3DGLA 1W2B2 1B21A 3F7SA 4FCJA 4O2HA 4U13A 1UUVB 1VQL3 1BGSA 5IEPA 1K734 4HM0B 4K1VA 3WODG 1RCKA 4IT7A 5BXQA 1NU3A 1PYLA 3F8XA 3Q2PA 1A2PA 2FXTA 1SIHA 1TFOA 1IVVA 1D6ZA 1SARA 3MSOA 3VGNA 2HMKB 3PXMA 4R9LA 1VZZA 4MMZB 1HKXA 1GSPA 2C4BA 5EEOA 1OHOA 1SQWA 2XSOB 1JBTA 1BSDA 1YGEA 1B27A 1B20A 1QALA 2GEXA 3F7XA 3NV0A 3KFQC 3MYTA 3WA2X 3CME3 2CX1A 1O7GB 1UCJA 5D83A 3JVCA 1CQSA 1BNFA 1YVSA 3A5EA 1BSEA 4G1MB 3HK4A 1JB4A 1MWRA 4HM4B 1CYVA 1Q42A 1UI7A 2SBLA 4BL3A 1VQK3 3SOAA 3MG3A 2AADA 4KVHA 5D81A 1O7WB 2P0MA 1M1XB 2ZA4A 1G96A 1EEJA 3NX0A 3OXAA 2ZL8A 3B7CA 2Y73A 1FGOA 3DY5A 3F14A 4HOHA 3EN1B 4MMYB 3V92A 3CCE3 3RNTA 1Q824 1OHPA 3SXXA 3UL6A 4RZMA 4CCVA 2W2CA 1A2KA 1RGHA 1B2SA 3U1WA 3GZRA 3S27A 1BNRA 1BRKA 4L7KA 3M8CA 1O7NB 1NDOB 1BRJA 4HM8B 5STDA 1GMQA 2I9WA 1BRSA 3ER7A 2Z7AA 3LTBA 5RNTA 1LOYA 1N9JA 1FGMA 2UX0A 1QAKA 2CHCA 3ECFA 4IPBA 3EX9A 1N8QA 3GWRA 4N6NB 1YIJ3 1KQS2 1MWTA 1NO3A 3I563 2RGQA 2YX9A 3NM7A 4KFFA 1N9EA 5IEOA 3RGAA 2OOVA 1VQM3 4KFEA 2CFWA 2W04A 1RKYA 1UUGB 1VQQA 1N5HA 3LT9A 4XDVA 1M1K4 2Z76A 4GSPA 3BNCA 1K8A4 1C7HA 4HM1B 1RTUA 8RNTA 3MKIA 3MG2A 3FG1A 3SX1A 1W4NA 4LSOA 3ZG5A 4HM5B 5IG4A 1KSIA 1JBRA 2QGUA 1OCVA 1R4CA 1GMPA 1SIIA 6STDA 2QA43 1BOXA 4GHOA 1GOYA 4J5KA 3EN8A 2OTJ3 4CPKA 1RGEA 1IT7A 4I4KA 1ULJB 2WO0A 2R41A 4L8OA 1I2GA 1RN4A 3KZTA 3S29A 1JNQA 2GBXB 1DMMA 1FZUA 1ZX2A 3WDGB 1RLSA 5EVHA 2GSPA 3RDEA 1AVKA 1QVF2 1BNJA 3DZLA 4MMXB 3UB1A 1RNBA 1WMOA 3F8HA 1VQ43 1OF5B 3CU3A 4J8TA 1IU7A 4AKYA 4OUQA 1VQ83 1GMRA 2RFRA 1I3IA 3ROBA 3T0UA 3CC73 2F56A 1ISKA 2FNQA 2PZVA 3CCU3 1IQYA 5AIGA 1IQ8A 2P38A 1S723 5CLKA 4EV2A 3KKGA 1BNEA 2P0XA 3NXJA 4WHAA 1PU4A 3L0RA 1BRNL 3Q1CA 2ZHXB 3EB8A 1AV4A 4EC6A 3G0KA 1LVNA 2F86B 3K5TA 1MWUA 1E97A 1UUWB 1T3BA 1SPUA 2BHMA 2KXGA 2F5WA 2KF4A 1BSAA 5AYSC 3IPTA 3PS8A 4OK0A 1VQ73 9RNTA 4HVNA 1A2VA 1F8NA 5KP3A 2SARA 4LEHA 4X2OA 3B4OA 1DVDA 1VQ53 1JZDA 2CG0A 1UCIA 3X3ZA 1AY7A 4DKIA 3LZAA 1TU5A 1JB2A 2BO9B 2OQEA 3LH4A 1RGLA 4O02B 1TFKA 2HMJB 4QWTA 3K0ZA 1JKGA 1VQ93 2KRTA 1BSBA 1T2IA 2CX0A 2W03A 4R4KA 3A76A 4GL6A 4BL2A 1I70A 1EKMA 3NM2A 4RNZA 3OX9A 3N8BA 3LOYA 1FW7A 1FA3A 1BIRA 3MWZA 1DMQA 3U97A 1J2BA 1OPYA 2K3DA 2O3OA 2YFLB 2CK3H 4JRFA 1RCLA 4Q53A 2CG1A 3X3YA 4CDLA 5CF2A 3CC43 2HMNB 1WMNA 1YI23 3B4PA 3NQYA 3AGNA 5CK6A 2H0GA 1YVBI 4ZM8A 3DGOA 3WOFB 5HOHA 3JUMA 2Q07A 1IVWA 1V57A 2INXA 1RGAA 3DUKA 1OHSA 3BNEA 3CXC2 4AKZA 3BB9A 2CWUA 3LYGA 4HM7B 3CD63 1R4YA 1W2ZA 1Q7Y4 2P05A 4FR9A 1LOXA 3JUNA 3S5CA 1VQO3 3FG4A 3FG3A 1RMSA 3GAXA 5G2GA 1NB5I 1IYYA 2OWPA 2R4IA 1Q9EA 3FSDA 4R9KA 5JBSA 3JUPA 5BVBA 4N6UA 1RSNA 2GEYA 2E2VA 3G713 4KT3B 1V74A 3KN4A 1RGGA 4LYLB 1NJI4 2Z77A 3K7CA 3SLUA 1RN7A 4PEJA 3GSPA 2FGTA 1W7CA 2CW9A 1FUTA 3FZWA 1T5YA 2XH9A 5IERA 3NBBA 1JBSA 3G8ZA 1EQKA 2V1LA 3JUQA 4EV5A 1W01A 1W6GA 2OCTA 3KE7A 6GSPA 1W02A 1EUIC 5AIFA 1B2MA 1Q40B 3BIRA 3KSPA 3TDGA 4XB5A 4FCMA 5M18A 3SOYA 1QAFA 3I0YA 1BUJA 2IYJA 3CCV3 3AMOB 2MF7A 2H0HA 1GS3A 1VQ63 1MGWA 1MWSA 1ULIB 2CFDA 2W6JH 4EW5A 3HI7A 3D4AA 4GB5A 5A0OB 1JN5A 1OGXA 1LXEA 1UDII 3FGYA 1IVXA 3H3HA 3K63A 2GXFA 5AI1A 3Q3FA 1B2XA 5AIHA 3JUOA 3DGYA 4NPBA 3CMA3 3PCSA 1AQZA 2GBWB 2RBIA 3FCSB 4XBTA 1GY5A 4NHFA 5ELJA 1HYFA 1I3FA 1OGZA 1GOUA 2XF3A 1GY6A 1WMPA 3X41A 1OUNA 3DM8A 4WYKB 1ZGXA 1BANA 1O7MB 5TGNA 3G4S3 4O3VA 1RNTA 5G1LA 3AGOA 3X3XA 1WTHA 3IMAB 2XFSA 5BU4A 1K9M4 5M1AA 4FMDA 2KF3A 1I0XA 5LC7A 1STFI 1IV9A 3NBRA 2PNCA 1LOWA 2W56B 3EE1A 5AIIA 2KF5A 2E2TA 2WGQA 2HMLB 4L8PA 1IK3A 1BUQA 5IG5A 1U5OA 3ZFZA 5DREA 1TIJA 3PZWA 1UGIA 3PCRA 3CC23 3G6E3 1S5AA 1X1WA 1FUSA 2GU1A 4K1UA 1IV7A 1DMNA 5FGOA 3J7Yd 5IG3A 4FCZA 1BSCA 4BTXA 4HM3B 1A67A 2F99A 2WOHA 7STDA 3OWSA 5IF6A 3VSYA 1FGQA 3G16A 2OQEC 2RCDA 3SYUA 2L4VA 4HKVB 3S67A 4KZ1A 2CFKA 1PY3A 1I2EA 1CH0A 1JV2B 1TUHA 1DVCA 3EQQB 1ROVA 1W5ZA 3D79A 1LNIA 1MOLA 2BU4A 3N9HA 4N6OB 5AYRB 3UL5A 1I8VA 3X40A 5IENA 1OACA 3ALAA 3HZPA 2B1XB 2K0MA 5FW5A 1IDPA 4R1KA 1TRQA 3EBTA 4EXRA 1EG9B 3NV0B 3CCJ3 5CXOA 2D42A 2CWTA 2XGLA 2GU3A 4FMAA 5KP1A 2C11A 1TRPA 4N3VA 1EA2A 2CC3A 3CCQ3 3WMDA 3CNMA 2BNGA 3UNLA 2QEX3 3PYJA 4ORLA 4H61A 1JB5A 3LTDA 1GD3A 2WGOA 3B8LA 3PGBA 2XEPA 5IW9A
chains in the Genus database with same CATH topology
1YIT3 3O8YA 1DYUA 4LZIA 3EF8A 4WFOA 1Z1SA 1O7HB 4TX4A 3DGMA 2F98A 2CFLA 1AR0A 1E3RA 1IT8A 2OTL3 3N54B 3OWYA 3OV4A 3V99A 1CYUA 2BMOB 1QVG2 4BTWA 2W0QA 2IA7A 3EC9A 3GZXB 1LNHA 1CEWI 5D82A 1IQXA 1JN5B 1QMAA 5I97A 1MNLA 4WWUC 2Y74A 1OF5A 3CNXA 4XBXA 4XBYA 2HMMB 4HM2B 2IMJA 3BNDA 4X2HA 3T8UA 3I553 2XFTA 1L5GB 1RJOA 2QIYA 2Z6BA 4NREA 3FF2A 2OOVC 1GD4A 3WA3A 1JJ22 1U8CB 1KD14 4N6V0 5HGRA 1SJWA 2ML6A 5IG0A 2CKFB 3RGRA 3CCR3 3MPHA 4STDA 3NQZA 3QRDA 1ZO2A 2ML5A 3HIIA 3LT8A 5ELUA 5JPPA 2K54A 1Q814 1VQN3 1D6UA 2P09A 2M7OA 3BLZA 3D3LA 2XGNA 2XRXB 3KIIA 3LXUX 4JF8A 1OH0A 1WQLB 3STDA 1HU9A 1YHQ3 4H3UA 3FH1A 3GZYB 3F9SA 1STDA 4RBNA 3HIGA 4HYZA 4MJDA 5DRVA 4EBGA 3MHEA 2STDA 1KWIA 3EHCA 2CFGA 3SVAA 1VQP3 1UW1A 3EJVA 3HX8A 3MG1A 2D1WA 1ASKA 3Q90A 4XM4A 1FGTA 3BNBA 2YFJB 4IIAA 1GY7A 1Y4KA 2IUKA 1M9GA 4HBRA 2XR8B 1KC84 5LC6A 3IJEB 2CH9A 2W9PA 3LTCA 1E3VA 3DGNA 4J9AA 1A90A 5JPUA 4FMBA 1US1A 4KFDA 3DXOA 8CHOA 1FUWA 1N5PA 2CIUA 2BMQB 4FMCA 3WOEB 2ZDJA 4WP5A 1GYBA 3F40A 2KCDA 3OWUA 1JKGB 4RNYA 2CWVA 1PFPA 2LQVA 2WOFA 3E99A 1O7PB 3NBJA 2LYXA 5EQLA 2JDIH 1W6CA 2E2UA 3LTAA 2O9UX 3VF1A 3X42A 4HM6B 4HZBB 4XDWA 3GRDA 3KSED 1JRQA 3CPOA 3FLJA 3V98A 4OVMA 4LGQA 2W9QA 5AEWB 4AEQA 3EBYA 1K28A 4R80A 4BTYA 2JQ5A 3NUVA 4O8SA 1Q40A 1NWWA 1YJW3 2MC8A 1FGRA 1N8R4 4N6TA 3CCS3 2C10A 3AMOA 1ROAA 1IVUA 3QK9A 3CPW2 5KP4A 2BMRB 4N6MA 3FKAA 3K9MC 1YJN3 4N6LA 3H51A 1AVLA 1UI8A 1NB3I 3T8NA 1YJ93 2A15A 3LMLA 1QJGA 2XSHB 1Q864 2IUJA 1D6YA 3NHXA 4WYKA 3S28A 1TP6A 2B24B 4MEIA 5AEUB 3GZBA 3OW22 2RSXA 4HZ9B 3DMCA 5CF1A 3CCM3 2W56A 1K41A 1WNHA 3CCL3 1RRLA 2HMOB 4K90B 4LMIA 1RRHA 3UJMA 3SEDA 3D9RA 2YFIB 4K61A 1W00A 1W6YA 2BT3A 4HJLB 1M904 4EYCA 3FF0A 3DGLA 1W2B2 3F7SA 4FCJA 4O2HA 4U13A 1UUVB 1VQL3 5IEPA 1K734 4HM0B 4K1VA 3WODG 4IT7A 5BXQA 1NU3A 3F8XA 3Q2PA 2FXTA 1SIHA 1TFOA 1IVVA 1D6ZA 3MSOA 3VGNA 2HMKB 3PXMA 4R9LA 1VZZA 4MMZB 1HKXA 5EEOA 1OHOA 1SQWA 2XSOB 1YGEA 2GEXA 3F7XA 1QALA 3WA2X 1FA3A 3NV0A 3KFQC 3MYTA 3CME3 1O7GB 5D83A 3JVCA 1CQSA 4G1MB 3HK4A 1JB4A 4HM4B 1CYVA 1Q42A 1UI7A 2SBLA 1VQK3 3SOAA 3MG3A 4KVHA 5D81A 1O7WB 2P0MA 1M1XB 3NX0A 1G96A 3OXAA 2ZL8A 3B7CA 2Y73A 1FGOA 3DY5A 3F14A 3EN1B 4MMYB 3V92A 3CCE3 1Q824 1OHPA 3SXXA 3UL6A 4RZMA 4CCVA 2W2CA 1A2KA 3U1WA 3GZRA 3S27A 4L7KA 3M8CA 1O7NB 1NDOB 4HM8B 5STDA 2I9WA 3LTBA 3ER7A 2Z7AA 1N9JA 1FGMA 2UX0A 1QAKA 2CHCA 3ECFA 4IPBA 3EX9A 1N8QA 3GWRA 4N6NB 1YIJ3 1KQS2 1NO3A 3I563 2RGQA 2YX9A 3NM7A 4KFFA 1N9EA 5IEOA 3RGAA 2OOVA 1VQM3 4KFEA 2CFWA 2W04A 1RKYA 1N5HA 3LT9A 4XDVA 1M1K4 2Z76A 3BNCA 1K8A4 1C7HA 4HM1B 3MKIA 3MG2A 3FG1A 3SX1A 1W4NA 4LSOA 4HM5B 5IG4A 1KSIA 2QGUA 1OCVA 1R4CA 1SIIA 6STDA 2QA43 2OTJ3 3EN8A 1IT7A 4I4KA 1ULJB 2WO0A 4L8OA 3S29A 3KZTA 1JNQA 2GBXB 1DMMA 1ZX2A 3WDGB 5EVHA 3RDEA 1AVKA 1QVF2 3DZLA 4MMXB 3UB1A 1WMOA 3F8HA 1VQ43 1OF5B 3CU3A 4J8TA 1IU7A 4AKYA 4OUQA 1VQ83 3ROBA 2RFRA 3T0UA 3CC73 1ISKA 2PZVA 2FNQA 3CCU3 1IQYA 5AIGA 1IQ8A 2P38A 1S723 5CLKA 4EV2A 3KKGA 2P0XA 3NXJA 4WHAA 1PU4A 3L0RA 3Q1CA 3EB8A 4EC6A 1AV4A 3G0KA 1LVNA 2F86B 3K5TA 1E97A 1UUWB 1SPUA 2BHMA 2KXGA 5AYSC 3IPTA 3PS8A 4OK0A 1VQ73 4HVNA 1A2VA 1F8NA 5KP3A 4LEHA 1DVDA 4X2OA 3B4OA 1VQ53 2CG0A 3X3ZA 1TU5A 3LZAA 1JB2A 2BO9B 2OQEA 3LH4A 4O02B 1TFKA 2HMJB 4QWTA 3K0ZA 1JKGA 1VQ93 2KRTA 2W03A 4R4KA 3A76A 4GL6A 1EKMA 3NM2A 4RNZA 3OX9A 3N8BA 3LOYA 3MWZA 1DMQA 3U97A 1J2BA 2YFLB 1OPYA 2O3OA 4JRFA 2CK3H 4Q53A 2CG1A 3X3YA 3CC43 5CF2A 4CDLA 2HMNB 1WMNA 1YI23 3B4PA 3NQYA 5CK6A 4ZM8A 1YVBI 3DGOA 3WOFB 3JUMA 2Q07A 1IVWA 2INXA 3DUKA 1OHSA 3BNEA 3CXC2 4AKZA 3BB9A 2CWUA 3LYGA 4HM7B 3CD63 1W2ZA 1Q7Y4 2P05A 4FR9A 1LOXA 3JUNA 3S5CA 1VQO3 3FG4A 3FG3A 3GAXA 5G2GA 1NB5I 2OWPA 2R4IA 3FSDA 4R9KA 5JBSA 3JUPA 5BVBA 4N6UA 2GEYA 2E2VA 3G713 1V74A 3KN4A 1NJI4 2Z77A 3K7CA 3SLUA 1RN7A 4PEJA 2FGTA 1W7CA 2CW9A 3FZWA 5IERA 1T5YA 2XH9A 3NBBA 3G8ZA 1EQKA 2V1LA 3JUQA 4EV5A 1W01A 1W6GA 2OCTA 3KE7A 1W02A 5AIFA 1Q40B 3KSPA 3TDGA 4XB5A 4FCMA 3SOYA 1QAFA 3I0YA 3CCV3 3AMOB 2MF7A 1GS3A 1VQ63 1ULIB 2CFDA 2W6JH 3HI7A 4GB5A 5A0OB 1JN5A 1OGXA 1LXEA 3FGYA 1IVXA 3H3HA 3K63A 2GXFA 5AI1A 5AIHA 3JUOA 3CMA3 3PCSA 2GBWB 3FCSB 4XBTA 1GY5A 4NHFA 5ELJA 2XF3A 1OGZA 1GY6A 1WMPA 3X41A 1OUNA 3DM8A 4WYKB 5TGNA 1O7MB 3G4S3 4O3VA 3X3XA 1WTHA 3IMAB 2XFSA 1K9M4 4FMDA 5LC7A 1STFI 1IV9A 3NBRA 2PNCA 2W56B 3EE1A 5AIIA 2E2TA 2WGQA 2HMLB 4L8PA 1IK3A 1BUQA 5IG5A 1U5OA 5DREA 1TIJA 3PZWA 3PCRA 3CC23 3G6E3 1S5AA 4K1UA 2GU1A 1IV7A 1DMNA 5FGOA 3J7Yd 5IG3A 4FCZA 4BTXA 4HM3B 1A67A 2F99A 2WOHA 7STDA 3OWSA 5IF6A 3VSYA 1FGQA 3G16A 2OQEC 2RCDA 2L4VA 4HKVB 3S67A 4KZ1A 2CFKA 3EQQB 1JV2B 1DVCA 1TUHA 1ROVA 1W5ZA 4N6OB 1MOLA 3N9HA 5AYRB 3UL5A 3X40A 5IENA 1OACA 3ALAA 3HZPA 2B1XB 2K0MA 5FW5A 1IDPA 4R1KA 4EXRA 3EBTA 1EG9B 3NV0B 3CCJ3 5CXOA 2D42A 2CWTA 2XGLA 2GU3A 4FMAA 5KP1A 2C11A 4N3VA 3CCQ3 1EA2A 2CC3A 3WMDA 3CNMA 2BNGA 3UNLA 2QEX3 3PYJA 4ORLA 4H61A 1JB5A 3LTDA 1GD3A 2WGOA 3B8LA 3PGBA 2XEPA 5IW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF8 A;  1Z1S A;  1O7H B;  2F98 A;  1AR0 A;  1E3R A;  3OWY A;  3OV4 A;  2BMO B;  3EC9 A;  3GZX B;  5D82 A;  1JN5 B;  1QMA A;  4WWU C;  1OF5 A;  3CNX A;  4XBX A;  4XBY A;  2HMM B;  4HM2 B;  2IMJ A;  4X2H A;  3T8U A;  2QIY A;  3FF2 A;  5HGR A;  1SJW A;  5IG0 A;  2CKF B;  3RGR A;  4STD A;  1ZO2 A;  5JPP A;  2K54 A;  3BLZ A;  2XRX B;  1OH0 A;  1WQL B;  3STD A;  4H3U A;  3FH1 A;  3GZY B;  3F9S A;  1STD A;  4MJD A;  5DRV A;  3MHE A;  2STD A;  3EHC A;  3EJV A;  3HX8 A;  3MG1 A;  1ASK A;  3Q90 A;  4XM4 A;  2YFJ B;  4IIA A;  1GY7 A;  2XR8 B;  1E3V A;  4J9A A;  5JPU A;  8CHO A;  3DXO A;  2BMQ B;  4WP5 A;  1GYB A;  3F40 A;  3OWU A;  1JKG B;  3E99 A;  1O7P B;  4HM6 B;  4XDW A;  4HZB B;  3GRD A;  3CPO A;  3FLJ A;  4OVM A;  4LGQ A;  5AEW B;  3EBY A;  2JQ5 A;  3NUV A;  1Q40 A;  1NWW A;  5KP4 A;  2BMR B;  3FKA A;  3H51 A;  3T8N A;  2A15 A;  1QJG A;  2XSH B;  3NHX A;  4WYK A;  1TP6 A;  2B24 B;  5AEU B;  3GZB A;  4HZ9 B;  3DMC A;  5CF1 A;  1K41 A;  2HMO B;  4LMI A;  3UJM A;  3SED A;  3D9R A;  2YFI B;  1W00 A;  1W6Y A;  4HJL B;  3FF0 A;  3F7S A;  4FCJ A;  4U13 A;  1UUV B;  5IEP A;  4HM0 B;  4K1V A;  5BXQ A;  1NU3 A;  3F8X A;  3MSO A;  3VGN A;  2HMK B;  4R9L A;  1VZZ A;  1HKX A;  1OHO A;  2XSO B;  2GEX A;  3F7X A;  3NV0 A;  3MYT A;  1O7G B;  5D83 A;  1CQS A;  3HK4 A;  1JB4 A;  4HM4 B;  1Q42 A;  3SOA A;  3MG3 A;  4KVH A;  5D81 A;  1O7W B;  3OXA A;  3B7C A;  3F14 A;  3EN1 B;  1OHP A;  4RZM A;  2W2C A;  1A2K A;  3GZR A;  4L7K A;  3M8C A;  1NDO B;  1O7N B;  4HM8 B;  5STD A;  2I9W A;  3ER7 A;  2Z7A A;  2UX0 A;  3ECF A;  2CHC A;  3WMD A;  3EX9 A;  3GWR A;  2RGQ A;  5IEO A;  3RGA A;  4XDV A;  2Z76 A;  1C7H A;  4HM1 B;  3MKI A;  3MG2 A;  4HM5 B;  5IG4 A;  2QGU A;  1OCV A;  6STD A;  3EN8 A;  4I4K A;  1ULJ B;  4L8O A;  3KZT A;  2GBX B;  1DMM A;  1ZX2 A;  5EVH A;  3DZL A;  3F8H A;  1OF5 B;  3CU3 A;  4J8T A;  4OUQ A;  3ROB A;  2RFR A;  1ISK A;  2PZV A;  5AIG A;  5CLK A;  3KKG A;  3NXJ A;  3G0K A;  2F86 B;  1E97 A;  1UUW B;  3IPT A;  4HVN A;  5KP3 A;  4LEH A;  4X2O A;  3B4O A;  3LZA A;  1JB2 A;  2HMJ B;  3K0Z A;  1JKG A;  3A76 A;  3NM2 A;  3OX9 A;  1DMQ A;  1OPY A;  2YFL B;  4Q53 A;  5CF2 A;  4CDL A;  2HMN B;  3B4P A;  5CK6 A;  3JUM A;  2INX A;  3DUK A;  1OHS A;  4HM7 B;  3BB9 A;  3LYG A;  3JUN A;  3S5C A;  5G2G A;  2OWP A;  2R4I A;  3FSD A;  4R9K A;  3JUP A;  5BVB A;  2GEY A;  2Z77 A;  3K7C A;  4PEJ A;  3FZW A;  5IER A;  3G8Z A;  3JUQ A;  1W01 A;  3KE7 A;  1W02 A;  5AIF A;  1Q40 B;  3KSP A;  4XB5 A;  4FCM A;  3SOY A;  3I0Y A;  1GS3 A;  1ULI B;  4GB5 A;  1JN5 A;  1OGX A;  3FGY A;  3H3H A;  5AI1 A;  2GXF A;  5AIH A;  3JUO A;  2GBW B;  4XBT A;  1GY5 A;  1OGZ A;  1GY6 A;  1OUN A;  3DM8 A;  4WYK B;  5TGN A;  1O7M B;  3NBR A;  5AII A;  1BUQ A;  4L8P A;  2HML B;  5IG5 A;  1U5O A;  5DRE A;  1S5A A;  4K1U A;  1DMN A;  5IG3 A;  4HM3 B;  2F99 A;  7STD A;  3OWS A;  5IF6 A;  3VSY A;  3G16 A;  2RCD A;  4HKV B;  3EQQ B;  1TUH A;  5IEN A;  3HZP A;  2B1X B;  5FW5 A;  1IDP A;  4R1K A;  3EBT A;  1EG9 B;  3NV0 B;  5CXO A;  5KP1 A;  4N3V A;  1EA2 A;  3CNM A;  2BNG A;  3UNL A;  4ORL A;  1JB5 A;  3B8L A; 
#chains in the Genus database with same CATH topology
 1RGK A;  1BAO A;  1UCK A;  1YIT 3;  3O8Y A;  1DYU A;  4LZI A;  2H0I A;  3EF8 A;  2KAA A;  4WFO A;  3BU4 A;  7GSP A;  1Z1S A;  1O7H B;  4TX4 A;  3DGM A;  3WHO A;  2F98 A;  2CFL A;  1AR0 A;  1MGR A;  1E3R A;  1IT8 A;  3KCH A;  2OTL 3;  3N54 B;  3OWY A;  3OV4 A;  3V99 A;  1CYU A;  2BMO B;  1QVG 2;  4BTW A;  2W0Q A;  1X1U A;  2IA7 A;  3EC9 A;  1LNH A;  3GZX B;  1CEW I;  3DH2 A;  5D82 A;  1IQX A;  3URP A;  1JN5 B;  1NNV A;  1QMA A;  1BRH A;  2L1S A;  3D5I A;  5BIR A;  5I97 A;  1MNL A;  4WWU C;  1RGC A;  1BNG A;  2Y74 A;  3AHW A;  1OF5 A;  3CNX A;  4XBX A;  1X1X A;  1UGH I;  2HMM B;  4HM2 B;  4XBY A;  2IMJ A;  3BND A;  4RNT A;  4X2H A;  5GSP A;  3T8U A;  3I55 3;  2XFT A;  1L5G B;  1RJO A;  2QIY A;  2Z6B A;  4NRE A;  4HAA A;  3FF2 A;  2OOV C;  1GD4 A;  3WA3 A;  1JJ2 2;  3AHS A;  1U8C B;  1KD1 4;  4N6V 0;  1LOV A;  5HGR A;  1SJW A;  2ML6 A;  5IG0 A;  2CKF B;  3RGR A;  3CCR 3;  1T2H A;  3MPH A;  5M19 A;  4STD A;  3NQZ A;  3QRD A;  3ZG0 A;  1BVI A;  1ZO2 A;  2ML5 A;  3D5G A;  3HII A;  3LT8 A;  2F4Y A;  5ELU A;  2RNT A;  5JPP A;  2K54 A;  1Q81 4;  1VQN 3;  1D6U A;  2P09 A;  2M7O A;  3BLZ A;  3D3L A;  2XGN A;  2XRX B;  3KII A;  3LXU X;  4JF8 A;  1OH0 A;  1TTO A;  1WQL B;  1HU9 A;  3STD A;  1YHQ 3;  4H3U A;  1JZO A;  3FH1 A;  3WR2 A;  3GZY B;  3F9S A;  1STD A;  4ILF A;  4RBN A;  3HIG A;  4HYZ A;  1YGW A;  4MJD A;  5DRV A;  4EBG A;  3MHE A;  2STD A;  1KWI A;  3EHC A;  2CFG A;  3SVA A;  1VQP 3;  1UW1 A;  3EJV A;  3HX8 A;  3MG1 A;  1DE3 A;  2D1W A;  2J8X B;  6RNT A;  7RNT A;  1ASK A;  3Q90 A;  4XM4 A;  1FGT A;  3BNB A;  2YFJ B;  2KF6 A;  4IIA A;  1BRG A;  1GY7 A;  1X1Y A;  1Y4K A;  2IUK A;  1M9G A;  4HBR A;  2XR8 B;  1KC8 4;  5LC6 A;  1G0T A;  3IJE B;  2CH9 A;  2HOH A;  2W9P A;  3LTC A;  4BIR A;  1E3V A;  3DGN A;  4J9A A;  1A90 A;  5JPU A;  1RGF A;  1US1 A;  4FMB A;  1FYS A;  1RHL A;  3DXO A;  4KFD A;  8CHO A;  1FUW A;  1N5P A;  2CIU A;  2BMQ B;  4FMC A;  3WOE B;  2ZDJ A;  4WP5 A;  1GYB A;  3F40 A;  2KCD A;  3OWU A;  1JKG B;  4RNY A;  2CWV A;  1PFP A;  2LQV A;  2WOF A;  3E99 A;  1LQG C;  1O7P B;  3NBJ A;  2LYX A;  1HZ1 A;  2JDI H;  5EQL A;  1W6C A;  2E2U A;  3LTA A;  1Q7H A;  2O9U X;  3VF1 A;  4J5G A;  3X42 A;  4CJN A;  1YNV X;  4HM6 B;  4HZB B;  4XDW A;  3GRD A;  3KSE D;  1JRQ A;  3CPO A;  3FLJ A;  3V98 A;  4OVM A;  4LGQ A;  2F5M A;  2W9Q A;  5AEW B;  4AEQ A;  1ZS7 A;  1RN1 A;  3EBY A;  1K28 A;  4R80 A;  4BTY A;  1BNS A;  2JQ5 A;  3NUV A;  4O8S A;  4BU4 A;  1Q40 A;  1B2U A;  1NWW A;  2MC8 A;  1FGR A;  1YJW 3;  3HOH A;  1N8R 4;  4N6T A;  1B2Z A;  3CCS 3;  2C10 A;  1GOV A;  3AMO A;  1ROA A;  1IVU A;  3QK9 A;  3CPW 2;  5KP4 A;  2BMR B;  4N6M A;  3FKA A;  1C54 A;  1I0V A;  2UGI A;  3K9M C;  1BU4 A;  1V58 A;  4N6L A;  1YJN 3;  3H51 A;  1AVL A;  1UI8 A;  1I2F A;  1NB3 I;  3T8N A;  1RDS A;  1YJ9 3;  1BRI A;  5G1K A;  2A15 A;  2AAE A;  3LML A;  1QJG A;  2IY2 A;  2XSH B;  2IUJ A;  1D6Y A;  3NHX A;  1Q86 4;  1B3S A;  4WYK A;  1TP6 A;  3S28 A;  2B24 B;  1DET A;  1UCL A;  1TJD A;  1G02 A;  4MEI A;  5AEU B;  3GZB A;  3OW2 2;  2RSX A;  4HZ9 B;  3DMC A;  1LRA A;  1LQM B;  5CF1 A;  3CCM 3;  2W56 A;  1K41 A;  1WNH A;  3CCL 3;  1RRL A;  1BNI A;  2HMO B;  4K90 B;  1RRH A;  4LMI A;  3SED A;  3UJM A;  3D9R A;  2YFI B;  2UUG C;  4K61 A;  1W00 A;  2BIR A;  1W6Y A;  2BT3 A;  4HJL B;  1M90 4;  4I5Q A;  4EYC A;  3FF0 A;  3DGL A;  1W2B 2;  1B21 A;  3F7S A;  4FCJ A;  4O2H A;  4U13 A;  1UUV B;  1VQL 3;  1BGS A;  5IEP A;  1K73 4;  4HM0 B;  4K1V A;  3WOD G;  1RCK A;  4IT7 A;  5BXQ A;  1NU3 A;  1PYL A;  3F8X A;  3Q2P A;  1A2P A;  2FXT A;  1SIH A;  1TFO A;  1IVV A;  1D6Z A;  1SAR A;  3MSO A;  3VGN A;  2HMK B;  3PXM A;  4R9L A;  1VZZ A;  4MMZ B;  1HKX A;  1GSP A;  2C4B A;  5EEO A;  1OHO A;  1SQW A;  2XSO B;  1JBT A;  1BSD A;  1YGE A;  1B27 A;  1B20 A;  1QAL A;  2GEX A;  3F7X A;  3NV0 A;  3KFQ C;  3MYT A;  3WA2 X;  3CME 3;  2CX1 A;  1O7G B;  1UCJ A;  5D83 A;  3JVC A;  1CQS A;  1BNF A;  1YVS A;  3A5E A;  1BSE A;  4G1M B;  3HK4 A;  1JB4 A;  1MWR A;  4HM4 B;  1CYV A;  1Q42 A;  1UI7 A;  2SBL A;  4BL3 A;  1VQK 3;  3SOA A;  3MG3 A;  2AAD A;  4KVH A;  5D81 A;  1O7W B;  2P0M A;  1M1X B;  2ZA4 A;  1G96 A;  1EEJ A;  3NX0 A;  3OXA A;  2ZL8 A;  3B7C A;  2Y73 A;  1FGO A;  3DY5 A;  3F14 A;  4HOH A;  3EN1 B;  4MMY B;  3V92 A;  3CCE 3;  3RNT A;  1Q82 4;  1OHP A;  3SXX A;  3UL6 A;  4RZM A;  4CCV A;  2W2C A;  1A2K A;  1RGH A;  1B2S A;  3U1W A;  3GZR A;  3S27 A;  1BNR A;  1BRK A;  4L7K A;  3M8C A;  1O7N B;  1NDO B;  1BRJ A;  4HM8 B;  5STD A;  1GMQ A;  2I9W A;  1BRS A;  3ER7 A;  2Z7A A;  3LTB A;  5RNT A;  1LOY A;  1N9J A;  1FGM A;  2UX0 A;  1QAK A;  2CHC A;  3ECF A;  4IPB A;  3EX9 A;  1N8Q A;  3GWR A;  4N6N B;  1YIJ 3;  1KQS 2;  1MWT A;  1NO3 A;  3I56 3;  2RGQ A;  2YX9 A;  3NM7 A;  4KFF A;  1N9E A;  5IEO A;  3RGA A;  2OOV A;  1VQM 3;  4KFE A;  2CFW A;  2W04 A;  1RKY A;  1UUG B;  1VQQ A;  1N5H A;  3LT9 A;  4XDV A;  1M1K 4;  2Z76 A;  4GSP A;  3BNC A;  1K8A 4;  1C7H A;  4HM1 B;  1RTU A;  8RNT A;  3MKI A;  3MG2 A;  3FG1 A;  3SX1 A;  1W4N A;  4LSO A;  3ZG5 A;  4HM5 B;  5IG4 A;  1KSI A;  1JBR A;  2QGU A;  1OCV A;  1R4C A;  1GMP A;  1SII A;  6STD A;  2QA4 3;  1BOX A;  4GHO A;  1GOY A;  4J5K A;  3EN8 A;  2OTJ 3;  4CPK A;  1RGE A;  1IT7 A;  4I4K A;  1ULJ B;  2WO0 A;  2R41 A;  4L8O A;  1I2G A;  1RN4 A;  3KZT A;  3S29 A;  1JNQ A;  2GBX B;  1DMM A;  1FZU A;  1ZX2 A;  3WDG B;  1RLS A;  5EVH A;  2GSP A;  3RDE A;  1AVK A;  1QVF 2;  1BNJ A;  3DZL A;  4MMX B;  3UB1 A;  1RNB A;  1WMO A;  3F8H A;  1VQ4 3;  1OF5 B;  3CU3 A;  4J8T A;  1IU7 A;  4AKY A;  4OUQ A;  1VQ8 3;  1GMR A;  2RFR A;  1I3I A;  3ROB A;  3T0U A;  3CC7 3;  2F56 A;  1ISK A;  2FNQ A;  2PZV A;  3CCU 3;  1IQY A;  5AIG A;  1IQ8 A;  2P38 A;  1S72 3;  5CLK A;  4EV2 A;  3KKG A;  1BNE A;  2P0X A;  3NXJ A;  4WHA A;  1PU4 A;  3L0R A;  1BRN L;  3Q1C A;  2ZHX B;  3EB8 A;  1AV4 A;  4EC6 A;  3G0K A;  1LVN A;  2F86 B;  3K5T A;  1MWU A;  1E97 A;  1UUW B;  1T3B A;  1SPU A;  2BHM A;  2KXG A;  2F5W A;  2KF4 A;  1BSA A;  5AYS C;  3IPT A;  3PS8 A;  4OK0 A;  1VQ7 3;  9RNT A;  4HVN A;  1A2V A;  1F8N A;  5KP3 A;  2SAR A;  4LEH A;  4X2O A;  3B4O A;  1DVD A;  1VQ5 3;  1JZD A;  2CG0 A;  1UCI A;  3X3Z A;  1AY7 A;  4DKI A;  3LZA A;  1TU5 A;  1JB2 A;  2BO9 B;  2OQE A;  3LH4 A;  1RGL A;  4O02 B;  1TFK A;  2HMJ B;  4QWT A;  3K0Z A;  1JKG A;  1VQ9 3;  2KRT A;  1BSB A;  1T2I A;  2CX0 A;  2W03 A;  4R4K A;  3A76 A;  4GL6 A;  4BL2 A;  1I70 A;  1EKM A;  3NM2 A;  4RNZ A;  3OX9 A;  3N8B A;  3LOY A;  1FW7 A;  1FA3 A;  1BIR A;  3MWZ A;  1DMQ A;  3U97 A;  1J2B A;  1OPY A;  2K3D A;  2O3O A;  2YFL B;  2CK3 H;  4JRF A;  1RCL A;  4Q53 A;  2CG1 A;  3X3Y A;  4CDL A;  5CF2 A;  3CC4 3;  2HMN B;  1WMN A;  1YI2 3;  3B4P A;  3NQY A;  3AGN A;  5CK6 A;  2H0G A;  1YVB I;  4ZM8 A;  3DGO A;  3WOF B;  5HOH A;  3JUM A;  2Q07 A;  1IVW A;  1V57 A;  2INX A;  1RGA A;  3DUK A;  1OHS A;  3BNE A;  3CXC 2;  4AKZ A;  3BB9 A;  2CWU A;  3LYG A;  4HM7 B;  3CD6 3;  1R4Y A;  1W2Z A;  1Q7Y 4;  2P05 A;  4FR9 A;  1LOX A;  3JUN A;  3S5C A;  1VQO 3;  3FG4 A;  3FG3 A;  1RMS A;  3GAX A;  5G2G A;  1NB5 I;  1IYY A;  2OWP A;  2R4I A;  1Q9E A;  3FSD A;  4R9K A;  5JBS A;  3JUP A;  5BVB A;  4N6U A;  1RSN A;  2GEY A;  2E2V A;  3G71 3;  4KT3 B;  1V74 A;  3KN4 A;  1RGG A;  4LYL B;  1NJI 4;  2Z77 A;  3K7C A;  3SLU A;  1RN7 A;  4PEJ A;  3GSP A;  2FGT A;  1W7C A;  2CW9 A;  1FUT A;  3FZW A;  1T5Y A;  2XH9 A;  5IER A;  3NBB A;  1JBS A;  3G8Z A;  1EQK A;  2V1L A;  3JUQ A;  4EV5 A;  1W01 A;  1W6G A;  2OCT A;  3KE7 A;  6GSP A;  1W02 A;  1EUI C;  5AIF A;  1B2M A;  1Q40 B;  3BIR A;  3KSP A;  3TDG A;  4XB5 A;  4FCM A;  5M18 A;  3SOY A;  1QAF A;  3I0Y A;  1BUJ A;  2IYJ A;  3CCV 3;  3AMO B;  2MF7 A;  2H0H A;  1GS3 A;  1VQ6 3;  1MGW A;  1MWS A;  1ULI B;  2CFD A;  2W6J H;  4EW5 A;  3HI7 A;  3D4A A;  4GB5 A;  5A0O B;  1JN5 A;  1OGX A;  1LXE A;  1UDI I;  3FGY A;  1IVX A;  3H3H A;  3K63 A;  2GXF A;  5AI1 A;  3Q3F A;  1B2X A;  5AIH A;  3JUO A;  3DGY A;  4NPB A;  3CMA 3;  3PCS A;  1AQZ A;  2GBW B;  2RBI A;  3FCS B;  4XBT A;  1GY5 A;  4NHF A;  5ELJ A;  1HYF A;  1I3F A;  1OGZ A;  1GOU A;  2XF3 A;  1GY6 A;  1WMP A;  3X41 A;  1OUN A;  3DM8 A;  4WYK B;  1ZGX A;  1BAN A;  1O7M B;  5TGN A;  3G4S 3;  4O3V A;  1RNT A;  5G1L A;  3AGO A;  3X3X A;  1WTH A;  3IMA B;  2XFS A;  5BU4 A;  1K9M 4;  5M1A A;  4FMD A;  2KF3 A;  1I0X A;  5LC7 A;  1STF I;  1IV9 A;  3NBR A;  2PNC A;  1LOW A;  2W56 B;  3EE1 A;  5AII A;  2KF5 A;  2E2T A;  2WGQ A;  2HML B;  4L8P A;  1IK3 A;  1BUQ A;  5IG5 A;  1U5O A;  3ZFZ A;  5DRE A;  1TIJ A;  3PZW A;  1UGI A;  3PCR A;  3CC2 3;  3G6E 3;  1S5A A;  1X1W A;  1FUS A;  2GU1 A;  4K1U A;  1IV7 A;  1DMN A;  5FGO A;  3J7Y d;  5IG3 A;  4FCZ A;  1BSC A;  4BTX A;  4HM3 B;  1A67 A;  2F99 A;  2WOH A;  7STD A;  3OWS A;  5IF6 A;  3VSY A;  1FGQ A;  3G16 A;  2OQE C;  2RCD A;  3SYU A;  2L4V A;  4HKV B;  3S67 A;  4KZ1 A;  2CFK A;  1PY3 A;  1I2E A;  1CH0 A;  1JV2 B;  1TUH A;  1DVC A;  3EQQ B;  1ROV A;  1W5Z A;  3D79 A;  1LNI A;  1MOL A;  2BU4 A;  3N9H A;  4N6O B;  5AYR B;  3UL5 A;  1I8V A;  3X40 A;  5IEN A;  1OAC A;  3ALA A;  3HZP A;  2B1X B;  2K0M A;  5FW5 A;  1IDP A;  4R1K A;  1TRQ A;  3EBT A;  4EXR A;  1EG9 B;  3NV0 B;  3CCJ 3;  5CXO A;  2D42 A;  2CWT A;  2XGL A;  2GU3 A;  4FMA A;  5KP1 A;  2C11 A;  1TRP A;  4N3V A;  1EA2 A;  2CC3 A;  3CCQ 3;  3WMD A;  3CNM A;  2BNG A;  3UNL A;  2QEX 3;  3PYJ A;  4ORL A;  4H61 A;  1JB5 A;  3LTD A;  1GD3 A;  2WGO A;  3B8L A;  3PGB A;  2XEP A;  5IW9 A; 
#chains in the Genus database with same CATH homology
 1YIT 3;  3O8Y A;  1DYU A;  4LZI A;  3EF8 A;  4WFO A;  1Z1S A;  1O7H B;  4TX4 A;  3DGM A;  2F98 A;  2CFL A;  1AR0 A;  1E3R A;  1IT8 A;  2OTL 3;  3N54 B;  3OWY A;  3OV4 A;  3V99 A;  1CYU A;  2BMO B;  1QVG 2;  4BTW A;  2W0Q A;  2IA7 A;  3EC9 A;  3GZX B;  1LNH A;  1CEW I;  5D82 A;  1IQX A;  1JN5 B;  1QMA A;  5I97 A;  1MNL A;  4WWU C;  2Y74 A;  1OF5 A;  3CNX A;  4XBX A;  4XBY A;  2HMM B;  4HM2 B;  2IMJ A;  3BND A;  4X2H A;  3T8U A;  3I55 3;  2XFT A;  1L5G B;  1RJO A;  2QIY A;  2Z6B A;  4NRE A;  3FF2 A;  2OOV C;  1GD4 A;  3WA3 A;  1JJ2 2;  1U8C B;  1KD1 4;  4N6V 0;  5HGR A;  1SJW A;  2ML6 A;  5IG0 A;  2CKF B;  3RGR A;  3CCR 3;  3MPH A;  4STD A;  3NQZ A;  3QRD A;  1ZO2 A;  2ML5 A;  3HII A;  3LT8 A;  5ELU A;  5JPP A;  2K54 A;  1Q81 4;  1VQN 3;  1D6U A;  2P09 A;  2M7O A;  3BLZ A;  3D3L A;  2XGN A;  2XRX B;  3KII A;  3LXU X;  4JF8 A;  1OH0 A;  1WQL B;  3STD A;  1HU9 A;  1YHQ 3;  4H3U A;  3FH1 A;  3GZY B;  3F9S A;  1STD A;  4RBN A;  3HIG A;  4HYZ A;  4MJD A;  5DRV A;  4EBG A;  3MHE A;  2STD A;  1KWI A;  3EHC A;  2CFG A;  3SVA A;  1VQP 3;  1UW1 A;  3EJV A;  3HX8 A;  3MG1 A;  2D1W A;  1ASK A;  3Q90 A;  4XM4 A;  1FGT A;  3BNB A;  2YFJ B;  4IIA A;  1GY7 A;  1Y4K A;  2IUK A;  1M9G A;  4HBR A;  2XR8 B;  1KC8 4;  5LC6 A;  3IJE B;  2CH9 A;  2W9P A;  3LTC A;  1E3V A;  3DGN A;  4J9A A;  1A90 A;  5JPU A;  4FMB A;  1US1 A;  4KFD A;  3DXO A;  8CHO A;  1FUW A;  1N5P A;  2CIU A;  2BMQ B;  4FMC A;  3WOE B;  2ZDJ A;  4WP5 A;  1GYB A;  3F40 A;  2KCD A;  3OWU A;  1JKG B;  4RNY A;  2CWV A;  1PFP A;  2LQV A;  2WOF A;  3E99 A;  1O7P B;  3NBJ A;  2LYX A;  5EQL A;  2JDI H;  1W6C A;  2E2U A;  3LTA A;  2O9U X;  3VF1 A;  3X42 A;  4HM6 B;  4HZB B;  4XDW A;  3GRD A;  3KSE D;  1JRQ A;  3CPO A;  3FLJ A;  3V98 A;  4OVM A;  4LGQ A;  2W9Q A;  5AEW B;  4AEQ A;  3EBY A;  1K28 A;  4R80 A;  4BTY A;  2JQ5 A;  3NUV A;  4O8S A;  1Q40 A;  1NWW A;  1YJW 3;  2MC8 A;  1FGR A;  1N8R 4;  4N6T A;  3CCS 3;  2C10 A;  3AMO A;  1ROA A;  1IVU A;  3QK9 A;  3CPW 2;  5KP4 A;  2BMR B;  4N6M A;  3FKA A;  3K9M C;  1YJN 3;  4N6L A;  3H51 A;  1AVL A;  1UI8 A;  1NB3 I;  3T8N A;  1YJ9 3;  2A15 A;  3LML A;  1QJG A;  2XSH B;  1Q86 4;  2IUJ A;  1D6Y A;  3NHX A;  4WYK A;  3S28 A;  1TP6 A;  2B24 B;  4MEI A;  5AEU B;  3GZB A;  3OW2 2;  2RSX A;  4HZ9 B;  3DMC A;  5CF1 A;  3CCM 3;  2W56 A;  1K41 A;  1WNH A;  3CCL 3;  1RRL A;  2HMO B;  4K90 B;  4LMI A;  1RRH A;  3UJM A;  3SED A;  3D9R A;  2YFI B;  4K61 A;  1W00 A;  1W6Y A;  2BT3 A;  4HJL B;  1M90 4;  4EYC A;  3FF0 A;  3DGL A;  1W2B 2;  3F7S A;  4FCJ A;  4O2H A;  4U13 A;  1UUV B;  1VQL 3;  5IEP A;  1K73 4;  4HM0 B;  4K1V A;  3WOD G;  4IT7 A;  5BXQ A;  1NU3 A;  3F8X A;  3Q2P A;  2FXT A;  1SIH A;  1TFO A;  1IVV A;  1D6Z A;  3MSO A;  3VGN A;  2HMK B;  3PXM A;  4R9L A;  1VZZ A;  4MMZ B;  1HKX A;  5EEO A;  1OHO A;  1SQW A;  2XSO B;  1YGE A;  2GEX A;  3F7X A;  1QAL A;  3WA2 X;  1FA3 A;  3NV0 A;  3KFQ C;  3MYT A;  3CME 3;  1O7G B;  5D83 A;  3JVC A;  1CQS A;  4G1M B;  3HK4 A;  1JB4 A;  4HM4 B;  1CYV A;  1Q42 A;  1UI7 A;  2SBL A;  1VQK 3;  3SOA A;  3MG3 A;  4KVH A;  5D81 A;  1O7W B;  2P0M A;  1M1X B;  3NX0 A;  1G96 A;  3OXA A;  2ZL8 A;  3B7C A;  2Y73 A;  1FGO A;  3DY5 A;  3F14 A;  3EN1 B;  4MMY B;  3V92 A;  3CCE 3;  1Q82 4;  1OHP A;  3SXX A;  3UL6 A;  4RZM A;  4CCV A;  2W2C A;  1A2K A;  3U1W A;  3GZR A;  3S27 A;  4L7K A;  3M8C A;  1O7N B;  1NDO B;  4HM8 B;  5STD A;  2I9W A;  3LTB A;  3ER7 A;  2Z7A A;  1N9J A;  1FGM A;  2UX0 A;  1QAK A;  2CHC A;  3ECF A;  4IPB A;  3EX9 A;  1N8Q A;  3GWR A;  4N6N B;  1YIJ 3;  1KQS 2;  1NO3 A;  3I56 3;  2RGQ A;  2YX9 A;  3NM7 A;  4KFF A;  1N9E A;  5IEO A;  3RGA A;  2OOV A;  1VQM 3;  4KFE A;  2CFW A;  2W04 A;  1RKY A;  1N5H A;  3LT9 A;  4XDV A;  1M1K 4;  2Z76 A;  3BNC A;  1K8A 4;  1C7H A;  4HM1 B;  3MKI A;  3MG2 A;  3FG1 A;  3SX1 A;  1W4N A;  4LSO A;  4HM5 B;  5IG4 A;  1KSI A;  2QGU A;  1OCV A;  1R4C A;  1SII A;  6STD A;  2QA4 3;  2OTJ 3;  3EN8 A;  1IT7 A;  4I4K A;  1ULJ B;  2WO0 A;  4L8O A;  3S29 A;  3KZT A;  1JNQ A;  2GBX B;  1DMM A;  1ZX2 A;  3WDG B;  5EVH A;  3RDE A;  1AVK A;  1QVF 2;  3DZL A;  4MMX B;  3UB1 A;  1WMO A;  3F8H A;  1VQ4 3;  1OF5 B;  3CU3 A;  4J8T A;  1IU7 A;  4AKY A;  4OUQ A;  1VQ8 3;  3ROB A;  2RFR A;  3T0U A;  3CC7 3;  1ISK A;  2PZV A;  2FNQ A;  3CCU 3;  1IQY A;  5AIG A;  1IQ8 A;  2P38 A;  1S72 3;  5CLK A;  4EV2 A;  3KKG A;  2P0X A;  3NXJ A;  4WHA A;  1PU4 A;  3L0R A;  3Q1C A;  3EB8 A;  4EC6 A;  1AV4 A;  3G0K A;  1LVN A;  2F86 B;  3K5T A;  1E97 A;  1UUW B;  1SPU A;  2BHM A;  2KXG A;  5AYS C;  3IPT A;  3PS8 A;  4OK0 A;  1VQ7 3;  4HVN A;  1A2V A;  1F8N A;  5KP3 A;  4LEH A;  1DVD A;  4X2O A;  3B4O A;  1VQ5 3;  2CG0 A;  3X3Z A;  1TU5 A;  3LZA A;  1JB2 A;  2BO9 B;  2OQE A;  3LH4 A;  4O02 B;  1TFK A;  2HMJ B;  4QWT A;  3K0Z A;  1JKG A;  1VQ9 3;  2KRT A;  2W03 A;  4R4K A;  3A76 A;  4GL6 A;  1EKM A;  3NM2 A;  4RNZ A;  3OX9 A;  3N8B A;  3LOY A;  3MWZ A;  1DMQ A;  3U97 A;  1J2B A;  2YFL B;  1OPY A;  2O3O A;  4JRF A;  2CK3 H;  4Q53 A;  2CG1 A;  3X3Y A;  3CC4 3;  5CF2 A;  4CDL A;  2HMN B;  1WMN A;  1YI2 3;  3B4P A;  3NQY A;  5CK6 A;  4ZM8 A;  1YVB I;  3DGO A;  3WOF B;  3JUM A;  2Q07 A;  1IVW A;  2INX A;  3DUK A;  1OHS A;  3BNE A;  3CXC 2;  4AKZ A;  3BB9 A;  2CWU A;  3LYG A;  4HM7 B;  3CD6 3;  1W2Z A;  1Q7Y 4;  2P05 A;  4FR9 A;  1LOX A;  3JUN A;  3S5C A;  1VQO 3;  3FG4 A;  3FG3 A;  3GAX A;  5G2G A;  1NB5 I;  2OWP A;  2R4I A;  3FSD A;  4R9K A;  5JBS A;  3JUP A;  5BVB A;  4N6U A;  2GEY A;  2E2V A;  3G71 3;  1V74 A;  3KN4 A;  1NJI 4;  2Z77 A;  3K7C A;  3SLU A;  1RN7 A;  4PEJ A;  2FGT A;  1W7C A;  2CW9 A;  3FZW A;  5IER A;  1T5Y A;  2XH9 A;  3NBB A;  3G8Z A;  1EQK A;  2V1L A;  3JUQ A;  4EV5 A;  1W01 A;  1W6G A;  2OCT A;  3KE7 A;  1W02 A;  5AIF A;  1Q40 B;  3KSP A;  3TDG A;  4XB5 A;  4FCM A;  3SOY A;  1QAF A;  3I0Y A;  3CCV 3;  3AMO B;  2MF7 A;  1GS3 A;  1VQ6 3;  1ULI B;  2CFD A;  2W6J H;  3HI7 A;  4GB5 A;  5A0O B;  1JN5 A;  1OGX A;  1LXE A;  3FGY A;  1IVX A;  3H3H A;  3K63 A;  2GXF A;  5AI1 A;  5AIH A;  3JUO A;  3CMA 3;  3PCS A;  2GBW B;  3FCS B;  4XBT A;  1GY5 A;  4NHF A;  5ELJ A;  2XF3 A;  1OGZ A;  1GY6 A;  1WMP A;  3X41 A;  1OUN A;  3DM8 A;  4WYK B;  5TGN A;  1O7M B;  3G4S 3;  4O3V A;  3X3X A;  1WTH A;  3IMA B;  2XFS A;  1K9M 4;  4FMD A;  5LC7 A;  1STF I;  1IV9 A;  3NBR A;  2PNC A;  2W56 B;  3EE1 A;  5AII A;  2E2T A;  2WGQ A;  2HML B;  4L8P A;  1IK3 A;  1BUQ A;  5IG5 A;  1U5O A;  5DRE A;  1TIJ A;  3PZW A;  3PCR A;  3CC2 3;  3G6E 3;  1S5A A;  4K1U A;  2GU1 A;  1IV7 A;  1DMN A;  5FGO A;  3J7Y d;  5IG3 A;  4FCZ A;  4BTX A;  4HM3 B;  1A67 A;  2F99 A;  2WOH A;  7STD A;  3OWS A;  5IF6 A;  3VSY A;  1FGQ A;  3G16 A;  2OQE C;  2RCD A;  2L4V A;  4HKV B;  3S67 A;  4KZ1 A;  2CFK A;  3EQQ B;  1JV2 B;  1DVC A;  1TUH A;  1ROV A;  1W5Z A;  4N6O B;  1MOL A;  3N9H A;  5AYR B;  3UL5 A;  3X40 A;  5IEN A;  1OAC A;  3ALA A;  3HZP A;  2B1X B;  2K0M A;  5FW5 A;  1IDP A;  4R1K A;  4EXR A;  3EBT A;  1EG9 B;  3NV0 B;  3CCJ 3;  5CXO A;  2D42 A;  2CWT A;  2XGL A;  2GU3 A;  4FMA A;  5KP1 A;  2C11 A;  4N3V A;  3CCQ 3;  1EA2 A;  2CC3 A;  3WMD A;  3CNM A;  2BNG A;  3UNL A;  2QEX 3;  3PYJ A;  4ORL A;  4H61 A;  1JB5 A;  3LTD A;  1GD3 A;  2WGO A;  3B8L A;  3PGB A;  2XEP A;  5IW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...