1CYVA

Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTATIN A
publication title Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor (cysteine)
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cyvA00
1YVBI 3K9MC 1A67A 1MOLA 2W9QA 5ELUA 3SVAA 5A0OB 1CEWI 5LC7A 2KXGA 1TIJA 3PXMA 1G96A 1MNLA 3QRDA 1GD3A 1PFPA 2OCTA 4N6LA 4N6TA 3GAXA 1M9GA 3PYJA 3UL5A 1FUWA 1A90A 1N9JA 4ZM8A 4IT7A 3KSED 1GD4A 3PS8A 2W9PA 1LXEA 3L0RA 4N6MA 1IV9A 5EQLA 1NB3I 3S67A 4N6NB 1EQKA 1FA3A 1IV7A 1KWIA 2CH9A 4CCVA 3LH4A 1N5HA 3NX0A 3MWZA 1DVDA 1CYVA 4TX4A 2O9UX 4EYCA 3UL6A 4N6UA 1ROAA 5ELJA 4LZIA 2BO9B 3IMAB 1CYUA 1NB5I 3Q2PA 1N5PA 1DVCA 1R4CA 4N6V0 4N6OB 5LC6A 1STFI 1WNHA 1RN7A 3KFQC
chains in the Genus database with same CATH superfamily
1D6UA 2SBLA 2FXTA 2QIYA 1JZDA 1ULIB 2ZDJA 5BU4A 3E99A 2RGQA 3A76A 1BNRA 3SOYA 1QALA 1STDA 4RZMA 1B2MA 1Q42A 3V99A 2H0GA 5D82A 1N8R4 2C10A 3LMLA 2LQVA 3RDEA 3EB8A 1S5AA 1MOLA 2W9QA 3BLZA 1AVKA 4HKVB 1VQO3 3CC43 4JRFA 4XBXA 6RNTA 3GZBA 3NQYA 5A0OB 2IMJA 3T8UA 5LC7A 3ZG5A 1HKXA 5IW9A 2UUGC 3K5TA 1TIJA 1FGRA 1UCIA 1BRKA 4KFDA 2XFTA 3G8ZA 4RNZA 5BIRA 1WMOA 3QRDA 3NBBA 1W6CA 4LEHA 2HMJB 1K9M4 1GD3A 1PFPA 3DGMA 1UCKA 2OCTA 1NO3A 1BGSA 1IDPA 3CNXA 3WA2X 1IK3A 3CCE3 1JNQA 2INXA 1S723 1JRQA 2OQEA 1LQMB 4O3VA 2F4YA 5DREA 2HMOB 2RNTA 3PYJA 2Q07A 1VQN3 3PCRA 2OOVC 1Z1SA 4HZ9B 5M18A 1WMPA 5JBSA 1BSEA 2A15A 3FF0A 3JUPA 3DGNA 1N9JA 1ZO2A 3LYGA 1EKMA 4OVMA 4ORLA 1B2UA 4GSPA 3DGOA 1YVSA 2MF7A 3LT9A 4EW5A 3F7XA 4X2OA 3Q3FA 3I563 5G2GA 3MYTA 3VGNA 1D6ZA 5AI1A 3NXJA 2L4VA 1JKGB 1BRGA 2KF3A 1OUNA 3PS8A 4WYKB 6GSPA 2H0IA 2W9PA 1B20A 1O7WB 3ALAA 1MWUA 1LXEA 4HOHA 7RNTA 9RNTA 1JBSA 3G0KA 1UGHI 1OH0A 1Q7Y4 2KCDA 1RGGA 2WOHA 1T2HA 2K0MA 3DGYA 3ECFA 1WTHA 1T3BA 2W2CA 4BL2A 3O8YA 3RGAA 1BRIA 4R1KA 5M1AA 4BU4A 1KWIA 2CH9A 5HOHA 3JVCA 1KC84 3DMCA 1G0TA 1JKGA 3UB1A 4HM2B 1LVNA 3OWSA 1BSBA 3CNMA 3G713 4BTYA 1GMRA 2XGNA 1QAKA 2RBIA 1TFOA 1B27A 1CYVA 1BRSA 3DZLA 3K0ZA 4AKYA 3PCSA 1D6YA 3ZG0A 3LT8A 1QAFA 3S5CA 1IVUA 1F8NA 1VQ83 3ER7A 1GY7A 2BMQB 2QA43 3T8NA 1I0VA 3X3XA 1EEJA 5M19A 1OGXA 1VQK3 3RNTA 3CCQ3 2WGQA 1RRHA 1GYBA 1WMNA 2BO9B 2XEPA 4LZIA 1U5OA 4AEQA 1E3RA 3IMAB 4HM4B 1GY6A 2Y74A 4EC6A 1GOUA 3WR2A 1RGCA 1QVF2 2XSHB 4MMXB 1R4CA 3B7CA 4N6V0 5IG5A 1K41A 1B3SA 1ZX2A 1BSCA 4MJDA 1UUGB 1YGEA 3GSPA 1BAOA 1GS3A 1YGWA 3AHSA 3CCJ3 2IUJA 1B2ZA 1I8VA 1FGOA 2E2TA 1FGTA 4H3UA 3WHOA 2CFWA 2CX1A 2GBWB 5AIFA 3OWUA 3VSYA 4EV2A 4I4KA 2UGIA 4R80A 4N3VA 4RNYA 2ML6A 3OW22 1VQM3 1YVBI 4J5KA 1ISKA 3CCM3 3NHXA 1RGHA 3D4AA 4HM1B 3CMA3 3MG3A 1W01A 1OPYA 3V92A 5GSPA 5ELUA 1RGKA 1IU7A 3SVAA 1AV4A 1BNGA 4OK0A 2W04A 1Q864 3NM2A 1BNFA 2BU4A 5CXOA 5FGOA 3CME3 1MNLA 2KAAA 4HAAA 1BUJA 1RN4A 1QMAA 4BTXA 3IPTA 4GL6A 5IG0A 3Q90A 4HJLB 2J8XB 4HZBB 3GAXA 5D81A 3ROBA 1JV2B 3GZYB 5IF6A 5FW5A 4FMBA 1FZUA 1UUWB 2L1SA 1BRHA 4WP5A 1Y4KA 5TGNA 3UL5A 2HOHA 3H3HA 3I553 3N54B 2BHMA 1ASKA 1I2EA 2CHCA 2P0XA 3FGYA 3FF2A 2JDIH 1O7NB 3MSOA 2KF4A 4I5QA 5JPUA 2F99A 2W56A 2IA7A 4HM8B 4GB5A 5HGRA 3MG1A 1NJI4 3F8HA 4J8TA 2RSXA 1A2KA 2W6JH 3D79A 5AIIA 2W03A 3FSDA 3NBRA 3S27A 3URPA 2PNCA 1VQQA 2HMNB 3L0RA 4N6MA 1IV9A 2CIUA 1SPUA 1RGFA 1TU5A 5KP3A 3BNEA 4AKZA 1M904 1MWSA 1V57A 3FKAA 4BL3A 1FA3A 2HMMB 1JB4A 2BT3A 4WFOA 2AADA 1LOXA 4CCVA 3STDA 1BNSA 1GOYA 4FCMA 5IG3A 4CJNA 3LH4A 1N5HA 1RSNA 4GHOA 2YFIB 1FUTA 4EV5A 1V74A 3G4S3 3EBTA 2O9UX 3CD63 3B4PA 1IQ8A 3AHWA 3BNDA 3IJEB 1A2PA 3M8CA 1OCVA 1AQZA 5KP4A 1RGEA 2C4BA 3K63A 1Q7HA 1K8A4 1R4YA 4N6UA 5ELJA 3WMDA 3CCR3 1BRNL 4FMDA 3CCS3 2I9WA 2JQ5A 1KD14 1DETA 1UI8A 2XSOB 2STDA 5CF2A 4PEJA 3HX8A 1EUIC 3X41A 1UI7A 1HZ1A 3MPHA 1N5PA 1RGLA 2W0QA 1DVCA 3DUKA 3BNCA 1LOYA 2XFSA 3BNBA 1W5ZA 4L8OA 1TUHA 2KF5A 3S29A 1YIT3 1LOVA 1AY7A 2D1WA 8RNTA 3UNLA 1FGQA 4L8PA 3JUNA 1I2GA 1YNVX 2OTJ3 1C7HA 3I0YA 2F5MA 1W7CA 1LQGC 1LOWA 4JF8A 2CC3A 1UW1A 3EN8A 5CK6A 2CG0A 3F9SA 3OX9A 1RJOA 1O7PB 2H0HA 3NV0A 2BIRA 2P05A 2V1LA 3HI7A 2BMOB 2CX0A 3ZFZA 3NM7A 3F40A 5DRVA 3HK4A 1A67A 1IT8A 3X3ZA 4MMZB 1SIHA 1RRLA 3BIRA 1O7MB 3D3LA 3EJVA 1BANA 4HBRA 1IVWA 3X3YA 1GMQA 2GU3A 2CFKA 2LYXA 1N9EA 3PXMA 2AAEA 5JPPA 1HU9A 2C11A 3AMOA 3CC73 1JBRA 4KFFA 3LTBA 1I70A 1NNVA 4STDA 2GU1A 2FGTA 3DXOA 1GSPA 3H51A 3N9HA 2CG1A 3FG3A 3KKGA 3KN4A 3FH1A 3DM8A 1VQ93 1YJW3 1VQ53 2CK3H 4N6LA 4N6TA 1RN1A 1FUSA 2WOFA 5STDA 2P0MA 1M9GA 1OHPA 4FMAA 4G1MB 1RNBA 2XF3A 3MG2A 4K90B 1CQSA 2E2UA 2Z77A 1NDOB 5IEOA 3U1WA 1GOVA 3FLJA 5AIGA 4ZM8A 3MHEA 2GEXA 1RHLA 3SEDA 4BTWA 3Q1CA 3WA3A 3LTAA 1DE3A 4RBNA 1T5YA 4HM3B 4K61A 2P38A 4NREA 3WODG 2R41A 5BVBA 3G6E3 3CCV3 3DY5A 3KCHA 1Q40A 3LXUX 1PY3A 1BUQA 3NBJA 3SOAA 2OOVA 3WDGB 4MMYB 4XDWA 2GEYA 3GRDA 1YJ93 3JUQA 1JN5A 1GY5A 3F14A 3S67A 1NB3I 2W56B 4CDLA 4N6NB 1TFKA 1QJGA 4EBGA 2GXFA 1CH0A 5I97A 4HM5B 1EQKA 4J5GA 3FG1A 1FW7A 1IV7A 2CKFB 1TRQA 5IEPA 3VF1A 1BNEA 1YIJ3 2ML5A 1SJWA 4OUQA 4X2HA 3GWRA 3NX0A 1TJDA 3AGOA 3PZWA 1W4NA 3CC23 4HYZA 4IPBA 3TDGA 4WHAA 3MWZA 4NHFA 1DVDA 3X40A 1RKYA 1YI23 2YX9A 3CPOA 5AYSC 2Z76A 4HM0B 4TX4A 3SXXA 1OHSA 4DKIA 2F86B 1LNHA 2CW9A 3WOEB 4XB5A 1NWWA 2XRXB 3A5EA 1G02A 1DMQA 1N8QA 3FCSB 3MKIA 1ROAA 5G1KA 3EE1A 7GSPA 1ZS7A 3FG4A 1YJN3 1DYUA 2HMLB 4KVHA 1CYUA 2F98A 1IQXA 3B4OA 3Q2PA 5CF1A 1UDII 5RNTA 4O8SA 1RMSA 1I2FA 2K54A 3S28A 1VQ63 3KIIA 2XH9A 3D5GA 5G1LA 2IUKA 3CCU3 3V98A 3EF8A 1IVXA 6STDA 3JUMA 3JUOA 3OXAA 1E97A 1J2BA 1NU3A 3SLUA 1LNIA 1Q9EA 4R4KA 1MGWA 2Z6BA 1RN7A 3DGLA 5IENA 3T0UA 3K7CA 2QGUA 5EVHA 7STDA 2OWPA 1BIRA 2F5WA 3K9MC 3NUVA 3J7Yd 1OHOA 1O7HB 1QVG2 4FCJA 4LSOA 3NQZA 3LOYA 3LZAA 4KFEA 4HVNA 1W2B2 1WQLB 4NPBA 1BOXA 3F8XA 4K1VA 4WWUC 2ZA4A 3B8LA 3D9RA 1FYSA 1TTOA 2HMKB 5D83A 1KQS2 1MWRA 1CEWI 1W00A 3CU3A 1X1WA 2BNGA 8CHOA 1ROVA 1DMMA 3KZTA 5KP1A 1Q824 2KXGA 1ZGXA 1MGRA 2YFLB 4LGQA 3NV0B 4H61A 1B2XA 1G96A 3EX9A 4CPKA 4O2HA 1JJ22 4R9LA 2O3OA 2M7OA 1TRPA 1SARA 2RFRA 1C54A 1B2SA 1AR0A 1JB2A 5EEOA 3EN1B 3HIGA 5AIHA 2K3DA 1IYYA 1RNTA 3CPW2 1BSAA 4O02B 1HYFA 1PU4A 3D5IA 1UGIA 3EQQB 1ULJB 1YHQ3 3HOHA 1K28A 2SARA 3AMOB 1TP6A 4XDVA 5AEWB 1PYLA 4FR9A 1M1XB 1X1UA 1JBTA 1RDSA 1BNJA 2Z7AA 3HIIA 4XBTA 1A90A 1FUWA 2CWUA 2FNQA 3GZRA 1VQP3 4WYKA 1BU4A 1JZOA 2YFJB 1IT7A 3FZWA 1UCLA 1B21A 2GSPA 2ZHXB 2WGOA 4HM7B 1W6GA 1X1YA 2RCDA 4IT7A 3KSED 1UUVB 3LTCA 2OQEC 1FGMA 4BIRA 3N8BA 1RCKA 1T2IA 1X1XA 1GD4A 1GMPA 2WO0A 2XR8B 1EA2A 2CFDA 2KRTA 4ILFA 3UJMA 1OF5B 5BXQA 3CXC2 4QWTA 5AEUB 5IERA 1KSIA 1AVLA 3QK9A 5CLKA 4R9KA 2E2VA 4IIAA 2R4IA 5EQLA 3SYUA 1I0XA 3LTDA 1U8CB 2Y73A 5IG4A 2B24B 4XM4A 2MC8A 2OTL3 1OACA 4J9AA 3CCL3 4K1UA 2CWTA 3SX1A 4KZ1A 1Q40B 1I3FA 5AYRB 1DMNA 1M1K4 4HM6B 1JB5A 3F7SA 4Q53A 1VQ73 1OF5A 2CFLA 3BB9A 1JN5B 1O7GB 2D42A 4FMCA 1RLSA 2PZVA 3U97A 1BNIA 2GBXB 1UCJA 2P09A 2F56A 2IY2A 3AGNA 3EC9A 3G16A 4RNTA 3X42A 4EXRA 1RGAA 2BMRB 1EG9B 4KT3B 1SIIA 3HZPA 4XBYA 4L7KA 1IQYA 4MEIA 4U13A 2QEX3 1LRAA 4EYCA 2ZL8A 2CFGA 3KSPA 1W02A 1K734 3KE7A 1RTUA 3GZXB 3UL6A 1OGZA 1SQWA 1VQL3 2IYJA 4LMIA 3RGRA 4LYLB 1RCLA 3OWYA 3EHCA 1VQ43 1E3VA 1W6YA 1W2ZA 1NB5I 1BSDA 3PGBA 1A2VA 3WOFB 1BVIA 3BU4A 4FCZA 3OV4A 1IVVA 3DH2A 1V58A 4N6OB 1I3IA 2CWVA 1US1A 1BRJA 1L5GB 2B1XB 1Q814 5LC6A 1VZZA 2UX0A 1STFI 2KF6A 3EBYA 1WNHA 1MWTA 3KFQC 2XGLA
chains in the Genus database with same CATH topology
1D6UA 2SBLA 2FXTA 2QIYA 1ULIB 2ZDJA 3E99A 2RGQA 3A76A 3SOYA 1QALA 1STDA 4RZMA 1Q42A 3V99A 5D82A 1N8R4 2C10A 3LMLA 2LQVA 3RDEA 3EB8A 1S5AA 1MOLA 2W9QA 3BLZA 1AVKA 4HKVB 1VQO3 3CC43 4JRFA 4XBXA 3GZBA 3NQYA 5A0OB 2IMJA 3T8UA 5LC7A 1HKXA 5IW9A 3K5TA 1TIJA 1FGRA 4KFDA 2XFTA 3G8ZA 4RNZA 1WMOA 3QRDA 3NBBA 1W6CA 4LEHA 2HMJB 1K9M4 1GD3A 1PFPA 3DGMA 2OCTA 1NO3A 1IDPA 3CNXA 3WA2X 1IK3A 3CCE3 1JNQA 2INXA 1S723 1JRQA 2OQEA 4O3VA 5DREA 2HMOB 3PYJA 2Q07A 1VQN3 3PCRA 2OOVC 1Z1SA 4HZ9B 1WMPA 5JBSA 2A15A 3FF0A 3JUPA 3DGNA 1N9JA 1ZO2A 3LYGA 1EKMA 4OVMA 4ORLA 3DGOA 2MF7A 3LT9A 3F7XA 4X2OA 3I563 5G2GA 3MYTA 3VGNA 1D6ZA 5AI1A 3NXJA 2L4VA 1JKGB 3PS8A 1OUNA 4WYKB 2W9PA 1O7WB 3ALAA 1LXEA 3G0KA 1OH0A 1Q7Y4 2KCDA 2WOHA 2K0MA 3ECFA 1WTHA 2W2CA 3O8YA 3RGAA 4R1KA 1KC84 1KWIA 2CH9A 3JVCA 3DMCA 1JKGA 3UB1A 4HM2B 1LVNA 3OWSA 3CNMA 3G713 4BTYA 2XGNA 1QAKA 1TFOA 1CYVA 3DZLA 3K0ZA 4AKYA 3PCSA 1D6YA 3LT8A 1QAFA 3S5CA 1IVUA 1F8NA 1VQ83 3ER7A 1GY7A 2BMQB 2QA43 3T8NA 3X3XA 1VQK3 1OGXA 3CCQ3 2WGQA 1RRHA 1GYBA 1WMNA 2BO9B 2XEPA 4LZIA 1U5OA 4AEQA 1E3RA 3IMAB 4HM4B 1GY6A 2Y74A 4EC6A 1QVF2 2XSHB 4MMXB 1R4CA 3B7CA 4N6V0 5IG5A 1K41A 1ZX2A 4MJDA 1YGEA 1GS3A 3CCJ3 2IUJA 1FGOA 2E2TA 1FGTA 4H3UA 2CFWA 2GBWB 5AIFA 3VSYA 3OWUA 4EV2A 4I4KA 4R80A 4N3VA 4RNYA 2ML6A 3OW22 1VQM3 1YVBI 1ISKA 3CCM3 3NHXA 4HM1B 3CMA3 3MG3A 1W01A 1OPYA 3V92A 5ELUA 1IU7A 3SVAA 1AV4A 4OK0A 2W04A 1Q864 3NM2A 5CXOA 5FGOA 3CME3 1MNLA 1QMAA 4BTXA 3IPTA 4GL6A 5IG0A 3Q90A 4HJLB 4HZBB 5D81A 3GAXA 3ROBA 1JV2B 3GZYB 5IF6A 5FW5A 4FMBA 1UUWB 4WP5A 1Y4KA 5TGNA 3UL5A 3H3HA 3I553 3N54B 2BHMA 1ASKA 2CHCA 2P0XA 3FGYA 3FF2A 2JDIH 1O7NB 3MSOA 5JPUA 2F99A 2W56A 2IA7A 4HM8B 4GB5A 5HGRA 3MG1A 1NJI4 3F8HA 4J8TA 2RSXA 1A2KA 2W6JH 5AIIA 2W03A 3FSDA 3NBRA 3S27A 2PNCA 2HMNB 3L0RA 4N6MA 1IV9A 2CIUA 1SPUA 1TU5A 5KP3A 3BNEA 4AKZA 1M904 3FKAA 1FA3A 2HMMB 1JB4A 2BT3A 4WFOA 1LOXA 4CCVA 3STDA 4FCMA 5IG3A 3LH4A 1N5HA 2YFIB 4EV5A 1V74A 3G4S3 3EBTA 2O9UX 3CD63 3B4PA 1IQ8A 3BNDA 3IJEB 3M8CA 1OCVA 5KP4A 3K63A 1K8A4 4N6UA 5ELJA 3WMDA 3CCR3 4FMDA 3CCS3 2I9WA 2JQ5A 1KD14 1UI8A 2XSOB 2STDA 5CF2A 4PEJA 3HX8A 3X41A 1UI7A 3MPHA 1N5PA 2W0QA 1DVCA 3DUKA 3BNCA 2XFSA 3BNBA 1W5ZA 4L8OA 1TUHA 3S29A 1YIT3 2D1WA 3UNLA 1FGQA 4L8PA 3JUNA 2OTJ3 1C7HA 3I0YA 1W7CA 4JF8A 2CC3A 1UW1A 3EN8A 5CK6A 2CG0A 3F9SA 3OX9A 1RJOA 1O7PB 3NV0A 2P05A 2V1LA 3HI7A 2BMOB 3NM7A 3F40A 5DRVA 3HK4A 1A67A 1IT8A 3X3ZA 4MMZB 1SIHA 1RRLA 1O7MB 3D3LA 3EJVA 4HBRA 3X3YA 1IVWA 2GU3A 2CFKA 2LYXA 1N9EA 3PXMA 5JPPA 1HU9A 2C11A 3AMOA 3CC73 4KFFA 3LTBA 4STDA 2GU1A 2FGTA 3DXOA 2CG1A 3H51A 3N9HA 3FG3A 3KKGA 3KN4A 3FH1A 3DM8A 1VQ93 1YJW3 1VQ53 2CK3H 4N6LA 4N6TA 2WOFA 5STDA 2P0MA 1M9GA 1OHPA 4FMAA 4G1MB 2XF3A 3MG2A 4K90B 1CQSA 2E2UA 2Z77A 1NDOB 5IEOA 3U1WA 3FLJA 5AIGA 4ZM8A 3MHEA 2GEXA 3SEDA 4BTWA 3WA3A 3Q1CA 3LTAA 4RBNA 1T5YA 4HM3B 4K61A 2P38A 4NREA 3WODG 5BVBA 3G6E3 3CCV3 3DY5A 1Q40A 3LXUX 1BUQA 3NBJA 3SOAA 2OOVA 3WDGB 4MMYB 4XDWA 2GEYA 3GRDA 1YJ93 3JUQA 1JN5A 1GY5A 3F14A 3S67A 1NB3I 2W56B 4CDLA 4N6NB 1TFKA 1QJGA 4EBGA 2GXFA 5I97A 1EQKA 4HM5B 3FG1A 1IV7A 2CKFB 5IEPA 3VF1A 1YIJ3 2ML5A 1SJWA 4OUQA 4X2HA 3GWRA 3NX0A 3PZWA 1W4NA 3CC23 4HYZA 4IPBA 3TDGA 4WHAA 3MWZA 4NHFA 1DVDA 3X40A 1RKYA 1YI23 2YX9A 3CPOA 5AYSC 2Z76A 4HM0B 4TX4A 3SXXA 1OHSA 2F86B 1LNHA 2CW9A 3WOEB 4XB5A 1NWWA 2XRXB 1DMQA 1N8QA 3FCSB 3MKIA 1ROAA 3EE1A 3FG4A 1YJN3 1DYUA 2HMLB 4KVHA 1CYUA 2F98A 1IQXA 3B4OA 3Q2PA 5CF1A 4O8SA 3S28A 2K54A 1VQ63 3KIIA 2XH9A 2IUKA 3CCU3 3V98A 3EF8A 1IVXA 6STDA 3JUMA 3JUOA 3OXAA 1E97A 1J2BA 1NU3A 3SLUA 4R4KA 2Z6BA 1RN7A 3DGLA 5IENA 3T0UA 3K7CA 2QGUA 5EVHA 7STDA 2OWPA 3K9MC 3NUVA 3J7Yd 1OHOA 1O7HB 1QVG2 4FCJA 4LSOA 3NQZA 3LOYA 3LZAA 4KFEA 4HVNA 1W2B2 1WQLB 4WWUC 3F8XA 4K1VA 1KQS2 5D83A 3B8LA 3D9RA 2HMKB 3CU3A 1CEWI 1W00A 8CHOA 5KP1A 2BNGA 1Q824 1ROVA 1DMMA 3KZTA 2KXGA 2YFLB 4LGQA 3NV0B 4H61A 1G96A 3EX9A 4O2HA 1JJ22 4R9LA 2O3OA 2M7OA 2RFRA 1JB2A 1AR0A 5EEOA 3EN1B 3HIGA 5AIHA 3CPW2 1PU4A 4O02B 3EQQB 1ULJB 1YHQ3 1K28A 3AMOB 1TP6A 4XDVA 5AEWB 4FR9A 1M1XB 2Z7AA 4XBTA 3HIIA 1A90A 1FUWA 2CWUA 2FNQA 3GZRA 1VQP3 4WYKA 2YFJB 1IT7A 3FZWA 2WGOA 4HM7B 1W6GA 4IT7A 2RCDA 3KSED 1UUVB 3LTCA 2OQEC 1FGMA 3N8BA 1GD4A 2WO0A 2XR8B 1EA2A 2CFDA 2KRTA 3UJMA 3CXC2 1OF5B 5BXQA 4QWTA 5AEUB 5IERA 1KSIA 1AVLA 3QK9A 5CLKA 4R9KA 2E2VA 4IIAA 2R4IA 5EQLA 3LTDA 1U8CB 2Y73A 5IG4A 2B24B 4XM4A 2MC8A 2OTL3 1OACA 4J9AA 3CCL3 4K1UA 2CWTA 3SX1A 4KZ1A 1Q40B 5AYRB 1DMNA 1M1K4 4HM6B 1JB5A 3F7SA 4Q53A 1VQ73 1OF5A 2CFLA 3BB9A 1JN5B 1O7GB 2D42A 4FMCA 2PZVA 3U97A 2GBXB 2P09A 4EXRA 3X42A 3EC9A 3G16A 2BMRB 1EG9B 1SIIA 3HZPA 4XBYA 4L7KA 1IQYA 4MEIA 4U13A 2QEX3 4EYCA 2ZL8A 2CFGA 3KSPA 1W02A 1K734 3KE7A 3GZXB 3UL6A 1OGZA 1SQWA 1VQL3 4LMIA 3RGRA 3OWYA 3EHCA 1VQ43 1E3VA 1W6YA 1W2ZA 1NB5I 3PGBA 1A2VA 3WOFB 4FCZA 3OV4A 1IVVA 4N6OB 2CWVA 1US1A 1L5GB 2B1XB 1Q814 5LC6A 1VZZA 2UX0A 1STFI 3EBYA 1WNHA 3KFQC 2XGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVB I;  3K9M C;  1A67 A;  1MOL A;  2W9Q A;  5ELU A;  3SVA A;  5A0O B;  1CEW I;  5LC7 A;  2KXG A;  1TIJ A;  3PXM A;  1G96 A;  1MNL A;  3QRD A;  1GD3 A;  1PFP A;  2OCT A;  4N6L A;  4N6T A;  3GAX A;  1M9G A;  3PYJ A;  3UL5 A;  1FUW A;  1A90 A;  1N9J A;  4ZM8 A;  4IT7 A;  3KSE D;  1GD4 A;  3PS8 A;  2W9P A;  1LXE A;  3L0R A;  4N6M A;  1IV9 A;  5EQL A;  1NB3 I;  3S67 A;  4N6N B;  1EQK A;  1FA3 A;  1IV7 A;  1KWI A;  2CH9 A;  4CCV A;  3LH4 A;  1N5H A;  3NX0 A;  3MWZ A;  1DVD A;  1CYV A;  4TX4 A;  2O9U X;  4EYC A;  3UL6 A;  4N6U A;  1ROA A;  5ELJ A;  4LZI A;  2BO9 B;  3IMA B;  1CYU A;  1NB5 I;  3Q2P A;  1N5P A;  1DVC A;  1R4C A;  4N6V 0;  4N6O B;  5LC6 A;  1STF I;  1WNH A;  1RN7 A;  3KFQ C; 
#chains in the Genus database with same CATH topology
 1D6U A;  2SBL A;  2FXT A;  2QIY A;  1JZD A;  1ULI B;  2ZDJ A;  5BU4 A;  3E99 A;  2RGQ A;  3A76 A;  1BNR A;  3SOY A;  1QAL A;  1STD A;  4RZM A;  1B2M A;  1Q42 A;  3V99 A;  2H0G A;  5D82 A;  1N8R 4;  2C10 A;  3LML A;  2LQV A;  3RDE A;  3EB8 A;  1S5A A;  1MOL A;  2W9Q A;  3BLZ A;  1AVK A;  4HKV B;  1VQO 3;  3CC4 3;  4JRF A;  4XBX A;  6RNT A;  3GZB A;  3NQY A;  5A0O B;  2IMJ A;  3T8U A;  5LC7 A;  3ZG5 A;  1HKX A;  5IW9 A;  2UUG C;  3K5T A;  1TIJ A;  1FGR A;  1UCI A;  1BRK A;  4KFD A;  2XFT A;  3G8Z A;  4RNZ A;  5BIR A;  1WMO A;  3QRD A;  3NBB A;  1W6C A;  4LEH A;  2HMJ B;  1K9M 4;  1GD3 A;  1PFP A;  3DGM A;  1UCK A;  2OCT A;  1NO3 A;  1BGS A;  1IDP A;  3CNX A;  3WA2 X;  1IK3 A;  3CCE 3;  1JNQ A;  2INX A;  1S72 3;  1JRQ A;  2OQE A;  1LQM B;  4O3V A;  2F4Y A;  5DRE A;  2HMO B;  2RNT A;  3PYJ A;  2Q07 A;  1VQN 3;  3PCR A;  2OOV C;  1Z1S A;  4HZ9 B;  5M18 A;  1WMP A;  5JBS A;  1BSE A;  2A15 A;  3FF0 A;  3JUP A;  3DGN A;  1N9J A;  1ZO2 A;  3LYG A;  1EKM A;  4OVM A;  4ORL A;  1B2U A;  4GSP A;  3DGO A;  1YVS A;  2MF7 A;  3LT9 A;  4EW5 A;  3F7X A;  4X2O A;  3Q3F A;  3I56 3;  5G2G A;  3MYT A;  3VGN A;  1D6Z A;  5AI1 A;  3NXJ A;  2L4V A;  1JKG B;  1BRG A;  2KF3 A;  1OUN A;  3PS8 A;  4WYK B;  6GSP A;  2H0I A;  2W9P A;  1B20 A;  1O7W B;  3ALA A;  1MWU A;  1LXE A;  4HOH A;  7RNT A;  9RNT A;  1JBS A;  3G0K A;  1UGH I;  1OH0 A;  1Q7Y 4;  2KCD A;  1RGG A;  2WOH A;  1T2H A;  2K0M A;  3DGY A;  3ECF A;  1WTH A;  1T3B A;  2W2C A;  4BL2 A;  3O8Y A;  3RGA A;  1BRI A;  4R1K A;  5M1A A;  4BU4 A;  1KWI A;  2CH9 A;  5HOH A;  3JVC A;  1KC8 4;  3DMC A;  1G0T A;  1JKG A;  3UB1 A;  4HM2 B;  1LVN A;  3OWS A;  1BSB A;  3CNM A;  3G71 3;  4BTY A;  1GMR A;  2XGN A;  1QAK A;  2RBI A;  1TFO A;  1B27 A;  1CYV A;  1BRS A;  3DZL A;  3K0Z A;  4AKY A;  3PCS A;  1D6Y A;  3ZG0 A;  3LT8 A;  1QAF A;  3S5C A;  1IVU A;  1F8N A;  1VQ8 3;  3ER7 A;  1GY7 A;  2BMQ B;  2QA4 3;  3T8N A;  1I0V A;  3X3X A;  1EEJ A;  5M19 A;  1OGX A;  1VQK 3;  3RNT A;  3CCQ 3;  2WGQ A;  1RRH A;  1GYB A;  1WMN A;  2BO9 B;  2XEP A;  4LZI A;  1U5O A;  4AEQ A;  1E3R A;  3IMA B;  4HM4 B;  1GY6 A;  2Y74 A;  4EC6 A;  1GOU A;  3WR2 A;  1RGC A;  1QVF 2;  2XSH B;  4MMX B;  1R4C A;  3B7C A;  4N6V 0;  5IG5 A;  1K41 A;  1B3S A;  1ZX2 A;  1BSC A;  4MJD A;  1UUG B;  1YGE A;  3GSP A;  1BAO A;  1GS3 A;  1YGW A;  3AHS A;  3CCJ 3;  2IUJ A;  1B2Z A;  1I8V A;  1FGO A;  2E2T A;  1FGT A;  4H3U A;  3WHO A;  2CFW A;  2CX1 A;  2GBW B;  5AIF A;  3OWU A;  3VSY A;  4EV2 A;  4I4K A;  2UGI A;  4R80 A;  4N3V A;  4RNY A;  2ML6 A;  3OW2 2;  1VQM 3;  1YVB I;  4J5K A;  1ISK A;  3CCM 3;  3NHX A;  1RGH A;  3D4A A;  4HM1 B;  3CMA 3;  3MG3 A;  1W01 A;  1OPY A;  3V92 A;  5GSP A;  5ELU A;  1RGK A;  1IU7 A;  3SVA A;  1AV4 A;  1BNG A;  4OK0 A;  2W04 A;  1Q86 4;  3NM2 A;  1BNF A;  2BU4 A;  5CXO A;  5FGO A;  3CME 3;  1MNL A;  2KAA A;  4HAA A;  1BUJ A;  1RN4 A;  1QMA A;  4BTX A;  3IPT A;  4GL6 A;  5IG0 A;  3Q90 A;  4HJL B;  2J8X B;  4HZB B;  3GAX A;  5D81 A;  3ROB A;  1JV2 B;  3GZY B;  5IF6 A;  5FW5 A;  4FMB A;  1FZU A;  1UUW B;  2L1S A;  1BRH A;  4WP5 A;  1Y4K A;  5TGN A;  3UL5 A;  2HOH A;  3H3H A;  3I55 3;  3N54 B;  2BHM A;  1ASK A;  1I2E A;  2CHC A;  2P0X A;  3FGY A;  3FF2 A;  2JDI H;  1O7N B;  3MSO A;  2KF4 A;  4I5Q A;  5JPU A;  2F99 A;  2W56 A;  2IA7 A;  4HM8 B;  4GB5 A;  5HGR A;  3MG1 A;  1NJI 4;  3F8H A;  4J8T A;  2RSX A;  1A2K A;  2W6J H;  3D79 A;  5AII A;  2W03 A;  3FSD A;  3NBR A;  3S27 A;  3URP A;  2PNC A;  1VQQ A;  2HMN B;  3L0R A;  4N6M A;  1IV9 A;  2CIU A;  1SPU A;  1RGF A;  1TU5 A;  5KP3 A;  3BNE A;  4AKZ A;  1M90 4;  1MWS A;  1V57 A;  3FKA A;  4BL3 A;  1FA3 A;  2HMM B;  1JB4 A;  2BT3 A;  4WFO A;  2AAD A;  1LOX A;  4CCV A;  3STD A;  1BNS A;  1GOY A;  4FCM A;  5IG3 A;  4CJN A;  3LH4 A;  1N5H A;  1RSN A;  4GHO A;  2YFI B;  1FUT A;  4EV5 A;  1V74 A;  3G4S 3;  3EBT A;  2O9U X;  3CD6 3;  3B4P A;  1IQ8 A;  3AHW A;  3BND A;  3IJE B;  1A2P A;  3M8C A;  1OCV A;  1AQZ A;  5KP4 A;  1RGE A;  2C4B A;  3K63 A;  1Q7H A;  1K8A 4;  1R4Y A;  4N6U A;  5ELJ A;  3WMD A;  3CCR 3;  1BRN L;  4FMD A;  3CCS 3;  2I9W A;  2JQ5 A;  1KD1 4;  1DET A;  1UI8 A;  2XSO B;  2STD A;  5CF2 A;  4PEJ A;  3HX8 A;  1EUI C;  3X41 A;  1UI7 A;  1HZ1 A;  3MPH A;  1N5P A;  1RGL A;  2W0Q A;  1DVC A;  3DUK A;  3BNC A;  1LOY A;  2XFS A;  3BNB A;  1W5Z A;  4L8O A;  1TUH A;  2KF5 A;  3S29 A;  1YIT 3;  1LOV A;  1AY7 A;  2D1W A;  8RNT A;  3UNL A;  1FGQ A;  4L8P A;  3JUN A;  1I2G A;  1YNV X;  2OTJ 3;  1C7H A;  3I0Y A;  2F5M A;  1W7C A;  1LQG C;  1LOW A;  4JF8 A;  2CC3 A;  1UW1 A;  3EN8 A;  5CK6 A;  2CG0 A;  3F9S A;  3OX9 A;  1RJO A;  1O7P B;  2H0H A;  3NV0 A;  2BIR A;  2P05 A;  2V1L A;  3HI7 A;  2BMO B;  2CX0 A;  3ZFZ A;  3NM7 A;  3F40 A;  5DRV A;  3HK4 A;  1A67 A;  1IT8 A;  3X3Z A;  4MMZ B;  1SIH A;  1RRL A;  3BIR A;  1O7M B;  3D3L A;  3EJV A;  1BAN A;  4HBR A;  1IVW A;  3X3Y A;  1GMQ A;  2GU3 A;  2CFK A;  2LYX A;  1N9E A;  3PXM A;  2AAE A;  5JPP A;  1HU9 A;  2C11 A;  3AMO A;  3CC7 3;  1JBR A;  4KFF A;  3LTB A;  1I70 A;  1NNV A;  4STD A;  2GU1 A;  2FGT A;  3DXO A;  1GSP A;  3H51 A;  3N9H A;  2CG1 A;  3FG3 A;  3KKG A;  3KN4 A;  3FH1 A;  3DM8 A;  1VQ9 3;  1YJW 3;  1VQ5 3;  2CK3 H;  4N6L A;  4N6T A;  1RN1 A;  1FUS A;  2WOF A;  5STD A;  2P0M A;  1M9G A;  1OHP A;  4FMA A;  4G1M B;  1RNB A;  2XF3 A;  3MG2 A;  4K90 B;  1CQS A;  2E2U A;  2Z77 A;  1NDO B;  5IEO A;  3U1W A;  1GOV A;  3FLJ A;  5AIG A;  4ZM8 A;  3MHE A;  2GEX A;  1RHL A;  3SED A;  4BTW A;  3Q1C A;  3WA3 A;  3LTA A;  1DE3 A;  4RBN A;  1T5Y A;  4HM3 B;  4K61 A;  2P38 A;  4NRE A;  3WOD G;  2R41 A;  5BVB A;  3G6E 3;  3CCV 3;  3DY5 A;  3KCH A;  1Q40 A;  3LXU X;  1PY3 A;  1BUQ A;  3NBJ A;  3SOA A;  2OOV A;  3WDG B;  4MMY B;  4XDW A;  2GEY A;  3GRD A;  1YJ9 3;  3JUQ A;  1JN5 A;  1GY5 A;  3F14 A;  3S67 A;  1NB3 I;  2W56 B;  4CDL A;  4N6N B;  1TFK A;  1QJG A;  4EBG A;  2GXF A;  1CH0 A;  5I97 A;  4HM5 B;  1EQK A;  4J5G A;  3FG1 A;  1FW7 A;  1IV7 A;  2CKF B;  1TRQ A;  5IEP A;  3VF1 A;  1BNE A;  1YIJ 3;  2ML5 A;  1SJW A;  4OUQ A;  4X2H A;  3GWR A;  3NX0 A;  1TJD A;  3AGO A;  3PZW A;  1W4N A;  3CC2 3;  4HYZ A;  4IPB A;  3TDG A;  4WHA A;  3MWZ A;  4NHF A;  1DVD A;  3X40 A;  1RKY A;  1YI2 3;  2YX9 A;  3CPO A;  5AYS C;  2Z76 A;  4HM0 B;  4TX4 A;  3SXX A;  1OHS A;  4DKI A;  2F86 B;  1LNH A;  2CW9 A;  3WOE B;  4XB5 A;  1NWW A;  2XRX B;  3A5E A;  1G02 A;  1DMQ A;  1N8Q A;  3FCS B;  3MKI A;  1ROA A;  5G1K A;  3EE1 A;  7GSP A;  1ZS7 A;  3FG4 A;  1YJN 3;  1DYU A;  2HML B;  4KVH A;  1CYU A;  2F98 A;  1IQX A;  3B4O A;  3Q2P A;  5CF1 A;  1UDI I;  5RNT A;  4O8S A;  1RMS A;  1I2F A;  2K54 A;  3S28 A;  1VQ6 3;  3KII A;  2XH9 A;  3D5G A;  5G1L A;  2IUK A;  3CCU 3;  3V98 A;  3EF8 A;  1IVX A;  6STD A;  3JUM A;  3JUO A;  3OXA A;  1E97 A;  1J2B A;  1NU3 A;  3SLU A;  1LNI A;  1Q9E A;  4R4K A;  1MGW A;  2Z6B A;  1RN7 A;  3DGL A;  5IEN A;  3T0U A;  3K7C A;  2QGU A;  5EVH A;  7STD A;  2OWP A;  1BIR A;  2F5W A;  3K9M C;  3NUV A;  3J7Y d;  1OHO A;  1O7H B;  1QVG 2;  4FCJ A;  4LSO A;  3NQZ A;  3LOY A;  3LZA A;  4KFE A;  4HVN A;  1W2B 2;  1WQL B;  4NPB A;  1BOX A;  3F8X A;  4K1V A;  4WWU C;  2ZA4 A;  3B8L A;  3D9R A;  1FYS A;  1TTO A;  2HMK B;  5D83 A;  1KQS 2;  1MWR A;  1CEW I;  1W00 A;  3CU3 A;  1X1W A;  2BNG A;  8CHO A;  1ROV A;  1DMM A;  3KZT A;  5KP1 A;  1Q82 4;  2KXG A;  1ZGX A;  1MGR A;  2YFL B;  4LGQ A;  3NV0 B;  4H61 A;  1B2X A;  1G96 A;  3EX9 A;  4CPK A;  4O2H A;  1JJ2 2;  4R9L A;  2O3O A;  2M7O A;  1TRP A;  1SAR A;  2RFR A;  1C54 A;  1B2S A;  1AR0 A;  1JB2 A;  5EEO A;  3EN1 B;  3HIG A;  5AIH A;  2K3D A;  1IYY A;  1RNT A;  3CPW 2;  1BSA A;  4O02 B;  1HYF A;  1PU4 A;  3D5I A;  1UGI A;  3EQQ B;  1ULJ B;  1YHQ 3;  3HOH A;  1K28 A;  2SAR A;  3AMO B;  1TP6 A;  4XDV A;  5AEW B;  1PYL A;  4FR9 A;  1M1X B;  1X1U A;  1JBT A;  1RDS A;  1BNJ A;  2Z7A A;  3HII A;  4XBT A;  1A90 A;  1FUW A;  2CWU A;  2FNQ A;  3GZR A;  1VQP 3;  4WYK A;  1BU4 A;  1JZO A;  2YFJ B;  1IT7 A;  3FZW A;  1UCL A;  1B21 A;  2GSP A;  2ZHX B;  2WGO A;  4HM7 B;  1W6G A;  1X1Y A;  2RCD A;  4IT7 A;  3KSE D;  1UUV B;  3LTC A;  2OQE C;  1FGM A;  4BIR A;  3N8B A;  1RCK A;  1T2I A;  1X1X A;  1GD4 A;  1GMP A;  2WO0 A;  2XR8 B;  1EA2 A;  2CFD A;  2KRT A;  4ILF A;  3UJM A;  1OF5 B;  5BXQ A;  3CXC 2;  4QWT A;  5AEU B;  5IER A;  1KSI A;  1AVL A;  3QK9 A;  5CLK A;  4R9K A;  2E2V A;  4IIA A;  2R4I A;  5EQL A;  3SYU A;  1I0X A;  3LTD A;  1U8C B;  2Y73 A;  5IG4 A;  2B24 B;  4XM4 A;  2MC8 A;  2OTL 3;  1OAC A;  4J9A A;  3CCL 3;  4K1U A;  2CWT A;  3SX1 A;  4KZ1 A;  1Q40 B;  1I3F A;  5AYR B;  1DMN A;  1M1K 4;  4HM6 B;  1JB5 A;  3F7S A;  4Q53 A;  1VQ7 3;  1OF5 A;  2CFL A;  3BB9 A;  1JN5 B;  1O7G B;  2D42 A;  4FMC A;  1RLS A;  2PZV A;  3U97 A;  1BNI A;  2GBX B;  1UCJ A;  2P09 A;  2F56 A;  2IY2 A;  3AGN A;  3EC9 A;  3G16 A;  4RNT A;  3X42 A;  4EXR A;  1RGA A;  2BMR B;  1EG9 B;  4KT3 B;  1SII A;  3HZP A;  4XBY A;  4L7K A;  1IQY A;  4MEI A;  4U13 A;  2QEX 3;  1LRA A;  4EYC A;  2ZL8 A;  2CFG A;  3KSP A;  1W02 A;  1K73 4;  3KE7 A;  1RTU A;  3GZX B;  3UL6 A;  1OGZ A;  1SQW A;  1VQL 3;  2IYJ A;  4LMI A;  3RGR A;  4LYL B;  1RCL A;  3OWY A;  3EHC A;  1VQ4 3;  1E3V A;  1W6Y A;  1W2Z A;  1NB5 I;  1BSD A;  3PGB A;  1A2V A;  3WOF B;  1BVI A;  3BU4 A;  4FCZ A;  3OV4 A;  1IVV A;  3DH2 A;  1V58 A;  4N6O B;  1I3I A;  2CWV A;  1US1 A;  1BRJ A;  1L5G B;  2B1X B;  1Q81 4;  5LC6 A;  1VZZ A;  2UX0 A;  1STF I;  2KF6 A;  3EBY A;  1WNH A;  1MWT A;  3KFQ C;  2XGL A; 
#chains in the Genus database with same CATH homology
 1D6U A;  2SBL A;  2FXT A;  2QIY A;  1ULI B;  2ZDJ A;  3E99 A;  2RGQ A;  3A76 A;  3SOY A;  1QAL A;  1STD A;  4RZM A;  1Q42 A;  3V99 A;  5D82 A;  1N8R 4;  2C10 A;  3LML A;  2LQV A;  3RDE A;  3EB8 A;  1S5A A;  1MOL A;  2W9Q A;  3BLZ A;  1AVK A;  4HKV B;  1VQO 3;  3CC4 3;  4JRF A;  4XBX A;  3GZB A;  3NQY A;  5A0O B;  2IMJ A;  3T8U A;  5LC7 A;  1HKX A;  5IW9 A;  3K5T A;  1TIJ A;  1FGR A;  4KFD A;  2XFT A;  3G8Z A;  4RNZ A;  1WMO A;  3QRD A;  3NBB A;  1W6C A;  4LEH A;  2HMJ B;  1K9M 4;  1GD3 A;  1PFP A;  3DGM A;  2OCT A;  1NO3 A;  1IDP A;  3CNX A;  3WA2 X;  1IK3 A;  3CCE 3;  1JNQ A;  2INX A;  1S72 3;  1JRQ A;  2OQE A;  4O3V A;  5DRE A;  2HMO B;  3PYJ A;  2Q07 A;  1VQN 3;  3PCR A;  2OOV C;  1Z1S A;  4HZ9 B;  1WMP A;  5JBS A;  2A15 A;  3FF0 A;  3JUP A;  3DGN A;  1N9J A;  1ZO2 A;  3LYG A;  1EKM A;  4OVM A;  4ORL A;  3DGO A;  2MF7 A;  3LT9 A;  3F7X A;  4X2O A;  3I56 3;  5G2G A;  3MYT A;  3VGN A;  1D6Z A;  5AI1 A;  3NXJ A;  2L4V A;  1JKG B;  3PS8 A;  1OUN A;  4WYK B;  2W9P A;  1O7W B;  3ALA A;  1LXE A;  3G0K A;  1OH0 A;  1Q7Y 4;  2KCD A;  2WOH A;  2K0M A;  3ECF A;  1WTH A;  2W2C A;  3O8Y A;  3RGA A;  4R1K A;  1KC8 4;  1KWI A;  2CH9 A;  3JVC A;  3DMC A;  1JKG A;  3UB1 A;  4HM2 B;  1LVN A;  3OWS A;  3CNM A;  3G71 3;  4BTY A;  2XGN A;  1QAK A;  1TFO A;  1CYV A;  3DZL A;  3K0Z A;  4AKY A;  3PCS A;  1D6Y A;  3LT8 A;  1QAF A;  3S5C A;  1IVU A;  1F8N A;  1VQ8 3;  3ER7 A;  1GY7 A;  2BMQ B;  2QA4 3;  3T8N A;  3X3X A;  1VQK 3;  1OGX A;  3CCQ 3;  2WGQ A;  1RRH A;  1GYB A;  1WMN A;  2BO9 B;  2XEP A;  4LZI A;  1U5O A;  4AEQ A;  1E3R A;  3IMA B;  4HM4 B;  1GY6 A;  2Y74 A;  4EC6 A;  1QVF 2;  2XSH B;  4MMX B;  1R4C A;  3B7C A;  4N6V 0;  5IG5 A;  1K41 A;  1ZX2 A;  4MJD A;  1YGE A;  1GS3 A;  3CCJ 3;  2IUJ A;  1FGO A;  2E2T A;  1FGT A;  4H3U A;  2CFW A;  2GBW B;  5AIF A;  3VSY A;  3OWU A;  4EV2 A;  4I4K A;  4R80 A;  4N3V A;  4RNY A;  2ML6 A;  3OW2 2;  1VQM 3;  1YVB I;  1ISK A;  3CCM 3;  3NHX A;  4HM1 B;  3CMA 3;  3MG3 A;  1W01 A;  1OPY A;  3V92 A;  5ELU A;  1IU7 A;  3SVA A;  1AV4 A;  4OK0 A;  2W04 A;  1Q86 4;  3NM2 A;  5CXO A;  5FGO A;  3CME 3;  1MNL A;  1QMA A;  4BTX A;  3IPT A;  4GL6 A;  5IG0 A;  3Q90 A;  4HJL B;  4HZB B;  5D81 A;  3GAX A;  3ROB A;  1JV2 B;  3GZY B;  5IF6 A;  5FW5 A;  4FMB A;  1UUW B;  4WP5 A;  1Y4K A;  5TGN A;  3UL5 A;  3H3H A;  3I55 3;  3N54 B;  2BHM A;  1ASK A;  2CHC A;  2P0X A;  3FGY A;  3FF2 A;  2JDI H;  1O7N B;  3MSO A;  5JPU A;  2F99 A;  2W56 A;  2IA7 A;  4HM8 B;  4GB5 A;  5HGR A;  3MG1 A;  1NJI 4;  3F8H A;  4J8T A;  2RSX A;  1A2K A;  2W6J H;  5AII A;  2W03 A;  3FSD A;  3NBR A;  3S27 A;  2PNC A;  2HMN B;  3L0R A;  4N6M A;  1IV9 A;  2CIU A;  1SPU A;  1TU5 A;  5KP3 A;  3BNE A;  4AKZ A;  1M90 4;  3FKA A;  1FA3 A;  2HMM B;  1JB4 A;  2BT3 A;  4WFO A;  1LOX A;  4CCV A;  3STD A;  4FCM A;  5IG3 A;  3LH4 A;  1N5H A;  2YFI B;  4EV5 A;  1V74 A;  3G4S 3;  3EBT A;  2O9U X;  3CD6 3;  3B4P A;  1IQ8 A;  3BND A;  3IJE B;  3M8C A;  1OCV A;  5KP4 A;  3K63 A;  1K8A 4;  4N6U A;  5ELJ A;  3WMD A;  3CCR 3;  4FMD A;  3CCS 3;  2I9W A;  2JQ5 A;  1KD1 4;  1UI8 A;  2XSO B;  2STD A;  5CF2 A;  4PEJ A;  3HX8 A;  3X41 A;  1UI7 A;  3MPH A;  1N5P A;  2W0Q A;  1DVC A;  3DUK A;  3BNC A;  2XFS A;  3BNB A;  1W5Z A;  4L8O A;  1TUH A;  3S29 A;  1YIT 3;  2D1W A;  3UNL A;  1FGQ A;  4L8P A;  3JUN A;  2OTJ 3;  1C7H A;  3I0Y A;  1W7C A;  4JF8 A;  2CC3 A;  1UW1 A;  3EN8 A;  5CK6 A;  2CG0 A;  3F9S A;  3OX9 A;  1RJO A;  1O7P B;  3NV0 A;  2P05 A;  2V1L A;  3HI7 A;  2BMO B;  3NM7 A;  3F40 A;  5DRV A;  3HK4 A;  1A67 A;  1IT8 A;  3X3Z A;  4MMZ B;  1SIH A;  1RRL A;  1O7M B;  3D3L A;  3EJV A;  4HBR A;  3X3Y A;  1IVW A;  2GU3 A;  2CFK A;  2LYX A;  1N9E A;  3PXM A;  5JPP A;  1HU9 A;  2C11 A;  3AMO A;  3CC7 3;  4KFF A;  3LTB A;  4STD A;  2GU1 A;  2FGT A;  3DXO A;  2CG1 A;  3H51 A;  3N9H A;  3FG3 A;  3KKG A;  3KN4 A;  3FH1 A;  3DM8 A;  1VQ9 3;  1YJW 3;  1VQ5 3;  2CK3 H;  4N6L A;  4N6T A;  2WOF A;  5STD A;  2P0M A;  1M9G A;  1OHP A;  4FMA A;  4G1M B;  2XF3 A;  3MG2 A;  4K90 B;  1CQS A;  2E2U A;  2Z77 A;  1NDO B;  5IEO A;  3U1W A;  3FLJ A;  5AIG A;  4ZM8 A;  3MHE A;  2GEX A;  3SED A;  4BTW A;  3WA3 A;  3Q1C A;  3LTA A;  4RBN A;  1T5Y A;  4HM3 B;  4K61 A;  2P38 A;  4NRE A;  3WOD G;  5BVB A;  3G6E 3;  3CCV 3;  3DY5 A;  1Q40 A;  3LXU X;  1BUQ A;  3NBJ A;  3SOA A;  2OOV A;  3WDG B;  4MMY B;  4XDW A;  2GEY A;  3GRD A;  1YJ9 3;  3JUQ A;  1JN5 A;  1GY5 A;  3F14 A;  3S67 A;  1NB3 I;  2W56 B;  4CDL A;  4N6N B;  1TFK A;  1QJG A;  4EBG A;  2GXF A;  5I97 A;  1EQK A;  4HM5 B;  3FG1 A;  1IV7 A;  2CKF B;  5IEP A;  3VF1 A;  1YIJ 3;  2ML5 A;  1SJW A;  4OUQ A;  4X2H A;  3GWR A;  3NX0 A;  3PZW A;  1W4N A;  3CC2 3;  4HYZ A;  4IPB A;  3TDG A;  4WHA A;  3MWZ A;  4NHF A;  1DVD A;  3X40 A;  1RKY A;  1YI2 3;  2YX9 A;  3CPO A;  5AYS C;  2Z76 A;  4HM0 B;  4TX4 A;  3SXX A;  1OHS A;  2F86 B;  1LNH A;  2CW9 A;  3WOE B;  4XB5 A;  1NWW A;  2XRX B;  1DMQ A;  1N8Q A;  3FCS B;  3MKI A;  1ROA A;  3EE1 A;  3FG4 A;  1YJN 3;  1DYU A;  2HML B;  4KVH A;  1CYU A;  2F98 A;  1IQX A;  3B4O A;  3Q2P A;  5CF1 A;  4O8S A;  3S28 A;  2K54 A;  1VQ6 3;  3KII A;  2XH9 A;  2IUK A;  3CCU 3;  3V98 A;  3EF8 A;  1IVX A;  6STD A;  3JUM A;  3JUO A;  3OXA A;  1E97 A;  1J2B A;  1NU3 A;  3SLU A;  4R4K A;  2Z6B A;  1RN7 A;  3DGL A;  5IEN A;  3T0U A;  3K7C A;  2QGU A;  5EVH A;  7STD A;  2OWP A;  3K9M C;  3NUV A;  3J7Y d;  1OHO A;  1O7H B;  1QVG 2;  4FCJ A;  4LSO A;  3NQZ A;  3LOY A;  3LZA A;  4KFE A;  4HVN A;  1W2B 2;  1WQL B;  4WWU C;  3F8X A;  4K1V A;  1KQS 2;  5D83 A;  3B8L A;  3D9R A;  2HMK B;  3CU3 A;  1CEW I;  1W00 A;  8CHO A;  5KP1 A;  2BNG A;  1Q82 4;  1ROV A;  1DMM A;  3KZT A;  2KXG A;  2YFL B;  4LGQ A;  3NV0 B;  4H61 A;  1G96 A;  3EX9 A;  4O2H A;  1JJ2 2;  4R9L A;  2O3O A;  2M7O A;  2RFR A;  1JB2 A;  1AR0 A;  5EEO A;  3EN1 B;  3HIG A;  5AIH A;  3CPW 2;  1PU4 A;  4O02 B;  3EQQ B;  1ULJ B;  1YHQ 3;  1K28 A;  3AMO B;  1TP6 A;  4XDV A;  5AEW B;  4FR9 A;  1M1X B;  2Z7A A;  4XBT A;  3HII A;  1A90 A;  1FUW A;  2CWU A;  2FNQ A;  3GZR A;  1VQP 3;  4WYK A;  2YFJ B;  1IT7 A;  3FZW A;  2WGO A;  4HM7 B;  1W6G A;  4IT7 A;  2RCD A;  3KSE D;  1UUV B;  3LTC A;  2OQE C;  1FGM A;  3N8B A;  1GD4 A;  2WO0 A;  2XR8 B;  1EA2 A;  2CFD A;  2KRT A;  3UJM A;  3CXC 2;  1OF5 B;  5BXQ A;  4QWT A;  5AEU B;  5IER A;  1KSI A;  1AVL A;  3QK9 A;  5CLK A;  4R9K A;  2E2V A;  4IIA A;  2R4I A;  5EQL A;  3LTD A;  1U8C B;  2Y73 A;  5IG4 A;  2B24 B;  4XM4 A;  2MC8 A;  2OTL 3;  1OAC A;  4J9A A;  3CCL 3;  4K1U A;  2CWT A;  3SX1 A;  4KZ1 A;  1Q40 B;  5AYR B;  1DMN A;  1M1K 4;  4HM6 B;  1JB5 A;  3F7S A;  4Q53 A;  1VQ7 3;  1OF5 A;  2CFL A;  3BB9 A;  1JN5 B;  1O7G B;  2D42 A;  4FMC A;  2PZV A;  3U97 A;  2GBX B;  2P09 A;  4EXR A;  3X42 A;  3EC9 A;  3G16 A;  2BMR B;  1EG9 B;  1SII A;  3HZP A;  4XBY A;  4L7K A;  1IQY A;  4MEI A;  4U13 A;  2QEX 3;  4EYC A;  2ZL8 A;  2CFG A;  3KSP A;  1W02 A;  1K73 4;  3KE7 A;  3GZX B;  3UL6 A;  1OGZ A;  1SQW A;  1VQL 3;  4LMI A;  3RGR A;  3OWY A;  3EHC A;  1VQ4 3;  1E3V A;  1W6Y A;  1W2Z A;  1NB5 I;  3PGB A;  1A2V A;  3WOF B;  4FCZ A;  3OV4 A;  1IVV A;  4N6O B;  2CWV A;  1US1 A;  1L5G B;  2B1X B;  1Q81 4;  5LC6 A;  1VZZ A;  2UX0 A;  1STF I;  3EBY A;  1WNH A;  3KFQ C;  2XGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...