1CYVA

Solution nmr structure of recombinant human cystatin a under the condition of ph 3.8 and 310k
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
98
structure length
98
Chain Sequence
MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Proteinase inhibitor (cysteine)
molecule keywords CYSTATIN A
total genus 7
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1995-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00031 Cystatin Cystatin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1cyvA00
5EQLA 3KFQC 3MWZA 1G96A 4N6LA 1RN7A 1CEWI 5LC7A 1LXEA 4N6MA 1GD4A 3PXMA 3QRDA 3S67A 1ROAA 1MOLA 4N6UA 5ELJA 1IV7A 2KXGA 5A0OB 1A90A 1CYVA 1N5PA 1WNHA 2O9UX 3PYJA 3LH4A 4EYCA 1STFI 1TIJA 1DVCA 4N6OB 4CCVA 2W9QA 3IMAB 4LZIA 1FUWA 1FA3A 2CH9A 4N6V0 1N9JA 3PS8A 4ZM8A 1R4CA 5ELUA 2BO9B 3UL6A 1EQKA 4N6NB 1PFPA 3NX0A 1NB5I 3SVAA 3UL5A 1YVBI 1KWIA 1M9GA 1GD3A 3GAXA 1NB3I 1IV9A 4IT7A 1CYUA 1A67A 2OCTA 1DVDA 2W9PA 3L0RA 3Q2PA 4TX4A 3KSED 1N5HA 1MNLA 4N6TA 3K9MC 5LC6A
chains in the Genus database with same CATH superfamily
1JKGB 2RSXA 1Y4KA 4J5GA 3VSYA 3CD63 4JRFA 2F99A 3S67A 1X1XA 2KXGA 3FLJA 2RFRA 4RZMA 1FGMA 1TJDA 2F98A 1V58A 3AHSA 1PY3A 1YGWA 5FGOA 1ZS7A 1I3FA 1SIHA 3NHXA 3LMLA 1QVG2 2CWUA 1KC84 1BNEA 3PCRA 5RNTA 2E2VA 1FYSA 3CCU3 1VQ63 1N8QA 1B27A 3B4OA 1Q42A 1NB3I 4FMAA 1LNIA 1VQL3 1QALA 2KCDA 1VQO3 1ZO2A 1AR0A 3H3HA 1E3VA 3RGRA 3F40A 3KSED 1IV9A 1IVUA 1SIIA 4HM3B 5IENA 5LC6A 1RMSA 3KFQC 2HMKB 2FGTA 3URPA 1LQMB 2WO0A 5CK6A 1JKGA 4R4KA 2IUJA 3NQYA 1K9M4 1NO3A 1ROVA 2KF4A 3NV0B 1GMPA 4KFFA 5AYSC 3S28A 1JBTA 2MC8A 1AY7A 1UDII 3IMAB 4CCVA 2IYJA 1AVKA 4U13A 2F4YA 2F86B 3PCSA 3KKGA 4NHFA 2CFDA 3BNBA 3X3YA 3WOFB 3K63A 2GEXA 3VGNA 2P0MA 1VQ83 3HOHA 3V92A 1VQQA 2UUGC 2STDA 4HM2B 3AGNA 4LEHA 1RCLA 2R4IA 2OQEA 1T5YA 1YJW3 3FH1A 4QWTA 4R1KA 3WA3A 1N5HA 1X1UA 5AIGA 3LTCA 3EX9A 3JUOA 3OW22 1WTHA 1IQXA 1BOXA 3ROBA 1IQ8A 2BHMA 5JPUA 3I563 3G6E3 3LZAA 4LYLB 3D79A 3LXUX 1NJI4 1HU9A 2H0IA 1W2ZA 3DXOA 3I553 1JN5B 1AVLA 4PEJA 3SXXA 1IDPA 5EEOA 3BNDA 2JQ5A 1D6YA 1SPUA 3CU3A 4WHAA 1YIJ3 1OF5A 1OGZA 3UL5A 5BXQA 1TFKA 1RKYA 1JZDA 1Q864 2P09A 2ML6A 1Q9EA 3EN8A 3EB8A 2ZDJA 1A67A 4BU4A 1UW1A 1KD14 1FUWA 1RNTA 3LTDA 1W2B2 3OV4A 1BUQA 1TRQA 3LT8A 2W56A 3T8NA 1RN7A 3G713 1YGEA 3FZWA 3EBTA 4BTXA 1CYVA 3H51A 4K1UA 1BSCA 3CC23 1J2BA 5I97A 4CJNA 5BVBA 1IK3A 2GXFA 1U5OA 1VQ93 1RGGA 3RDEA 7STDA 1R4CA 2ZA4A 2ML5A 3UB1A 1NNVA 4BTWA 2QA43 1O7HB 3G4S3 1K734 1JN5A 2OTJ3 1VQM3 1WMOA 2C11A 1LVNA 4J8TA 3LOYA 2WGOA 4EC6A 1D6UA 1CQSA 3SEDA 3L0RA 2AAEA 5KP1A 1GOUA 1BRIA 3DGOA 1YNVX 4EW5A 1GY7A 5CF2A 4OVMA 3EC9A 1UUGB 1ROAA 1FW7A 5ELJA 1W6CA 3PZWA 5A0OB 1G0TA 2O3OA 3FCSB 3CXC2 1B2ZA 4EXRA 2LQVA 2B1XB 2CFKA 2GU1A 4HM4B 1A2VA 3CCR3 4XBXA 1RN4A 1QMAA 1BRGA 3HK4A 3LT9A 3OWUA 4XBYA 1FGQA 4BL2A 1S723 4HYZA 2JDIH 1PFPA 4AKYA 2CG1A 1DMNA 3WMDA 2ZL8A 3JUQA 4BIRA 2INXA 4RNTA 1LOWA 3EJVA 2WOHA 2XSHB 2BIRA 5JPPA 4IIAA 3NM2A 1YIT3 3F8XA 4J9AA 3CCE3 1IQYA 1Q7Y4 3JUNA 3NV0A 1MGRA 4K1VA 3CCL3 1E3RA 2XEPA 3IJEB 3LTBA 1MWUA 1FUSA 1W00A 1OHSA 3CME3 4XDVA 1Q7HA 1G02A 1UI7A 1STFI 1UCIA 1PYLA 2J8XB 2W2CA 3EF8A 4ORLA 1OPYA 2XFTA 2OOVA 4FR9A 1JBSA 2BNGA 1WMNA 3TDGA 4ILFA 6RNTA 5IW9A 2UX0A 1O7NB 3K5TA 1I8VA 1GMRA 2CFGA 3QK9A 1WMPA 1YVBI 1LRAA 1M9GA 2KF5A 3AMOB 3BLZA 3BU4A 8RNTA 1YI23 1SQWA 3D5IA 1K41A 1V74A 1BSAA 2CX0A 4CDLA 3CCV3 3HX8A 5CF1A 3ALAA 1VQK3 3DUKA 3SOYA 5D81A 2W6JH 3NM7A 4HBRA 3EHCA 1NU3A 2C4BA 2L1SA 1LXEA 1LOXA 2XH9A 4FMCA 4N6MA 4RNZA 3STDA 3U97A 3V98A 1RGCA 3K7CA 3OWYA 1VQ53 3CC43 2KRTA 1T2HA 1I0XA 5HGRA 1DVCA 1OF5B 1JB5A 3S5CA 2XF3A 3OWSA 3JUPA 4MMZB 2XR8B 3CCM3 1NB5I 4XBTA 4FCJA 2W56B 2W03A 3D9RA 5IEOA 1RTUA 1Q824 3F7SA 4X2OA 3DZLA 2FXTA 1DVDA 1K28A 2K3DA 2Y73A 3Q2PA 2BU4A 4FMBA 4ZM8A 3WODG 3V99A 3D3LA 4DKIA 1HYFA 3RGAA 3FSDA 4HZBB 1CEWI 1YVSA 1OHOA 3M8CA 2PZVA 3NXJA 4L8OA 3ZFZA 1PU4A 1B20A 1OH0A 3IPTA 1BNIA 4FCZA 4BL3A 2XGLA 2GBWB 2CH9A 1BNSA 1RLSA 2HOHA 5KP3A 3DGNA 1O7MB 1W6GA 3U1WA 3WHOA 3GZRA 1STDA 1BRJA 2Q07A 2R41A 1N9EA 2BMQB 5AEUB 5BIRA 1LOVA 4FMDA 4NREA 2XGNA 3KN4A 4FCMA 4O02B 1FZUA 3A5EA 3Q3FA 1TRPA 3SX1A 1VQN3 2WOFA 4N6TA 8CHOA 5IERA 2Z76A 5DREA 1RGHA 5CXOA 4JF8A 2IY2A 3NBRA 4BTYA 1T2IA 3CPOA 1GY5A 5EVHA 1IV7A 1U8CB 1BNGA 3SOAA 4KVHA 3DGMA 4KZ1A 3SLUA 3KIIA 2BT3A 3DGLA 3EE1A 2D42A 5M1AA 5TGNA 1FGRA 1V57A 4LGQA 4N6V0 1BUJA 3PS8A 3KSPA 1ULJB 4L8PA 2RCDA 3A76A 3J7Yd 5G1KA 6STDA 1T3BA 3DM8A 3FG4A 1IVXA 3DY5A 3FGYA 1B3SA 1X1WA 2YFIB 1ZX2A 4LSOA 4XDWA 1JB2A 1GD3A 4CPKA 4KFDA 1OUNA 1IYYA 1BU4A 1DMMA 1KSIA 1MWRA 3CNMA 1OACA 5AI1A 2BMOB 3T0UA 2CIUA 1VQ73 3S29A 1IU7A 2OWPA 1YJ93 1E97A 1EA2A 1JZOA 1BIRA 3BNEA 3KE7A 4R9KA 1OGXA 2XFSA 1IT8A 1JNQA 1A2PA 1DYUA 3JUMA 1RRHA 4I4KA 2D1WA 1M1K4 5JBSA 1W7CA 4X2HA 1MGWA 3KZTA 3MG1A 1OCVA 1WQLB 1X1YA 1TFOA 4GHOA 3AMOA 1TTOA 5AIIA 3FF2A 2AADA 5IF6A 1OHPA 1RGEA 2GBXB 2P38A 4HM8B 1GMQA 2OQEC 4HKVB 4K90B 2RGQA 3MSOA 2E2TA 1NWWA 1I0VA 1RN1A 2Z6BA 4G1MB 2QEX3 3WA2X 1W4NA 2HMJB 1QVF2 3CCQ3 1RRLA 2CKFB 3G16A 1CYUA 3F9SA 3X42A 4AEQA 3EQQB 1I70A 4N6LA 7GSPA 5D82A 1A2KA 4KT3B 3ZG5A 1IVVA 3MWZA 1Q40A 2KF6A 1EUIC 4NPBA 5M19A 2CFLA 3CMA3 1ASKA 3HI7A 3CNXA 1BRNL 1B2SA 4HVNA 3PYJA 1FGOA 4KFEA 4WYKB 2L4VA 1QAKA 2W9QA 2MF7A 1JV2B 2K54A 4H3UA 1RGFA 1BVIA 2W04A 4RNYA 2CC3A 3GRDA 1KQS2 2C10A 1LNHA 1TP6A 1BRKA 1BNFA 2CK3H 2GSPA 4MJDA 4XB5A 1I2EA 3HIIA 4N6NB 1JJ22 3DH2A 1BNJA 2HMOB 2CG0A 1UUVB 1AV4A 1BRHA 1IT7A 3GWRA 1BSEA 3N54B 1RGLA 4GB5A 4J5KA 1AQZA 2Y74A 7RNTA 1DETA 1JBRA 5DRVA 2W9PA 4HJLB 3JVCA 3O8YA 1W6YA 3PXMA 1UI8A 1LOYA 4HM7B 4H61A 1GOVA 1LQGC 2OOVC 4HM5B 1I2GA 2QGUA 2HMLB 2K0MA 1A90A 3D4AA 1W02A 1YJN3 3MPHA 4O2HA 4R9LA 4N6OB 4XM4A 4LZIA 3GZXB 5HOHA 1FA3A 1F8NA 1VQP3 3HIGA 3G0KA 1QJGA 1SARA 3UL6A 1EKMA 4WYKA 4WWUC 5CLKA 3FG1A 1RNBA 2FNQA 1Q814 4O3VA 1KWIA 1RCKA 5IG3A 1S5AA 4AKZA 1O7PB 5IG5A 2XSOB 1O7WB 2KAAA 2KF3A 2P05A 1M1XB 1RGAA 2UGIA 2XRXB 3CCJ3 1CH0A 1EEJA 1MWTA 3X3ZA 3CC73 1L5GB 1RGKA 1GD4A 3Q1CA 2F5MA 3WR2A 4GL6A 1MOLA 2Z7AA 4MMYB 1MWSA 4RBNA 4EV2A 2YFJB 5FW5A 3EN1B 1VQ43 1TIJA 1RDSA 4HM0B 2RBIA 3X41A 2CWVA 2ZHXB 3FKAA 1EQKA 1GS3A 1ZGXA 4MMXB 1YHQ3 3FF0A 2B24B 1DE3A 3SVAA 3D5GA 3WOEB 3E99A 1RSNA 2CX1A 1C7HA 2W0QA 3RNTA 4IT7A 2HMNB 2LYXA 1UGIA 3AHWA 4TX4A 5G2GA 4LMIA 1MNLA 1W01A 2YFLB 2GU3A 1Z1SA 1VZZA 2CFWA 2CW9A 3ECFA 3GSPA 5ELUA 5EQLA 3S27A 3G8ZA 1ULIB 1FGTA 1R4YA 1UUWB 3DMCA 3ZG0A 1RJOA 2P0XA 1BAOA 2OTL3 4HOHA 5AIHA 1B21A 1BSDA 2SBLA 1K8A4 2O9UX 1QAFA 2YX9A 2RNTA 3ER7A 3OX9A 3EBYA 3F8HA 1GSPA 3UJMA 1I2FA 4HM1B 4L7KA 1O7GB 1HZ1A 5D83A 3X40A 1UCJA 1EG9B 2A15A 3N8BA 4HAAA 4WFOA 1BSBA 1Q40B 4MEIA 3FG3A 1HKXA 3GZBA 1UCLA 3CPW2 2GEYA 2QIYA 4HM6B 2F56A 1UCKA 2CHCA 3B8LA 1NDOB 3K0ZA 3OXAA 4OUQA 5M18A 1TU5A 3F7XA 4EYCA 1RHLA 3X3XA 3WDGB 9RNTA 1TUHA 5LC7A 3LTAA 3MG3A 5AIFA 3N9HA 3SYUA 1N5PA 2IMJA 1W5ZA 3BIRA 2H0HA 4I5QA 2H0GA 1B2MA 5STDA 1SJWA 1US1A 1B2UA 1N9JA 1D6ZA 2IA7A 1M904 6GSPA 3BNCA 2PNCA 2M7OA 5AEWB 3HZPA 3NX0A 3NBJA 1GYBA 4HZ9B 3VF1A 5IEPA 1JRQA 1BANA 1GY6A 3B7CA 4EV5A 5IG0A 3UNLA 3GZYB 1FUTA 2OCTA 1DMQA 3MHEA 3I0YA 3NQZA 1B2XA 3K9MC 3NBBA 1ISKA 1G96A 4Q53A 4O8SA 3MYTA 1JB4A 3QRDA 4WP5A 2V1LA 4N6UA 4R80A 3BB9A 5BU4A 1N8R4 1WNHA 3F14A 2E2UA 3LH4A 4EBGA 1BGSA 4N3VA 5GSPA 3PGBA 5KP4A 4K61A 2CWTA 3KCHA 1BRSA 2IUKA 1C54A 2BO9B 2I9WA 3DGYA 5AYRB 3NUVA 2WGQA 2SARA 4GSPA 3T8UA 5IG4A 1GOYA 2F5WA 2BMRB 1I3IA 3MG2A 3MKIA 3GAXA 1IVWA 4IPBA 3CCS3 1BNRA 4OK0A 4STDA 3B4PA 3LYGA 5G1LA 3AGOA 2Z77A 1UGHI 3Q90A 2HMMB
chains in the Genus database with same CATH topology
1JKGB 2RSXA 1Y4KA 3VSYA 3CD63 4JRFA 2F99A 3S67A 2KXGA 3FLJA 2RFRA 4RZMA 1FGMA 2F98A 5FGOA 1SIHA 3NHXA 3LMLA 1QVG2 2CWUA 1KC84 3PCRA 2E2VA 1VQ63 3CCU3 1N8QA 3B4OA 1Q42A 1NB3I 4FMAA 1VQL3 1QALA 2KCDA 1VQO3 1ZO2A 1AR0A 3H3HA 1E3VA 3RGRA 3F40A 3KSED 1IV9A 1IVUA 1SIIA 4HM3B 5IENA 5LC6A 3KFQC 2HMKB 2FGTA 2WO0A 5CK6A 1JKGA 4R4KA 2IUJA 3NQYA 1K9M4 1NO3A 1ROVA 3NV0B 4KFFA 5AYSC 3S28A 2MC8A 3IMAB 4CCVA 1AVKA 4U13A 2F86B 3PCSA 4NHFA 3KKGA 2CFDA 3BNBA 3X3YA 3WOFB 3K63A 2GEXA 3VGNA 2P0MA 1VQ83 3V92A 4HM2B 2STDA 4LEHA 2R4IA 2OQEA 1YJW3 1T5YA 3FH1A 4QWTA 4R1KA 3WA3A 1N5HA 5AIGA 3LTCA 3EX9A 3JUOA 3OW22 1WTHA 1IQXA 3ROBA 1IQ8A 2BHMA 5JPUA 3I563 3G6E3 3LZAA 3LXUX 1NJI4 1HU9A 1W2ZA 3DXOA 3I553 1JN5B 1AVLA 4PEJA 3SXXA 1IDPA 5EEOA 3BNDA 2JQ5A 1D6YA 1SPUA 3CU3A 4WHAA 1YIJ3 1OF5A 1OGZA 3UL5A 5BXQA 1TFKA 1RKYA 1Q864 2P09A 2ML6A 3EN8A 3EB8A 2ZDJA 1A67A 1UW1A 1KD14 1FUWA 3LTDA 1W2B2 3OV4A 1BUQA 3LT8A 2W56A 3T8NA 1RN7A 3G713 1YGEA 3FZWA 3EBTA 4BTXA 1CYVA 3H51A 4K1UA 3CC23 1J2BA 5I97A 5BVBA 1IK3A 2GXFA 1U5OA 1VQ93 3RDEA 7STDA 1R4CA 3UB1A 2ML5A 4BTWA 2QA43 1O7HB 3G4S3 1K734 1JN5A 2OTJ3 1VQM3 1WMOA 2C11A 1LVNA 4J8TA 3LOYA 2WGOA 4EC6A 1D6UA 1CQSA 3SEDA 3L0RA 5KP1A 3DGOA 5CF2A 1GY7A 4OVMA 3EC9A 1ROAA 5ELJA 1W6CA 3PZWA 5A0OB 2O3OA 3FCSB 3CXC2 4EXRA 2LQVA 2B1XB 2CFKA 2GU1A 4HM4B 1A2VA 3CCR3 4XBXA 1S723 1QMAA 3HK4A 3LT9A 3OWUA 4XBYA 1FGQA 4HYZA 2JDIH 1PFPA 4AKYA 2CG1A 1DMNA 3WMDA 2ZL8A 3JUQA 2INXA 3EJVA 2WOHA 2XSHB 5JPPA 4IIAA 3NM2A 1YIT3 3F8XA 4J9AA 3CCE3 1IQYA 1Q7Y4 3JUNA 3NV0A 4K1VA 3CCL3 1E3RA 2XEPA 3IJEB 3LTBA 1W00A 3CME3 1OHSA 4XDVA 1UI7A 1STFI 2W2CA 2OOVA 3EF8A 4ORLA 1OPYA 2XFTA 4FR9A 2BNGA 1WMNA 3TDGA 5IW9A 2UX0A 1O7NB 3K5TA 2CFGA 3QK9A 1WMPA 1YVBI 1M9GA 3AMOB 1YI23 3BLZA 1SQWA 1K41A 1V74A 3CCV3 4CDLA 3HX8A 5CF1A 3ALAA 1VQK3 3DUKA 3SOYA 5D81A 2W6JH 3NM7A 4HBRA 3EHCA 2XH9A 1NU3A 4RNZA 1LXEA 1LOXA 4FMCA 4N6MA 3STDA 3U97A 3V98A 3K7CA 3OWYA 1VQ53 3CC43 2KRTA 5HGRA 1DVCA 1OF5B 1JB5A 3S5CA 2XF3A 3OWSA 3JUPA 4MMZB 2XR8B 3CCM3 1NB5I 4XBTA 4FCJA 2W56B 2W03A 3D9RA 5IEOA 1Q824 3F7SA 4X2OA 3DZLA 2FXTA 1DVDA 1K28A 2Y73A 3Q2PA 4FMBA 4ZM8A 3WODG 3V99A 3D3LA 3RGAA 3FSDA 4HZBB 1CEWI 1PU4A 1OHOA 3M8CA 2PZVA 3NXJA 4L8OA 1OH0A 3IPTA 4FCZA 2XGLA 2GBWB 2CH9A 5KP3A 3DGNA 1O7MB 1W6GA 3U1WA 3GZRA 1STDA 2Q07A 1N9EA 2BMQB 5AEUB 4NREA 4FMDA 2XGNA 3KN4A 4FCMA 4O02B 3SX1A 1VQN3 2WOFA 4N6TA 8CHOA 5IERA 2Z76A 5DREA 5CXOA 4JF8A 3NBRA 4BTYA 3CPOA 1GY5A 5EVHA 1IV7A 1U8CB 3SOAA 4KVHA 3DGMA 4KZ1A 3SLUA 3KIIA 2BT3A 3DGLA 3EE1A 2D42A 5TGNA 1FGRA 4N6V0 4LGQA 3PS8A 3KSPA 1ULJB 4L8PA 2RCDA 3A76A 3J7Yd 6STDA 3DM8A 3FG4A 1IVXA 3DY5A 3FGYA 2YFIB 4LSOA 1ZX2A 4XDWA 1JB2A 1GD3A 4KFDA 1OUNA 1KSIA 1DMMA 5AI1A 3CNMA 3T0UA 1OACA 2BMOB 2CIUA 1VQ73 3S29A 1IU7A 2OWPA 1YJ93 1E97A 1EA2A 3BNEA 3KE7A 4R9KA 1OGXA 2XFSA 1IT8A 1JNQA 1DYUA 3JUMA 1RRHA 4I4KA 2D1WA 1M1K4 5JBSA 1W7CA 4X2HA 3KZTA 3MG1A 1OCVA 1WQLB 1TFOA 3AMOA 5AIIA 3FF2A 5IF6A 1OHPA 2GBXB 2P38A 4HM8B 2OQEC 4HKVB 4K90B 2RGQA 3MSOA 2E2TA 1NWWA 2Z6BA 4G1MB 2QEX3 3WA2X 1W4NA 2HMJB 1QVF2 3CCQ3 1RRLA 2CKFB 3G16A 1CYUA 3F9SA 3X42A 4AEQA 3EQQB 4N6LA 5D82A 1A2KA 1IVVA 3MWZA 1Q40A 2CFLA 3CMA3 1ASKA 3HI7A 3CNXA 4HVNA 3PYJA 1FGOA 4KFEA 4WYKB 2L4VA 1QAKA 2W9QA 2MF7A 1JV2B 2K54A 4H3UA 2W04A 4RNYA 2CC3A 3GRDA 1KQS2 2C10A 1LNHA 1TP6A 2CK3H 4MJDA 4XB5A 5ELUA 1JJ22 1ISKA 3HIIA 4N6NB 2HMOB 2CG0A 1UUVB 1AV4A 1IT7A 3GWRA 3N54B 4GB5A 2Y74A 5DRVA 2W9PA 4HJLB 3JVCA 3O8YA 1W6YA 3PXMA 1UI8A 4HM7B 4H61A 2OOVC 4HM5B 2QGUA 2HMLB 2K0MA 1A90A 1W02A 1YJN3 3MPHA 4O2HA 4R9LA 4N6OB 4XM4A 4LZIA 3GZXB 1FA3A 1F8NA 1VQP3 3HIGA 3G0KA 1QJGA 3UL6A 1EKMA 4WYKA 4WWUC 5CLKA 3FG1A 2FNQA 1Q814 4O3VA 1KWIA 5IG3A 1S5AA 4AKZA 1O7PB 5IG5A 2XSOB 1O7WB 2P05A 1M1XB 2XRXB 3CCJ3 3X3ZA 3CC73 1L5GB 1GD4A 3Q1CA 4GL6A 1MOLA 2Z7AA 4MMYB 4RBNA 4EV2A 2YFJB 5FW5A 3EN1B 1VQ43 1TIJA 4HM0B 3X41A 2CWVA 3FKAA 1EQKA 1GS3A 4MMXB 1YHQ3 3FF0A 2B24B 3SVAA 3WOEB 3E99A 2W0QA 1C7HA 4IT7A 2HMNB 2LYXA 4TX4A 5G2GA 4LMIA 1MNLA 1W01A 2YFLB 2GU3A 1Z1SA 1VZZA 2CFWA 2CW9A 3ECFA 5EQLA 3S27A 3G8ZA 1ULIB 1FGTA 1UUWB 3DMCA 2OTL3 1RJOA 2P0XA 5AIHA 2SBLA 1K8A4 2O9UX 1QAFA 2YX9A 3ER7A 3OX9A 3EBYA 3F8HA 3UJMA 4HM1B 4L7KA 1O7GB 5D83A 3X40A 1EG9B 2A15A 3N8BA 4WFOA 4MEIA 1Q40B 3FG3A 1HKXA 3GZBA 3CPW2 2GEYA 2QIYA 4HM6B 2CHCA 3K0ZA 3B8LA 1NDOB 3OXAA 4OUQA 1TU5A 3F7XA 4EYCA 3X3XA 3WDGB 1TUHA 5LC7A 3LTAA 3MG3A 5AIFA 3N9HA 1N5PA 2IMJA 1W5ZA 5STDA 1SJWA 1US1A 1N9JA 1D6ZA 2IA7A 1M904 3BNCA 2PNCA 2M7OA 5AEWB 3HZPA 3NX0A 3NBJA 1GYBA 4HZ9B 3VF1A 5IEPA 1JRQA 1GY6A 3B7CA 4EV5A 5IG0A 3UNLA 3GZYB 2OCTA 1DMQA 3MHEA 3I0YA 3NQZA 3K9MC 3NBBA 1G96A 4Q53A 4O8SA 3MYTA 1JB4A 3QRDA 4WP5A 2V1LA 4N6UA 4R80A 3BB9A 1N8R4 1WNHA 3F14A 2E2UA 3LH4A 4EBGA 4N3VA 3PGBA 5KP4A 4K61A 2CWTA 2IUKA 2BO9B 2I9WA 5AYRB 3NUVA 2WGQA 3T8UA 5IG4A 2BMRB 3MG2A 3MKIA 3GAXA 1IVWA 4IPBA 3CCS3 4OK0A 4STDA 3B4PA 3LYGA 2Z77A 3Q90A 2HMMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQL A;  3KFQ C;  3MWZ A;  1G96 A;  4N6L A;  1RN7 A;  1CEW I;  5LC7 A;  1LXE A;  4N6M A;  1GD4 A;  3PXM A;  3QRD A;  3S67 A;  1ROA A;  1MOL A;  4N6U A;  5ELJ A;  1IV7 A;  2KXG A;  5A0O B;  1A90 A;  1CYV A;  1N5P A;  1WNH A;  2O9U X;  3PYJ A;  3LH4 A;  4EYC A;  1STF I;  1TIJ A;  1DVC A;  4N6O B;  4CCV A;  2W9Q A;  3IMA B;  4LZI A;  1FUW A;  1FA3 A;  2CH9 A;  4N6V 0;  1N9J A;  3PS8 A;  4ZM8 A;  1R4C A;  5ELU A;  2BO9 B;  3UL6 A;  1EQK A;  4N6N B;  1PFP A;  3NX0 A;  1NB5 I;  3SVA A;  3UL5 A;  1YVB I;  1KWI A;  1M9G A;  1GD3 A;  3GAX A;  1NB3 I;  1IV9 A;  4IT7 A;  1CYU A;  1A67 A;  2OCT A;  1DVD A;  2W9P A;  3L0R A;  3Q2P A;  4TX4 A;  3KSE D;  1N5H A;  1MNL A;  4N6T A;  3K9M C;  5LC6 A; 
#chains in the Genus database with same CATH topology
 1JKG B;  2RSX A;  1Y4K A;  4J5G A;  3VSY A;  3CD6 3;  4JRF A;  2F99 A;  3S67 A;  1X1X A;  2KXG A;  3FLJ A;  2RFR A;  4RZM A;  1FGM A;  1TJD A;  2F98 A;  1V58 A;  3AHS A;  1PY3 A;  1YGW A;  5FGO A;  1ZS7 A;  1I3F A;  1SIH A;  3NHX A;  3LML A;  1QVG 2;  2CWU A;  1KC8 4;  1BNE A;  3PCR A;  5RNT A;  2E2V A;  1FYS A;  3CCU 3;  1VQ6 3;  1N8Q A;  1B27 A;  3B4O A;  1Q42 A;  1NB3 I;  4FMA A;  1LNI A;  1VQL 3;  1QAL A;  2KCD A;  1VQO 3;  1ZO2 A;  1AR0 A;  3H3H A;  1E3V A;  3RGR A;  3F40 A;  3KSE D;  1IV9 A;  1IVU A;  1SII A;  4HM3 B;  5IEN A;  5LC6 A;  1RMS A;  3KFQ C;  2HMK B;  2FGT A;  3URP A;  1LQM B;  2WO0 A;  5CK6 A;  1JKG A;  4R4K A;  2IUJ A;  3NQY A;  1K9M 4;  1NO3 A;  1ROV A;  2KF4 A;  3NV0 B;  1GMP A;  4KFF A;  5AYS C;  3S28 A;  1JBT A;  2MC8 A;  1AY7 A;  1UDI I;  3IMA B;  4CCV A;  2IYJ A;  1AVK A;  4U13 A;  2F4Y A;  2F86 B;  3PCS A;  3KKG A;  4NHF A;  2CFD A;  3BNB A;  3X3Y A;  3WOF B;  3K63 A;  2GEX A;  3VGN A;  2P0M A;  1VQ8 3;  3HOH A;  3V92 A;  1VQQ A;  2UUG C;  2STD A;  4HM2 B;  3AGN A;  4LEH A;  1RCL A;  2R4I A;  2OQE A;  1T5Y A;  1YJW 3;  3FH1 A;  4QWT A;  4R1K A;  3WA3 A;  1N5H A;  1X1U A;  5AIG A;  3LTC A;  3EX9 A;  3JUO A;  3OW2 2;  1WTH A;  1IQX A;  1BOX A;  3ROB A;  1IQ8 A;  2BHM A;  5JPU A;  3I56 3;  3G6E 3;  3LZA A;  4LYL B;  3D79 A;  3LXU X;  1NJI 4;  1HU9 A;  2H0I A;  1W2Z A;  3DXO A;  3I55 3;  1JN5 B;  1AVL A;  4PEJ A;  3SXX A;  1IDP A;  5EEO A;  3BND A;  2JQ5 A;  1D6Y A;  1SPU A;  3CU3 A;  4WHA A;  1YIJ 3;  1OF5 A;  1OGZ A;  3UL5 A;  5BXQ A;  1TFK A;  1RKY A;  1JZD A;  1Q86 4;  2P09 A;  2ML6 A;  1Q9E A;  3EN8 A;  3EB8 A;  2ZDJ A;  1A67 A;  4BU4 A;  1UW1 A;  1KD1 4;  1FUW A;  1RNT A;  3LTD A;  1W2B 2;  3OV4 A;  1BUQ A;  1TRQ A;  3LT8 A;  2W56 A;  3T8N A;  1RN7 A;  3G71 3;  1YGE A;  3FZW A;  3EBT A;  4BTX A;  1CYV A;  3H51 A;  4K1U A;  1BSC A;  3CC2 3;  1J2B A;  5I97 A;  4CJN A;  5BVB A;  1IK3 A;  2GXF A;  1U5O A;  1VQ9 3;  1RGG A;  3RDE A;  7STD A;  1R4C A;  2ZA4 A;  2ML5 A;  3UB1 A;  1NNV A;  4BTW A;  2QA4 3;  1O7H B;  3G4S 3;  1K73 4;  1JN5 A;  2OTJ 3;  1VQM 3;  1WMO A;  2C11 A;  1LVN A;  4J8T A;  3LOY A;  2WGO A;  4EC6 A;  1D6U A;  1CQS A;  3SED A;  3L0R A;  2AAE A;  5KP1 A;  1GOU A;  1BRI A;  3DGO A;  1YNV X;  4EW5 A;  1GY7 A;  5CF2 A;  4OVM A;  3EC9 A;  1UUG B;  1ROA A;  1FW7 A;  5ELJ A;  1W6C A;  3PZW A;  5A0O B;  1G0T A;  2O3O A;  3FCS B;  3CXC 2;  1B2Z A;  4EXR A;  2LQV A;  2B1X B;  2CFK A;  2GU1 A;  4HM4 B;  1A2V A;  3CCR 3;  4XBX A;  1RN4 A;  1QMA A;  1BRG A;  3HK4 A;  3LT9 A;  3OWU A;  4XBY A;  1FGQ A;  4BL2 A;  1S72 3;  4HYZ A;  2JDI H;  1PFP A;  4AKY A;  2CG1 A;  1DMN A;  3WMD A;  2ZL8 A;  3JUQ A;  4BIR A;  2INX A;  4RNT A;  1LOW A;  3EJV A;  2WOH A;  2XSH B;  2BIR A;  5JPP A;  4IIA A;  3NM2 A;  1YIT 3;  3F8X A;  4J9A A;  3CCE 3;  1IQY A;  1Q7Y 4;  3JUN A;  3NV0 A;  1MGR A;  4K1V A;  3CCL 3;  1E3R A;  2XEP A;  3IJE B;  3LTB A;  1MWU A;  1FUS A;  1W00 A;  1OHS A;  3CME 3;  4XDV A;  1Q7H A;  1G02 A;  1UI7 A;  1STF I;  1UCI A;  1PYL A;  2J8X B;  2W2C A;  3EF8 A;  4ORL A;  1OPY A;  2XFT A;  2OOV A;  4FR9 A;  1JBS A;  2BNG A;  1WMN A;  3TDG A;  4ILF A;  6RNT A;  5IW9 A;  2UX0 A;  1O7N B;  3K5T A;  1I8V A;  1GMR A;  2CFG A;  3QK9 A;  1WMP A;  1YVB I;  1LRA A;  1M9G A;  2KF5 A;  3AMO B;  3BLZ A;  3BU4 A;  8RNT A;  1YI2 3;  1SQW A;  3D5I A;  1K41 A;  1V74 A;  1BSA A;  2CX0 A;  4CDL A;  3CCV 3;  3HX8 A;  5CF1 A;  3ALA A;  1VQK 3;  3DUK A;  3SOY A;  5D81 A;  2W6J H;  3NM7 A;  4HBR A;  3EHC A;  1NU3 A;  2C4B A;  2L1S A;  1LXE A;  1LOX A;  2XH9 A;  4FMC A;  4N6M A;  4RNZ A;  3STD A;  3U97 A;  3V98 A;  1RGC A;  3K7C A;  3OWY A;  1VQ5 3;  3CC4 3;  2KRT A;  1T2H A;  1I0X A;  5HGR A;  1DVC A;  1OF5 B;  1JB5 A;  3S5C A;  2XF3 A;  3OWS A;  3JUP A;  4MMZ B;  2XR8 B;  3CCM 3;  1NB5 I;  4XBT A;  4FCJ A;  2W56 B;  2W03 A;  3D9R A;  5IEO A;  1RTU A;  1Q82 4;  3F7S A;  4X2O A;  3DZL A;  2FXT A;  1DVD A;  1K28 A;  2K3D A;  2Y73 A;  3Q2P A;  2BU4 A;  4FMB A;  4ZM8 A;  3WOD G;  3V99 A;  3D3L A;  4DKI A;  1HYF A;  3RGA A;  3FSD A;  4HZB B;  1CEW I;  1YVS A;  1OHO A;  3M8C A;  2PZV A;  3NXJ A;  4L8O A;  3ZFZ A;  1PU4 A;  1B20 A;  1OH0 A;  3IPT A;  1BNI A;  4FCZ A;  4BL3 A;  2XGL A;  2GBW B;  2CH9 A;  1BNS A;  1RLS A;  2HOH A;  5KP3 A;  3DGN A;  1O7M B;  1W6G A;  3U1W A;  3WHO A;  3GZR A;  1STD A;  1BRJ A;  2Q07 A;  2R41 A;  1N9E A;  2BMQ B;  5AEU B;  5BIR A;  1LOV A;  4FMD A;  4NRE A;  2XGN A;  3KN4 A;  4FCM A;  4O02 B;  1FZU A;  3A5E A;  3Q3F A;  1TRP A;  3SX1 A;  1VQN 3;  2WOF A;  4N6T A;  8CHO A;  5IER A;  2Z76 A;  5DRE A;  1RGH A;  5CXO A;  4JF8 A;  2IY2 A;  3NBR A;  4BTY A;  1T2I A;  3CPO A;  1GY5 A;  5EVH A;  1IV7 A;  1U8C B;  1BNG A;  3SOA A;  4KVH A;  3DGM A;  4KZ1 A;  3SLU A;  3KII A;  2BT3 A;  3DGL A;  3EE1 A;  2D42 A;  5M1A A;  5TGN A;  1FGR A;  1V57 A;  4LGQ A;  4N6V 0;  1BUJ A;  3PS8 A;  3KSP A;  1ULJ B;  4L8P A;  2RCD A;  3A76 A;  3J7Y d;  5G1K A;  6STD A;  1T3B A;  3DM8 A;  3FG4 A;  1IVX A;  3DY5 A;  3FGY A;  1B3S A;  1X1W A;  2YFI B;  1ZX2 A;  4LSO A;  4XDW A;  1JB2 A;  1GD3 A;  4CPK A;  4KFD A;  1OUN A;  1IYY A;  1BU4 A;  1DMM A;  1KSI A;  1MWR A;  3CNM A;  1OAC A;  5AI1 A;  2BMO B;  3T0U A;  2CIU A;  1VQ7 3;  3S29 A;  1IU7 A;  2OWP A;  1YJ9 3;  1E97 A;  1EA2 A;  1JZO A;  1BIR A;  3BNE A;  3KE7 A;  4R9K A;  1OGX A;  2XFS A;  1IT8 A;  1JNQ A;  1A2P A;  1DYU A;  3JUM A;  1RRH A;  4I4K A;  2D1W A;  1M1K 4;  5JBS A;  1W7C A;  4X2H A;  1MGW A;  3KZT A;  3MG1 A;  1OCV A;  1WQL B;  1X1Y A;  1TFO A;  4GHO A;  3AMO A;  1TTO A;  5AII A;  3FF2 A;  2AAD A;  5IF6 A;  1OHP A;  1RGE A;  2GBX B;  2P38 A;  4HM8 B;  1GMQ A;  2OQE C;  4HKV B;  4K90 B;  2RGQ A;  3MSO A;  2E2T A;  1NWW A;  1I0V A;  1RN1 A;  2Z6B A;  4G1M B;  2QEX 3;  3WA2 X;  1W4N A;  2HMJ B;  1QVF 2;  3CCQ 3;  1RRL A;  2CKF B;  3G16 A;  1CYU A;  3F9S A;  3X42 A;  4AEQ A;  3EQQ B;  1I70 A;  4N6L A;  7GSP A;  5D82 A;  1A2K A;  4KT3 B;  3ZG5 A;  1IVV A;  3MWZ A;  1Q40 A;  2KF6 A;  1EUI C;  4NPB A;  5M19 A;  2CFL A;  3CMA 3;  1ASK A;  3HI7 A;  3CNX A;  1BRN L;  1B2S A;  4HVN A;  3PYJ A;  1FGO A;  4KFE A;  4WYK B;  2L4V A;  1QAK A;  2W9Q A;  2MF7 A;  1JV2 B;  2K54 A;  4H3U A;  1RGF A;  1BVI A;  2W04 A;  4RNY A;  2CC3 A;  3GRD A;  1KQS 2;  2C10 A;  1LNH A;  1TP6 A;  1BRK A;  1BNF A;  2CK3 H;  2GSP A;  4MJD A;  4XB5 A;  1I2E A;  3HII A;  4N6N B;  1JJ2 2;  3DH2 A;  1BNJ A;  2HMO B;  2CG0 A;  1UUV B;  1AV4 A;  1BRH A;  1IT7 A;  3GWR A;  1BSE A;  3N54 B;  1RGL A;  4GB5 A;  4J5K A;  1AQZ A;  2Y74 A;  7RNT A;  1DET A;  1JBR A;  5DRV A;  2W9P A;  4HJL B;  3JVC A;  3O8Y A;  1W6Y A;  3PXM A;  1UI8 A;  1LOY A;  4HM7 B;  4H61 A;  1GOV A;  1LQG C;  2OOV C;  4HM5 B;  1I2G A;  2QGU A;  2HML B;  2K0M A;  1A90 A;  3D4A A;  1W02 A;  1YJN 3;  3MPH A;  4O2H A;  4R9L A;  4N6O B;  4XM4 A;  4LZI A;  3GZX B;  5HOH A;  1FA3 A;  1F8N A;  1VQP 3;  3HIG A;  3G0K A;  1QJG A;  1SAR A;  3UL6 A;  1EKM A;  4WYK A;  4WWU C;  5CLK A;  3FG1 A;  1RNB A;  2FNQ A;  1Q81 4;  4O3V A;  1KWI A;  1RCK A;  5IG3 A;  1S5A A;  4AKZ A;  1O7P B;  5IG5 A;  2XSO B;  1O7W B;  2KAA A;  2KF3 A;  2P05 A;  1M1X B;  1RGA A;  2UGI A;  2XRX B;  3CCJ 3;  1CH0 A;  1EEJ A;  1MWT A;  3X3Z A;  3CC7 3;  1L5G B;  1RGK A;  1GD4 A;  3Q1C A;  2F5M A;  3WR2 A;  4GL6 A;  1MOL A;  2Z7A A;  4MMY B;  1MWS A;  4RBN A;  4EV2 A;  2YFJ B;  5FW5 A;  3EN1 B;  1VQ4 3;  1TIJ A;  1RDS A;  4HM0 B;  2RBI A;  3X41 A;  2CWV A;  2ZHX B;  3FKA A;  1EQK A;  1GS3 A;  1ZGX A;  4MMX B;  1YHQ 3;  3FF0 A;  2B24 B;  1DE3 A;  3SVA A;  3D5G A;  3WOE B;  3E99 A;  1RSN A;  2CX1 A;  1C7H A;  2W0Q A;  3RNT A;  4IT7 A;  2HMN B;  2LYX A;  1UGI A;  3AHW A;  4TX4 A;  5G2G A;  4LMI A;  1MNL A;  1W01 A;  2YFL B;  2GU3 A;  1Z1S A;  1VZZ A;  2CFW A;  2CW9 A;  3ECF A;  3GSP A;  5ELU A;  5EQL A;  3S27 A;  3G8Z A;  1ULI B;  1FGT A;  1R4Y A;  1UUW B;  3DMC A;  3ZG0 A;  1RJO A;  2P0X A;  1BAO A;  2OTL 3;  4HOH A;  5AIH A;  1B21 A;  1BSD A;  2SBL A;  1K8A 4;  2O9U X;  1QAF A;  2YX9 A;  2RNT A;  3ER7 A;  3OX9 A;  3EBY A;  3F8H A;  1GSP A;  3UJM A;  1I2F A;  4HM1 B;  4L7K A;  1O7G B;  1HZ1 A;  5D83 A;  3X40 A;  1UCJ A;  1EG9 B;  2A15 A;  3N8B A;  4HAA A;  4WFO A;  1BSB A;  1Q40 B;  4MEI A;  3FG3 A;  1HKX A;  3GZB A;  1UCL A;  3CPW 2;  2GEY A;  2QIY A;  4HM6 B;  2F56 A;  1UCK A;  2CHC A;  3B8L A;  1NDO B;  3K0Z A;  3OXA A;  4OUQ A;  5M18 A;  1TU5 A;  3F7X A;  4EYC A;  1RHL A;  3X3X A;  3WDG B;  9RNT A;  1TUH A;  5LC7 A;  3LTA A;  3MG3 A;  5AIF A;  3N9H A;  3SYU A;  1N5P A;  2IMJ A;  1W5Z A;  3BIR A;  2H0H A;  4I5Q A;  2H0G A;  1B2M A;  5STD A;  1SJW A;  1US1 A;  1B2U A;  1N9J A;  1D6Z A;  2IA7 A;  1M90 4;  6GSP A;  3BNC A;  2PNC A;  2M7O A;  5AEW B;  3HZP A;  3NX0 A;  3NBJ A;  1GYB A;  4HZ9 B;  3VF1 A;  5IEP A;  1JRQ A;  1BAN A;  1GY6 A;  3B7C A;  4EV5 A;  5IG0 A;  3UNL A;  3GZY B;  1FUT A;  2OCT A;  1DMQ A;  3MHE A;  3I0Y A;  3NQZ A;  1B2X A;  3K9M C;  3NBB A;  1ISK A;  1G96 A;  4Q53 A;  4O8S A;  3MYT A;  1JB4 A;  3QRD A;  4WP5 A;  2V1L A;  4N6U A;  4R80 A;  3BB9 A;  5BU4 A;  1N8R 4;  1WNH A;  3F14 A;  2E2U A;  3LH4 A;  4EBG A;  1BGS A;  4N3V A;  5GSP A;  3PGB A;  5KP4 A;  4K61 A;  2CWT A;  3KCH A;  1BRS A;  2IUK A;  1C54 A;  2BO9 B;  2I9W A;  3DGY A;  5AYR B;  3NUV A;  2WGQ A;  2SAR A;  4GSP A;  3T8U A;  5IG4 A;  1GOY A;  2F5W A;  2BMR B;  1I3I A;  3MG2 A;  3MKI A;  3GAX A;  1IVW A;  4IPB A;  3CCS 3;  1BNR A;  4OK0 A;  4STD A;  3B4P A;  3LYG A;  5G1L A;  3AGO A;  2Z77 A;  1UGH I;  3Q90 A;  2HMM B; 
#chains in the Genus database with same CATH homology
 1JKG B;  2RSX A;  1Y4K A;  3VSY A;  3CD6 3;  4JRF A;  2F99 A;  3S67 A;  2KXG A;  3FLJ A;  2RFR A;  4RZM A;  1FGM A;  2F98 A;  5FGO A;  1SIH A;  3NHX A;  3LML A;  1QVG 2;  2CWU A;  1KC8 4;  3PCR A;  2E2V A;  1VQ6 3;  3CCU 3;  1N8Q A;  3B4O A;  1Q42 A;  1NB3 I;  4FMA A;  1VQL 3;  1QAL A;  2KCD A;  1VQO 3;  1ZO2 A;  1AR0 A;  3H3H A;  1E3V A;  3RGR A;  3F40 A;  3KSE D;  1IV9 A;  1IVU A;  1SII A;  4HM3 B;  5IEN A;  5LC6 A;  3KFQ C;  2HMK B;  2FGT A;  2WO0 A;  5CK6 A;  1JKG A;  4R4K A;  2IUJ A;  3NQY A;  1K9M 4;  1NO3 A;  1ROV A;  3NV0 B;  4KFF A;  5AYS C;  3S28 A;  2MC8 A;  3IMA B;  4CCV A;  1AVK A;  4U13 A;  2F86 B;  3PCS A;  4NHF A;  3KKG A;  2CFD A;  3BNB A;  3X3Y A;  3WOF B;  3K63 A;  2GEX A;  3VGN A;  2P0M A;  1VQ8 3;  3V92 A;  4HM2 B;  2STD A;  4LEH A;  2R4I A;  2OQE A;  1YJW 3;  1T5Y A;  3FH1 A;  4QWT A;  4R1K A;  3WA3 A;  1N5H A;  5AIG A;  3LTC A;  3EX9 A;  3JUO A;  3OW2 2;  1WTH A;  1IQX A;  3ROB A;  1IQ8 A;  2BHM A;  5JPU A;  3I56 3;  3G6E 3;  3LZA A;  3LXU X;  1NJI 4;  1HU9 A;  1W2Z A;  3DXO A;  3I55 3;  1JN5 B;  1AVL A;  4PEJ A;  3SXX A;  1IDP A;  5EEO A;  3BND A;  2JQ5 A;  1D6Y A;  1SPU A;  3CU3 A;  4WHA A;  1YIJ 3;  1OF5 A;  1OGZ A;  3UL5 A;  5BXQ A;  1TFK A;  1RKY A;  1Q86 4;  2P09 A;  2ML6 A;  3EN8 A;  3EB8 A;  2ZDJ A;  1A67 A;  1UW1 A;  1KD1 4;  1FUW A;  3LTD A;  1W2B 2;  3OV4 A;  1BUQ A;  3LT8 A;  2W56 A;  3T8N A;  1RN7 A;  3G71 3;  1YGE A;  3FZW A;  3EBT A;  4BTX A;  1CYV A;  3H51 A;  4K1U A;  3CC2 3;  1J2B A;  5I97 A;  5BVB A;  1IK3 A;  2GXF A;  1U5O A;  1VQ9 3;  3RDE A;  7STD A;  1R4C A;  3UB1 A;  2ML5 A;  4BTW A;  2QA4 3;  1O7H B;  3G4S 3;  1K73 4;  1JN5 A;  2OTJ 3;  1VQM 3;  1WMO A;  2C11 A;  1LVN A;  4J8T A;  3LOY A;  2WGO A;  4EC6 A;  1D6U A;  1CQS A;  3SED A;  3L0R A;  5KP1 A;  3DGO A;  5CF2 A;  1GY7 A;  4OVM A;  3EC9 A;  1ROA A;  5ELJ A;  1W6C A;  3PZW A;  5A0O B;  2O3O A;  3FCS B;  3CXC 2;  4EXR A;  2LQV A;  2B1X B;  2CFK A;  2GU1 A;  4HM4 B;  1A2V A;  3CCR 3;  4XBX A;  1S72 3;  1QMA A;  3HK4 A;  3LT9 A;  3OWU A;  4XBY A;  1FGQ A;  4HYZ A;  2JDI H;  1PFP A;  4AKY A;  2CG1 A;  1DMN A;  3WMD A;  2ZL8 A;  3JUQ A;  2INX A;  3EJV A;  2WOH A;  2XSH B;  5JPP A;  4IIA A;  3NM2 A;  1YIT 3;  3F8X A;  4J9A A;  3CCE 3;  1IQY A;  1Q7Y 4;  3JUN A;  3NV0 A;  4K1V A;  3CCL 3;  1E3R A;  2XEP A;  3IJE B;  3LTB A;  1W00 A;  3CME 3;  1OHS A;  4XDV A;  1UI7 A;  1STF I;  2W2C A;  2OOV A;  3EF8 A;  4ORL A;  1OPY A;  2XFT A;  4FR9 A;  2BNG A;  1WMN A;  3TDG A;  5IW9 A;  2UX0 A;  1O7N B;  3K5T A;  2CFG A;  3QK9 A;  1WMP A;  1YVB I;  1M9G A;  3AMO B;  1YI2 3;  3BLZ A;  1SQW A;  1K41 A;  1V74 A;  3CCV 3;  4CDL A;  3HX8 A;  5CF1 A;  3ALA A;  1VQK 3;  3DUK A;  3SOY A;  5D81 A;  2W6J H;  3NM7 A;  4HBR A;  3EHC A;  2XH9 A;  1NU3 A;  4RNZ A;  1LXE A;  1LOX A;  4FMC A;  4N6M A;  3STD A;  3U97 A;  3V98 A;  3K7C A;  3OWY A;  1VQ5 3;  3CC4 3;  2KRT A;  5HGR A;  1DVC A;  1OF5 B;  1JB5 A;  3S5C A;  2XF3 A;  3OWS A;  3JUP A;  4MMZ B;  2XR8 B;  3CCM 3;  1NB5 I;  4XBT A;  4FCJ A;  2W56 B;  2W03 A;  3D9R A;  5IEO A;  1Q82 4;  3F7S A;  4X2O A;  3DZL A;  2FXT A;  1DVD A;  1K28 A;  2Y73 A;  3Q2P A;  4FMB A;  4ZM8 A;  3WOD G;  3V99 A;  3D3L A;  3RGA A;  3FSD A;  4HZB B;  1CEW I;  1PU4 A;  1OHO A;  3M8C A;  2PZV A;  3NXJ A;  4L8O A;  1OH0 A;  3IPT A;  4FCZ A;  2XGL A;  2GBW B;  2CH9 A;  5KP3 A;  3DGN A;  1O7M B;  1W6G A;  3U1W A;  3GZR A;  1STD A;  2Q07 A;  1N9E A;  2BMQ B;  5AEU B;  4NRE A;  4FMD A;  2XGN A;  3KN4 A;  4FCM A;  4O02 B;  3SX1 A;  1VQN 3;  2WOF A;  4N6T A;  8CHO A;  5IER A;  2Z76 A;  5DRE A;  5CXO A;  4JF8 A;  3NBR A;  4BTY A;  3CPO A;  1GY5 A;  5EVH A;  1IV7 A;  1U8C B;  3SOA A;  4KVH A;  3DGM A;  4KZ1 A;  3SLU A;  3KII A;  2BT3 A;  3DGL A;  3EE1 A;  2D42 A;  5TGN A;  1FGR A;  4N6V 0;  4LGQ A;  3PS8 A;  3KSP A;  1ULJ B;  4L8P A;  2RCD A;  3A76 A;  3J7Y d;  6STD A;  3DM8 A;  3FG4 A;  1IVX A;  3DY5 A;  3FGY A;  2YFI B;  4LSO A;  1ZX2 A;  4XDW A;  1JB2 A;  1GD3 A;  4KFD A;  1OUN A;  1KSI A;  1DMM A;  5AI1 A;  3CNM A;  3T0U A;  1OAC A;  2BMO B;  2CIU A;  1VQ7 3;  3S29 A;  1IU7 A;  2OWP A;  1YJ9 3;  1E97 A;  1EA2 A;  3BNE A;  3KE7 A;  4R9K A;  1OGX A;  2XFS A;  1IT8 A;  1JNQ A;  1DYU A;  3JUM A;  1RRH A;  4I4K A;  2D1W A;  1M1K 4;  5JBS A;  1W7C A;  4X2H A;  3KZT A;  3MG1 A;  1OCV A;  1WQL B;  1TFO A;  3AMO A;  5AII A;  3FF2 A;  5IF6 A;  1OHP A;  2GBX B;  2P38 A;  4HM8 B;  2OQE C;  4HKV B;  4K90 B;  2RGQ A;  3MSO A;  2E2T A;  1NWW A;  2Z6B A;  4G1M B;  2QEX 3;  3WA2 X;  1W4N A;  2HMJ B;  1QVF 2;  3CCQ 3;  1RRL A;  2CKF B;  3G16 A;  1CYU A;  3F9S A;  3X42 A;  4AEQ A;  3EQQ B;  4N6L A;  5D82 A;  1A2K A;  1IVV A;  3MWZ A;  1Q40 A;  2CFL A;  3CMA 3;  1ASK A;  3HI7 A;  3CNX A;  4HVN A;  3PYJ A;  1FGO A;  4KFE A;  4WYK B;  2L4V A;  1QAK A;  2W9Q A;  2MF7 A;  1JV2 B;  2K54 A;  4H3U A;  2W04 A;  4RNY A;  2CC3 A;  3GRD A;  1KQS 2;  2C10 A;  1LNH A;  1TP6 A;  2CK3 H;  4MJD A;  4XB5 A;  5ELU A;  1JJ2 2;  1ISK A;  3HII A;  4N6N B;  2HMO B;  2CG0 A;  1UUV B;  1AV4 A;  1IT7 A;  3GWR A;  3N54 B;  4GB5 A;  2Y74 A;  5DRV A;  2W9P A;  4HJL B;  3JVC A;  3O8Y A;  1W6Y A;  3PXM A;  1UI8 A;  4HM7 B;  4H61 A;  2OOV C;  4HM5 B;  2QGU A;  2HML B;  2K0M A;  1A90 A;  1W02 A;  1YJN 3;  3MPH A;  4O2H A;  4R9L A;  4N6O B;  4XM4 A;  4LZI A;  3GZX B;  1FA3 A;  1F8N A;  1VQP 3;  3HIG A;  3G0K A;  1QJG A;  3UL6 A;  1EKM A;  4WYK A;  4WWU C;  5CLK A;  3FG1 A;  2FNQ A;  1Q81 4;  4O3V A;  1KWI A;  5IG3 A;  1S5A A;  4AKZ A;  1O7P B;  5IG5 A;  2XSO B;  1O7W B;  2P05 A;  1M1X B;  2XRX B;  3CCJ 3;  3X3Z A;  3CC7 3;  1L5G B;  1GD4 A;  3Q1C A;  4GL6 A;  1MOL A;  2Z7A A;  4MMY B;  4RBN A;  4EV2 A;  2YFJ B;  5FW5 A;  3EN1 B;  1VQ4 3;  1TIJ A;  4HM0 B;  3X41 A;  2CWV A;  3FKA A;  1EQK A;  1GS3 A;  4MMX B;  1YHQ 3;  3FF0 A;  2B24 B;  3SVA A;  3WOE B;  3E99 A;  2W0Q A;  1C7H A;  4IT7 A;  2HMN B;  2LYX A;  4TX4 A;  5G2G A;  4LMI A;  1MNL A;  1W01 A;  2YFL B;  2GU3 A;  1Z1S A;  1VZZ A;  2CFW A;  2CW9 A;  3ECF A;  5EQL A;  3S27 A;  3G8Z A;  1ULI B;  1FGT A;  1UUW B;  3DMC A;  2OTL 3;  1RJO A;  2P0X A;  5AIH A;  2SBL A;  1K8A 4;  2O9U X;  1QAF A;  2YX9 A;  3ER7 A;  3OX9 A;  3EBY A;  3F8H A;  3UJM A;  4HM1 B;  4L7K A;  1O7G B;  5D83 A;  3X40 A;  1EG9 B;  2A15 A;  3N8B A;  4WFO A;  4MEI A;  1Q40 B;  3FG3 A;  1HKX A;  3GZB A;  3CPW 2;  2GEY A;  2QIY A;  4HM6 B;  2CHC A;  3K0Z A;  3B8L A;  1NDO B;  3OXA A;  4OUQ A;  1TU5 A;  3F7X A;  4EYC A;  3X3X A;  3WDG B;  1TUH A;  5LC7 A;  3LTA A;  3MG3 A;  5AIF A;  3N9H A;  1N5P A;  2IMJ A;  1W5Z A;  5STD A;  1SJW A;  1US1 A;  1N9J A;  1D6Z A;  2IA7 A;  1M90 4;  3BNC A;  2PNC A;  2M7O A;  5AEW B;  3HZP A;  3NX0 A;  3NBJ A;  1GYB A;  4HZ9 B;  3VF1 A;  5IEP A;  1JRQ A;  1GY6 A;  3B7C A;  4EV5 A;  5IG0 A;  3UNL A;  3GZY B;  2OCT A;  1DMQ A;  3MHE A;  3I0Y A;  3NQZ A;  3K9M C;  3NBB A;  1G96 A;  4Q53 A;  4O8S A;  3MYT A;  1JB4 A;  3QRD A;  4WP5 A;  2V1L A;  4N6U A;  4R80 A;  3BB9 A;  1N8R 4;  1WNH A;  3F14 A;  2E2U A;  3LH4 A;  4EBG A;  4N3V A;  3PGB A;  5KP4 A;  4K61 A;  2CWT A;  2IUK A;  2BO9 B;  2I9W A;  5AYR B;  3NUV A;  2WGQ A;  3T8U A;  5IG4 A;  2BMR B;  3MG2 A;  3MKI A;  3GAX A;  1IVW A;  4IPB A;  3CCS 3;  4OK0 A;  4STD A;  3B4P A;  3LYG A;  2Z77 A;  3Q90 A;  2HMM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...